(data stored in ACNUC7421 zone)

EMBL: CP000478

ID   CP000478; SV 1; circular; genomic DNA; STD; PRO; 4990251 BP.
XX
AC   CP000478; AAJF01000000-AAJF01000142;
XX
PR   Project:PRJNA13013;
XX
DT   03-NOV-2006 (Rel. 89, Created)
DT   09-SEP-2019 (Rel. 142, Last updated, Version 7)
XX
DE   Syntrophobacter fumaroxidans MPOB, complete genome.
XX
KW   .
XX
OS   Syntrophobacter fumaroxidans MPOB
OC   Bacteria; Proteobacteria; Deltaproteobacteria; Syntrophobacterales;
OC   Syntrophobacteraceae; Syntrophobacter.
XX
RN   [1]
RP   1-4990251
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Goltsman E.G.,
RA   Martinez M., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Kim E., Boone D.R., Brockman F., Culley D., Ferry J., Gunsalus R.,
RA   McInerney M.J., Morrison M., Plugge C., Rohlin L., Scholten J., Sieber J.,
RA   Stams A.J.M., Worm P., Henstra A.M., Richardson P.;
RT   "Complete sequence of Syntrophobacter fumaroxidans MPOB";
RL   Unpublished.
XX
RN   [2]
RP   1-4990251
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Goltsman E.G.,
RA   Martinez M., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Kim E., Boone D.R., Brockman F., Culley D., Ferry J., Gunsalus R.,
RA   McInerney M.J., Morrison M., Plugge C., Rohlin L., Scholten J., Sieber J.,
RA   Stams A.J.M., Worm P., Henstra A.M., Richardson P.;
RT   ;
RL   Submitted (23-OCT-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 95e3e7819a3a8c8a174e5ad82a50a8b0.
DR   BioSample; SAMN02598285.
DR   EnsemblGenomes-Gn; EBG00001011612.
DR   EnsemblGenomes-Gn; EBG00001011613.
DR   EnsemblGenomes-Gn; EBG00001011614.
DR   EnsemblGenomes-Gn; EBG00001011615.
DR   EnsemblGenomes-Gn; EBG00001011616.
DR   EnsemblGenomes-Gn; EBG00001011617.
DR   EnsemblGenomes-Gn; EBG00001011618.
DR   EnsemblGenomes-Gn; EBG00001011619.
DR   EnsemblGenomes-Gn; EBG00001011620.
DR   EnsemblGenomes-Gn; EBG00001011621.
DR   EnsemblGenomes-Gn; EBG00001011622.
DR   EnsemblGenomes-Gn; EBG00001011623.
DR   EnsemblGenomes-Gn; EBG00001011624.
DR   EnsemblGenomes-Gn; EBG00001011625.
DR   EnsemblGenomes-Gn; EBG00001011626.
DR   EnsemblGenomes-Gn; EBG00001011627.
DR   EnsemblGenomes-Gn; EBG00001011629.
DR   EnsemblGenomes-Gn; EBG00001011630.
DR   EnsemblGenomes-Gn; EBG00001011631.
DR   EnsemblGenomes-Gn; EBG00001011632.
DR   EnsemblGenomes-Gn; EBG00001011633.
DR   EnsemblGenomes-Gn; EBG00001011634.
DR   EnsemblGenomes-Gn; EBG00001011635.
DR   EnsemblGenomes-Gn; EBG00001011636.
DR   EnsemblGenomes-Gn; EBG00001011637.
DR   EnsemblGenomes-Gn; EBG00001011638.
DR   EnsemblGenomes-Gn; EBG00001011639.
DR   EnsemblGenomes-Gn; EBG00001011640.
DR   EnsemblGenomes-Gn; EBG00001011641.
DR   EnsemblGenomes-Gn; EBG00001011642.
DR   EnsemblGenomes-Gn; EBG00001011643.
DR   EnsemblGenomes-Gn; EBG00001011644.
DR   EnsemblGenomes-Gn; EBG00001011645.
DR   EnsemblGenomes-Gn; EBG00001011646.
DR   EnsemblGenomes-Gn; EBG00001011647.
DR   EnsemblGenomes-Gn; EBG00001011648.
DR   EnsemblGenomes-Gn; EBG00001011649.
DR   EnsemblGenomes-Gn; EBG00001011650.
DR   EnsemblGenomes-Gn; EBG00001011651.
DR   EnsemblGenomes-Gn; EBG00001011652.
DR   EnsemblGenomes-Gn; EBG00001011653.
DR   EnsemblGenomes-Gn; EBG00001011654.
DR   EnsemblGenomes-Gn; EBG00001011655.
DR   EnsemblGenomes-Gn; EBG00001011656.
DR   EnsemblGenomes-Gn; EBG00001011657.
DR   EnsemblGenomes-Gn; EBG00001011658.
DR   EnsemblGenomes-Gn; EBG00001011659.
DR   EnsemblGenomes-Gn; EBG00001011660.
DR   EnsemblGenomes-Gn; EBG00001011661.
DR   EnsemblGenomes-Gn; EBG00001011662.
DR   EnsemblGenomes-Gn; EBG00001011663.
DR   EnsemblGenomes-Gn; EBG00001011664.
DR   EnsemblGenomes-Gn; EBG00001011665.
DR   EnsemblGenomes-Gn; EBG00001011666.
DR   EnsemblGenomes-Gn; EBG00001011667.
DR   EnsemblGenomes-Gn; EBG00001011668.
DR   EnsemblGenomes-Gn; EBG00001011669.
DR   EnsemblGenomes-Gn; EBG00001011670.
DR   EnsemblGenomes-Gn; EBG00001011671.
DR   EnsemblGenomes-Gn; EBG00001011672.
DR   EnsemblGenomes-Gn; EBG00001011673.
DR   EnsemblGenomes-Gn; EBG00001011674.
DR   EnsemblGenomes-Gn; EBG00001011675.
DR   EnsemblGenomes-Gn; EBG00001011676.
DR   EnsemblGenomes-Gn; EBG00001011677.
DR   EnsemblGenomes-Gn; Sfum_R0001.
DR   EnsemblGenomes-Gn; Sfum_R0002.
DR   EnsemblGenomes-Gn; Sfum_R0003.
DR   EnsemblGenomes-Gn; Sfum_R0004.
DR   EnsemblGenomes-Gn; Sfum_R0005.
DR   EnsemblGenomes-Gn; Sfum_R0006.
DR   EnsemblGenomes-Gn; Sfum_R0007.
DR   EnsemblGenomes-Gn; Sfum_R0008.
DR   EnsemblGenomes-Gn; Sfum_R0009.
DR   EnsemblGenomes-Gn; Sfum_R0011.
DR   EnsemblGenomes-Gn; Sfum_R0012.
DR   EnsemblGenomes-Gn; Sfum_R0013.
DR   EnsemblGenomes-Gn; Sfum_R0014.
DR   EnsemblGenomes-Gn; Sfum_R0015.
DR   EnsemblGenomes-Gn; Sfum_R0016.
DR   EnsemblGenomes-Gn; Sfum_R0017.
DR   EnsemblGenomes-Gn; Sfum_R0019.
DR   EnsemblGenomes-Gn; Sfum_R0020.
DR   EnsemblGenomes-Gn; Sfum_R0021.
DR   EnsemblGenomes-Gn; Sfum_R0022.
DR   EnsemblGenomes-Gn; Sfum_R0023.
DR   EnsemblGenomes-Gn; Sfum_R0024.
DR   EnsemblGenomes-Gn; Sfum_R0025.
DR   EnsemblGenomes-Gn; Sfum_R0026.
DR   EnsemblGenomes-Gn; Sfum_R0027.
DR   EnsemblGenomes-Gn; Sfum_R0028.
DR   EnsemblGenomes-Gn; Sfum_R0029.
DR   EnsemblGenomes-Gn; Sfum_R0030.
DR   EnsemblGenomes-Gn; Sfum_R0031.
DR   EnsemblGenomes-Gn; Sfum_R0032.
DR   EnsemblGenomes-Gn; Sfum_R0033.
DR   EnsemblGenomes-Gn; Sfum_R0034.
DR   EnsemblGenomes-Gn; Sfum_R0035.
DR   EnsemblGenomes-Gn; Sfum_R0036.
DR   EnsemblGenomes-Gn; Sfum_R0040.
DR   EnsemblGenomes-Gn; Sfum_R0041.
DR   EnsemblGenomes-Gn; Sfum_R0043.
DR   EnsemblGenomes-Gn; Sfum_R0044.
DR   EnsemblGenomes-Gn; Sfum_R0045.
DR   EnsemblGenomes-Gn; Sfum_R0046.
DR   EnsemblGenomes-Gn; Sfum_R0047.
DR   EnsemblGenomes-Gn; Sfum_R0048.
DR   EnsemblGenomes-Gn; Sfum_R0049.
DR   EnsemblGenomes-Gn; Sfum_R0050.
DR   EnsemblGenomes-Gn; Sfum_R0051.
DR   EnsemblGenomes-Gn; Sfum_R0052.
DR   EnsemblGenomes-Gn; Sfum_R0053.
DR   EnsemblGenomes-Gn; Sfum_R0054.
DR   EnsemblGenomes-Gn; Sfum_R0055.
DR   EnsemblGenomes-Gn; Sfum_R0056.
DR   EnsemblGenomes-Gn; Sfum_R0057.
DR   EnsemblGenomes-Gn; Sfum_R0058.
DR   EnsemblGenomes-Gn; Sfum_R0059.
DR   EnsemblGenomes-Gn; Sfum_R0060.
DR   EnsemblGenomes-Gn; Sfum_R0061.
DR   EnsemblGenomes-Gn; Sfum_R0062.
DR   EnsemblGenomes-Gn; Sfum_R0063.
DR   EnsemblGenomes-Gn; Sfum_R0064.
DR   EnsemblGenomes-Tr; EBT00001538615.
DR   EnsemblGenomes-Tr; EBT00001538616.
DR   EnsemblGenomes-Tr; EBT00001538617.
DR   EnsemblGenomes-Tr; EBT00001538618.
DR   EnsemblGenomes-Tr; EBT00001538619.
DR   EnsemblGenomes-Tr; EBT00001538620.
DR   EnsemblGenomes-Tr; EBT00001538621.
DR   EnsemblGenomes-Tr; EBT00001538622.
DR   EnsemblGenomes-Tr; EBT00001538623.
DR   EnsemblGenomes-Tr; EBT00001538624.
DR   EnsemblGenomes-Tr; EBT00001538625.
DR   EnsemblGenomes-Tr; EBT00001538626.
DR   EnsemblGenomes-Tr; EBT00001538627.
DR   EnsemblGenomes-Tr; EBT00001538628.
DR   EnsemblGenomes-Tr; EBT00001538629.
DR   EnsemblGenomes-Tr; EBT00001538630.
DR   EnsemblGenomes-Tr; EBT00001538631.
DR   EnsemblGenomes-Tr; EBT00001538632.
DR   EnsemblGenomes-Tr; EBT00001538633.
DR   EnsemblGenomes-Tr; EBT00001538634.
DR   EnsemblGenomes-Tr; EBT00001538635.
DR   EnsemblGenomes-Tr; EBT00001538636.
DR   EnsemblGenomes-Tr; EBT00001538637.
DR   EnsemblGenomes-Tr; EBT00001538638.
DR   EnsemblGenomes-Tr; EBT00001538639.
DR   EnsemblGenomes-Tr; EBT00001538640.
DR   EnsemblGenomes-Tr; EBT00001538641.
DR   EnsemblGenomes-Tr; EBT00001538642.
DR   EnsemblGenomes-Tr; EBT00001538643.
DR   EnsemblGenomes-Tr; EBT00001538644.
DR   EnsemblGenomes-Tr; EBT00001538645.
DR   EnsemblGenomes-Tr; EBT00001538646.
DR   EnsemblGenomes-Tr; EBT00001538647.
DR   EnsemblGenomes-Tr; EBT00001538648.
DR   EnsemblGenomes-Tr; EBT00001538649.
DR   EnsemblGenomes-Tr; EBT00001538650.
DR   EnsemblGenomes-Tr; EBT00001538651.
DR   EnsemblGenomes-Tr; EBT00001538652.
DR   EnsemblGenomes-Tr; EBT00001538653.
DR   EnsemblGenomes-Tr; EBT00001538654.
DR   EnsemblGenomes-Tr; EBT00001538655.
DR   EnsemblGenomes-Tr; EBT00001538656.
DR   EnsemblGenomes-Tr; EBT00001538657.
DR   EnsemblGenomes-Tr; EBT00001538658.
DR   EnsemblGenomes-Tr; EBT00001538659.
DR   EnsemblGenomes-Tr; EBT00001538660.
DR   EnsemblGenomes-Tr; EBT00001538661.
DR   EnsemblGenomes-Tr; EBT00001538662.
DR   EnsemblGenomes-Tr; EBT00001538663.
DR   EnsemblGenomes-Tr; EBT00001538664.
DR   EnsemblGenomes-Tr; EBT00001538665.
DR   EnsemblGenomes-Tr; EBT00001538666.
DR   EnsemblGenomes-Tr; EBT00001538667.
DR   EnsemblGenomes-Tr; EBT00001538668.
DR   EnsemblGenomes-Tr; EBT00001538669.
DR   EnsemblGenomes-Tr; EBT00001538670.
DR   EnsemblGenomes-Tr; EBT00001538671.
DR   EnsemblGenomes-Tr; EBT00001538672.
DR   EnsemblGenomes-Tr; EBT00001538673.
DR   EnsemblGenomes-Tr; EBT00001538674.
DR   EnsemblGenomes-Tr; EBT00001538675.
DR   EnsemblGenomes-Tr; EBT00001538676.
DR   EnsemblGenomes-Tr; EBT00001538677.
DR   EnsemblGenomes-Tr; EBT00001538678.
DR   EnsemblGenomes-Tr; EBT00001538679.
DR   EnsemblGenomes-Tr; Sfum_R0001-1.
DR   EnsemblGenomes-Tr; Sfum_R0002-1.
DR   EnsemblGenomes-Tr; Sfum_R0003-1.
DR   EnsemblGenomes-Tr; Sfum_R0004-1.
DR   EnsemblGenomes-Tr; Sfum_R0005-1.
DR   EnsemblGenomes-Tr; Sfum_R0006-1.
DR   EnsemblGenomes-Tr; Sfum_R0007-1.
DR   EnsemblGenomes-Tr; Sfum_R0008-1.
DR   EnsemblGenomes-Tr; Sfum_R0009-1.
DR   EnsemblGenomes-Tr; Sfum_R0011-1.
DR   EnsemblGenomes-Tr; Sfum_R0012-1.
DR   EnsemblGenomes-Tr; Sfum_R0013-1.
DR   EnsemblGenomes-Tr; Sfum_R0014-1.
DR   EnsemblGenomes-Tr; Sfum_R0015-1.
DR   EnsemblGenomes-Tr; Sfum_R0016-1.
DR   EnsemblGenomes-Tr; Sfum_R0017-1.
DR   EnsemblGenomes-Tr; Sfum_R0019-1.
DR   EnsemblGenomes-Tr; Sfum_R0020-1.
DR   EnsemblGenomes-Tr; Sfum_R0021-1.
DR   EnsemblGenomes-Tr; Sfum_R0022-1.
DR   EnsemblGenomes-Tr; Sfum_R0023-1.
DR   EnsemblGenomes-Tr; Sfum_R0024-1.
DR   EnsemblGenomes-Tr; Sfum_R0025-1.
DR   EnsemblGenomes-Tr; Sfum_R0026-1.
DR   EnsemblGenomes-Tr; Sfum_R0027-1.
DR   EnsemblGenomes-Tr; Sfum_R0028-1.
DR   EnsemblGenomes-Tr; Sfum_R0029-1.
DR   EnsemblGenomes-Tr; Sfum_R0030-1.
DR   EnsemblGenomes-Tr; Sfum_R0031-1.
DR   EnsemblGenomes-Tr; Sfum_R0032-1.
DR   EnsemblGenomes-Tr; Sfum_R0033-1.
DR   EnsemblGenomes-Tr; Sfum_R0034-1.
DR   EnsemblGenomes-Tr; Sfum_R0035-1.
DR   EnsemblGenomes-Tr; Sfum_R0036-1.
DR   EnsemblGenomes-Tr; Sfum_R0040-1.
DR   EnsemblGenomes-Tr; Sfum_R0041-1.
DR   EnsemblGenomes-Tr; Sfum_R0043-1.
DR   EnsemblGenomes-Tr; Sfum_R0044-1.
DR   EnsemblGenomes-Tr; Sfum_R0045-1.
DR   EnsemblGenomes-Tr; Sfum_R0046-1.
DR   EnsemblGenomes-Tr; Sfum_R0047-1.
DR   EnsemblGenomes-Tr; Sfum_R0048-1.
DR   EnsemblGenomes-Tr; Sfum_R0049-1.
DR   EnsemblGenomes-Tr; Sfum_R0050-1.
DR   EnsemblGenomes-Tr; Sfum_R0051-1.
DR   EnsemblGenomes-Tr; Sfum_R0052-1.
DR   EnsemblGenomes-Tr; Sfum_R0053-1.
DR   EnsemblGenomes-Tr; Sfum_R0054-1.
DR   EnsemblGenomes-Tr; Sfum_R0055-1.
DR   EnsemblGenomes-Tr; Sfum_R0056-1.
DR   EnsemblGenomes-Tr; Sfum_R0057-1.
DR   EnsemblGenomes-Tr; Sfum_R0058-1.
DR   EnsemblGenomes-Tr; Sfum_R0059-1.
DR   EnsemblGenomes-Tr; Sfum_R0060-1.
DR   EnsemblGenomes-Tr; Sfum_R0061-1.
DR   EnsemblGenomes-Tr; Sfum_R0062-1.
DR   EnsemblGenomes-Tr; Sfum_R0063-1.
DR   EnsemblGenomes-Tr; Sfum_R0064-1.
DR   EuropePMC; PMC3035298; 21304732.
DR   EuropePMC; PMC3278476; 22045996.
DR   EuropePMC; PMC3570798; 23450070.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP000478.
DR   SILVA-SSU; CP000478.
DR   StrainInfo; 161775; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634477
CC   Source DNA and bacteria available from Michael J. McInerney
CC   (mcinerney@ou.edu)
CC   Contacts: Michael J. McInerney (mcinerney@ou.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4990251
FT                   /organism="Syntrophobacter fumaroxidans MPOB"
FT                   /strain="MPOB"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:335543"
FT                   /type_material="type strain of Syntrophobacter
FT                   fumaroxidans"
FT   gene            346..1698
FT                   /locus_tag="Sfum_0001"
FT   CDS_pept        346..1698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator, DnaA
FT                   C-terminal domain; Chromosomal replication initiator, DnaA;
FT                   KEGG: pca:Pcar_0001 chromosomal replication initiator
FT                   protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15705"
FT                   /db_xref="GOA:A0LE53"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LE53"
FT                   /protein_id="ABK15705.1"
FT                   /translation="MEQEWLQVRKKLQRSLSKGQYDLWVSTLEFLGIEDGNLILGCQNR
FT                   FHIEWLREKLEAKLLPIASQHFRGVRKLEYRVAQGCAAGAPEIEGAGPRQIAFSDVVKC
FT                   VGPAFNPRFTFDHFVVGGCNQFAYAAAMGMANNQQLYNQSVYLLSDTGLGKSHLTHAVG
FT                   NYLRNRKPELRVQYVTTEQFANEMIFSLKNGNMEAFKNKFRTGCDVLLLEKIEFLSGKE
FT                   KIQKELVYTLDELMDRGKTVLCTGNAYPKDIPKLNSELQSRLGGGLLAPIDKPDFKTRI
FT                   EIIKRKSHTENIRVPMEVVEYLADRITGDVRQLESCLVGLMAKSNILRTPITLDLAREV
FT                   SQTMLDQLPKISVEQIQKIICANFRITLEELRSTSRRKQVALARKIGIYLSREYTTESL
FT                   QSIGKSFQRSHSSVLYAVNEVQKGMGEANGRLKREVEYLSRRLETSCLSES"
FT   gene            complement(2035..2322)
FT                   /locus_tag="Sfum_0002"
FT   CDS_pept        complement(2035..2322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0002"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: gme:Gmet_1417 histone-like DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15706"
FT                   /db_xref="GOA:A0LE54"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE54"
FT                   /protein_id="ABK15706.1"
FT                   /translation="MTLTKAHIVENLFAKNIFTKTESAQIIETLFEIVKQTLEHGEDVL
FT                   ISGFGKFSVKEKNQRRGRNPQTGDPIMLSPRKVVTFKCSGVLRERINLAK"
FT   gene            complement(2632..2708)
FT                   /locus_tag="Sfum_R0001"
FT                   /note="tRNA-Met3"
FT   tRNA            complement(2632..2708)
FT                   /locus_tag="Sfum_R0001"
FT                   /product="tRNA-Met"
FT   gene            3108..3491
FT                   /locus_tag="Sfum_0003"
FT   CDS_pept        3108..3491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0003"
FT                   /product="6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /note="PFAM: 6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein; KEGG: mac:MA0956
FT                   6-pyruvoyltetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15707"
FT                   /db_xref="GOA:A0LE55"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE55"
FT                   /protein_id="ABK15707.1"
FT                   /translation="MKNTFYEIKIITDFSAAHHLRDFRGKCENLHGHNWKIEIVLRGTE
FT                   LNEIGVLVDFGEVKQATRALLSEVDHHYLNEIPFFADRNPSSENIARYLFERLAEKFDN
FT                   DKLRLYRVSAWESDDACATFMRE"
FT   gene            3935..4657
FT                   /locus_tag="Sfum_0004"
FT   CDS_pept        3935..4657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA0862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15708"
FT                   /db_xref="InterPro:IPR016936"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE56"
FT                   /protein_id="ABK15708.1"
FT                   /translation="MTFVDTMINLMENELHGRVLGWRPNDIIVGRFTDNINNYQLGVLE
FT                   AIRFTTLRLKDSLTRMGDADTYDPDLEYALNLFMIRATSFWFPTAEGEYDKAIEHLRNF
FT                   RAKLEKGQRTFYYRKDNLISLLSVYKDLLGNVNKTLVVSPISWFQADDSFYYAKGVAHV
FT                   CYEILRVVRVGYQKQLASTMYGIEMMDTIVHELYRVENIDPWLILDSDLGSLLANHRAN
FT                   INAPLSEATHLMGILALL"
FT   gene            complement(4738..6567)
FT                   /locus_tag="Sfum_0005"
FT   CDS_pept        complement(4738..6567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0005"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein; peptidase M48,
FT                   Ste24p; Tetratricopeptide TPR_4; Tetratricopeptide TPR_2
FT                   repeat protein; SMART: Tetratricopeptide domain protein;
FT                   KEGG: dps:DP0525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15709"
FT                   /db_xref="GOA:A0LE57"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE57"
FT                   /protein_id="ABK15709.1"
FT                   /translation="MYSQFLYFIIVLLLFTMQQPGSSASLSLPLTASMAAAVWGLLALA
FT                   AYRACRGMSLAASDFSQSNLAARYHRLQFRLQILALSCFAFEVYVLDVKFYFNLIPFVE
FT                   KSLSLSGLIGLALYLSHTTVIWFFSHPAYQAVFRSAIRRSAFIKTHLSFSSAILLSWLL
FT                   VAIASDLLEAFKPFPPKWTATGEYAVLAGVMVLFMFFAPGPVVRLWGCRPLLEQPLRAE
FT                   LEIFCRKHGFRVGDFMLWPLFGGEMLTAGIVGVLPRMRYILVTRGLLSILNPEELRAVV
FT                   AHEMGHVRRFHLPMFLLFLLSYLPVAGVVSTLFLFVLLDQDIVLEWVLSAGAGAPERIS
FT                   IISSVLIVLLFLVFFRFIFGYFLRNCERQADLYAMNLMGDPYPLITSLQKIALHSGRIE
FT                   DLPSWHHYSIRQRIECLIDSSRDTTLIRRHNRKLYASALAFFVSVAVVFTTVTGLLNSS
FT                   GMRKWTFNPDRDSVERALREEPGNPDLLASYGGLLLEAGRIGEAERLLRKALHLSPDDP
FT                   SLMNNLAWLYATSPPPHHNPEAALKLAAKAAELRSDAVILDTLAEAYYVNGRYREAVDT
FT                   IEKALRQAQSDHSEYLTHKEKYQKALAAESDRS"
FT   sig_peptide     complement(6454..6567)
FT                   /locus_tag="Sfum_0005"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.954) with cleavage site probability 0.415 at
FT                   residue 38"
FT   gene            complement(6663..7736)
FT                   /locus_tag="Sfum_0006"
FT   CDS_pept        complement(6663..7736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0006"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: sat:SYN_00471 arabinose-5-phosphate isomerase;
FT                   TIGRFAM: KpsF/GutQ family protein; PFAM: CBS domain
FT                   containing protein; sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15710"
FT                   /db_xref="GOA:A0LE58"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE58"
FT                   /protein_id="ABK15710.1"
FT                   /translation="MTKSAHRAGGPQEEPSAVPLLRKGSTEHPAASTKGILEIAADVLR
FT                   IESEGILHLLDHISESFARAVLWIYEAGGRIIVTGIGKSGIVGRKIVATLSSTGTPALF
FT                   IHPVEAMHGDLGMVRAGDIVLALSNSGETDELNIILPSLKNIGTRIIAFTGDTSSTLAQ
FT                   YSDLTVYTGVPREACPMGLVPTASTTAMLAMGDALAVALLRLRNFQERDFHRFHPGGHL
FT                   GERLQVPLRDVMLKGDEIPAVPAATPVPAALAEMSRKGLGATLILDEDKRLQGIFTDGD
FT                   LRRTLNSCSNFTEKRISEVMTPGPRTISSHRSVADALELMERHLITVLPVVDENRNVEG
FT                   ILHLHDLLGKGRIRFSR"
FT   gene            complement(7764..9227)
FT                   /locus_tag="Sfum_0007"
FT   CDS_pept        complement(7764..9227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0007"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase, class-II;
FT                   phosphoribosyltransferase; KEGG: sat:SYN_01624
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15711"
FT                   /db_xref="GOA:A0LE59"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE59"
FT                   /protein_id="ABK15711.1"
FT                   /translation="MNRYDRLIGHVSKPPLSPFIPSRKEECGVFGVFGNPDAAKLTYFG
FT                   LYALQHRGQESAGIAVGDGCQIKEYKHMGLVNDVFNEDRLKSLKGHLSIGHVRYSTTGS
FT                   SLLANAQPFLMFHGGEYYAIAHNGNLVNAVQLRRELETQGAIFQTTMDTEIVMHLLARN
FT                   LIYGLEEALVAALTQIRGAYSLVMCTRNRLIGIRDPRGFRPLCLGKLNGSYVLASETCA
FT                   LDLIEATYIRDLDPGEVLIIDDKGFRSLHPFPKVRPAHCIFEFIYFARPDSSVFEQNVY
FT                   MFRKRLGHIMARENGSLTADLVMPFPDSGNYAALGFAEASRIPLEMGMIRNHYVGRTFI
FT                   QPSQAMRDFGVRIKLNPVRELLRQKRLILVEDSIIRGTTTRTRIKALRQAGAKEVHMLV
FT                   SCPPHRHPCPYGIDFSTKGELIAASHTVDEIRSFIGLDSLKYLSIEGLLEGAGASVDDH
FT                   PYCLACFNGDYSVTFEEQVRKDCFEQHEP"
FT   gene            complement(9364..12606)
FT                   /locus_tag="Sfum_0008"
FT   CDS_pept        complement(9364..12606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0008"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: phosphoribosylglycinamide synthetase;
FT                   ATP-dependent carboxylate-amine ligase domain protein,
FT                   ATP-grasp; protein of unknown function DUF201;
FT                   Carbamoyl-phosphate synthase L chain, ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain,
FT                   oligomerisation; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; MGS domain protein; KEGG: sat:SYN_01625
FT                   carbamoyl-phosphate synthase large chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15712"
FT                   /db_xref="GOA:A0LE60"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE60"
FT                   /protein_id="ABK15712.1"
FT                   /translation="MPKRTDIRKILIIGSGPIIISQACEFDYSGTQACKALREEGYEIV
FT                   LINSNPATIMTDPETADRTYIEPITPEAVAKVIERERPDALLPTLGGQTALNVAVRVAE
FT                   TGVLERFGVALIGASVEVIKKAEDRELFRDAMKRIGLRVPASGIARSMSEVESIAREIG
FT                   FPIIVRPSFTLGGTGGGVAYNREELKELAQSGLDASFIHTVMLEESVLGWKEFELEVMR
FT                   DCMDNVVIICSIENMDAMGVHTGDSITVAPAQTLTDREYQLLRDASIAILREIGVETGG
FT                   SNVQFAINPADGEMVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYSLDEIANDIT
FT                   RETRASFEPTIDYCVVKVPRFTFEKFPRTEDFLSTSMKSVGETMAIGRTFKEALHKAVR
FT                   SLEIGRFGFVDPPANADREYMERLRQKLRRPNSMRLFQIGEALKLGMPIEELHALTFID
FT                   PWFLHHIRQVLLLEDEIRGDADRSGFLDDPERVRYAKSWGFSDVRLAQLSGSDEETVRQ
FT                   LRIKHGIKPVYKLVDTCAAEFEAYTPYYYSTYETEDEARPTGRPKVVILGGGPNRIGQG
FT                   IEFDYCCVHASFSLREEDHESIMVNSNPETVSTDYDTSDKLYFEPLTREDVLHILDTEK
FT                   PKGVIVQFGGQTPLNLSVPLEKAGARILGTSPDAIDRAEDRKRFQKLLQKLGLKQPRNA
FT                   TAFTLREAAEAAGRIGYPVVVRPSYVLGGRAMEIVFDAAMLESFMKTAVHVSPGHPILI
FT                   DQFLEDAVEIDVDAISDGTVTVVGGIMEHIEQAGIHSGDSACVLPPMSISRSIQEEIRR
FT                   QTRLLAKELGVVGLMNIQFALQNGEIFILEVNPRASRTIPFVSKAIGFPLAKLATRVML
FT                   GKSLKELGFDTEVEPEHISVKEAVFPFSRFPNVDVLLGPEMKSTGEVMGIGSTFGIAFA
FT                   KAQAAVGYELPTSGTVFISVHDADKPKVLSVARKFGEMGFQLIATAGTADFLNGNGIRT
FT                   RPVFKLKEGRPHVVDRIKNGEVQLVVNTSMGKKTTSDSYEIRRTTLIYNIPYATTIAGA
FT                   KAMAEAVSELQRGDWDVRTLQEYHHRERSRRQ"
FT   gene            complement(13077..14252)
FT                   /locus_tag="Sfum_0009"
FT   CDS_pept        complement(13077..14252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0009"
FT                   /product="carbamoyl-phosphate synthase small subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: glutamine amidotransferase class-I;
FT                   Carbamoyl-phosphate synthase, small chain; KEGG:
FT                   sat:SYN_01627 carbamoyl-phosphate synthase small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15713"
FT                   /db_xref="GOA:A0LE61"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE61"
FT                   /protein_id="ABK15713.1"
FT                   /translation="MTSPWKRNSALLLLEDGTVFRGYAFAGGGRALGEVVFNTSMTGYQ
FT                   EVLTDPSYKGQMVTMTYPLTGAYGINDEDMESAAVQVEAFIVKEYQEFPSNWRSNRSLA
FT                   DFLNEYNKIGIEGIDTRALTRHIRMGGAMRGIIATDTDNVKELMEEVQAYPGLNGIDLV
FT                   KTVTCSKPYLWRTGVKPGTLEPKWPENRPELRVAAIDCGVKYNILRKLEASGCQVMVFP
FT                   AHVSAREIAACKPDGVFLSNGPGDPSAVGYVIETVRSLLGEKPVFGICLGHQMMGLALG
FT                   GRTFKLKFGHRGGNQPVKDVTTGKVEITSQNHGYCVDIDSLGNVPVKLTHVNLNDNTLE
FT                   GMEHLEIPAFSVQYHPEASPGPHDASYLFDRFVRLMQGPERGHGASAPRGR"
FT   gene            complement(14823..15575)
FT                   /locus_tag="Sfum_0010"
FT   CDS_pept        complement(14823..15575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0010"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="KEGG: pca:Pcar_1946 3-deoxy-manno-octulosonate
FT                   cytidylyltransferase; TIGRFAM: 3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase; PFAM: acylneuraminate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15714"
FT                   /db_xref="GOA:A0LE62"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LE62"
FT                   /protein_id="ABK15714.1"
FT                   /translation="MRIVGIIPARYQSSRFPGKPLVDILGKPMIRHVYERSARAGCLDR
FT                   LIVATDDARIAAAVAGFGGEALLTRADHASGTDRLAEAARLLELDGADIVVNIQGDEPL
FT                   VNHRMIEALVEALQCDRHCPMATLAFPSESLQDYNNPNVVKVVLDRGLRALYFSRAPIP
FT                   FVRDGAADAPAFLKHLGFYAYSASFLQTFSRLPPGRLEGLEKLEQLRALEHGYGIRVAL
FT                   SPVDTRGVDTPEDLEAVVPVLAQDAVGA"
FT   gene            15808..18558
FT                   /locus_tag="Sfum_0011"
FT   CDS_pept        15808..18558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0011"
FT                   /product="(Glutamate--ammonia-ligase) adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="PFAM: glutamate-ammonia ligase adenylyltransferase;
FT                   KEGG: gme:Gmet_0071 glutamate-ammonia ligase
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15715"
FT                   /db_xref="GOA:A0LE63"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE63"
FT                   /protein_id="ABK15715.1"
FT                   /translation="MDEFERIRQSSQYLTILLRTRPDFADWLRLRKHLYRRYPLTGLYS
FT                   DLRQTTRDAHSFVELAERFREFKQRHFLRIGGRDLLGLSDLAETTSQLSDLAGVSLQVG
FT                   LEVLSDHPEWWAGAGEVERWPEVREAYETVVMGLGKLGGQELNYVSDVDLIFLSHPRNG
FT                   DPIPSHAASMLLDRLCHWLSRLMGDRVKGDRVFVVDVRLRPQGKDGLLIPSLDAAAEHY
FT                   LLHGRPWERQMLLKARPVAGGRSSGMSFLQQIRPFVFRRFLDFQALDELRSMRDRILAE
FT                   ALQLGKGARQYNVKLGIGGIREIEFLVQSLQLIYGGRYPELDEPNTLRCLQVLNELSLL
FT                   PAQTVEELREAYVFLRRVEHWVQLDQNRQTQKLPQSEEAMARLASALGLGGSEKAFNDK
FT                   LRTCAEIVHGHFMGLFHAPAGDTAPAGRNADERDARHEAEDDGSGPVNGDSMHRLLGML
FT                   QDFPPGVRQTVLDVVKRYPLVRSRELSEKVLLRTERYFSQVSRRPGLKQIFNASGPWLQ
FT                   GLCEGIARTEMLADLLAHHPGLAEGIALGEERCPDSKSWAEAASRLLETVTGYEEGLEW
FT                   IRRLKNERTVTLALADLRGDFGPAALERQLSDLADFVARYTYEHIKASLGLAPDLPLAV
FT                   LGLGRLGSREMSYLSDMDLVFVYQPRPGELEDQVPGDVVRLIQRFMRMLSTPLQDGPGY
FT                   AVDARLRPTGSYGPLIVTQNSWLEYYSEQADLWELQALLRLRQIAGDRQLGLWLEDKAL
FT                   EICYRENRPEDVWRRLCHLRGRMQRERSDEKADRLDLKLGAGGLVDLEFLIQGNLLVKG
FT                   YDNPLIRVRSVRAAIQDFLEEITESAGHSREIRAAFEAIRALDHRLRLHLNQSGAKITP
FT                   EQFEGLKGLGLWPPAHVGTTIETWEDILKYRRIIRAALQEFCPDL"
FT   gene            complement(18755..21190)
FT                   /pseudo
FT                   /locus_tag="Sfum_0012"
FT   gene            complement(21465..23087)
FT                   /locus_tag="Sfum_0013"
FT   CDS_pept        complement(21465..23087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0013"
FT                   /product="methyl-viologen-reducing hydrogenase, delta
FT                   subunit"
FT                   /note="PFAM: methyl-viologen-reducing hydrogenase, delta
FT                   subunit; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein; KEGG: dps:DP3052 similar to
FT                   iron-sulfur binding reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15716"
FT                   /db_xref="GOA:A0LE64"
FT                   /db_xref="InterPro:IPR003813"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE64"
FT                   /protein_id="ABK15716.1"
FT                   /translation="MTFTRDFDETSRGMDELKIVLFVCNWGPHAALQTLQDQDRDIPHQ
FT                   VRMIRIPCTGRISKTLLFKAFERGADGVALIGCTPGTCRYGAGTYTAERNVEGARGILD
FT                   LLGLGKDRLRLATFLPEEASPLLDFLNDFTDQVRGMGKSPVTPVPLKQPAHDGRRNTAE
FT                   VLKAHDVYACQDCGKCSSACPMALSGRPYSPRAIANSIIAGSGNTPAVVNDVWSCLTCG
FT                   ICYDRCPSAVDFPAFIREMRCVQKASGKSGHEAHEGFFQSLMRAMTSPDLRTQHWKCLP
FT                   EGIRTDQQSKTLFFGGCAPYFDEFFRRHLDVHTSDILADSLRLLNFFDVTPALLPGERC
FT                   CGHDLLWSGDRENFLRLARLNVEAIEKMGIEEVVTACPECYRSFARDYPENGVPVNFRV
FT                   THIFDLAEKEIDKGAVGFEALDRSLTFQDPCRLSRMEGRADLPRKLIDRLRVKGFREMQ
FT                   DRGVSALCCGNCAWTGCDGYTKALQVKRLRQARATGSDLLVTACPKCQIHLRCAMEDPL
FT                   LGKEIGMDLMDLTSVIARTIRWE"
FT   gene            complement(23084..26434)
FT                   /locus_tag="Sfum_0014"
FT   CDS_pept        complement(23084..26434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0014"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; 4Fe-4S ferredoxin, iron-sulfur binding
FT                   domain protein; KEGG: mta:Moth_1194 4Fe-4S ferredoxin,
FT                   iron-sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15717"
FT                   /db_xref="GOA:A0LE65"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE65"
FT                   /protein_id="ABK15717.1"
FT                   /translation="MRTAKDRLHRVLVIGATPAGIAAANKLGEMGIPVTLIDRDPDLNE
FT                   KLAREEWRLSSGLLLNYAHRPGLLRILKNPRIRCILPGEVQSIKHTPQGFCARYRKNPT
FT                   FVDPERCTLCGRCAEVCPAAAGDGTRPIRYNGRQSLPGRPFIDKRRKPLCQANCPLGVN
FT                   VQGYVALIRVGRFAEALELIRRDNVLPGICGRVCTHPCEAACRRNELDAPLAIRDLKRF
FT                   AADHAGTEPQRPLVPQSAGRSESVAIVGSGPAGLAAAADLARWGYPVTVFEKESLPGGL
FT                   LRFGMGPHRLPRDILDREIGAIERMGVSIRTSSAIDMRTDIPGLLESHAAVILTTGAWT
FT                   DRKLGVPGEALERVEGCLEFLGRLYRGEIAALHESVAVIGDGNAAFDVARACVRLGAKV
FT                   TILSWFPEDLIPADPDEVIAAREEGIAIVDRAKVVEFLGGGGKLSGLRCVETKPGEPDA
FT                   NGIPWPVPVPGGKSFEAAFDRAVVAIGQVADREGFEGCIELTRSGTIRTDNDRMTSLAD
FT                   VYAAGDAVTGASSVVRAMASGREAALAVHCRLSGEARPHHLPNRPEDRDFPPIAPDLPS
FT                   IARVKMPERQPMARKDGFVEVALGLDETQACSEAARCLQCGICSECLQCAEYCISPNTI
FT                   MHDDRVSEGVEHAGVVIIADPEAAPAVKGEDVLRAYSTKSAREDAHAMMMRGFAAAAEA
FT                   MVMVGGGVQRLRGHGLSISPPDPQLSADLRIGVFVCRCNDAYGWPAELNHYAEELGARP
FT                   NVEVLEVIASACSPEGSAAILRTIREKGLTRIVLASCVCCPLDFICSACTDQRARLKNS
FT                   LFHGTGVTRAMAETCNLRGEVLRLLRTDPQLAMKRFKGLLDRSIGRARKLKSMPSPARP
FT                   YNFTTAVIGDSEAALKSALTLARTGMEVFLFGTVGEPLAEQLDHPNIHNFRGSAVTSLR
FT                   GTVGNFQVIVETDGSLQVFHVGAVILGEESRRRVPYVPMTELPPHPVESRMQKRGMTGT
FT                   PYFFPGATSIPGLFLANPPGIKLSERIKGTASAILAASVMPRSPRQNKGYTVSVDESRC
FT                   RGCGRCLQACPYQAISFRKNGLGGSHAVVDEALCKGCGNCISVCPSDAADSPYRDQLFL
FT                   EQMIEEILS"
FT   gene            complement(26434..27054)
FT                   /locus_tag="Sfum_0015"
FT   CDS_pept        complement(26434..27054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0015"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: ade:Adeh_1957 pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15718"
FT                   /db_xref="GOA:A0LE66"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE66"
FT                   /protein_id="ABK15718.1"
FT                   /translation="MTTKHGNSVKAAVAVRKEIIITGFGGQGIVLAGQIVGKAAGLRDR
FT                   KQSTLTQSYGPEARGGACSAQVIISDQAIHYPYVRKPDILICMSQGGFEKYGGLLGENS
FT                   ILIVDQDLVNPPEARCAAFFSIPATRLAEEMGRKMMANIVMLGFFTAVAGAISTEAARQ
FT                   TVTESVPKGTEELNLAAFNKGYDYGAAVLKGRQKKAEGKKGAL"
FT   gene            complement(27086..27928)
FT                   /locus_tag="Sfum_0016"
FT   CDS_pept        complement(27086..27928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0016"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, beta
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: ade:Adeh_1958 thiamine pyrophosphate
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15719"
FT                   /db_xref="GOA:A0LE67"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE67"
FT                   /protein_id="ABK15719.1"
FT                   /translation="MDRTRKRKDHPLDGLLRTDRIPHIWCPGCGIGTAFSACLVAMQAS
FT                   GIDLKKTAVVSGIGCSGRGAGYTRLDSYHTTHGRAIPFATGMKLANPELNVVVFSGDGD
FT                   LFAIGGNHFIHAARRNIDLTVICVNNLNYGMTGGQAAATTPCMAKTTTTPSGNPEPPFN
FT                   LPLLAFAAGATYIARWTVLHTRDLTKSMEEALTRHGFSFIEVLAPCPTGYGRRNREKPL
FT                   DSLRFYQERTITKNGAHPAEVILDYNRGITLGKFIDTERPTYSDSYDKTCRPASSASM"
FT   gene            complement(28280..29437)
FT                   /locus_tag="Sfum_0017"
FT   CDS_pept        complement(28280..29437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0017"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; Transketolase domain protein; KEGG:
FT                   aba:Acid345_1810 pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15720"
FT                   /db_xref="GOA:A0LE68"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE68"
FT                   /protein_id="ABK15720.1"
FT                   /translation="MKPAVLTGEHFFTGDIACAEGALAAGCRFFAGYPITPATEIAEHM
FT                   ASRLPDVGGTFIQMEDEIAAMAAVLGASNAGVKSMTATSGPGFSLMMENLGLGICTETP
FT                   CVVVNVQRAGPSTGLPTLGAQGDMMQARWGSHGHYEIIALAPASPQEIFHQTITAFNLS
FT                   ETYRVPVLIMADEVVGHLSERVSVPDAQAIKLRSRPRPKGRKDRFKPFLPGPGGVAPMA
FT                   VAGEGYGVHVTGLTHDERGYPVMTAEAHVEMIDRLTAKIRNNMRDISMTERYRLEDADI
FT                   AVISYGVSSRSSMAAVDEAREAGIKAGLLRLVTVWPFPEELIRELSERVRSFVTVEINL
FT                   GQIHLEVQRCAAGRVPAYLVGHAGGTVIPPEQVLETLRKVSGSGS"
FT   gene            complement(29501..29782)
FT                   /locus_tag="Sfum_0018"
FT   CDS_pept        complement(29501..29782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0018"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: aba:Acid345_1811 4Fe-4S ferredoxin,
FT                   iron-sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE69"
FT                   /protein_id="ABK15721.1"
FT                   /translation="MKYWRIPLDTDQIQVSKGIVYILEERCKGCGFCIEFCPRDVLEMA
FT                   RHYNVKGYHPPRVKKPEDCVNCHYCETICPDFAIYSVEAPAEPKPSEL"
FT   gene            complement(30557..31330)
FT                   /locus_tag="Sfum_0019"
FT   CDS_pept        complement(30557..31330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0019"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sat:SYN_01176 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15722"
FT                   /db_xref="InterPro:IPR007161"
FT                   /db_xref="InterPro:IPR025251"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE70"
FT                   /protein_id="ABK15722.1"
FT                   /translation="MQLIRNLYDHFHEKAQKTKIACLCVGLSYTAVITDDGGMGIAYTY
FT                   AEDTHCCRMNRNYRDYEGERAIELLEEIRSPDALRRSMGLACVNAMNYHDASGFPEDST
FT                   DRLWMDSFGIGSGTRVAMVGFFRPLMKLFRDRGALVEALDDFQGIGDRDSFYGKLDGWA
FT                   EVLLLTSTSILNHTTEEILGRIAPEVKVVMLGPSTPMVADAFRHLPVRVLAGTVPVDKE
FT                   AVLRAVRHGAGTPVIHRFSRKAYVTLADGRVRAPC"
FT   gene            complement(32284..34755)
FT                   /locus_tag="Sfum_0020"
FT   CDS_pept        complement(32284..34755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0020"
FT                   /product="ATP-dependent protease, putative"
FT                   /note="KEGG: gsu:GSU2433 ATP-dependent protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15723"
FT                   /db_xref="GOA:A0LE71"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041699"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE71"
FT                   /protein_id="ABK15723.1"
FT                   /translation="MARKFPELSVKELRAYIEPETLPFETTASLEAPGDRVVGQERAID
FT                   AIQFGMGMKTSGYNIFIAGPAKAGLTFMAKSFIEERARKEPTPPDWCYVFNFKEQDKPK
FT                   CLKVTPGRGKALKKDMNEFIDTLQAKIPEVFDSDDYRAKESEVHQAFEKQRREIIDELS
FT                   QQAKDQGFILQFSQVGMVIIPANKEGEPMTQEDLRHLGEEERLVLREKSDELHEKMKEA
FT                   IKHIREAEAEFKDKHTKLDNEIALFVVGQLMDTYEETYKDDEQVLEYLKMVQEDILENI
FT                   EDFKKKPEAAQQQGQPGTPFPMPTRETAMRKYDVNVLIDNSETEGAPVVIESNPAYPNI
FT                   FGSIERQAWFGALFTDHTMIKAGALHKANGGYLVMKALDLLKWFVTYEALKRALRDGEV
FT                   RIEDLGELYGIFSTRTIRPEPIPLNVKIVLTGDPYIYQLLYTYDDRFQKLFKVKAHMDD
FT                   QMDRSEDKLLQCAGMISRYCEDHKLRHLDRTGVSRVLEYSVELTEDRDKLTLEFGTIGD
FT                   LLKEANYFAGIEDCEFVKREHVEQAIKKRIYRSNLIEERMKEMMLKDIFWVETTGGKVG
FT                   QVNGLSVLMAGDHVFGRPNRITCSVSVGREGMISIDRESKMSGPTHTKGLIILSSILKD
FT                   RFAHNKPISLNASLCFEQSYGMVDGDSASSTELYVLLSAIADVPIKQGIAVTGSVSQKG
FT                   EIQPIGGVNHKVKGFFDICKHKGLTGKQGVMIPSKNVRNLMLDQEVIDAAKEGKFHIWP
FT                   VSTIEEGIELLTGMKAGKLQPDGTYPEGTLFRKVDDRLREIAEIVKTFGKDSDNGRKSS
FT                   EEEGGCSGCGA"
FT   gene            complement(34935..35171)
FT                   /locus_tag="Sfum_0021"
FT   CDS_pept        complement(34935..35171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0021"
FT                   /product="RNA-binding protein (KH domain)"
FT                   /note="KEGG: dde:Dde_1098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15724"
FT                   /db_xref="GOA:A0LE72"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE72"
FT                   /protein_id="ABK15724.1"
FT                   /translation="MAFKDLVEYLVTSLADHPREVVLTEREEDDTVILELKISTEDLGR
FT                   IIGKNGNTINAIRTVIQTAASSTKKKVKLDVLS"
FT   gene            complement(35199..35504)
FT                   /locus_tag="Sfum_0022"
FT   CDS_pept        complement(35199..35504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0022"
FT                   /product="protein of unknown function DUF77"
FT                   /note="PFAM: protein of unknown function DUF77; KEGG:
FT                   mta:Moth_2497 protein of unknown function DUF77"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15725"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE73"
FT                   /protein_id="ABK15725.1"
FT                   /translation="MAVVEVSIVPIGVPGTSLSTHVAKVLKVLKESSLQYELTAMGTIV
FT                   SGDLDEILPVLKRMHESCFGPEVTRVLTQIRIDDRRDRKGTPEQKIRSVMDKLTDR"
FT   gene            complement(35568..36401)
FT                   /locus_tag="Sfum_0023"
FT   CDS_pept        complement(35568..36401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0023"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sat:SYN_01340 endonuclease IV"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15726"
FT                   /db_xref="GOA:A0LE74"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE74"
FT                   /protein_id="ABK15726.1"
FT                   /translation="MKPYFSDAMQTLLRQVHINMPIKLLPKYLEMILHYRLNVELGFEA
FT                   VELDRMSGKELSAVAGKLHGRNCRISLHGPFWDLSTGSVDPLIRKVSVSRFQQLFETLD
FT                   IFRPVQVVLHTGFDPRHHRGHRRAWLDNSMAIWEPLVKRAEGLNIPLLLENVWERDPEL
FT                   HLELFGRIDSPFFGFCLDVGHQHSFSGTALSVWLEALWHVLREIHVHDNDGSRDAHLPV
FT                   GRGSIDFALLFDFLKARNLTPLLTLEPHLEEHLPESLSGLMRVMTACGTAWPVLS"
FT   gene            37084..38022
FT                   /locus_tag="Sfum_0024"
FT   CDS_pept        37084..38022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0024"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   dvu:DVU1343 cation ABC transporter, periplasmc-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15727"
FT                   /db_xref="GOA:A0LE75"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE75"
FT                   /protein_id="ABK15727.1"
FT                   /translation="MTHPARVVAKLLLGLSLVFAVAGAPAAVGAAEAKGRLEVTVSILP
FT                   QKYFVEKIGGDLVSVTVMVEPGAEPHVYDPKPQRMTGLTRSKIYFAVGAPFEDVWLDRF
FT                   AAANPKMRIVRTDAGIAKLSMEHDHATPEKEEAHTHPESAAREHSHGGEDPHVWTSPPL
FT                   VMIQARHILAGLVEADPAHRGAYETNYRKFVEELVELDHFLLNLFQDRPKGEFIVFHPA
FT                   WGYFAEAYNLQQVSIEIEGKEPKAADLQRLIEQARKRRVGTVFVQPQFSDRSAKVIAEA
FT                   IGSRVEFADPMSADWDRNLREFAGKIHASLH"
FT   sig_peptide     37084..37176
FT                   /locus_tag="Sfum_0024"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.660 at
FT                   residue 31"
FT   gene            38113..38562
FT                   /locus_tag="Sfum_0025"
FT   CDS_pept        38113..38562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0025"
FT                   /product="putative ferric uptake regulator, Fur family"
FT                   /note="KEGG: reu:Reut_A0164 putative transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15728"
FT                   /db_xref="GOA:A0LE76"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE76"
FT                   /protein_id="ABK15728.1"
FT                   /translation="MCRQCDYSDLLKRSGVSLTVHRLRVLEVIGDSPCPLSHREIHRTL
FT                   KRSRVVDRVTVYRILDLLVDKGVVQRISSGDRGFRYGLAPSSNHPSHHHFFCSVCGNMQ
FT                   CLDPGALPIDLQALQRSCASLIRNVEVRLDGICGNCLENRGAKDN"
FT   gene            complement(38724..39092)
FT                   /locus_tag="Sfum_0026"
FT   CDS_pept        complement(38724..39092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15729"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE77"
FT                   /protein_id="ABK15729.1"
FT                   /translation="MVNGDLPYRIPQAVSGHSAIRVNRRRNRHAVSSPAETRGTPRGTQ
FT                   TSPPGPSTPPLRPLRGQRGKKTGTREKGRLRHWKPGLTCSPFRNGRHARFQAHPAGRRK
FT                   SLRPGGSGSDRSFYPKSK"
FT   gene            39107..39952
FT                   /locus_tag="Sfum_0027"
FT   CDS_pept        39107..39952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0027"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="KEGG: mta:Moth_0067 extracellular solute-binding
FT                   protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15730"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE78"
FT                   /protein_id="ABK15730.1"
FT                   /translation="MLRKSVLAGAVLVALVCFGFIGVRDGDCAEPQIKDLILATTTSTV
FT                   DTGLLDALIPKFEKETGYRVKTISAGTGQALAMGEKGEADVLLVHAPEAEKKLVDGGMV
FT                   INYQLVMHNDFVIVGPAGDPAGIKGKPSADALKAVAAKEAVFISRGDDSGTHKKEKSLW
FT                   KKVEIQPAGKWYRESGQGMGATLLMASEQQGYTLTDRGTYLAQKKNVKLDILSEGDKAL
FT                   LNIYHVMQVNPEKFAKVNGPGAKAFVEFMVRPDVQKFIGEFGKDKFGQPLFFPDAGKQM
FT                   "
FT   sig_peptide     39107..39166
FT                   /locus_tag="Sfum_0027"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.962) with cleavage site probability 0.866 at
FT                   residue 20"
FT   gene            39986..40678
FT                   /locus_tag="Sfum_0028"
FT   CDS_pept        39986..40678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0028"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sat:SYN_00838 ABC-type
FT                   tungstate transport permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15731"
FT                   /db_xref="GOA:A0LE79"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE79"
FT                   /protein_id="ABK15731.1"
FT                   /translation="MNVISEGIVEAARLLVTLDPDVVAITLRTLQVSTTATFISVLIGL
FT                   PFGTFLALTRFFGRGFVVSLVNFGMGLPPVVVGLVTWLFLTRYGPLGTLGLLYSPTAMV
FT                   IAQAVIASPIVAGFAMAAIQSVNPKLRLQILSLGATRIQFLFLLLWEARLGILAAVIAG
FT                   FGGVISEVGASMMVGGNVRGYTRVLTTATVLEVSKGSFALATGLSIILLALSFGIMASL
FT                   SYLQQRGR"
FT   gene            40678..41406
FT                   /locus_tag="Sfum_0029"
FT   CDS_pept        40678..41406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0029"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mta:Moth_0069 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15732"
FT                   /db_xref="GOA:A0LE80"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE80"
FT                   /protein_id="ABK15732.1"
FT                   /translation="MAEHLIAAKDLRLRLDGRDIFHIPEFSLQRGEVLALVGPNGSGKS
FT                   SLLLTLALLQEPTEGTVRFDGRPAGRDNALALRRRMALVFQEALLLDATVRRNLMIALR
FT                   LRGVTGREAEQRANRWLDRFGIAHLASRKARRLSGGEAQRTSLARAFALEPEVLFLDEP
FT                   FASLDYPTRRSLLGELGKLLKDMNMTTLFVTHDYTEIPYLADRVMVLYEGRIIKTGSVR
FT                   QVFGDQIVERKVWAPWEDAE"
FT   gene            42222..43301
FT                   /locus_tag="Sfum_0030"
FT   CDS_pept        42222..43301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0030"
FT                   /product="molybdopterin oxidoreductase Fe4S4 region"
FT                   /note="PFAM: ferredoxin; 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein; molybdopterin oxidoreductase Fe4S4
FT                   region; KEGG: sat:SYN_00630 formate dehydrogenase,
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15733"
FT                   /db_xref="GOA:A0LE81"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE81"
FT                   /protein_id="ABK15733.1"
FT                   /translation="MKDDIITLKVNGKDFKGREVKGKKGQTVLEVLRANDVHVPTLCYH
FT                   PQMPPYGGCRLCIVEIENMRGLPPSCTTPATDGMVVNTHSPKVVGVRKTVLELLLAYGD
FT                   HNCLLCEQTGSCELQNLVYEHGIDHVRIKSQFVPKIKDDSHPMIVRDHNKCVLCGRCVR
FT                   ACLQVQVNGAIDVAARGSDSYITTFNNTNLMESNCVSCGQCVQACPVGALTEKKSRFKG
FT                   RAWEMEKVRTTCPYCGVGCQMWLHVKDGRIVKVTGVEDGAPNEGRLCVKGRFGYDFIYS
FT                   EERLKTPLIKENGAFREASWDEALDLVAKKFTEIKKKHGPDAIAGVSSSRSLNEDSYQM
FT                   QKLFRAVIGTNNIDNCART"
FT   gene            43350..44936
FT                   /locus_tag="Sfum_0031"
FT   CDS_pept        43350..44936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0031"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: sat:SYN_00629 formate
FT                   dehydrogenase, catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15734"
FT                   /db_xref="GOA:A0LE82"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR041925"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE82"
FT                   /protein_id="ABK15734.1"
FT                   /translation="MTNSFGDFARAKLILAIGTNMTEAHPVASSFVKNAVQNGGELIVV
FT                   DPRRTGLADHASQHLQLRVGSDIALLNGLMHVLITEDLYDKEYVKNCCTGFDELKKKVM
FT                   EYPPERAAEISGVDAETIRQVARKLATVRPAMLAYTLGITEHTCGMNNVLSCANLQMLL
FT                   GNVGFECGGVNPLRGQNNVQGACDMGALPNVFPGYQQVADPKARAKFEAAWNVKGLPDK
FT                   PGLMMPQMMDGLASGKVKAFYIFGENLANTEPDIRHVEHCLDSAEFLVCNDIFPTETTR
FT                   FADVVFPVAAWSENDGTFSNSERRVSRVRTVSEPPGVAKPNWWVFKEIARRMGQEWASS
FT                   SAQELWDNEISVLAPALGGIKYRRIEKDGLQWPAPTEEHPGTPTLHRDGKFTCGLGNLV
FT                   PVDWTPPAEVPDKEYPFVLSTGRRLFHYHTRTQTGRCEGLNDLLGEETADMSREDGIAM
FT                   GIQVGDKVRVKSRRGEVVVTANPTDRVPKGMVWMAFHFRDGCANWLTNPVFDPVTQTAE
FT                   YKACAVKIEKA"
FT   gene            45717..47351
FT                   /locus_tag="Sfum_0032"
FT   CDS_pept        45717..47351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0032"
FT                   /product="molybdopterin binding domain"
FT                   /note="PFAM: molybdopterin binding domain;
FT                   formylmethanofuran dehydrogenase, subunit E region; KEGG:
FT                   dde:Dde_0685 tungsten formylmethanofuran dehydrogenase
FT                   family protein/molybdopterin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15735"
FT                   /db_xref="GOA:A0LE83"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE83"
FT                   /protein_id="ABK15735.1"
FT                   /translation="MKIGRYSYDEYLELVKSFHGYAAPGLMMGGVMVDLALSRMPEGVL
FT                   FDAVCETASCLPDAVQLLTPCTVGNGWVRVLNLGRYALSLYDKSTGSGVRVFVDAAKIR
FT                   AWPEAEAWLFKLKPKAAQDTGLLLRQIKEAGYGIYGVQDIRIQPQFLVRHHKGSIGTCT
FT                   LCGEPYPADDGGICRGCQGEAPYAVPGEVESDGFPDGPDLLAVPVQDAVGRSMLHDMTQ
FT                   ILPGKSKGAAFRRGQQISVGDLCRLQQMGRQRVYVDQGNTPDGEWIHEDQAALAFARAM
FT                   AGEGVRFVEPPREGKINFVADRDGLFLVEEESLEEFNMVAGVMCASRRGYTLVRNGRML
FT                   GGTRAIPLYLPRSAFMKALAVLRYGPLFRVLPMRKARVGILVTGSEVFQGLIEDRFIPI
FT                   IGAKVEALDCKVVKAVIVPDDRVAIRDGVHELVRAGADLLVTTAGLSVDPDDVTRQGLK
FT                   DAGAMDMLYGAPVLPGAMTLLARIGSVQVMGVPACALYFKTTSFDLLFPRLLAGVDIAR
FT                   RDLAKLGHGSFCLECKACTFPKCPFGG"
FT   gene            47379..47846
FT                   /locus_tag="Sfum_0033"
FT   CDS_pept        47379..47846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0033"
FT                   /product="putative transcriptional regulator, ModE family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: dvu:DVU1759
FT                   molybdenum-binding protein, HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15736"
FT                   /db_xref="GOA:A0LE84"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE84"
FT                   /protein_id="ABK15736.1"
FT                   /translation="MPSQSQEDSAARPARRSESKGKTKPVEVLNEPTIRLHIWLETGDG
FT                   VFFGAGRAFLLEKIEEHGSLRKAAEDLGMSYRAAWGKIRKTEKVLGVKLIAQCRSKKEG
FT                   HNLTEEGRMLKEKYLLWFQEIEREALRKAAEIFPWPVRGYKEKGGDKFLRQ"
FT   gene            47918..48721
FT                   /locus_tag="Sfum_0034"
FT   CDS_pept        47918..48721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0034"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase, subunit FdhD;
FT                   KEGG: dde:Dde_3516 formate dehydrogenase family accessory
FT                   protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15737"
FT                   /db_xref="GOA:A0LE85"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE85"
FT                   /protein_id="ABK15737.1"
FT                   /translation="MQTLKHMTARFKDNGLFSAENELAVEELLEIYVDDSPYAITMRLP
FT                   GDDINLAAGFCFTEGIIRSYDDIASIEHCEAIPGERRVMVHLSRDRKRAKSVRKERAEY
FT                   LSKSSCGLCGKREAEEIFDDIPPVETCRHIELEEILRLKDVFEGRQAIFPRTGSTHSAA
FT                   AFDDRANLLAFAEDIGRHNAFDKVIGALLKTRELGKVFLGVVSSRLSFEMVQKAGVAGF
FT                   EVFAGLSAATSLAVAMADRLNMTLIGFLREKSMSIYTHPERVLRC"
FT   gene            49011..49598
FT                   /locus_tag="Sfum_0035"
FT   CDS_pept        49011..49598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0035"
FT                   /product="Formate dehydrogenase"
FT                   /EC_number="1.17.1.9"
FT                   /note="PFAM: molybdopterin oxidoreductase Fe4S4 region;
FT                   KEGG: sat:SYN_00635 formate dehydrogenase major subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15738"
FT                   /db_xref="GOA:A0LE86"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE86"
FT                   /protein_id="ABK15738.1"
FT                   /translation="MGVTRREFLLISGTMGAGLALSSLGVDMRPIMAHAEELSKIEKVK
FT                   SAKQTYSLCYYCSVTCGLICSTDQKTGKIINIEGDPDHPVTEGSLCAKGAASLQMSARN
FT                   EHRLTKVLYRKPGGDKWEPKTMDWALTEIAKRIKATRDKDFMVKNAKGQVVNRLESISH
FT                   LGSSKLDNEECWMVTAAVRALGLVYIDHQARV"
FT   sig_peptide     49011..49088
FT                   /locus_tag="Sfum_0035"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.906) with cleavage site probability 0.630 at
FT                   residue 26"
FT   gene            49647..52061
FT                   /locus_tag="Sfum_0036"
FT   CDS_pept        49647..52061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0036"
FT                   /product="formate dehydrogenase alpha subunit"
FT                   /EC_number="1.17.1.9"
FT                   /note="KEGG: sat:SYN_00634 formate dehydrogenase major
FT                   subunit; TIGRFAM: formate dehydrogenase, alpha subunit;
FT                   PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15739"
FT                   /db_xref="GOA:A0LE87"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE87"
FT                   /protein_id="ABK15739.1"
FT                   /translation="MTNHYIDIKNADVILIMGSNAAEMHPISFKWVLRAREERGAKIIH
FT                   VDPRFTRTSALADHYIALRSGTDIAFLGGMIKYILENKKYFEEYVRDYTNASFIVDEKF
FT                   SFNDGLFSGYDPAARKYDKSTWAIKVDEKGIPQKDPTFENPRCVLQMLKAHYSRYDIDK
FT                   VSSITGTPVEDLKTVYELYASTGVKDKAGTELYALGWTQHTVGVQNIRAMSIIQGLLGN
FT                   MGIAGGGINALRGEPNVQGSTDHAILSHILPGYLKAPVASLTTLEEYLKKNTPKTSEPQ
FT                   SANWYQNTPKYMVSLLKAWYGDKAVKENDFGYANVPKLDDGQDATVLNMIDKMYEGKIK
FT                   GFTCIGQDPAVSLPNANKVRQAFTKLDWMVHVNIFDNETASFWKGPGLDPKKVKTEVFL
FT                   LPAAASMEKEGSMSNSGRMLQWKYTAEKPPGDALSVGDILYRLVNKLKDLYKKEKGAFP
FT                   DPIVNLVWNYGDAKGHYDALATSKAVNGLFLEDVTIGDKTFKKGQCVPGFGNLQADGKT
FT                   SCGNWIYSGAFAADGTNLMARRKKDDPTGLGLYPEWGWAWPVNRRILYNRASVDKNGQP
FT                   FDPSRPLLKWVDGKWVGDVPDGPWPPLSDKEKGKLPFIMKPDGVASLFGPGLADGPFPE
FT                   HYEPLEGPLAKNPMSSQLNNPAIKIFTKECDLYSGCDPKFPFVCTTYSCTEHWCTGAET
FT                   RWQSWLTEAQPEAYVEISRELAELRGIKNGERVRVESPRGKVECVAMVTTRFRPFQVGG
FT                   QTIHQVGMTFNYGWLFPKDCGDTANLLTPTAGDANTMTPEYKAFMVNVTKV"
FT   gene            52074..52727
FT                   /locus_tag="Sfum_0037"
FT   CDS_pept        52074..52727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0037"
FT                   /product="formate dehydrogenase, beta subunit, putative"
FT                   /note="KEGG: dde:Dde_0812 formate dehydrogenase, beta
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15740"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE88"
FT                   /protein_id="ABK15740.1"
FT                   /translation="MSKGKSIMVDTSRCTACRGCQVACKQWNGLPGTKTKQVGTYQNPQ
FT                   DVSAETWKLVRFSEGIKENGKPYWYFFSEQCRHCLEPPCVDSIGGYQPEGATRDEATGA
FT                   VIFKPASKEAPFEEVKGACPYNIPRQDAKSKVFFKCTMCLDRITNNRIPACVQSCPTGA
FT                   MAFGERDAIVEMVKKRVEELKKTYPKAMALNPDEVRVIYIVTDDPKKYHQYAVA"
FT   gene            52769..53779
FT                   /locus_tag="Sfum_0038"
FT   CDS_pept        52769..53779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0038"
FT                   /product="protein involved in formate dehydrogenase
FT                   formation"
FT                   /note="KEGG: sat:SYN_00636 protein involved in formate
FT                   dehydrogenase formation"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15741"
FT                   /db_xref="GOA:A0LE89"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE89"
FT                   /protein_id="ABK15741.1"
FT                   /translation="MRNRDGRRLSEEEYLMEQESLAARAAGRVADALKKTSEENRYLRT
FT                   VLAPFAGLLMEQARWKAELPETEAGNALAPDATRFGNGIPVTDRQSLICLGDLWKEAAE
FT                   RLVPPFADGFAEVADGLRRLQYAILKGGFDPDSYWSRVLKNRNAAVPDEVRAIGLEPEV
FT                   LQFALIQLAKPVVERRAEGLQPLIKSLTWNKGYCPICGSLPELSLLKGKEGHRWLRCAF
FT                   CAGEWRFHRTTCPNCESQKPDDIELCYVEGREHERVELCHNCMTYVVSVDVRTLADEIV
FT                   PEVARLGLLHLDAIAQRREFRPMNPTGWTKSAPAGAAADEASGRASGASGGTMLH"
FT   gene            complement(53803..54669)
FT                   /locus_tag="Sfum_0039"
FT   CDS_pept        complement(53803..54669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0039"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein, putative"
FT                   /note="KEGG: dvu:DVU0978 ABC transporter, periplasmic
FT                   substrate-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15742"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE90"
FT                   /protein_id="ABK15742.1"
FT                   /translation="MKALFFKAAVFSICLAIAGTGAVPSAGGEPCDGTYGSGPNRFVLA
FT                   TGSPGELGLVKALADVFTARTNTTLCWKKAGSGESLKMLKEKTADVIMGHSPDAEKKAV
FT                   AEGWAANHTLIGSNEFFIVGPATDPAGIANTSSAVEAYRKIAETKAKFFSRGDNSGTHK
FT                   KELQIWAKAGVTPSGDWYVVTKQFMIATLRMADSERGYFMTDSSTWVAEKKNLKNLKVL
FT                   LKGDKILVNVYHGLCQPPGSTPGAEWAAKFIAFVASDEGQNIIRGFGKDLHGEGLYNDA
FT                   AYAKQFE"
FT   sig_peptide     complement(54589..54669)
FT                   /locus_tag="Sfum_0039"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.407 at
FT                   residue 27"
FT   gene            55042..55374
FT                   /locus_tag="Sfum_0040"
FT   CDS_pept        55042..55374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP0127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15743"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE91"
FT                   /protein_id="ABK15743.1"
FT                   /translation="MKQYVIDQLRGPDYERIRDYLDANAEKTFMEDMYWVNLPPGLYSA
FT                   VQKEHESCHPFYFAVNLSPTQVDFEFLIRSRQIIRCSCIAYATAKQRDYIMDYADEMIR
FT                   RLDMKI"
FT   gene            complement(55576..56631)
FT                   /locus_tag="Sfum_0041"
FT   CDS_pept        complement(55576..56631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0041"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="PFAM: chorismate synthase; KEGG: sat:SYN_01934
FT                   chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15744"
FT                   /db_xref="GOA:A0LE92"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LE92"
FT                   /protein_id="ABK15744.1"
FT                   /translation="MAGSSFGRLFRITTWGESHGPALGVVIDGCPPGIPLAPEDIQRDL
FT                   ERRRPGKRLTSPRGEPDRVEILSGVFQGVTTGTPISLVIFNRDVRSGDYTELAEVYRPG
FT                   HGDRTYEQKYGVRDWRGGGRSSGRETAARVAAGAVARKFLAGRGVEVKAYTVAFAGLHV
FT                   DSFNRDEIDRNPFFCPDATAAAAMERRVEELRDAGDSCGGVVEVSARGCPAGLGEPVFD
FT                   KLDARLAGALMSVGAVKGVEIGAGFAAAAMLGSENNDPLTPDGYASNNAGGVLAGISTG
FT                   MDIVARAAVKPIPSISKPQQTVNTRGEPVTLSIKGRHDVSAIPRIVPVCEAMVLLVLAD
FT                   FMLHPAPVEKR"
FT   gene            56834..57076
FT                   /locus_tag="Sfum_0042"
FT   CDS_pept        56834..57076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0042"
FT                   /product="ATP-dependent Clp protease adaptor protein ClpS"
FT                   /note="PFAM: ATP-dependent Clp protease adaptor protein
FT                   ClpS; KEGG: pca:Pcar_2261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15745"
FT                   /db_xref="GOA:A0LE93"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE93"
FT                   /protein_id="ABK15745.1"
FT                   /translation="MYRVLLHNDDYTTMEFVVEILQSVFHKSPSEATRIMLLVHKSGTG
FT                   VCGVFTAEVAETKVELVHHLARKNGFPLQCSMEET"
FT   gene            57077..59407
FT                   /locus_tag="Sfum_0043"
FT   CDS_pept        57077..59407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0043"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   clpA"
FT                   /note="KEGG: dde:Dde_2099 ATPase; TIGRFAM: ATP-dependent
FT                   Clp protease, ATP-binding subunit clpA; PFAM: AAA ATPase,
FT                   central domain protein; Clp N terminal domain protein;
FT                   ATPase associated with various cellular activities, AAA_5;
FT                   ATPase AAA-2 domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15746"
FT                   /db_xref="GOA:A0LE94"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE94"
FT                   /protein_id="ABK15746.1"
FT                   /translation="MINRELEITLSAAIKEAKTRRHEFFTLEHVLFAMLHDVTGRRVLF
FT                   HCGADLETLKGKLLKFFEERAEKLPEGIDQDPIQTLSVQRVLQRAVMHVHGAEKKEVDA
FT                   GDILAAMFYEENSYAVYFLKSEGVSRLDVLSYISHGISKVGYPEEDEGARDEPAHEVAP
FT                   GEEGEPRRTSALESFAVNLIEKAAQGRIDPLIGREEEILRTLQILGRRSKNNPIFVGDP
FT                   GVGKTAIAEGLALKIQKGEVPEVFQNIEIFALDMGALLAGTKFRGDFEARLKSVIQELK
FT                   KKEGAILFIDEIHTVVGAGATSGGSMDASNILKPVLVTGGLRCIGSTTYEEYKNHFEKD
FT                   RALSRRFQKVEIHEPSVEETYRILLGLRQYYEKHHGIRYTDAALRAATELSNRFINDRY
FT                   LPDKAIDVIDETGASLRLKKDRRVRRVVGPKDIELVVARIAKIPPRSVSASDQLRLHSL
FT                   DEELKGQVFGQDGAIDVLVKAIKRSRAGLRIPERPIGSFLFIGPTGVGKTEVAKQLARI
FT                   LGVNFLRFDMSEYMEKHTVARLIGAPPGYIGFDQGGLLTDAIRKQPYTVLLLDEIEKAH
FT                   PDLFSILLQVMDHATLTDNNGKKADFRNVILLMTSNAGAREMSMSSIGFGGGTVEPDHR
FT                   AIKGLKAVESLFSPEFRNRLDGIVLFNGLNLEIMEQIVDKFVVEMETQLGEKKIRMELS
FT                   AEARRWLGGQGYDVTFGARPLARLIQTEVKDVLADEILFGRLMHGGRVQVFRPDEAVPA
FT                   GEEILKTSNLVFVFPDVPGVPAA"
FT   gene            59426..60130
FT                   /locus_tag="Sfum_0044"
FT   CDS_pept        59426..60130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0044"
FT                   /product="Leucyltransferase"
FT                   /EC_number="2.3.2.6"
FT                   /note="PFAM: leucyl/phenylalanyl-tRNA--protein transferase;
FT                   KEGG: eba:ebA4891 leucyl/phenylalanyl-tRNA--protein
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15747"
FT                   /db_xref="GOA:A0LE95"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LE95"
FT                   /protein_id="ABK15747.1"
FT                   /translation="MPVFRLTEELIFPPSYLAERDGLLAVGGDLSAERLLLAYRQGIFP
FT                   WYTEKTPILWWSPDPRLVLFPAELKISISLRRVLRKNVFSVTFDRAFADVIRRCAEVRR
FT                   ARDDSTWIVPGMVTAYSRLHRLGYAHSVESWHEGELVGGLYGVALGRVFYGESMFTRKT
FT                   DASKVALVHLVDLLTRGGFQLIDCQVTTAHLQSMGAREISRRRFLTLLAENIPEVVHGE
FT                   SWEGESCCGKRP"
FT   gene            complement(60382..60672)
FT                   /locus_tag="Sfum_0045"
FT   CDS_pept        complement(60382..60672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15748"
FT                   /db_xref="GOA:A0LE96"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE96"
FT                   /protein_id="ABK15748.1"
FT                   /translation="MRECPKCGHVRRQEDDGFVPAEECPKCGVIYSRARPDVSLQPYSN
FT                   RPAGKGIGETIKFVLLIALVLIGFYLWTHYYGSSAEGKSTFGLEFLMVPRG"
FT   gene            61277..62605
FT                   /locus_tag="Sfum_0046"
FT   CDS_pept        61277..62605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP1561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15749"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE97"
FT                   /protein_id="ABK15749.1"
FT                   /translation="MVEKVIIVGAAGRDFHNFNVYFKNNRRYRVVAFTAAQIPNIESRL
FT                   FPPELSGEHYPEGIPIYPEADMARLIREHRIDLVAFSYSDVAHVDVMHRASLAMAEGAD
FT                   FILLGATYTMLKSRKPVIAVCAVRTGSGKSQTTREICRILQNLGKKAVVVRHPMPYGDL
FT                   RSQIVQRFASREDIDVNQCTIEEREEYEPLVDRGIVVYAGIDYARILERAESESEIIIW
FT                   DGGNNDTPFFSPDLHIVVFDPHRPGHELLYYPGETNLIMADVAIINKVDTALPENIESV
FT                   RENIGKFAPRAEIILAESPVTVSDPRRVRGSRVLAVEDGPTLTHGGMPFGAATIAARKY
FT                   GAAEIVDPHPYAVGTIREALLQYPHIGAELPAMGYGERQMRDLEATINAVDCDLVLAST
FT                   PVDLSGLLSMNKPTLRVRYEYKDHGRPGLEEVLTRRLVESGIL"
FT   gene            62717..63652
FT                   /locus_tag="Sfum_0047"
FT   CDS_pept        62717..63652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0047"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="PFAM: aspartate/glutamate/uridylate kinase; KEGG:
FT                   gme:Gmet_2786 carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15750"
FT                   /db_xref="GOA:A0LE98"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE98"
FT                   /protein_id="ABK15750.1"
FT                   /translation="MAVRKPILLVALGGNALIRKGQQGTIPEQLENLRVPLRQIARLAE
FT                   AHRIIITHGNGPQVGNLLLQQECCSEVPRLPLEILVAQTQGQIGYMIESTLDSELMSLG
FT                   VDKEHYIVSVLSYVVVNEDDPAFLHPSKPIGPAFNEAEAARLPYPTVRTDKGYRRVVAS
FT                   PKPVTIVEKREIKRLIDLGFIVISCGGGGIPVIRDSRTFHGVDAVIDKDLASARLAGEI
FT                   GVDIFLIATDVEGVALHYEQETRRSWLRSVSVGDAGRFLEEGHFPPGSMGPKVEACIEF
FT                   MKHGGTRAVIASIERIEAAVQGAAGTEFAP"
FT   gene            complement(63699..64796)
FT                   /locus_tag="Sfum_0048"
FT   CDS_pept        complement(63699..64796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_0554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15751"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE99"
FT                   /protein_id="ABK15751.1"
FT                   /translation="MAFILPEYRTPDFTAEPFKSAPAARFEAAPKAGVAPGDYHATSIY
FT                   PEYFQVAPGDWRLPRESRMDCVVVLQSDGSLTVKEFRHIAAGELVAIGRRENCEDGIFV
FT                   HSGAFGQPDTLSDKFAFRTQVSRETAFSADYDELYGLLDHERNHGFILWVLGPAVSFDR
FT                   DARNAFTLLVRNGYVDGLLAGNALAAHDIEGALFNTALGQDLYTKRHVPLGHYKHLDAI
FT                   NRIRELGSIEAAIRIGMVSGGIMDAVTRAGVPYVLAGSIRDDGPLPEVIANVYAAQDRM
FT                   RDLARRATTVIAMATQLHSIATGNMIPAYRVMPDDSVRPVYFYTVDMSEFAANKLADRG
FT                   SLTARSILTNAQDFVVNLERGLLGK"
FT   gene            complement(64811..65401)
FT                   /locus_tag="Sfum_0049"
FT   CDS_pept        complement(64811..65401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0049"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number="2.7.8.5"
FT                   /note="TIGRFAM: CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; KEGG: gme:Gmet_1952
FT                   CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15752"
FT                   /db_xref="GOA:A0LEA0"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEA0"
FT                   /protein_id="ABK15752.1"
FT                   /translation="MNRSDLSRQSLTNLPNILTYIRMATIPVIVVLLTPPASMNSSNLA
FT                   FLLYVLASITDYLDGILARRRNLVTSVGKLLDPLADKLLTSAVLIMLIPLGKVQAWLVF
FT                   LIIGRELIITGLRSIAAGHGLILNASRMGKNKMVSQTIALIFLLPSVPRIDWMLDYAGL
FT                   FFLWVSVVLGYWSAMDYFSHFYREAKRRSQSKE"
FT   gene            complement(66160..66795)
FT                   /locus_tag="Sfum_0050"
FT   CDS_pept        complement(66160..66795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0050"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   gsu:GSU1826 lytic murein transglycosylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15753"
FT                   /db_xref="GOA:A0LEA1"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEA1"
FT                   /protein_id="ABK15753.1"
FT                   /translation="MKHPTRLGVASIATAWGMICLLLLFQSHARADIYKYVDKDGVIHF
FT                   TNTPVQPEAKSLTLPPVTQANFVKYFPHRTFYSACNPKNQNYFDPQIRMVCMRHGLDYN
FT                   LVRAVIRAESGYNPQAVSPKGAMGLMQLMPGTSRDLGVLNPFDPGENIDGGARYLKMLI
FT                   ERFNNIPLAVAAYNAGPENVEKYKGIPPFDETQVYVQRVMDYYSRYRQ"
FT   sig_peptide     complement(66700..66795)
FT                   /locus_tag="Sfum_0050"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.603 at
FT                   residue 32"
FT   gene            complement(66965..67630)
FT                   /locus_tag="Sfum_0051"
FT   CDS_pept        complement(66965..67630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0051"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="KEGG: mja:MJ0960 transaldolase-like protein;
FT                   TIGRFAM: putative transaldolase; PFAM: Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15754"
FT                   /db_xref="GOA:A0LEA2"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEA2"
FT                   /protein_id="ABK15754.1"
FT                   /translation="MKFFIDTANLDEIKEAHSLGILDGVTTNPSLIAKEGIANREDFIR
FT                   HIKTICELIQAPVSAEAVSTDAEKMIVEARSLAAIDPHVVVKIPMTIDGLKAVRQLSEE
FT                   GIKTNVTLVFSPLQALMAAKAGATYISPFVGRLDDISADGMNLVEEILEIFSNYLFETE
FT                   IIVASVRNPLHVLAAAKLGADIATIPFKVIDQLAHHPLTDLGVERFLKDWEKVEKQRV"
FT   gene            complement(67652..67909)
FT                   /locus_tag="Sfum_0052"
FT   CDS_pept        complement(67652..67909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0052"
FT                   /product="TRASH domain protein"
FT                   /note="SMART: TRASH domain protein; KEGG: dps:DP0429
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15755"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEA3"
FT                   /protein_id="ABK15755.1"
FT                   /translation="MGRFIIIATLIFVGYLLAKRYFHLLAGKMNRNDSAENDATELVQD
FT                   PQCGTYFARQQGVEARIDGQTVYFCSETCRGKYLEKHRSG"
FT   gene            complement(67923..68417)
FT                   /locus_tag="Sfum_0053"
FT   CDS_pept        complement(67923..68417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0053"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="KEGG: sat:SYN_02163
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HppK);
FT                   TIGRFAM: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15756"
FT                   /db_xref="GOA:A0LEA4"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEA4"
FT                   /protein_id="ABK15756.1"
FT                   /translation="METVFIGIGGNLGDARGICLGAIEALRQRREIDVQKVSSLYRTKP
FT                   LGPIVQEWFINAAVQCRSRLEPEALLAVLMEIEEQFGRKRDVRWGPRTLDLDLLAFGDR
FT                   IVSLPNLRIPHPGLHERLFVLVPLAEIAPKWVHPELRMTAEDLLKRLSGAATDREIWRL
FT                   E"
FT   gene            complement(68460..69626)
FT                   /locus_tag="Sfum_0054"
FT   CDS_pept        complement(68460..69626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0054"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   mta:Moth_0889 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15757"
FT                   /db_xref="GOA:A0LEA5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019881"
FT                   /db_xref="InterPro:IPR019942"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEA5"
FT                   /protein_id="ABK15757.1"
FT                   /translation="MAFVKAERLKLLPPYLFQEIDRLKAELTAKGVDVINLGVGDPDLP
FT                   TPDHIIARLKTAAEDPSTHQYPSYSGMNDFKVSVAGWYKRRFGVELDPLSEVLTLIGSK
FT                   EGLAHFPLAVINPGDLALVPTPAYPVYHVATMFAGGESYFMPLVRENGFLPDLDSIPAD
FT                   VARRAKVMFINYPNNPTGATAERDFFEKVIAFAREYDVIVCHDAAYTEMAFGGYRPLSF
FT                   LELPGAGEVGVEFHSLSKTYNMTGWRLGFAVGNADILAGLGQVKSNIDSGAFNAVQWAG
FT                   ITALEGDQGCVVEMQRIYKERLDILIEGLKRIGLHPEVPRATFYVWCPTPPGYSSKDFS
FT                   SLLLREAGIVATPGSGFGAPGEGYIRMALTVDKERVREAVERMRKLSF"
FT   gene            complement(69890..70693)
FT                   /locus_tag="Sfum_0055"
FT   CDS_pept        complement(69890..70693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0055"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   sat:SYN_02162 dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15758"
FT                   /db_xref="GOA:A0LEA6"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEA6"
FT                   /protein_id="ABK15758.1"
FT                   /translation="MVRAAVAGIAGRMGSRIAQLIRETDGIELAGGFEHSGHQAVNREI
FT                   SEIIGGSPTGLKVTSHIAQVLDTVDVVLDFTLAAASLEHLRQASARGKAMVIGSTGFAR
FT                   EQLEEAEKLAGRVPCVISPNMSMGVNVLFKVVGDVARLLGESFDVEIIEAHHRLKKDAP
FT                   SGTALKLAQVAAGALGRNLEEVGVYARRGLIGERTGNEIGIQTIRGGDIVGEHTVMFAG
FT                   SGERIEIVHRAQSRDNFARGAIRAALWVVRQPPGLYGMDHVLGMK"
FT   gene            complement(70727..71602)
FT                   /locus_tag="Sfum_0056"
FT   CDS_pept        complement(70727..71602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0056"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="KEGG: sat:SYN_02161 dihydrodipicolinate synthase;
FT                   TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15759"
FT                   /db_xref="GOA:A0LEA7"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEA7"
FT                   /protein_id="ABK15759.1"
FT                   /translation="MFQGAMVAIVTPFKAGQVDEETFRNLIEFQIANGTHGIVPCGTTG
FT                   ESATLSFNEHERVIEIAVEQVDKRVPVIAGTGSNNTEEAIRLTKHAKNAGADGALLISP
FT                   YYNKPTQEGLYRHYEKIAKAVDIPLVPYNIPGRTAVNMEPDTIARLAKIDNIVAIKEAA
FT                   GSMKQITDIIARCGDELVVLSGEDFLTFPLLCVGGKGVISVVSNIAPADMANLCNLFLG
FT                   GDFDAARKLYYRLLPLCHGLFYETNPAPVKAALAMMNKIPSDELRLPLAPMSPANRLRL
FT                   RQDLQAYGLI"
FT   gene            complement(71613..72476)
FT                   /locus_tag="Sfum_0057"
FT   CDS_pept        complement(71613..72476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0057"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: sat:SYN_00169
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15760"
FT                   /db_xref="GOA:A0LEA8"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEA8"
FT                   /protein_id="ABK15760.1"
FT                   /translation="MPVENERTRFLKMTGSGNDFIVLDNRAQGISPEQGRELARLACRR
FT                   KLSVGADGLILIENDPEVDFRWRFFNADGSEAEMCGNGARCAARFAHIKGIVAKSRMSF
FT                   RTLAGIIEAEIKEPRVKIRMTPPHGLEPDLNVEAEQRSFRLHFINTGVPHVVCFLENDR
FT                   ALEEMNVFHWGRLLRHHRRFQPAGSNVNFALVEDANHMAIRTYERGVEDETLACGTGSI
FT                   ASALVAAAKGMVQSPVEVRTRSGETLTIYFDNPSTGAAAEFSQVYLEGDAKVVYEAELW
FT                   KETLRE"
FT   gene            complement(72652..73956)
FT                   /locus_tag="Sfum_0058"
FT   CDS_pept        complement(72652..73956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0058"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: sat:SYN_02160
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15761"
FT                   /db_xref="GOA:A0LEA9"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEA9"
FT                   /protein_id="ABK15761.1"
FT                   /translation="MTGSADRGFLMHHFHYHNDELYCERVPLRELAARVGTPCYVYSHA
FT                   TLLHHFTVFDSAFEGVPHLTCFSVKANSNLAVLRLFGSLGGGVDIVSGGELYRARQAGI
FT                   APDKIVYSGVGKTLEEIDYALRENILMFNIESTQELEAINARAAAFGCRARIALRVNPD
FT                   VDPNTHPYISTGMKKNKFGIEIDSAVKAYERARSLDHVEVVGVDCHIGSQLTEISPFVD
FT                   ALKRLRLLIEKLEAVGITIQYLDLGGGLGIVYDQEAPPEPREYARAILRELKGMHCTLI
FT                   FEPGRVIVGNAGVLLARVLYTKRTQSKSFIITDTAMNDLIRPSLYGSYHQVQPLRRQSR
FT                   ESHIVDVVGPICESGDFIAKDRGLPMVESGDFLAVMSAGAYGFTMSSNYNSRPRAAEVL
FT                   VKDDRYFVIRRRETWDDLIQCETIPAFLSSDKQPA"
FT   gene            complement(74133..75224)
FT                   /locus_tag="Sfum_0059"
FT   CDS_pept        complement(74133..75224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0059"
FT                   /product="Fibronectin, type III domain protein"
FT                   /note="PFAM: Fibronectin, type III domain protein; KEGG:
FT                   dps:DP0434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15762"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEB0"
FT                   /protein_id="ABK15762.1"
FT                   /translation="MKTSVHRFMQTRRLAGVICVLILGLTVGSCGRKTFPRPESTDAQP
FT                   QIRDLQVQVRAKGVELTWTIPPQMRKISKENPYRFNILRSELLWENRNCLDCPATVQRE
FT                   LQMIDPVYPDPALVHDGKLSWTDPAVSLQHAYRYQIVIQDKDGRPVTMSNTAIAKVFHP
FT                   PGQIRSLSAMPGPQGILVQWKPPARDNQGQPMQGELLFVVERLSATKVWERISPAPIKA
FT                   NNYLDQGIAADRMYGYRVTPVLYFEDTPIVGEPALTHQVKAPEALPPPPPANVWVIPSK
FT                   GTLEVQWTESTEKVAGYHVYRREGKEMVRLTANPIQHPPYVDHTAKPNTVYFYAVSSVS
FT                   SQHDNREGLLSKWAEIRSLMFEK"
FT   sig_peptide     complement(75135..75224)
FT                   /locus_tag="Sfum_0059"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.692) with cleavage site probability 0.375 at
FT                   residue 30"
FT   gene            complement(75248..76648)
FT                   /locus_tag="Sfum_0060"
FT   CDS_pept        complement(75248..76648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0060"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: pca:Pcar_2418 argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15763"
FT                   /db_xref="GOA:A0LEB1"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEB1"
FT                   /protein_id="ABK15763.1"
FT                   /translation="MTEKLWQGRFDQPTNRQVEDYTASIHFDNRLYRYDIEGSIAHCRM
FT                   LAQCKIISHDDASLIVQGLGEIRRELERGKLHLGSSNEDIHMAIEQELMRKIGEVGGKL
FT                   HTARSRNDQVALDVRLYMRDTLLQCRGLILQTQKVLVSCAEENLGVVMPGFTHLQHAQP
FT                   ILLSHHLMAYYEMLKRDDERFEQCFHRTNVLPLGSAALAGTTFPIDMEWTAKYLNFPRV
FT                   TSNSIDAVSDRDYLIEFGAASAMLMMHVSRLAEELILWSSTEFDFIEISDAFCTGSSIM
FT                   PQKKNPDVPELMRGKTGRVYGNLMALLTLTKALPLAYNRDLQEDKEPVFDTADTIISTL
FT                   RLLSRLIPEIRFHRERMGEMAIQGFTLATDLADYLVKKGVPFRKAHHIVGQIVQYCLKN
FT                   RKQLHDCTVEELKTFHKTIDQDVFPFLEVAGAIDQRVSIGGTATTRVVEAIEKARAELD
FT                   ALEQSLSS"
FT   gene            complement(76678..77883)
FT                   /locus_tag="Sfum_0061"
FT   CDS_pept        complement(76678..77883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0061"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="PFAM: argininosuccinate synthase; KEGG:
FT                   pca:Pcar_2417 argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15764"
FT                   /db_xref="GOA:A0LEB2"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEB2"
FT                   /protein_id="ABK15764.1"
FT                   /translation="MDVKKVVLAYSGGLDTSIILKWLIESYGCEVVAFSADLGQAEELD
FT                   GLEAKALATGAVKARIVDLREEFVRDFVFPAFRANAIYEGQYLLGTSIARPLIAKAQIR
FT                   IAEEEDADAVSHGATGKGNDQVRFELTYIALNPAIKIIAPWREWDLKSRSDLVEFARRH
FT                   GIPIPVTKEKPYSSDRNMLHISYEGGILEDPWLEPDPAMFTLSVAPEEAPDAPEFVEID
FT                   FERGNPVAVNGERLSPAQLLTRLNALGGRHGIGRVDLVESRFVGMKSRGVYETPGGTIM
FT                   RTAHHAVESVTMDRELMFLRDSLVPQYSRLIYNGFWYSPEMRLLQNTMDLAQENVYGTA
FT                   KLKLYKGNCVVIGRRSDRSLYQPSFATFEEDDVYRQDDATGFIRLHGLRLQIESLVRGK
FT                   SR"
FT   gene            complement(77970..78908)
FT                   /locus_tag="Sfum_0062"
FT   CDS_pept        complement(77970..78908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0062"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="KEGG: dps:DP0437 probable ornithine
FT                   carbamoyltransferase; TIGRFAM: ornithine
FT                   carbamoyltransferase; PFAM: aspartate/ornithine
FT                   carbamoyltransferase, Asp/Orn-binding region;
FT                   aspartate/ornithine carbamoyltransferase, carbamoyl-P
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15765"
FT                   /db_xref="GOA:A0LEB3"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEB3"
FT                   /protein_id="ABK15765.1"
FT                   /translation="MKRDLLSIRDLSADEIVALISRAETMKRELAEGNLRQSLRNKVVA
FT                   LIFVKPSTRTRVSFEAAIYRLGGHSIFMSARDTQISRQEPLADTARVLARYVDAIVIRT
FT                   FAQEDVTELARYASIPVINGLTDRTHPCQVLGDLLTIKEKRGTLEGLHVAWIGDGNNVA
FT                   HSWINAAARLGFTVSLACPSQYLPDREILDWADTQGKGKVIMAASPKEAVASADAIYTD
FT                   VWASMGQEEEADARRSIFRPFQVNEELLSAAPAHAIVLHCLPAHRGEEITNAVMEGPHS
FT                   AIFDQAENRLHIQMALLDWLLSDNAPTQGSK"
FT   gene            complement(78905..80095)
FT                   /locus_tag="Sfum_0063"
FT   CDS_pept        complement(78905..80095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0063"
FT                   /product="acetylornithine aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="TIGRFAM: acetylornithine and succinylornithine
FT                   aminotransferases; PFAM: aminotransferase class-III; KEGG:
FT                   sat:SYN_02155 acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15766"
FT                   /db_xref="GOA:A0LEB4"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEB4"
FT                   /protein_id="ABK15766.1"
FT                   /translation="MEDYKALSQEHIFNTYARLPVTFVRGKGCRLWDDNDKEYLDFLAG
FT                   IAVCNLGHCNPEVTRVLCEQADTLIHVSNLFYTRPQIELAAELTRLSFADKVFFSNSGA
FT                   EANEAAIKLARKYSKDRYGEGRFHIVTMKDSFHGRTLATLSATGQEKVHKGFEPLVEGF
FT                   AFVDFGSPAAVENAITERTCAVMVEPIQGEGGINLPPANYLEGLKELCRKHDLLLIFDE
FT                   VQVGMGRTGRLFAHEHYGVTPDIMTLAKALGNGLPIGAMLATNQAAEAFVPGTHATTFG
FT                   GTPLVTSVALRVLRIISEPSLLERVRETGEYLMGRLRELQQRRPSIREVRGLGLMVGAE
FT                   LDRPGQNVVTKLLERGYVINCTHDSVLRFVPPLVVERAEIDRLIQALDDALAEETQ"
FT   gene            complement(80165..81061)
FT                   /locus_tag="Sfum_0064"
FT   CDS_pept        complement(80165..81061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0064"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: sat:SYN_02154 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15767"
FT                   /db_xref="GOA:A0LEB5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEB5"
FT                   /protein_id="ABK15767.1"
FT                   /translation="MIEKAGILIEALPYIRRFYGKTVVIKYGGNAMVAEELKESFAKDI
FT                   VLMKYIGINPVVVHGGGPQIGRMLKRIGKESDFCAGMRVTDADTMDIVEMVLAGKINKE
FT                   IVSLINRHGGHAVGLSGKDGNLIEARKLHVYRYKGDDQPPEIIDIGLVGEVNRVNVSIL
FT                   DTLAGGNLIPVIAPVGVGEQGETYNINADLVAGHIAGALQAAKLVLMTDVEGVLDGGGN
FT                   LISSLTVAEAADALQDETLKGGMIPKVQCAIDALQSGVDKVHIVDGRVPHAILLEIFTD
FT                   AGVGTEIVRYRRGQSVG"
FT   gene            complement(81161..82561)
FT                   /locus_tag="Sfum_0065"
FT   CDS_pept        complement(81161..82561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0065"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: sat:SYN_02153 ATP-dependent endopeptidase hsl
FT                   ATP-binding subunit; TIGRFAM: heat shock protein HslVU,
FT                   ATPase subunit HslU; PFAM: ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15768"
FT                   /db_xref="GOA:A0LEB6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEB6"
FT                   /protein_id="ABK15768.1"
FT                   /translation="MQKPLTPAEIVQELDKYIIGQRDAKRMVAIALRNRWRRQQVPEHL
FT                   RDEIAPKNIIMIGPTGVGKTEIARRLARLAQSPFLKIEASKFTEVGYVGRDVESMIRDL
FT                   SELAVSMVRTEEMEAVKIKAEELAEEKLLDILLPPKRQQESREQELPVPVEPQEAREPR
FT                   EAAREEAVQADSTREKLRKLLRKGALDDRYVELDVPDRNFPMVEIFAGTGMEDMDYNLR
FT                   DMLGSMLPRRTKRRKVKIPEAREILVQEESQRLIDMDKVIKSAIERVEHSGIIFLDEID
FT                   KIAGRESGGRGPDVSREGVQRDLLPIVEGSTVTTKYGMVKTDHILFIASGAFHISKPSD
FT                   LIPELQGRFPIRVELASLTKEDFVRILKEPENALIVQYKSLLATEEVELTFDDEAIEEI
FT                   AGLAFQVNARTENIGARRLHTIMEKLLSDISFNAPDLKGQKIPITRQYIQETLSDIIKD
FT                   EDLSRYIL"
FT   gene            complement(82567..83106)
FT                   /locus_tag="Sfum_0066"
FT   CDS_pept        complement(82567..83106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0066"
FT                   /product="CodW component of CodWX peptidase. Threonine
FT                   peptidase. MEROPS family T01B"
FT                   /note="PFAM: 20S proteasome, A and B subunits; KEGG:
FT                   mta:Moth_1029 20S proteasome, A and B subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15769"
FT                   /db_xref="GOA:A0LEB7"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEB7"
FT                   /protein_id="ABK15769.1"
FT                   /translation="MGETVVHGTTVLAIKKDGKVVMAGDGQVTMGDTVVKHQAKKVRKM
FT                   YHDRILTGFSGSTADAFTLFERLEGKLEQYNGNLKRAAVELAKDWRMDRALRRLEALLV
FT                   AADRNDCFILSGTGDVIEPDDGLAAVGSGAPYALAAARALIRHTGMSIREIAEEAMNIA
FT                   ASICIYTNREFTFEEL"
FT   gene            complement(83198..84184)
FT                   /locus_tag="Sfum_0067"
FT   CDS_pept        complement(83198..84184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0067"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein; KEGG:
FT                   pca:Pcar_0623 site-specific recombinase, phage integrase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15770"
FT                   /db_xref="GOA:A0LEB8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEB8"
FT                   /protein_id="ABK15770.1"
FT                   /translation="MAPGTLDDNSADGSEATWSEASARFIAHLRHERGLSAETVRAYAG
FT                   DLDQFREHMNATAGTADPRLSQVDADAIRGYLAALHKTRKKTSRARKLSTLRSFYHFLN
FT                   DRELVRENPAALVAYPKLGTKIPSFLGVDDVFHLLDSLNAGAARAGASWRRCRNWALFE
FT                   CMYSTGVRVSELAGMDESDVDFHEGMVRVLGKGSKERIVPVGGKALDAVKLYLRVLDSQ
FT                   FPEARRMGSALFRNARGRRLTTRSVHRLLRMELRRCGLWQHLSPHGLRHTFATHLLNSG
FT                   ADLRAIQEMLGHSNLSTTQRYTHVHVDQLMKVYDAAHPRSRRDRSGK"
FT   gene            84698..86773
FT                   /locus_tag="Sfum_0068"
FT   CDS_pept        84698..86773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0068"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: sat:SYN_02930 protein translation elongation
FT                   factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15771"
FT                   /db_xref="GOA:A0LEB9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEB9"
FT                   /protein_id="ABK15771.1"
FT                   /translation="MKEDVAGVRTFAIISHGGAGKTSLAEAMLFDAGVTTRLGKVDDST
FT                   SVMDYEPEEVKRKITISTAFNTLTWKKHQFTIIDTPGDFNFIAETKTSMQGADAVLVLV
FT                   DAIDGVRVQTEKVWEFADEFKQPRIIFVNKMDRERADFAKTVADIQNNFGKSCVPLQIP
FT                   IGSAESFKGVVDVLNRKACLYGHGDSGKFEVKEMPADLADQVAHYHEELVERVAESNDE
FT                   LLEKYLESGELSPEEVKNALRGAVTSGTLVPIACGSGVANIGIHGLMDLIADCLPSPLD
FT                   RGPRTGKGARGAEADREPDPAAPFSALVIKTISDPYAGRLSVMRVFSGSLSPDSTVFNS
FT                   TKETKERFGQLLRLKGKNQEPIQGCGPGDVVAVAKLKETTTQDTLCSEKDVISFPPVEL
FT                   PPAIYSLAVEPKSKGDEEKIFSSLSRLMEEDLTLKLERNEETKEMILSGMGEIHIEATV
FT                   DKLKRKFGVEVNLRIPKVTYKETIKGKARVQGKYKKQSGGRGQYGDCWIEMEPLPRGEG
FT                   FQFYDKIVGGVIPRQYIPAVEKGIAEALVEGALAGYPVVDFKVDLVDGSFHPVDSSEMA
FT                   FKIAGSMAFKKAMMEAKPTLLEPIVLMEITVPDDCMGDIIGDLNSRRGRVLGMESKGKK
FT                   QIVRANVPLAEVLKYAPDLRSMTAGRGMFTMKFSHYEEVPGQLQEKIVEAAKAEEK"
FT   gene            86914..88029
FT                   /locus_tag="Sfum_0069"
FT   CDS_pept        86914..88029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15772"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEC0"
FT                   /protein_id="ABK15772.1"
FT                   /translation="MAQGQTAPDRFSGTVERVALADLMQMICLAQMSHAIVVQHESGTG
FT                   AIFVRSGQVCHAVLGGAQGEEPLFEMLRWRSGKFDAAPSQSSDTPATITRGWEYLLIEA
FT                   MRSRLTGEEAAGESAGPVLSAGFAGRLGGVQLSDLVQLACMSRTDHVYEVKTEPRTGRI
FT                   YARSGQVYHSECGKLQGEDAFCELLLAETGEFRTVSLEGEPPETIAKPWEYLLMDAMRY
FT                   RDEKTGGAGEELEEEIQSLLTKLHRMKVSEKIRAAMVGDKEVRSLLIREPNKLVQIAII
FT                   NNPRITEGEVSAIASSRNVDEEVLRRIANTREWMKIYAVRLALTTNPKCPLPSALRLLQ
FT                   GLTQHDIRQIAKSKSVPIGLAQTARRLIHEP"
FT   gene            88040..88579
FT                   /locus_tag="Sfum_0070"
FT   CDS_pept        88040..88579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0070"
FT                   /product="molybdopterin adenylyltransferase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; KEGG: sat:SYN_02931
FT                   hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15773"
FT                   /db_xref="GOA:A0LEC1"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEC1"
FT                   /protein_id="ABK15773.1"
FT                   /translation="MESRTTKQAKREFLRTVAIITVSDRGARGEREDASGQALHDLLTR
FT                   HGFDVCYQTIVPDEAEVISQAIRECAVVKRVALVLTTGGTGVSPRDVTPEATRAVIERL
FT                   VPGMAEAMRAANLLKTPHAMLSRAVVGIRGATLVINLPGSPTGAVENLSVLLGALPHAL
FT                   DKIQGDMSDCARPAGG"
FT   gene            complement(88847..89242)
FT                   /locus_tag="Sfum_0071"
FT   CDS_pept        complement(88847..89242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15774"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEC2"
FT                   /protein_id="ABK15774.1"
FT                   /translation="MKSVFEKVSDLVKQAGYFGLQNALVSVAWLKKLAKIRLRKFRKCS
FT                   ARKELDKAGARLGSEVYSLYKQGQTDWSDNAMVKQFLKVVEDAESGMFRFDEDVERIKE
FT                   GFQKRKQELVERYTLRRAQTGREDSED"
FT   gene            complement(89274..89750)
FT                   /locus_tag="Sfum_0072"
FT   CDS_pept        complement(89274..89750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0072"
FT                   /product="protein of unknown function DUF82"
FT                   /note="PFAM: protein of unknown function DUF82; KEGG:
FT                   mbo:Mb0594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15775"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEC3"
FT                   /protein_id="ABK15775.1"
FT                   /translation="MSERPSPEKRFVVDIMLGKVAKWLRILGFDARCLRVDSSAQVTRF
FT                   REEGRIIVTRRRQWCGSTGVFCLTSNDPSEQLKELIAAVPIRLEELRPLRRCILCNLDL
FT                   EVLPRDRVFGRVPDFVFETNECFHHCPGCGRIYWPGTHLVRMVERMRRELNWSG"
FT   gene            complement(89747..90532)
FT                   /locus_tag="Sfum_0073"
FT   CDS_pept        complement(89747..90532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15776"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEC4"
FT                   /protein_id="ABK15776.1"
FT                   /translation="MKTSRFHAVLLGLIMLCCLSCGKPKPPEVLPRPVSFDENLGKLEA
FT                   RAAHWRSYQAKLRIRLEGAKGKMRFQAIVLAVLPDQLRLEAFNLVGQTVALFTMNNGKP
FT                   ALSIPSEKMIFTAERPETLIEYFFGMPLPAGVFAYDLAAVVPPEQLDKLSPRREAPGWK
FT                   ADFSPEGSDASFLWEFEDNPPALKSLAARDGLWDRRITYDPAVELEPQNAPRKLRLESA
FT                   QWRMEITVEQIMPTSGFDASVFVPPVQEGVRTVDLDSIK"
FT   sig_peptide     complement(90464..90532)
FT                   /locus_tag="Sfum_0073"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.952 at
FT                   residue 23"
FT   gene            complement(90604..92307)
FT                   /locus_tag="Sfum_0074"
FT   CDS_pept        complement(90604..92307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0074"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: sat:SYN_00192
FT                   tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15777"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEC5"
FT                   /protein_id="ABK15777.1"
FT                   /translation="MILRYLLIIAVLSVCSCTQLKPYAATSSTPKAPAARSESGSRADL
FT                   YFEYLLAQYYVSVKEIDKAIEAYHEALKKDPRSPMLLTELAALLIRQGKIEQALKLTED
FT                   ATSFDRTYEPAYMLLGQLYAGIGQNARAIDAYSRAIEINPSNEDAHLLLGALYAQEKKY
FT                   DEAMEAFDHLKALLPDNPVALYYKARVFLDMKLYKQAEKIYLDVLAIEPAFENASLDLA
FT                   YVYEVTERLKDAEQTYLQILSANPANVNARTRLGNLYMRQDRPAEALRHFSHLLKLNRK
FT                   DVESRLKVGIIHLQQKDYEEAIKDFTYLLKDEPQYDQALYYLASTYAEKQDFEQAIRNF
FT                   RLIARSSPLWPMAQTRLALIFSKQKDFQNGAAVLKEAIDAQPEVADLYLYLGIIYEEAK
FT                   QYEDGVAAVDRGLVKTPRDTDLLFRKGVILDKMSRRDDAIAVMKRILEIEPQNANALNY
FT                   IGYTYAEMGINLNEARQMIKAALATAPDDGYIMDSLAWVYYKLGQHKKALETILEALKR
FT                   VPQDPVIHEHLGDIYLSLGKKNEAIEAYEKALEYSHTEPEKIREKLDRLK"
FT   sig_peptide     complement(92233..92307)
FT                   /locus_tag="Sfum_0074"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.937 at
FT                   residue 25"
FT   gene            92497..93741
FT                   /locus_tag="Sfum_0075"
FT   CDS_pept        92497..93741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0075"
FT                   /product="protein of unknown function DUF52"
FT                   /note="PFAM: protein of unknown function DUF52; KEGG:
FT                   aae:aq_1336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15778"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEC6"
FT                   /protein_id="ABK15778.1"
FT                   /translation="MTMEHPKLRYGLEALPMQHEGQNMILLRDRMGHSSDSLLLSPVVA
FT                   ELVIRMDGTNSFRDLQALFLRMTGEMLYTETLDEIVQKLDQNLFLENARFIDHVARQVA
FT                   RYRDDPVRRMRHAGQSYPSDAELLNRRLEGFFSAEDGGPGLPGAARDNRPVLGLVAPHI
FT                   DIQAGGRCFAHAYKAAADSVSPRTWIVLGTGHELVSNYFALTAKDFETPLGLVGHDEEC
FT                   CAHLVNSAKRDILAGEYNHVREHTVEFQAVFLAYVQPGAKIVPLLCSFSHEDLETDGEY
FT                   IDHFAGLLRDLVLTRSVGILASVDLAHIGPRYGDRFQPTDSTVKDHMASDRGLVESLRE
FT                   CDAEAFIRQIRLEGNRRKICGVAPLYVLAQALSGLAQGRLLDHAHVRVDPYGSFVTFAS
FT                   MIFHGTQASPGSDSE"
FT   gene            complement(93794..94720)
FT                   /locus_tag="Sfum_0076"
FT   CDS_pept        complement(93794..94720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0076"
FT                   /product="tRNA synthetase, class II (D, K and N)"
FT                   /note="PFAM: tRNA synthetase, class II (D, K and N); KEGG:
FT                   gme:Gmet_1839 tRNA synthetase, class II (D, K and N)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15779"
FT                   /db_xref="GOA:A0LEC7"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEC7"
FT                   /protein_id="ABK15779.1"
FT                   /translation="MPERNILSAKRDALELRSRVIERIRSHFRRAGFLEVQTPLLTPAP
FT                   APELNIEAVPAGDGFFLATSPELYMKRLLAAGYGKLFQLTPVFRSGERGRLHHPEFTLL
FT                   EWYRTGASYKDMQRDCVELLHEVCAFGAATGGGTCRGSVIEPGKPWESLTVRDAFLRLA
FT                   GWDPVVDFDPDRFDVDLVTKVEPYLGFPNPCFLEDYPPERAALARLKDSAPPVAERFEL
FT                   YWAGIELANGFTELTDPAEQRKRFEAVLADRHEAGLSSRPMPEAFLAAIEHLPQCAGIA
FT                   LGLDRLVMLLAGADSVDRVVAFPPDLL"
FT   gene            complement(94725..95297)
FT                   /locus_tag="Sfum_0077"
FT   CDS_pept        complement(94725..95297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0077"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /note="TIGRFAM: translation elongation factor P; PFAM:
FT                   Elongation factor P/YeiP protein; Elongation factor, KOW
FT                   domain protein; KEGG: sat:SYN_00183 protein translation
FT                   elongation factor P (EF-P)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15780"
FT                   /db_xref="GOA:A0LEC8"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEC8"
FT                   /protein_id="ABK15780.1"
FT                   /translation="MGVTLTAGDLRKGLKLEMDGEPYIIVDFEFSKPGKGQALYRCRLK
FT                   NMITGSQFDRTYRSGDKFQSADLEEQDMQFLYKQGDSYHFMNTTSYEQIEMSAAQVGDA
FT                   TNYLIENLVVSMLMFQGRPIGISLPNFVELKVIRSDPGIKGDTAAGATKPATMETGFII
FT                   QVPLFIEEGETLKIDTRNGSYVERVKV"
FT   gene            95481..96761
FT                   /locus_tag="Sfum_0078"
FT   CDS_pept        95481..96761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0078"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="PFAM: enolase; KEGG: gsu:GSU2286 enolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15781"
FT                   /db_xref="GOA:A0LEC9"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEC9"
FT                   /protein_id="ABK15781.1"
FT                   /translation="MSEILSVKAREILDSRGNPTVEAEVILDSGYSGTAAVPSGASTGS
FT                   REALELRDGDPARYLGKGVLQAVQNVNDEIAPKVIGMDGRDQVGLDSFLIELDGTENKG
FT                   RLGANAILSVSMAAAKAAAAECELPLYRYLGGAMASLLPVPMMNVINGGAHADNNVDIQ
FT                   EFMIVPAGAPTFGEALRMGAETFHNLKKVLKSKGLNTAVGDEGGFAPNLSSNEEAMEVL
FT                   MQAIEAAGYRPGEDIYIAIDAAASEFYKDGSYHMSAEQSPTKSAEEMIAFYEAWAGRYP
FT                   LICIEDGMAEGDWGGWQALTRKLGYNVQLVGDDVFVTNTSIIAKGIADGVANSVLIKLN
FT                   QIGTVTETLQAINMAFKAGYTVVISHRSGETEDTTIADLAVATNAGQIKTGSLSRSERI
FT                   AKYNQLLRIEEELGASGCYAGMSAFRV"
FT   gene            97015..97089
FT                   /locus_tag="Sfum_R0002"
FT                   /note="tRNA-Cys1"
FT   tRNA            97015..97089
FT                   /locus_tag="Sfum_R0002"
FT                   /product="tRNA-Cys"
FT   gene            97253..98035
FT                   /locus_tag="Sfum_0079"
FT   CDS_pept        97253..98035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0079"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224,
FT                   cysteine-rich region domain protein; KEGG: rxy:Rxyl_2995
FT                   protein of unknown function DUF224, cysteine-rich region"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15782"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:A0LED0"
FT                   /protein_id="ABK15782.1"
FT                   /translation="MNGRKEATLFVPCIIDGMYPEVGEAMVEVLRRLGVELCYPAGQTC
FT                   CGQPAFKAGYRKEAVVAARHFIRTFESAGTVVCPSGSCVAMVRHRYPELFRDDPGWLEK
FT                   ARAVGGRVFELTEYLVDVLGIEDVGARYRGKVTYHDSCDLLRGLGVREQPRKLIGRVRD
FT                   VEFVEMKDSERCCGFGGVFSFKYGDISTAILKDKVRNILDSGADTVVGCDMGCLMNIQG
FT                   ILSRTRHPVRAMHIAQLLAGSSDALPSPARRVPHPPCR"
FT   gene            98054..99481
FT                   /locus_tag="Sfum_0080"
FT   CDS_pept        98054..99481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0080"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /note="TIGRFAM: iron-sulfur cluster binding protein; KEGG:
FT                   bat:BAS3036 iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15783"
FT                   /db_xref="GOA:A0LED1"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0LED1"
FT                   /protein_id="ABK15783.1"
FT                   /translation="MTRIRTELFRQEAGKALNNRHLQEALSDFQERISKATATAFSSLS
FT                   DAEGLRLEARRARMRAIENLDVLLDRLADKILNRGGRVFFARDAREAVEYCLETARRLG
FT                   VKKVVKGKSMVAEEIGLNEALQEADIQVCETDVGEFIVQLAGEPPSHIIAPAVHKTKVE
FT                   VGRLFSEKLGIPYTDDPVALTRAARNALRQRFLEADMGISGCNLACAETGHITTVSNEG
FT                   NIRMASTLPRVHIAIMGMERIAARLEDHDVLLRLLCMGAAGQRLAGYVSYLGGPRQPDQ
FT                   EDGPDEFHLVVLDNGRSRILADEDFREILCCIRCAACLNVCPVYGKIGGHAYGHVYCGP
FT                   VGSVLTPLLVGVNRAKDLCLGETLCGACRDACPLHIDIPGMLLRLRSKLADGDDGWGVK
FT                   RERPAEKLFFTLWAGLVRSPGLYALALTAAAFLQRLPPGAKDTITRLPYPFHEWTQSRD
FT                   IKRLDGRAFRKRWKELR"
FT   gene            99875..100303
FT                   /locus_tag="Sfum_0081"
FT   CDS_pept        99875..100303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0081"
FT                   /product="protein of unknown function DUF162"
FT                   /note="PFAM: protein of unknown function DUF162; KEGG:
FT                   dvu:DVU1781 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15784"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0LED2"
FT                   /protein_id="ABK15784.1"
FT                   /translation="MFTAGLCAPGLEGMPAEESLEHIRKNVVESCIGVTAADYCVADTA
FT                   TLVMKTRPGQPRMLSLVPSVHIAVITLDQILADLRELYAFLRWEAREREDEGLTNCLTM
FT                   VTGPSKTADIELSMVHGAHGPRELHIVVIIGPAASTAN"
FT   gene            complement(100272..100793)
FT                   /locus_tag="Sfum_0082"
FT   CDS_pept        complement(100272..100793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15785"
FT                   /db_xref="UniProtKB/TrEMBL:A0LED3"
FT                   /protein_id="ABK15785.1"
FT                   /translation="MRYRQAAVELDDTSFRSTGHRSHAAVRIREKRRIERAARASAFTR
FT                   TLRFALVSPRLRNGRDCLYSRAQKTIPDGFTLAGTEMKTSFEDGERGARNPGTGMDPVF
FT                   GSSAPTKCRVPVDIPSELHGPLFYPLSRTERPSGRGRREPRAWSLPAKARDVFREARRA
FT                   LSSLLKQRGR"
FT   gene            complement(100769..101329)
FT                   /locus_tag="Sfum_0083"
FT   CDS_pept        complement(100769..101329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15786"
FT                   /db_xref="InterPro:IPR024520"
FT                   /db_xref="UniProtKB/TrEMBL:A0LED4"
FT                   /protein_id="ABK15786.1"
FT                   /translation="MQTPRTLTVLLALTVFLVCSPGCGQSSSSDKPQKPAAASTTLSNH
FT                   PTPSPAGKASASVNRRVDLASLKPCGILSREEVESVFGTVRGEPREDVSISGEKGCTYR
FT                   NLKGNFADIVVYEPEKWKLQKVVRKNVNPAEGMGDEAFWARVDNTVELWVLLRDRAVVE
FT                   VRVSTKDLEQARKLAQCVIDKLP"
FT   sig_peptide     complement(101243..101329)
FT                   /locus_tag="Sfum_0083"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.627 at
FT                   residue 29"
FT   gene            101883..102251
FT                   /locus_tag="Sfum_0084"
FT   CDS_pept        101883..102251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0084"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="PFAM: RNP-1 like RNA-binding protein; KEGG:
FT                   rba:RB10458 RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15787"
FT                   /db_xref="GOA:A0LED5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A0LED5"
FT                   /protein_id="ABK15787.1"
FT                   /translation="MSMKLYVGNLSFQTSSEQLRELFSQVGTVESATVVEDRESGRSRG
FT                   FGFVEMSTKEEGQKAIAELNGKDFNGRPLTVNEAKQREDRGRGGPRGGSGGGRGGYGGG
FT                   GGRGGGFGGGGGGRKKGW"
FT   gene            complement(103403..103651)
FT                   /locus_tag="Sfum_0085"
FT   CDS_pept        complement(103403..103651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15788"
FT                   /db_xref="UniProtKB/TrEMBL:A0LED6"
FT                   /protein_id="ABK15788.1"
FT                   /translation="MRRVMLLTVPDAPDRNPGRSPGNGLFLPIPPCASMMPMTHLLRRE
FT                   PDARAVRLIQAVFCAGIIHVAVRKSDRMDGVSIIAIL"
FT   gene            104087..105943
FT                   /locus_tag="Sfum_0086"
FT   CDS_pept        104087..105943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0086"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mca:MCA0894 ABC transporter, ATP-binding/permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15789"
FT                   /db_xref="GOA:A0LED7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0LED7"
FT                   /protein_id="ABK15789.1"
FT                   /translation="MVCRSNHKLAAKFRKAAAQLPNLVRAVFMVWEATRGWTLAWGLLV
FT                   VLQGLLPVANVWLLKVLVDGLAAAVGSGQPAPRFRSLLLVIVAMAAVTLVADALRSLTI
FT                   WIRTAQSGLFQDHLKHLIQQKSMELDLAFYESAEFFDRLYRAQFEAGYRPMILLENLGS
FT                   LAQNGITLVAMAAVLLQFGPWLPLILIVSTLPAFCVVLRQNLREHELWLRTTVDERKSR
FT                   YYDWVMTSRETAAELRVFELGSHFSALFRTLREALRRDRLALTRNRALADLGARIVGLL
FT                   ITGAAMAWMVWRVLLGAITLGDLALFYQAFNQGKQMMGGLLENVGQIYSNSLFLENLFE
FT                   FFRLEPGIREPERPVSAPAPLREGIRFRHVAFRYPASEKWALGDFSLTVPAGKMVALVG
FT                   PNGAGKSTVIKLLCRLYDPEAGQVELDGVDLRSIPLRELQDNITILFQEPVKYSAMVHE
FT                   NIGYGELGKMKDSAAVEVAARRAGADGFIERFPDRYDTLLGKWFEGGIDLSAGEWQRIA
FT                   LARAFLRQSPILILDEPTSSMDSWAEADWLGRLRGLAQGRTAILITHRFTTAMRADMIH
FT                   VMENGGIVESGTHEELLRQGGRYAESWRRQMRNLDRDSTPEP"
FT   gene            106093..107361
FT                   /locus_tag="Sfum_0087"
FT   CDS_pept        106093..107361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15790"
FT                   /db_xref="InterPro:IPR039498"
FT                   /db_xref="UniProtKB/TrEMBL:A0LED8"
FT                   /protein_id="ABK15790.1"
FT                   /translation="MKAREPDTIAGIPLTPESGLILRCVRHYSGRDERTRIARQLQGRL
FT                   DWDALLRLAEAHKILPILHAVLKESHWREVPESVLETMKRKHAANFAGNLLLSYELIRI
FT                   LEALGSRGIRCLVFKGPTLAVAAYGSIAMRRFQDLDLLVRRNDFLKTKDLLREIGYQPA
FT                   LRLPEAYEKHFYLTRSEHHFVRNDGKATVDLHWGLSPPCFSFFQDLDRLWPRSVTVAIE
FT                   GATVRAPGMEDLLLFLCRHGAKHRWEGLSLISDVAVLIAAHRAMDWPGVLARAKRTNST
FT                   VMLALGLRLAAELAGAEVPENIGDWMRADRKGEVLAGKVIRSLFSSEERPTVDVADRLN
FT                   LFHMRTMSRFTDRLHEIVLNLFTPTSIELSLIRLPARLYFLYYPCRLLRLAVRSVLNKA
FT                   LRTPRRQTPDRTGARRTSGSDKP"
FT   gene            complement(107499..109076)
FT                   /locus_tag="Sfum_0088"
FT   CDS_pept        complement(107499..109076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bms:BR0725 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15791"
FT                   /db_xref="UniProtKB/TrEMBL:A0LED9"
FT                   /protein_id="ABK15791.1"
FT                   /translation="MTPGTSKLSPDANQSMDRESRALKFLIDTNSLPSPERAAPGDATT
FT                   PAAALNRLAGQLTHRLYVHPAACIDTSASKPSFKLHQHPNLPGKCLLLPTPPQVPPPFE
FT                   TVFGPAPSGTEEWLGHRLLAALAADAVDFLISADGDLYRKARRLGLERRVLTIAEAVAL
FT                   ITDLSERPSSPFPIVEEVKAETLSPDDPIFDGIPDGGAVVLGSDEDSRSAWVIRDDRRN
FT                   VTGLCIAGLDRLPPPLLSGKVLKVWFCRLCAQSNSSRSGELLLRALFDHGARHRYDWAH
FT                   CRVPRGREALVQLLEDFGFGRLSGQDSSEELVLAKPLHPMQDEIGVPHPLAFHIRFGPT
FT                   HFRMEDVDYYLVPISPDLSQQLFPECESQRALFRNKRPFGNPIRKAYVSRSPVLNVAPG
FT                   SVLLFYRTGDQRGLVASGVVEETIPSQTTRDAIRALGMRTVYTSGELDELCVRPVSVLL
FT                   FRQALAFRPEIPLAKLIDHKVFKQVPQSIAKLDGEGLAWLRGFLAGFQSAPSSTQAAQI
FT                   HPLPSPAS"
FT   gene            complement(109721..110014)
FT                   /locus_tag="Sfum_0089"
FT   CDS_pept        complement(109721..110014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15792"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEE0"
FT                   /protein_id="ABK15792.1"
FT                   /translation="MNNARQRQKRRNRNRRVRKIAVRSWSALLKRAPGKGLRPTGKDRP
FT                   VEELKDDGCRVGLRAGPDRLPSHLGILLGYEKTRDIDHPGFFMRPELRPMFQ"
FT   gene            110252..111904
FT                   /locus_tag="Sfum_0090"
FT   CDS_pept        110252..111904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0090"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: dvu:DVU3144 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15793"
FT                   /db_xref="GOA:A0LEE1"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR024673"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEE1"
FT                   /protein_id="ABK15793.1"
FT                   /translation="MNAWSVCGRWLAGAALAAVFFSSVPGWAQIKVLDENQAPGRAMAQ
FT                   QATKGREIWITADHSLHPILKKEFKSGPEVTESCLSCHELAAGQFQKTIHWTWLDPNVD
FT                   PKLRVGKGGLSMNNFCINIQSNEPRCTSCHAGYGWKDKTFDFSNAHSVDCLACHEQTGT
FT                   YHKFPTGAGNPVSEPTVFKEDGKTYMPPEWNKVAQSVGRPTRQNCGTCHFFGGGGDGVK
FT                   HGDMDSSLMKPNKELDVHMGTDGQNFDCVRCHTTRVHHIAGRIYSTPAAKGRKSLIEDD
FT                   LTPKIMCESCHSRTPHKPGVKANAHTDKVACQSCHISTYARVNPTTMWWDWSKAGQMKE
FT                   GKPYKELDEFGKPGYDTKKGEFKWARNVVPEYYWFNGSLTTLTARDTIDPSGVVAVGWP
FT                   NGDKNDANARIFPFKVHRGRQPYDKVNKTLVIPRLFGKEGTGAYWADYDWDKSAAAGMA
FT                   YAGLPFSGELGFVDSTYVFPITHMVAPKDKAVQCQECHSKNGRLRNLGGFYMPGRDVNK
FT                   PIQVMGWILVLGSLAGVFFHGLGRMVARGKKED"
FT   sig_peptide     110252..110338
FT                   /locus_tag="Sfum_0090"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.996 at
FT                   residue 29"
FT   gene            111908..112576
FT                   /locus_tag="Sfum_0091"
FT   CDS_pept        111908..112576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0091"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: dvu:DVU3145
FT                   hydrogenase, b-type cytochrome subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15794"
FT                   /db_xref="GOA:A0LEE2"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEE2"
FT                   /protein_id="ABK15794.1"
FT                   /translation="MTQTEMVNVYLYTRYERFWHWLQTTLIVLLLMTGFEINGLFRLFG
FT                   FKLATEIHEYAGLSWLIAFAFFVFWLFTTGEWRQYIPTTRKMLTVIRYYTYGIFRGEAH
FT                   PVPKRKDAKHNPLQRLVYLSLAAILLPIQMITGFLYWGYNSWPDWGLNWLSLEVVASIH
FT                   LAGAFGVLSFLIVHLYMITTGHTLFAHTRAMITGWEQVAEGTPIDDWERKDRGKSAECS
FT                   "
FT   gene            complement(112749..114035)
FT                   /locus_tag="Sfum_0092"
FT   CDS_pept        complement(112749..114035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0092"
FT                   /product="chromate transporter, chromate ion transporter
FT                   (CHR) family"
FT                   /note="TIGRFAM: chromate transporter, chromate ion
FT                   transporter (CHR) family; PFAM: Chromate transporter; KEGG:
FT                   jan:Jann_1226 chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15795"
FT                   /db_xref="GOA:A0LEE3"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEE3"
FT                   /protein_id="ABK15795.1"
FT                   /translation="MPVASSNEIPCICTGYGDALASLTNARKPFMQNHTPEIIAESYPA
FT                   LFWRFLRFGLLAWGGPIAQIAMIRQELVEEEKWVSPERFNRVLGLYQALPGPEAHELCV
FT                   YFGMVNRGRFGGFLAGLGFMLPGFVLMFLLSWFYLSYGMAIPRFQAVFLGLQAAVGALI
FT                   VRAIHRIGGHSLTNAYLWGIAAMAVLAEVLGTPFLLTLTVGGAAYLLIKEERRTWFYLV
FT                   SALFVAGVILAWKVQGSGVLHNINQPPTGAIHAASLPGLFVSGLRSGMLTFGGAYTVIA
FT                   FLQHDAVAVQAWMTNAQFLDGLALSGTLPAPLIIFATFVGFVAGGGLGALIMTTAIFLP
FT                   AFGFTLIGHSTLERVIQNERLHAFLDGITAAVVGLMAVTTLNLLRAGIGDWRALGIFAL
FT                   ALAVLALWRAKLAIAVVMVAAGAVGVALF"
FT   gene            complement(114050..114370)
FT                   /locus_tag="Sfum_0093"
FT   CDS_pept        complement(114050..114370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0093"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: tbd:Tbd_2657
FT                   rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15796"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEE4"
FT                   /protein_id="ABK15796.1"
FT                   /translation="MKCSVDPEELKRALADAPDETVVIDVRRKTDFETDPRLIPGAQWK
FT                   DPEQVDDWSRELPRDKTVIVYCVRGGPVSRPVSAKPAENQVRVKYLEGGLAGWDLSAKE
FT                   DR"
FT   gene            complement(114367..115656)
FT                   /locus_tag="Sfum_0094"
FT   CDS_pept        complement(114367..115656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0094"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dvu:DVUA0096 major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15797"
FT                   /db_xref="GOA:A0LEE5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEE5"
FT                   /protein_id="ABK15797.1"
FT                   /translation="MDVEPATESKTMNPFSQLFGLCAVGFFARLSYALARSPVLPLFAL
FT                   YLGAAPEIIGWVVGISTVTGIFFKLPSGALSDVIGRRKTMLVGLVVFALTPFAYFWVKD
FT                   AALLLIVRFVHGFATAVYGPVAMAVVADVAGCRKGEMLSWFSSVTIAGSLLGAPLGGFL
FT                   LFTLARSGSPSLEHFHWVYLASGAFGCVALILGGKLLAGGDETVTQVGLKASLAQFGAG
FT                   IREVVSDRRVVLTSSMEGLQNMTMGALEAFLPIYAVKVAGLNEFQAGLLWGAQVLVTIV
FT                   SKPLMGRLSDRYGRKPAIVIGMLACAVAFAAIPLLTRFELLILASLLFGLGEAFVTSSS
FT                   AALVADLCQERHFGTAMGTFGTIFDVGHASGPILAGVLIASWGYLPAFSIMSAALVVAL
FT                   PVFILGVKVESRTSMVTSRVWRRRHRKGLP"
FT   gene            complement(115679..116020)
FT                   /locus_tag="Sfum_0095"
FT   CDS_pept        complement(115679..116020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15798"
FT                   /db_xref="GOA:A0LEE6"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR019224"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEE6"
FT                   /protein_id="ABK15798.1"
FT                   /translation="MVGLKKFQAAGCHCGACGFPTCAELNKERQPGEKDREYTGPHCVM
FT                   RMMDIGAALASAAKTVVLLNIDNRVRQRFGAVARALGLIDAEMVMGVQVSITGKIIGYD
FT                   GKVPAVKGR"
FT   gene            116446..116916
FT                   /locus_tag="Sfum_0096"
FT   CDS_pept        116446..116916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0096"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_0965 ChrB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15799"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEE7"
FT                   /protein_id="ABK15799.1"
FT                   /translation="MDWIMLITKLPRARTTAVKVALWRKLKRLGVYTLQDSVYVLPRSD
FT                   RTLELLEWVAAELREGGGEASVWEVMARTETQEREMREFFLEQANAQYRKILEDARKGL
FT                   DLERLQQLWSQFHKVKTQDYLKSPLAMEVRAACERRAQEISEAREMQKRRDS"
FT   gene            116913..117332
FT                   /locus_tag="Sfum_0097"
FT   CDS_pept        116913..117332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15800"
FT                   /db_xref="InterPro:IPR018634"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEE8"
FT                   /protein_id="ABK15800.1"
FT                   /translation="MKWITWSGVGVDRIACAWLIRRMVDRDAEFIFIPRGSDWKQLDGI
FT                   AFDIPGANLSHRRGRCTFCTVLKEYSISDRTMDQICAIVDAADSVNDLLPPPEAAGIDV
FT                   ICRGLIKVLKHDVKALEVGAILFEALYVQLAEEFQ"
FT   gene            complement(117774..117850)
FT                   /locus_tag="Sfum_R0003"
FT                   /note="tRNA-Asp1"
FT   tRNA            complement(117774..117850)
FT                   /locus_tag="Sfum_R0003"
FT                   /product="tRNA-Asp"
FT   gene            complement(117864..117939)
FT                   /locus_tag="Sfum_R0004"
FT                   /note="tRNA-Val3"
FT   tRNA            complement(117864..117939)
FT                   /locus_tag="Sfum_R0004"
FT                   /product="tRNA-Val"
FT   gene            complement(118044..120491)
FT                   /locus_tag="Sfum_0098"
FT   CDS_pept        complement(118044..120491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0098"
FT                   /product="Lon-A peptidase. Serine peptidase. MEROPS family
FT                   S16"
FT                   /note="KEGG: ade:Adeh_3350 ATP-dependent protease La;
FT                   TIGRFAM: ATP-dependent protease La; PFAM: peptidase S16,
FT                   lon domain protein; AAA ATPase, central domain protein;
FT                   ATPase associated with various cellular activities, AAA_5;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15801"
FT                   /db_xref="GOA:A0LEE9"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEE9"
FT                   /protein_id="ABK15801.1"
FT                   /translation="MFKLTRNKDEQSGSATFAMPLLPLRDIVVFPSMVVPLFVGRDKSV
FT                   NALDKAMATDKKIFLAAQTKAKTDTPGESDIYRVGTVANILQILRLPDGTVKVLVEGDF
FT                   RARISSFIPHPDHFFVSLEGLEESEDESVEIEALRRGVRAAFDAYSKHNKKINQEILDA
FT                   VAAIDNASRLADTIAAYMPFKLDVKQKLLETLGVAKRLEKLFGQIRSEIEILQTEERIK
FT                   GRVKKQMEKTQREYYLNEQMRAIQKEMGEKDDFKSELEELEKRIKRKKLSQEAAAKVRA
FT                   EFKKLKLMSPMSAEATVVRNYIDWILSLPWYEKTRDKLDIDESIRILDEDHYGLEKPKE
FT                   RIIEYLAVQALVKRIKGPILCFVGPPGVGKTSLAKSIARAMNRNFIRLSLGGVRDEAEI
FT                   RGHRRTYIGAMPGKIIQSLKKVKSNNPVFCLDEVDKMSMDFRGDPSAALLEVLDPEQNF
FT                   SFNDHYLDLDYDLSEVFFITTANNLHSIPPPLRDRMEIIQIAGYTEFDKLNIGRNFLVA
FT                   KQCKANGLSLDNIAFSDDMLLYIIRHYTKEAGVRNLEREIASICRKVAKEVVRRGPETR
FT                   IELTEDLVQEYLGIPKFRYGVAEEKDEIGLAVGLAWTEFGGDILGIETVVMPGKGKVQI
FT                   TGKLGDVMQESAQAALSYVRSRAKRLGIDPDFYQNFDIHVHVPEGAIPKDGPSAGITMA
FT                   TSIVSALARIPVRSDLAMTGEITLRGRVLPIGGLKEKILAAHRALLKTVLIPKDNAKDL
FT                   KDIPAKILEEIQVELVEHMDDVLRKAMVVPEDRELFHEEEAGAQQAVMFEQKPPAADEI
FT                   RAH"
FT   gene            complement(120691..121944)
FT                   /locus_tag="Sfum_0099"
FT   CDS_pept        complement(120691..121944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0099"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpX"
FT                   /EC_number="3.4.21.92"
FT                   /note="KEGG: gsu:GSU1791 ATP-dependent Clp protease,
FT                   ATP-binding subunit ClpX; TIGRFAM: ATP-dependent Clp
FT                   protease, ATP-binding subunit ClpX; PFAM: AAA ATPase,
FT                   central domain protein; zinc finger, C4 domain protein;
FT                   ATPase AAA-2 domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15802"
FT                   /db_xref="GOA:A0LEF0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEF0"
FT                   /protein_id="ABK15802.1"
FT                   /translation="MARKRDDRGGELRCSFCGKSQDEVKKLIAGPTVYICDECVELCND
FT                   IIAEEYEREEAARATQIPKPAEIKAILDQYVIGQDRAKKILSVAVHNHYKRIELKIDKN
FT                   DVELQKSNILMIGPTGSGKTLLAQTLARILNVPFTIADATTLTEAGYVGEDVENILVSL
FT                   IQAADYDIEKASRGIVYIDEIDKIAKKSDSPSITRDVSGEGVQQALLKILEGTVANVPP
FT                   KGGRKHPQQEFIKIDTTNILFICGGAFNYLETIIQSRVGVKGMGFGAEIRSKEDKSVGE
FT                   ILIKVQPEDLLKFGMIPEFVGRLPVIATLNELTEDELVSILTEPKNALVKQYKKLFELE
FT                   DVRLRFTEGVLRAIAKEAIRRKSGARGLRSIMENIMLDIMYDLPSHPEIQECIINEDVL
FT                   VKQAKPLLLYRNQSQESA"
FT   gene            complement(122508..123116)
FT                   /locus_tag="Sfum_0100"
FT   CDS_pept        complement(122508..123116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0100"
FT                   /product="ATP-dependent Clp protease proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="KEGG: mca:MCA0242 ATP-dependent Clp protease,
FT                   proteolytic subunit ClpP; TIGRFAM: ATP-dependent Clp
FT                   protease, proteolytic subunit ClpP; PFAM: peptidase S14,
FT                   ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15803"
FT                   /db_xref="GOA:A0LEF1"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEF1"
FT                   /protein_id="ABK15803.1"
FT                   /translation="MSLIPIVVEQSSRGERAFDIYSRLLRDRIIFLGTAITDEVANVII
FT                   AQLLFLESEDPDKDIHFYINSPGGLVTAGLAIYDTMQFIKPNVSTLCMGQAASMAAILL
FT                   AAGVKGKRYALPHVRIMLHQPMGGFQGQATDVEIQAKEILKLREELNDILVRHTGRPVE
FT                   QIQRDTDRDFYMSGEQAREYGMVDHIFTSRLSILPSATS"
FT   gene            complement(123131..124438)
FT                   /locus_tag="Sfum_0101"
FT   CDS_pept        complement(123131..124438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0101"
FT                   /product="trigger factor"
FT                   /note="TIGRFAM: trigger factor; PFAM: peptidylprolyl
FT                   isomerase, FKBP-type; trigger factor, C-terminal domain
FT                   protein; trigger factor, N-terminal domain; KEGG:
FT                   dps:DP2539 related to trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15804"
FT                   /db_xref="GOA:A0LEF2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEF2"
FT                   /protein_id="ABK15804.1"
FT                   /translation="MNVSVVDLSENQKKLQVEIPPEKVRQEIEGKYREMSRRIKIKGFR
FT                   PGKVPRSIIKSYYGKTIEQEVSSQFIQETFPEALKETDLKPLVEADVSETHFNDSGSFS
FT                   YTAIVDVCPPFELEGYRGLEIRKPSIDVADEQVDSELQRLREQHAELRTLETERPAREG
FT                   DVAVIDFTPSVDGKVFEKGKSADYMAEIGKKAVHPDFDANLIGRRAGETVSFEVDYPEN
FT                   APMREIAGKRVLFEVTVKEVKEKVLPELDDDFAQAVNSRFDALDALKQTIREELLKREE
FT                   YQARSDVQQQILDQLLSKVKIELSAKVIDREVDRMVGNLLHQFESQGLKMDVSKFNTPE
FT                   IRADYRPQAERNILRRLILEKIADQENLKLTDEEIEQVYQEVARYARMDVATVKHEFAD
FT                   SAVVEQSKESKIQEKVFRFLESEAVSGHISQEEKSE"
FT   gene            complement(124502..124588)
FT                   /locus_tag="Sfum_R0005"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(124502..124588)
FT                   /locus_tag="Sfum_R0005"
FT                   /product="tRNA-Leu"
FT   gene            complement(124691..125140)
FT                   /locus_tag="Sfum_0102"
FT   CDS_pept        complement(124691..125140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0102"
FT                   /product="general secretion pathway protein G"
FT                   /note="TIGRFAM: general secretion pathway protein G; PFAM:
FT                   type II secretion system protein G; KEGG: mfa:Mfla_1343
FT                   general secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15805"
FT                   /db_xref="GOA:A0LEF3"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEF3"
FT                   /protein_id="ABK15805.1"
FT                   /translation="MHGSQDTCHGGKNPRRSKAGFTLIELLIVMIILGLLAALVGPRLI
FT                   HKLGGSRQQAAKTQISMIGTALDAYRLDIGRYPTTEEGLGALRKNPGYKKWDGPYLSKE
FT                   LPDDPWGQAYLYRSPGEHGEYDLYSLGADAQEGGEAENADVVNWN"
FT   gene            complement(125280..126194)
FT                   /locus_tag="Sfum_0103"
FT   CDS_pept        complement(125280..126194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0103"
FT                   /product="conserved hypothetical radical SAM protein"
FT                   /note="KEGG: gme:Gmet_3163 hypothetical protein; TIGRFAM:
FT                   conserved hypothetical radical SAM protein; PFAM: Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15806"
FT                   /db_xref="GOA:A0LEF4"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEF4"
FT                   /protein_id="ABK15806.1"
FT                   /translation="MSEDLYRSYNSYLRDLFGCRVQKISLDAGLSCPNRDGTLGSSGCI
FT                   YCNERGSGTGAAEESSIGAQIREAKAILRRRYNAKRFIAYFQSFSNTYAPLPRLRELYA
FT                   EALEDPEVVGLSIGTRPDCVPDEVLDHLRALSAKHLIWLEYGLQSAKDSTLERINRRHS
FT                   VETFSDAVRRTRTRGLSVCAHVILGLPGETSEDMLNTARFIAGRDIQAVKIHSLYVIRG
FT                   TVLHGWHRAGKYVCPSREEYAATAGDFLSLLPPGMIVQRLTGDPHPSELVAPSWALEKR
FT                   KNIEAVHDHMRRHRLRQGSAFQG"
FT   gene            126498..128426
FT                   /locus_tag="Sfum_0104"
FT   CDS_pept        126498..128426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0104"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG: sat:SYN_01650
FT                   putative tRNA (5-carboxymethylaminomethyl-2-thiouridylate)
FT                   synthase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15807"
FT                   /db_xref="GOA:A0LEF5"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEF5"
FT                   /protein_id="ABK15807.1"
FT                   /translation="MNKYEVIVVGAGHAGCEAALAAARMGCRTLVLSICLDTVAHMPCS
FT                   PSVGGVGKGHLVREIDALGGRMALITDRTAIQFRLLNTKKGPAVWGTRTQNDKARYRIS
FT                   MKHCLESEPNLDLKQAHVESLAVEGNRIVGVIDQLGVFFGADAVVLATGTFLRGLVHIG
FT                   TTSVEAGRAGELASYPLANQLQRLGFTLGRMKTGTPARLGRRSIDFSRFREQHGDEAPK
FT                   PFSLFTDSIALPQVSCFIGKTHQRTHELVRRHIHLSPLYNGTIRGVSARYCPSLEDKVM
FT                   RFPDKDFHQIILEPEGLDTEEVYASGTGNSLPYDIQLRLIHSVPGLEEAEVMRPAYAIE
FT                   YDFVQPTQLKATLGSKLVEGLYMAGQINGTSGYEEAAGQGLWAGINAALKAQGRPPFIL
FT                   DRSEAYLAVMVDDLVTRGTNEPYRIFTSRAEYRLLLREDNADLRLLEKGCELGLHSADA
FT                   AKELRERRGAIRNELERLRLTHVRPSAQVNQTLAENHSPPLDAPAPLDKLLKRPELNYS
FT                   TVAILSPPPEPLSSKVTEQVEVECKYEGYLKRQEAEVAKFRQLEQAAIPEDLMYDDIPG
FT                   LSNELRQKLGAVRPLSLGQATRIPGMTPAAVSVLMVHLRRRAQGGPFLAPVLDPGVNMH
FT                   SQKKKLA"
FT   gene            128514..128957
FT                   /locus_tag="Sfum_0105"
FT   CDS_pept        128514..128957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0105"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: tte:TTE1767
FT                   Fe2+/Zn2+ uptake regulation proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15808"
FT                   /db_xref="GOA:A0LEF6"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEF6"
FT                   /protein_id="ABK15808.1"
FT                   /translation="MVMEGRNDKDFIATLRGHGLQVTYQRLAIYQALYHTKEHPSAEVI
FT                   YQQVKKRFPMISLGTVYKTLERFYEVGLIQKVSPVTEVARYDANTQPHHHMVCLECQSI
FT                   QDAEDIIPEQKFASVGKNGFRVLRQQVVLQGYCRGCRPDAAEN"
FT   gene            129310..130110
FT                   /locus_tag="Sfum_0106"
FT   CDS_pept        129310..130110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0106"
FT                   /product="electron transfer flavoprotein beta-subunit"
FT                   /note="PFAM: electron transfer flavoprotein beta-subunit;
FT                   KEGG: sat:SYN_02636 electron transfer flavoprotein
FT                   beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15809"
FT                   /db_xref="GOA:A0LEF7"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEF7"
FT                   /protein_id="ABK15809.1"
FT                   /translation="MAVNIVVILKQTPDTESVIRLAENKKSIVTRDLKWIINPYDEFAI
FT                   EAALRLKEKHGGKVTVVSYGPSRVVEALRTALAMGADDAVHLDDIALKSVDFLRVTRAL
FT                   TAAVKELNPDIILIGSRAVDYDQGQRGAIVAEHLGWPHLALAVSLESDGKTVTIERPIE
FT                   GGKVTLEAALPALVTVGGSHTIWNPRYASLPGIMKAKKKPLVVKKIADLGLDPALFKPE
FT                   TARIWITSLEMPPQRAPGRIIDGADAEDKARKLVTALHEEAKVI"
FT   gene            130130..131119
FT                   /locus_tag="Sfum_0107"
FT   CDS_pept        130130..131119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0107"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /note="PFAM: electron transfer flavoprotein beta-subunit;
FT                   electron transfer flavoprotein, alpha subunit; KEGG:
FT                   sat:SYN_02637 electron transfer flavoprotein alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15810"
FT                   /db_xref="GOA:A0LEF8"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEF8"
FT                   /protein_id="ABK15810.1"
FT                   /translation="MGKCVCMIAEFRGGNFRRVSFEVASEGKRIADALGIGLRGVAVGS
FT                   GVAGKAAELGQYGVERVLVRDDPALEHYLAEIYVPVVAEMIKKCDPAVVILPASVDGRD
FT                   LGARLGARLDITLVQDVTQVVCEGGKVKARWPIFGGKCFAWSEWADGTLPIMSCRPNVM
FT                   DCLPPDTSKRAEVELADIPIPESRSRVKAVDMDSSGKVELSEADIIVSGGRGMKEASNF
FT                   ALVEELAKAMGAAVGASRAAVDAGWRPHSDQVGQTGKVVTPALYVAVGISGAIQHLAGM
FT                   GYSRYIVAINKDPEAPIFSRADYGIVEDLFKFVPAFTEEVKRLKSTCS"
FT   gene            131216..132925
FT                   /locus_tag="Sfum_0108"
FT   CDS_pept        131216..132925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0108"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   chy:CHY_1731 long-chain-fatty-acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15811"
FT                   /db_xref="GOA:A0LEF9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEF9"
FT                   /protein_id="ABK15811.1"
FT                   /translation="MDRIWLKSYDPRVPHHAEYPEECLPRLLEARVKKLPGNSATEFYG
FT                   ARLTYEALWKQISSLANALRLLGLRHGDRVAVMLPNCPQTVITYYAVLWLGGVVVLTNP
FT                   LYVEREMEHQWKDSGAKYLVVLDHLYPKARKVIPETAIEKVIVTGIAECLPFLLKHLYP
FT                   LKAKLKKLFTAVPYDERTIFNFTRLIRSTEPTPPPCEVRLDDLALLQYTGGTTGIAKGV
FT                   MLSHRNILSNVIQLASWVQDLRFGEERFLALLPIFHVFGMTVAMNLPLYAGSALVLVPR
FT                   FDIDEIMKTIRKARPTLFPGVPTIYAAINGHPKAETFDLSSIRICVTGSAPMPVESLRR
FT                   FESLTGSVILEGYGLSETSPVTHANPVEGVRKPGSIGLALPDTDCKIVDLELGTRDMAV
FT                   GEVGELVIRGPQVMKAYWKMPEETANALRDGWLYTGDIARMDEDGYVYIIDRKKDMIIS
FT                   GGYNIYPREVDEVLYEHPKVLDAVAVGVPDDYRGEIVKAFIVPRVGETLTEDEIKQFCK
FT                   TRLAAYKVPRLIELRDSLPKTAVGKISRKELRKQALDEHESKKTREKADDGR"
FT   gene            132962..133678
FT                   /locus_tag="Sfum_0109"
FT   CDS_pept        132962..133678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cac:CAC1606 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15812"
FT                   /db_xref="InterPro:IPR007368"
FT                   /db_xref="InterPro:IPR041652"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEG0"
FT                   /protein_id="ABK15812.1"
FT                   /translation="MTDRFPGLHDERQWVLNQAAADFYLLQNRLYPRRAALEWVGNRYR
FT                   LTVRERELLNRGVFGQAEALARKAKRRCASALGGQCLVVDGHNVQITVESAVLGRPLLK
FT                   ANDGAVRDVAGQSARYRLSETSEVALDMIFQFLGIFRPGRVDFLFDAPMSHSGMLASAC
FT                   RRRLKSLGLDGDARAVPVPEREMTRAECIVAGSDRAVLDACSRWHDLAHEVIDLSCPCN
FT                   MFVDFSDLILAQSRRS"
FT   gene            133900..135246
FT                   /locus_tag="Sfum_0110"
FT   CDS_pept        133900..135246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0110"
FT                   /product="Uncharacterised conserved protein UCP033563"
FT                   /note="PFAM: Uncharacterised conserved protein UCP033563;
FT                   KEGG: pca:Pcar_2153 conserved hypothetical protein-putative
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15813"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEG1"
FT                   /protein_id="ABK15813.1"
FT                   /translation="MAEIAPFRGLRYSPKAAPDLAKVVIPPYDVISPAEQELFLHTSPY
FT                   NMVHLELGRSDRSDTPENNSHTRAGRTFEDWVRNGVLVREALPAVYYYELDYALSPGKE
FT                   ATRRGFICAMRLEDFRSGTVRPHEKTFQAVKDERLGLMLSCGANLSSVFSLYSDPESVV
FT                   DETLRSGREAAPAMAFVDRQGMSHRIWRVTDRGVLQRVAELMKGKAIFIADGHHRYETG
FT                   LNYRDLQRRRNPSAGPHAAFEYIMMYLSNLNQEGLTILPTHRLLRNLGSWDPESILKRA
FT                   EAFFEVKRFSSDVPGERMLCSELASRGDRKETAIGFFWDNVGSFFLLSARREPVSSYLA
FT                   GRGIPVETRGLDVVVLDQVVLRNLLGLSEEYLSSEHNIHFKHDLAESIGAVRSGDYEAA
FT                   FLINPTRIEQVQEVASAKLVMPHKSTYFYPKVGSGMVIRSLSPEEETVW"
FT   gene            135339..135974
FT                   /locus_tag="Sfum_0111"
FT   CDS_pept        135339..135974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0111"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: putative RNA methylase; methyltransferase
FT                   small; KEGG: sat:SYN_01006 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15814"
FT                   /db_xref="GOA:A0LEG2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEG2"
FT                   /protein_id="ABK15814.1"
FT                   /translation="MLLAGLVGVRPRERVVDLGTGCAVIPLIVAYRGQGRSVVGVELQP
FT                   ELVRLARKNVEVNGFVDSIRILEADFKEITSSFPPGTFDLVLSNPPYRRLASGRMNAVR
FT                   QKAVARHELAGSAEDVFRAASHLLVQGGRLALIYPASRVGLLFVLARRYGFNAKRFTVI
FT                   HSNASEPARLVYFECRKGGGEELLVTAPFFIYREDGGPTDAMRALYEA"
FT   gene            136032..136823
FT                   /locus_tag="Sfum_0112"
FT   CDS_pept        136032..136823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0112"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   tte:TTE2709 dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15815"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEG3"
FT                   /protein_id="ABK15815.1"
FT                   /translation="MDLGLRGKVAFIAGGSQGLGRAVSMEMAREGAKIAVCALDNPELP
FT                   KAVEEIRAATGAEIIGIPADLTDSAQASDFVRKGLEHYGTVDIMVTNAGGPPVKTFLEI
FT                   DDELWHYGFRLNLMSTIIMAREVIPTMMKKRWGRIVNMTSISVKQPLDGLILSNTVRSG
FT                   VIGLAKSLSNELAPYNITVNNVCPGYTMTERVRSLSVTVANAEGVRPEDIIKRWEATIP
FT                   MGRLGKPEEFAALVTFLASERAGYITGASVQIDGGFFKGVA"
FT   gene            136838..137836
FT                   /locus_tag="Sfum_0113"
FT   CDS_pept        136838..137836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0113"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="KEGG: sru:SRU_0042 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase III; TIGRFAM: 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III C terminal domain protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15816"
FT                   /db_xref="GOA:A0LEG4"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEG4"
FT                   /protein_id="ABK15816.1"
FT                   /translation="MPVRTAYIKSVGRFLPERRLTNKDLEKMVNTNDEWIMTRTGIRER
FT                   RILEPGLGNSHMAVRASRECLDRAGVDPMELDAIIVGTVTPDMLFPATACLVQNALGAK
FT                   NAWGYDLSAGCSGFLFSLTTGAQLIESGRNHKVLVIGSDVMSSILDYEDRNTCVLFGDG
FT                   AGAVLLEPCPEGGHGLIDFIHHIDGSGGPLLYMKAGGSLYPPSPETVRNKEHFVTQEGK
FT                   QVFKAAVTEMANVSAEILERNGLTGDDVALFIPHQANLRIIDACANRMGIDHDKVVINI
FT                   DRYANTTSGTLPLCLYDAVVEQERLKKGDYVVMSAFGAGFTWGSILLRWWR"
FT   gene            complement(138194..139078)
FT                   /locus_tag="Sfum_0114"
FT   CDS_pept        complement(138194..139078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0114"
FT                   /product="Pyruvate synthase"
FT                   /EC_number="1.2.7.1"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: sat:SYN_00691 pyruvate synthase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15817"
FT                   /db_xref="GOA:A0LEG5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEG5"
FT                   /protein_id="ABK15817.1"
FT                   /translation="MELPEVEYILPGTRTCAGCGLPIAYRHMLKALGPKMIMTHPACCL
FT                   TILHGIYPKTPVAINAVNNTFAGTAASASGLVAGLKATGRTDYTVVAMAGDGGTFDMGI
FT                   QALSGAAERETDFIYVCYDNEAYMNTGVQRSSATPSGAVTTTTPVIPKEQAKKDFIQIM
FT                   EAHDPAYLATMCSSYPADIYNKFLKAKAIKGTRFIHMAVPCPTGWSFPTKDTVKIGRLA
FT                   VESAVVVLYEVENGAFRLTGKSLSMARSGKKQPVNEYLEMQGRFKRISAEQLAEFQRQI
FT                   DVKWERFRKRAGF"
FT   gene            complement(139127..140335)
FT                   /locus_tag="Sfum_0115"
FT   CDS_pept        complement(139127..140335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0115"
FT                   /product="ketoisovalerate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.7"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: pab:PAB1472 ketoisovalerate
FT                   oxidoreductase subunit vorA"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15818"
FT                   /db_xref="GOA:A0LEG6"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEG6"
FT                   /protein_id="ABK15818.1"
FT                   /translation="MGQTLILTGTQAAALAAKLCRVQVIAAYPITPQSKIPEVLSEYVE
FT                   KGELQAEFVRVESEHSAMGVCISASLVGARVFTATAANGLAYMHEQLHWAAGARVPVVM
FT                   PVTNRGLGAPWTILNDMQDTIAQRDTGWMQFYCMNNQEVLDQVILAYKVAEQLMVPTMV
FT                   CFDGFRLSHTMMPVSIPAQSDVDKYLPPYEPLHSIDSGNPVNINPVVMTDPLRGPDGEL
FT                   CPSYMGFRFRLQETMESALPVIAEAGRSFAERFGRSYEDNLHRYRTEDAEFIFLTMGSL
FT                   ASEASDTVDILRERGVKAGVVGIRVFRPFPAASLVEATCRAKSVAVVEKAISYGYEGAL
FT                   ATELKAALFSRNGHRPVIYNYITGLGGKDVKPTDLLEVAQEIINGAAGNIPQEKPRWLG
FT                   YGV"
FT   gene            complement(140763..141047)
FT                   /locus_tag="Sfum_0116"
FT   CDS_pept        complement(140763..141047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0116"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sat:SYN_01726 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15819"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEG7"
FT                   /protein_id="ABK15819.1"
FT                   /translation="MICETVKTGAECAFMTKSGCGYNGGFCHPVVEQCEGCQRTSEWSN
FT                   GIYCTSYPNPAVKWRSSTCNFATHAKAEQQGLQQKINPLKASKRSNKKK"
FT   gene            141441..143156
FT                   /locus_tag="Sfum_0117"
FT   CDS_pept        141441..143156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0117"
FT                   /product="type IV-A pilus assembly ATPase PilB"
FT                   /note="TIGRFAM: type IV-A pilus assembly ATPase PilB; PFAM:
FT                   type II secretion system protein E; General secretory
FT                   system II, protein E domain protein; KEGG: gme:Gmet_1393
FT                   type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15820"
FT                   /db_xref="GOA:A0LEG8"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEG8"
FT                   /protein_id="ABK15820.1"
FT                   /translation="MAGKVRFVAKKIGELLLQEGLISKEQLDRALNEQHQTGERIGGVL
FT                   LKLGFVSEEMLTEFIAKQYSAPQVNIAKLTVPKDVLGLIPLDIAAKYQAVPFGVMGTTV
FT                   NVAMADPGNLFVIDDMRFLTRKNIQVHVASEPAIKKLLSQFYAPDDNFDDVLGMLKEDV
FT                   DVDVIETAEEMDLSFLEDAAEQAPVVKLVNLIMMDAIRKQASDIHLEPYEKLMRVRFRI
FT                   DGVLYEIMRPPLQLKNALISRIKIMARLDIAERRLPQDGRIKLKAKGREMDFRVSVLPT
FT                   LFGEKVVLRLLDKSGLQLDMTKLGFEELQYKHFREAIYQPFGMVLVTGPTGSGKTTTLY
FT                   SALSELNKLSHNISTAEDPVEYNMVGINQVQIHDAIGLNFANALRSFLRQDPDIIMVGE
FT                   VRDFETAEIAVKAALTGHLVLSTLHTNDAPSTINRLLNMGVESFLVSSAVNLVIAQRLV
FT                   RRVCLECREVEDVTHETLLDLGLREDELGTFECFRGRGCAVCNDTGYRGRVALYEVMPM
FT                   HEQIRELVLMGASAAEIKKESIRLGMITLRRSGINKLKAGITSVEEVIRSSAKD"
FT   gene            143223..144440
FT                   /locus_tag="Sfum_0118"
FT   CDS_pept        143223..144440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0118"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   sat:SYN_01284 general secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15821"
FT                   /db_xref="GOA:A0LEG9"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEG9"
FT                   /protein_id="ABK15821.1"
FT                   /translation="MPIYLWSGTDRAGKKQKGEIEADNLALARQMISRKNITIKNMRLK
FT                   PKDISEYIPALQGGVKEKELVIFVRQFSTMIDAGLPLVQCLEILQEQQENSTFKRIIKK
FT                   VKKDVEEGATLSDAIRKHPKVFDNLFVNLVAAGEVGGILDVILNRLAAYIEKVAKLKRR
FT                   VKGAMTYPAIVVTIALLVVAVILIYVIPVFAGLFREAGAKLPAMTLAVMNLSDFAQNYF
FT                   HWIILGLVLAYLGFRQFRKNDKGRELTDRLALRIPVFGGLLRKVAVARFTRTLGTMLAS
FT                   GVPILDGLDIVAATSGNMVIEKAIRVARNAISEGRPIAEPLSETKVFPMMVTQMIAVGE
FT                   ATGALDTMLGKIADFYDDEVDTAVDALTSLLEPMLIVFLGVTIGGLLVAMYLPIFQIAD
FT                   VVGRGA"
FT   gene            144442..146157
FT                   /locus_tag="Sfum_0119"
FT   CDS_pept        144442..146157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0119"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; PAS fold domain
FT                   protein; KEGG: gme:Gmet_1396 signal transduction histidine
FT                   kinase, nitrogen specific, NtrB"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15822"
FT                   /db_xref="GOA:A0LEH0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEH0"
FT                   /protein_id="ABK15822.1"
FT                   /translation="MQVDYDLEVNTINGELALRRKIQGLLLFRLLLAVFFLLLTIIVQS
FT                   RRDQDLLSAHLQPIYFFSCILFVFTIVGALSLGRIRNLKRFAYVQLFFDVGAVTVLIYL
FT                   SGGVESLFSFLYMPVIICAAVLLYRRGSLLTAAFSSVCYGTLLDLQYFGWLLPLHVVNQ
FT                   TAQARDSGSYFHSILMNIAVFYLVAFMSGYLAEELQKSSLKIVEQSKDLRRLEVLHRNI
FT                   VHSITSGLITIGPSGEILFCNNFAQDILGLRSEPVTGRRFSSIFPGLDPLTWPRVVGPG
FT                   PGHKKGPPERPEIVYRNPLGEELHLGYAVSVLQNETGKWAGWIFIFQDLTQFKAMEEHL
FT                   KRLERLVFAGRIAAEISHEIKNPLAAMSGAVQMLEDESIPDGSRARLMSIIHREIDRMN
FT                   SLVKDFLWLAKSTHGPENVENVPVCDLIQEILDLLSARNRVASEHVIKTAFAASPISRI
FT                   DPHHFRQIVWNLLVNALDAMPGGGHLTIAVGLHPSGDGSGRETRIDISDSGSGIPRDAR
FT                   TRIFEPFFTTKSQGTGLGLSIVYHLVEKANGRIEVTHHEEPCGTTFSLFFPLAS"
FT   gene            146297..146587
FT                   /locus_tag="Sfum_0120"
FT   CDS_pept        146297..146587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0120"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: sat:SYN_00062
FT                   co-chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15823"
FT                   /db_xref="GOA:A0LEH1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEH1"
FT                   /protein_id="ABK15823.1"
FT                   /translation="MNLRPLNDRVVVKRTEEEEKTAGGIIIPDTAKEKPIQGEVVAVGN
FT                   GKVMEDGSRRPLDVKAGDKVLFGKYAGTDIKVGGEELLIMREDDILAIIEK"
FT   gene            146644..148275
FT                   /locus_tag="Sfum_0121"
FT   CDS_pept        146644..148275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0121"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: sat:SYN_03223 chaperonin GroEL,
FT                   truncated"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15824"
FT                   /db_xref="GOA:A0LEH2"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEH2"
FT                   /protein_id="ABK15824.1"
FT                   /translation="MAKQLIYDVKAREALLSGVNILADAVKVTLGPKGRNVVIEKAFGG
FT                   PTVTKDGVTVAKEIELEDKFENMGAQMVKEVASKTSDVAGDGTTTATILAQSIYYEGSK
FT                   LVAAGANPMALKRGIEKAVQVVVDELKKISKPTKDQKEIAQVGTISANNDPTIGNIIAE
FT                   AMNKVGKEGVITVEEAKAMETTLEVVEGMQFDRGYISPYFVTDPEKMEVLLNEPLILIN
FT                   EKKISNMKDLLPVLEQIAKMGRPLLIIAEDVEGEALATLVVNKLRGTLHVCAVKAPGFG
FT                   DRRKAMLDDIAILTGGQVISEEKGIKLESVGLNDLGKAKTIRIDKDNTTIVDGAGDRKA
FT                   LEGRVRQIRTQIDETTSDYDREKLQERLAKMVGGVAVISVGAATETEMKEKKARVEDAL
FT                   NATRAAVEEGIVPGGGVAYLRCLGALGAVNLEGDEKLGLNIVKRALEEPARQIAMNAGE
FT                   EGSVIVQRVKSETGAFGFDAETSQFCDLIEAGVIDPTKVTRTALLNAASVSALMLTTEC
FT                   MVSEIPKEDKGAPAGMGGMPPGGGMY"
FT   gene            148642..151428
FT                   /locus_tag="Sfum_0122"
FT   CDS_pept        148642..151428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0122"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   gsu:GSU3136 isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15825"
FT                   /db_xref="GOA:A0LEH3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEH3"
FT                   /protein_id="ABK15825.1"
FT                   /translation="MDYKATLNLPQTDFPMKANLSRREPEILEKWEAMGLYDMLRERSR
FT                   GRPPYILHDGPPYANGHIHLGTALNKILKDMIVKSQQMSGKNAVYVPGWDCHGLPIEHQ
FT                   VDKELGKRKQTMSQVEIRRHCRKYAEKFIDIQRNEFRRLGVLGEWNNPYLTMSYDYEAS
FT                   IARELGRFFQEGGVIRSKKPIYWCTSCKTALAEAEVEYHDHTSPSIYVKFPMSAGGRAK
FT                   FPELAGKDVAVLIWTTTPWTLPANLAIAVHPDFTYVAADVGREVWILARGLLESCMESF
FT                   GIKDYRVLRTFEAGELRGLACSHPFVDRESVIVTGTHVTLEAGTGCVHTAPGHGREDYD
FT                   MALEYGLDVYSPVDDNGCFTDDVPLFAGRFVFDANRAINAKLEETGKLILEKSITHSYP
FT                   HCWRCKNPVIFRATEQWFISMEKNDLRGRALQWIDRVDWIPGWGRDRIHNMIANRPDWC
FT                   ISRQRSWGVPICVFTCRKCGTVLASKELFEKTAALFERNGADCWFEMTSEELLPPGATC
FT                   AGCGGQDFEKEEDILDVWFDSGVSHAAVLEARPDLRSPADLYLEGSDQHRGWFHSSLLT
FT                   AVGTRNAAPYKSVLTHGFVVDGQGYKMSKSLGNVIAPEEIIRQYGAEVLRLWVSAEDYR
FT                   DDVRISPDILKRLSEAYRRIRNTCRFLLGNLNDFDPEKDSVPYDRMDELDRFALHQLQE
FT                   FVRRVRQAYERFEFHRVYHAFHNYCVVDLSAFYLDILKDRLYTSGAAGPARRSAQTAVY
FT                   RILSALLRLMAPILSFTAEEAWWHLPHQSSETVHLEEFPAPDATWADEALNQRWQKILT
FT                   LRSDVTKALEGARQAKAIGHPLDAKVKLALPPDWIADFAGQEEMLRTVFIVSEVVLASG
FT                   EELAGAVEGTEVPGLLIRVEPASGEKCERCWMRSETVGQFSDHPALCGRCRNVVAAH"
FT   gene            151608..152069
FT                   /locus_tag="Sfum_0123"
FT   CDS_pept        151608..152069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0123"
FT                   /product="signal peptidase II. Aspartic peptidase. MEROPS
FT                   family A08"
FT                   /EC_number="3.4.23.36"
FT                   /note="TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   peptidase A8, signal peptidase II; KEGG: pca:Pcar_2454
FT                   lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15826"
FT                   /db_xref="GOA:A0LEH4"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEH4"
FT                   /protein_id="ABK15826.1"
FT                   /translation="MVFLVAVAGTIILLDQLTKLLILYYVPVNTGHVVIPGFFNLIHVR
FT                   NTGGAFSMLAGADATWRLPFFVAMTLIVVGIIVWAYRKIDRRELWTRTAYALICGGALG
FT                   NLSDRLRFGEVVDFLEFHIGTYSWPAFNVGDSAISAGAVMLIIALLRGK"
FT   gene            complement(152137..152931)
FT                   /locus_tag="Sfum_0124"
FT   CDS_pept        complement(152137..152931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0124"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lma:LmjF35.0290 hypothetical protein,
FT                   conserved"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15827"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEH5"
FT                   /protein_id="ABK15827.1"
FT                   /translation="MNRFLRGQESTRFVLRIVKVCCCLLALSFCGFVVAAAAQNQAPAQ
FT                   AQNAPQPSTSPQQPAAPAAAPAAPAPVGVAAPNAPAPAGEPATPNVAAAPSTAAPPGPP
FT                   PVEPVAKPPSPEHAPIVQATLAALMKDEFTYVPNRVIDPFKPFISPVAVVARGLRAGSD
FT                   DDDGSHELQKPLTPLQKMTVAEVEKGLRAITWGEYGRKAVIEDGAGKGYIVSIGTPVSD
FT                   KNGVISQIFNDRLIIQQENWDRETKRMVPQDTVVRLKKKDEK"
FT   sig_peptide     complement(152815..152931)
FT                   /locus_tag="Sfum_0124"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.408 at
FT                   residue 39"
FT   gene            complement(153112..155550)
FT                   /locus_tag="Sfum_0125"
FT   CDS_pept        complement(153112..155550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0125"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: ade:Adeh_3075
FT                   tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15828"
FT                   /db_xref="GOA:A0LEH6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEH6"
FT                   /protein_id="ABK15828.1"
FT                   /translation="MKKRLLECGSLFVLALMIVSAYCNTFLSPPYMDDYHSFINTDHVY
FT                   LKDFSPESLISLANTPFGWKRWVPILTFALNHKLGGSSLVLFHATNLAIHLLVTLSVAF
FT                   LAFQVFRLSKHRHDDDMRAGFWMAFFVACLWALNPVQTSAVTYLVQRMASLQALFYVIS
FT                   VACYLKGRILRQPPVSAENSSRLFYLISFLAGVCSFFSKENAVTLPIMLIISEIWFFQP
FT                   DLLPKSFQRLKRYAIKTKVLLSACLLACGAFSIFVFLHIISQYDLRHFTMTERLLTQAR
FT                   VVVWYISLLLWPAPSRLSMEHDVLVSTSLLSPPTTLIAILFLVLLLWLAIRLRHRFQIV
FT                   CYGMVWFLLNLSVESTFVPLELVFEHRLYLPSVGFFISIIAAIELAFRRVVPRLLTRDR
FT                   LLAMGSIVMILSSLLTFATFERNEAWESTMTLHKDAAEKAPNHPRALANLANAYYFAKE
FT                   YDKAVEAGEKSIALARPRFESYAVATNAILISLIRSGDLQKAIERTEELLQSRPREFEA
FT                   DVMATIYTNLGEAYRRQEKLDRALESALSALYWTQRLGSPTIDKVRVATLITSILKDAK
FT                   AKRINPDEGWATAPFDMPSQTWAAKVFYRYGDADIAKKLIAVALEEHPGDAETLKLSEE
FT                   IRTDEQLSEEQKGKWSFTAKYVRHPFSRFNFSMAIAFIIQEKQMPMTIMKLGEAFLDYA
FT                   LELQPDSTDAHLLKGWYYYQRDDAQNAVAEARLALKHDPENGKAWLGLGFFLIKAEQKE
FT                   EAAAALRKSLALYPRYSKRFVVRDIADNLLKKESLEEGVDSGPGTAAMTGEVSQGVRAD
FT                   "
FT   sig_peptide     complement(155473..155550)
FT                   /locus_tag="Sfum_0125"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.950) with cleavage site probability 0.892 at
FT                   residue 26"
FT   gene            complement(155744..156199)
FT                   /locus_tag="Sfum_0126"
FT   CDS_pept        complement(155744..156199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0126"
FT                   /product="Tfp pilus assembly protein PilE-like"
FT                   /note="KEGG: type IV pilus biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15829"
FT                   /db_xref="GOA:A0LEH7"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEH7"
FT                   /protein_id="ABK15829.1"
FT                   /translation="MFIKMRESKGFTLVELMIVVAIIGILAAVAVPYYQKYIQKSRMVS
FT                   KVFPGMHAIETNMGTYFSFKNTLLDVGSTATFGQFVQDADTKCFSPSWAGEYLLITIKD
FT                   PTLCQELKALTGMTLSATPRMDTSRTKIRGWALAGPLAVQLGLEGEQ"
FT   sig_peptide     complement(156107..156199)
FT                   /locus_tag="Sfum_0126"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.769) with cleavage site probability 0.760 at
FT                   residue 31"
FT   gene            complement(156744..158093)
FT                   /locus_tag="Sfum_0127"
FT   CDS_pept        complement(156744..158093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_2225 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15830"
FT                   /db_xref="GOA:A0LEH8"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEH8"
FT                   /protein_id="ABK15830.1"
FT                   /translation="MIKKLGPACLIALVLITALGFYMRCESVSETKVTKPLRSDALDYF
FT                   CYAYNLRHKGTYSREGLVLSDIGAPASPDAVRSPGYPLFLLPFVDSPPTHAMLGKIVLT
FT                   QAVLSTLTILIAFFFFLKFLPRPASLVATLLTALSPHLIVGNSYILSESLFCFLLVLSA
FT                   WASSLLPKSPSPLRAGLTGLSMGLASLVRPVLQYLPVAMFIPLIRDFGRAKGLKLGAFL
FT                   LLGCMLALSPWLTRNMSVQDKPGDNNLMIDFLHHGIYPDFMFNNDPNSYAFPYRFDPRT
FT                   PQIGANLGSVLKEVLTRFIDQPAPHLKWFLVGKPVEFWSWNTVQGVGDAFIYPISSTPY
FT                   TNRRLFAWTHSCMYYLHWPLVALCLLGSLLAWHSSAMRVFEPATAGVTRLASCYVLYFT
FT                   LVHMIGAPFPRYAFPLRPFQFGMAVFTVVLIHRHARNRFRRSAHGVSAAS"
FT   sig_peptide     complement(158004..158093)
FT                   /locus_tag="Sfum_0127"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.813) with cleavage site probability 0.299 at
FT                   residue 30"
FT   gene            158263..159444
FT                   /locus_tag="Sfum_0128"
FT   CDS_pept        158263..159444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0128"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   lic:LIC10452 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15831"
FT                   /db_xref="GOA:A0LEH9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEH9"
FT                   /protein_id="ABK15831.1"
FT                   /translation="MGNDSVSRAWTSTQGSTSLGRPVRLTLVIPCYNEEKTLEKCVQRV
FT                   LRIRDEELTLEIIIVDDHSQDDSPSIALSLAKRIPEIAVVCHDRNMGKGAALRTGFQKA
FT                   TGDYVAVQDADLEYDPWDLKKLLVPLVNDEADVVLGSRFLTAGPHRVLYFWHSLGNKFL
FT                   TLLSNMFSDLNLTDMETCYKVFRREFIQDITIEENRFGVEPELVAKMAAKRVRIFEMGI
FT                   SYYGRTYEEGKKIKAKDGLRAFYCIFHYNAPTAPMPIQFLIYLLIGGLSALFNLFLFLG
FT                   TLALGWTAPLSAATAYVAAAGMNYLLCIALLFRHKARWNSLMELAVYCLIVILVGVLDV
FT                   GLTHVLLLSGMAPWLAKSAASVAGLILNFLGRKYFVFPQPSAGPWKSRPGPGG"
FT   gene            159553..160458
FT                   /locus_tag="Sfum_0129"
FT   CDS_pept        159553..160458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_2689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15832"
FT                   /db_xref="GOA:A0LEI0"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEI0"
FT                   /protein_id="ABK15832.1"
FT                   /translation="MLSRFVSKLKFLSVLVCIACFCYIAWQSRSLILSVLRNAHLGYLL
FT                   AAVCVWSLSHLTAPLGVSMIYRSLGRTVPYRFALGTHLGLLPARYLPGGIWHTVGRGIR
FT                   YHRYGIDSSLVTVGIFLETAFDLGMAFILGGGCIWALRGTGGWLGLSAAVLLWMSLAGL
FT                   AVTPMLIPLAVGQARYKVSLPRYLEALGAYAMFSCIGPAAFILYLLSLRVITADVSLLE
FT                   IAGAYLYSWGLGVLAFFAPQGIGVFEVVAGALLAPPSALGSVAVLIAGFRLIRLLSDAA
FT                   GWGVSWCFKPREDGQIGEEG"
FT   sig_peptide     159553..159630
FT                   /locus_tag="Sfum_0129"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.832) with cleavage site probability 0.581 at
FT                   residue 26"
FT   gene            complement(160478..161536)
FT                   /locus_tag="Sfum_0130"
FT   CDS_pept        complement(160478..161536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0130"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   nar:Saro_3226 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15833"
FT                   /db_xref="GOA:A0LEI1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEI1"
FT                   /protein_id="ABK15833.1"
FT                   /translation="MFMISVKNPDSDSNLPDRPVCSVCIANFNGIDVIGPCLDSVYSQV
FT                   CDFPVEVIVHDDASRDGSVAFIRKHFPGVELIESGENVGFCVSNNRMVARARGPYVLLL
FT                   NNDAALHPDALATLHAAAESPGSQAIMGLPQHDMQTKQMIDIGSLFDPFLNPIPNLNPA
FT                   RLHVGMVIGACLWIPRVLWNELGGFPEWFGSLAEDMYLCCLARLRGCRVIALSRSGFDH
FT                   LVGKTLGGGKVVGNALRTTLRRRALSERNKSFVMILTFPPPLLQLVLPVHLLALLVEGV
FT                   LIGLIKRDMHVFQDIYLHSLKEIFRRRHQLRQLRREAQTGRKTGVRDFLAPFTLIPHKL
FT                   RMLVRHGVPRIE"
FT   gene            complement(161949..163694)
FT                   /locus_tag="Sfum_0131"
FT   CDS_pept        complement(161949..163694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_1707 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15834"
FT                   /db_xref="GOA:A0LEI2"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEI2"
FT                   /protein_id="ABK15834.1"
FT                   /translation="MVVKLRHYLRCYNKNTELNILNLFSARQNMWSGSFSSSYSCWKRT
FT                   WVTLPIGLLLLVIRTWPRLLHPEVWQEDGTYNLPGFFQNGLTDLLEPVNGYLIVVPKMI
FT                   TMLSVSISITQYPMISTFLACGVMLVVFYIVATAPIHIHGGILLAAACLLLPSNPEVFG
FT                   LPLYSFWWTSILLFVVVFWNANQNDWILRAVIIIMASLSSPVCIATLPLLWVRVCFLRK
FT                   NPREISLTLLATSCVAIQIWIMIHSNIYVVSQINIASFYLIITKFIGSYAIGNIFPMFR
FT                   WYFGLFILSLLIVTVLRDLRSPAKWGLAYLLCATILMSISRLSINHLHQAIGSPRYFFF
FT                   PFIILSWFLLQIALTETSRLLRMGALFILCLSILNAIPVLDRKHDDLNWATHLASCPHF
FT                   KEYELPVHIDGNIAGTWALKLTKQQCNSLLDKDPFFKPAVTGGFPFRVIRKHPDDRPFE
FT                   QNDVTVAINKVQPGNEWLGADPQKSHKNGIVVLGSFMDSGAGTGSLTLKMRRGDKLLYR
FT                   SGLLRSGQFIEVQAPLFRVTTSPVAREWVQLDFSNDLLPDEFSVIFSDRSTDWHEWSAI
FT                   MLKAD"
FT   gene            165054..165428
FT                   /locus_tag="Sfum_0132"
FT   CDS_pept        165054..165428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0132"
FT                   /product="putative transmembrane potein"
FT                   /note="KEGG: bxe:Bxe_A3784 putative transmembrane potein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15835"
FT                   /db_xref="GOA:A0LEI3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEI3"
FT                   /protein_id="ABK15835.1"
FT                   /translation="MSKVREFIKLARIYQYTKNVPVFLPAVFSYKLNDWTALATAAGAF
FT                   LAFCGMASSVYVLNDILDIDEDRHHPAKRHRPLASGKITVREASCFGIALGFLSIVFSV
FT                   LLLPYSSLTRIIHEAWRESR"
FT   sig_peptide     165054..165212
FT                   /locus_tag="Sfum_0132"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.684) with cleavage site probability 0.249 at
FT                   residue 53"
FT   gene            complement(165622..166815)
FT                   /locus_tag="Sfum_0133"
FT   CDS_pept        complement(165622..166815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0133"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   pol:Bpro_5331 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15836"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEI4"
FT                   /protein_id="ABK15836.1"
FT                   /translation="MSRALSDRRDQAKVHHGQEELLRQRLFAIAMGYEDGNDHQSLRFD
FT                   PGLKTAVGRLPETDPALASQPTLSRFENRVGNCELRRLSDALIDAYVAAHPAPRKVIVL
FT                   DMDATDDPVHGLQQLSFFHGYYDQYMLHPLLIFDGLTGFPVAAVLRAGNAHASKGAAAI
FT                   LKRIIRRLKHAYPGATILVRADAGFAVPAIYRLLEREKVKYTIGLITNDRLRKRAANLV
FT                   IKAERQFAKTGAKQRLFGSFYHRAGSWQRSRRVIAKVERLSRGLNTRFVVTNILESAAG
FT                   IYDGIYTGRGDAENRIKELKVHLKADRLSCTRFQANQFRLLLHTFAFVLFWHLRRSLAG
FT                   TELAAATVDTLKLKLLKVGARVVQSVRRILFTMPRAYPYQRLFATALQNIRQMPLRC"
FT   gene            167066..167608
FT                   /locus_tag="Sfum_0134"
FT   CDS_pept        167066..167608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0134"
FT                   /product="UbiA prenyltransferase"
FT                   /note="KEGG: tdn:Tmden_1216 UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15837"
FT                   /db_xref="GOA:A0LEI5"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEI5"
FT                   /protein_id="ABK15837.1"
FT                   /translation="MLIYMVLNILYSTKLKEIPIIDVLCVSAGFVLRILVGAYAVSVLP
FT                   NHWIILMTFLLALFLSFAKRRDDIVLSGNNNNGLIRCVIVGYSLEFVSTIMSVLASVVI
FT                   ICYILFTLSPETVAKHGTHNLYSSSFWVIMGIIRYMQLTFVYQRSGSPSRILIEDIPLK
FT                   IITVLWVVHIIFILYVK"
FT   gene            167617..168189
FT                   /locus_tag="Sfum_0135"
FT   CDS_pept        167617..168189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0135"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   C-terminal domain; KEGG: xac:XAC3593 NAD dependent
FT                   epimerase/dehydratase/dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15838"
FT                   /db_xref="GOA:A0LEI6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEI6"
FT                   /protein_id="ABK15838.1"
FT                   /translation="MLSKDKIVITGGAGLVGQNLVRLLVADGFENITVVDKDADSLAAM
FT                   KRDCPGVTVIHADLAEPGSWRAGFEGGRGVVQLQAQVTAKEGERFERNTVRSTANVLSG
FT                   CKEHGIDYIVHVSSSVVNSVADDDYTRSKKTQERMVIDSGIEHCILRPTLMFGPFDPKH
FT                   LGWLSRFMERVPVFPVSTNAKITPYTN"
FT   gene            168224..169528
FT                   /locus_tag="Sfum_0136"
FT   CDS_pept        168224..169528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0136"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: mac:MA1882
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15839"
FT                   /db_xref="GOA:A0LEI7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEI7"
FT                   /protein_id="ABK15839.1"
FT                   /translation="MRRKTLRFLSRKALGGRHMVKRELWYEVQSRFKLKESKKSIARSL
FT                   ELSVQTVRSVLKQKAAPSYRRGPGKRTLLSPFEDHIHRRLAALGYCSRAIYEELVEQGY
FT                   TGCYDTVRRFVQPLRKEAQTKATMRFETPPGRQAQVDWGQCWTLISGKRIKVHLFVMTL
FT                   GYSRRLFAKATWDERLATFLACHEEAFEHFGGAAHELVYDNAKTVVVSRDVEGRNVKWN
FT                   ATFWDFSTYYGFRAWAHRPYRAQTKGKVESGVRYVKRFVRGKAFESMAHLNTLLGRWLA
FT                   TVADLRIHGTTHQRPIDLFEQERTLLLPTGAKPPYQVRERAVRYVARDCMVSFETNRYS
FT                   VPLRFVGKPVEVQCANDRILIFHEGSLIVSHPCCTGKHQSLVDREHYTGIFYGIELPSV
FT                   RMLAFDHALPLCSREEVEVRDLAFYERLAQEGGAS"
FT   gene            169525..170304
FT                   /locus_tag="Sfum_0137"
FT   CDS_pept        169525..170304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0137"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: chy:CHY_1116 ISChy4, transposition
FT                   helper protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15840"
FT                   /db_xref="GOA:A0LEI8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEI8"
FT                   /protein_id="ABK15840.1"
FT                   /translation="MSSTQLVRIQERLKHLKLYRINEQLESRLEEASRGNVSYGDFLDQ
FT                   LLDEEVSAKKEKNISMRTSMARFPFVKTLESFDFAFQPSIDKKRINELAACRFIANGEN
FT                   VILLGPPGVGKTHLAVALGIKAVTEGYRTHFTQAMPLVASLTKAYAENRIEERLKFYCQ
FT                   PKLLIIDEIGYIPIDRHGAHLFFQLISRRYERGALIVTSNRSFGQWNEIFGDTVIATAI
FT                   LDRILHHSTTVNIKGNSYRLKEKVKAGLLQSPELEQT"
FT   gene            170301..170600
FT                   /pseudo
FT                   /locus_tag="Sfum_0138"
FT   gene            170642..171004
FT                   /locus_tag="Sfum_0139"
FT   CDS_pept        170642..171004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0139"
FT                   /product="NAD dependent
FT                   epimerase/dehydratase/dehydrogenase"
FT                   /note="KEGG: xac:XAC3593 NAD dependent
FT                   epimerase/dehydratase/dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15841"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEI9"
FT                   /protein_id="ABK15841.1"
FT                   /translation="MYSIDFCRIIEYCLVHKPSGKTYDIVGEEQIYYIDMIRSIKKHKR
FT                   LNTIILNIPYVLFSKLLKLYSLISSDPPFTADQLKALTAGDMFHGVDIRKEFGFDQTKF
FT                   DDAMYMTFQKNHHDCG"
FT   gene            171182..172480
FT                   /locus_tag="Sfum_0140"
FT   CDS_pept        171182..172480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0140"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: dar:Daro_1705 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15842"
FT                   /db_xref="GOA:A0LEJ0"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEJ0"
FT                   /protein_id="ABK15842.1"
FT                   /translation="MKRISIIGAGPMGLACAYYLLKRGFHVDVYEKDGVVGGMSASFDF
FT                   GGLMLERYYHFICGPDEDYLGLLDEIGMLDQVRWAETRMGFYYHGKLYEWGNPRALFRF
FT                   PHLDVGTKLRYALHAFHTSRITDWRKLDREEASGWLTKWIGGSGYEILWESLFRKKFHR
FT                   FSKPLSAAWIGSRIRRVARSRKGLFSEEMGYIEKGTESFLGRLKGLIEGMGGNVFLSAP
FT                   VSRILHRNGRVSGVSVEGIDRDYDVVVSTVPLPYVLRIADDLPDSYLCAVRAVNNIGVR
FT                   CVVLRLKHPLSDYFWINVNDPGFGIPGLIEYSNLNPLRDGIVYVPHYMPTESEEWRMAP
FT                   EAVIARAFVYCRRINPALDDGWLVDARLFEYEFAQPICTPGFFSKLPPVSGIIEGLYVA
FT                   DTTHSYPEDRSINESVRIAGMLARMIANERRGL"
FT   gene            172461..172886
FT                   /locus_tag="Sfum_0141"
FT   CDS_pept        172461..172886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0141"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: rso:RSc0167
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15843"
FT                   /db_xref="GOA:A0LEJ1"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEJ1"
FT                   /protein_id="ABK15843.1"
FT                   /translation="MNGVAFRLKNEFCSRQFAGFLVVGGSAAILNFFCRVFLSGYLSYA
FT                   AAIVVAYLIAMVFAFVLGKCFVFQSRRSSRTAREFINFGLVNGLAVLQTLGISLLLAYV
FT                   VLPYCGVSSHGEEIAHAVGIMVPAFTSYVGHKHFTFK"
FT   gene            172908..174206
FT                   /locus_tag="Sfum_0142"
FT   CDS_pept        172908..174206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0142"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   cte:CT0170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15844"
FT                   /db_xref="GOA:A0LEJ2"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEJ2"
FT                   /protein_id="ABK15844.1"
FT                   /translation="MEMTSWGRFPRIDAVGHTPRNEAALRACVLAGGEKIAHGMGRSYG
FT                   DSALNREVILTGGFRYFLDFDSKTGIITCEAGVSLSDIIDVILPRGWFLPVTPGTRFVS
FT                   LGGAIASDVHGKNHHLSGSFCDHVLGFDLMIADGATVRCSRSENEDLFHATCGGMGLTG
FT                   VILRGSFRLQKVKSCLIRQEIFKAANLSEVIALFEEKSAWSYSVAWIDCLATGTKLGRS
FT                   LLMVGEHADKGTLFRSPAKTLSVPFDFPRFCLNRYSVSAFNHLYHRRKGASTGEQTVSL
FT                   DHFFFPLDSILHWNRIYGAGGFTQYQFVLPKAAGVEGLRAILARIARSGRGSFLAVLKL
FT                   FGKGNDNLLSFPMEGFSLALDFKIERGLFPLLDELDHIVTDHGGRLYLAKDTRMRAGVF
FT                   RRGYPKWEVFRGIRETHGLVDRFNSLQARRLEI"
FT   gene            174209..174940
FT                   /locus_tag="Sfum_0143"
FT   CDS_pept        174209..174940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0143"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   tdn:Tmden_1219 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15845"
FT                   /db_xref="GOA:A0LEJ3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEJ3"
FT                   /protein_id="ABK15845.1"
FT                   /translation="MFVLILGANSDIARAIADKFAREEGAHLCLASRDTDELERLAKDI
FT                   EVRHRTRVQIARFDALQFASHRLFYESLDPKPDTVVVAFGYLGNQSRAQAEFDEARKIV
FT                   ETNFLGCVSILEIIAEDFEARGRGTILAISSVAGERGRQSNYMYGSAKSALTTYLSGLR
FT                   NRLYRRNVRVITVLPGFVRSKMTDGLRFPKMLSAVPEETADDVFRAFKSGADEVYTKWF
FT                   WKWIMTVIRMLPERIFKRLRL"
FT   gene            174965..176923
FT                   /locus_tag="Sfum_0144"
FT   CDS_pept        174965..176923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0144"
FT                   /product="glycosyl transferase, family 39"
FT                   /note="PFAM: glycosyl transferase, family 39; KEGG:
FT                   xom:XOO_1534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15846"
FT                   /db_xref="GOA:A0LEJ4"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEJ4"
FT                   /protein_id="ABK15846.1"
FT                   /translation="MPNTEHGKSEPSAAKYIYTLLAICFVANSVFISVGFRNTILDYHG
FT                   FRQTQTAISSYYTIKEGYRLAYETPVLGKPWSIPFEFPLYQWIVAFLSQASNIKLEQSG
FT                   RLVSMIFFYLSLLAIFHILRSLSIEREYCCISIVMMLCCPVYIFWSRTFMIESLAVFLS
FT                   LIYLLCFMKFYKNRKIHLFVIGALFGGLAAAVKITTLIVVTVPIIAILSNDWLSLLQGL
FT                   LRKNSNNPSLNRFQNEFKYAMLLVVPYLMGLMWTRFADFHKSLNPLARDFITSTHLIEW
FT                   NFGTWSQKLSLDCWEKIMVGDVIHGIGYPAILIIPLFVFITSSYYICAVIFSLIAYLSG
FT                   PIIFTNLYYTHRYYCYANSLFLILAISLSIIALIKTNKMKKFALYGLIPFCIITMIYSY
FT                   LSHYYMIQSPTNGISRPPVECLLIRAVTAPDDVVLIYGEDWNPTIPFYAERRAVMNRSN
FT                   LPLSDPRFQESIRTTGKERISVMVKDSRDEGLNAFFSFHPDPVMTCVYLRKDLYKSVFM
FT                   RMFHVDVEQSSSALPVKISFWNRRFRLFSATGSTMVVPLPAPVSKLRAQFGVLFDPRDA
FT                   EILAGVDFVIAHESHDGVRTELSRTHLDPVRSEADREVRNAEVELAKRGAGKILLETVP
FT                   GAGKTCKWSFWSDIELN"
FT   gene            complement(177260..178372)
FT                   /locus_tag="Sfum_0145"
FT   CDS_pept        complement(177260..178372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0145"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU2463 glycosyl transferase, group 1
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15847"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEJ5"
FT                   /protein_id="ABK15847.1"
FT                   /translation="MRVTMVSTSYPFDPEDWRGRFIKEMVYALAEDRAVELSLWAPPGK
FT                   IPDNVAYRPTAAEAAWLKDLLARGGIAHLIRSRTPRGFEAVFKLLWLLRRNCLRKPEAD
FT                   VAHVNWLQNVLPFWGTSIPAVVSVLGTDFGLLRVPGVTGLIRTVLRQRECLIAPNADWM
FT                   VPELEKRFGDVARVRAIPFGVDDRWFSVKPIRTPGAPRQWLVVSRVTEKKIGPLFSWGE
FT                   GLFGTDDELHLLGPMQEDLSIPGWVRYHGPTHPDALESEWFPRAAGLISVSRHDEGRPQ
FT                   VILEAMAARLPILASAIPAHRNVVRHMETGWLASSREEFAGGLEWLARPDHNEAAGASA
FT                   HDWVRREIGTWRDCADRYKTAYRMVTGVEG"
FT   gene            complement(178418..179428)
FT                   /locus_tag="Sfum_0146"
FT   CDS_pept        complement(178418..179428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0146"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   sat:SYN_00829 glycosyltransferase involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15848"
FT                   /db_xref="GOA:A0LEJ6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEJ6"
FT                   /protein_id="ABK15848.1"
FT                   /translation="MLTKRFSTTTTDATAPEVSIVIPAYNEADGIGNLISRVHAVMTSA
FT                   GRSYEVIVVDDGSADDTADNARRAGARIVRHPYNMGNGAAVKTGIRSSRGGILVMLDAD
FT                   GQHPPDYIPEMLEKTADYHMVVGARTRSSETSIHRDLANTIYNWLATYVCGRRIEDLTS
FT                   GFRAVRAHVAREFVSLLPNTFSYPTTITLATIRSGYGLTYLPIKADRRASNSKSKIKLL
FT                   RDGSRFLLIIFKIATLFSPMKIFLPASVVTFLLGLGYGLYKVVVLDGRYGPTSAMFMTS
FT                   SILMFLIGLVSEQITQSRFDRMEFVVDPAPVVDATDSAGQSPLAGDELPGKQAGL"
FT   gene            179888..180400
FT                   /locus_tag="Sfum_0147"
FT   CDS_pept        179888..180400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0147"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: gme:Gmet_3338 formylmethionine deformylase;
FT                   TIGRFAM: peptide deformylase; PFAM: formylmethionine
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15849"
FT                   /db_xref="GOA:A0LEJ7"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEJ7"
FT                   /protein_id="ABK15849.1"
FT                   /translation="MAILDICTYPDPILRQKAASVENIDEALIKLIDDMTETMYEAPGI
FT                   GLAANQVGRSLSLIVVDLQRQDEEHGLIVLINPQIVATQGEITWEEGCLSVPEYFSAVK
FT                   RHAEVVVRGYGRDGKEMEIQAGGLLAVALQHEIDHLEGRLFIDRLNPITRDIFKRKWKK
FT                   KLKEATA"
FT   gene            180427..181344
FT                   /locus_tag="Sfum_0148"
FT   CDS_pept        180427..181344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0148"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: gsu:GSU0130
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15850"
FT                   /db_xref="GOA:A0LEJ8"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEJ8"
FT                   /protein_id="ABK15850.1"
FT                   /translation="MGTPEFAVPSLRKLAEAGAPILLVVTQPDRPSGRGKKVTLPPIKL
FT                   LAQELGIPVFQPDRVRKPEAIDRIRSAGAECAVVVAFGQILPQALLDVFPRGALNVHAS
FT                   LLPKYRGAAPIHRAILEGDSGTGISVMLLDAGMDTGPVLTRRGLEIGDRETFGELHDRL
FT                   AAAGAELLIETLKGWKAGSVAAEPQDDAHASYAPPLRKEEFRLEWTQPAWHIVSRIRAF
FT                   DPQPGAFFMCGGKRVKCFGASLLSLRTAGQGGEIVGLQAGGLVVLGGDGRSLLIGELQM
FT                   EGQRRVPAPEFVRGRPLPPGTRLG"
FT   gene            181371..182174
FT                   /locus_tag="Sfum_0149"
FT   CDS_pept        181371..182174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0149"
FT                   /product="protein of unknown function DUF116"
FT                   /note="PFAM: protein of unknown function DUF116; KEGG:
FT                   gme:Gmet_3340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15851"
FT                   /db_xref="GOA:A0LEJ9"
FT                   /db_xref="InterPro:IPR002829"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEJ9"
FT                   /protein_id="ABK15851.1"
FT                   /translation="MTQRLTSFKMPPGQPEKKTILILVALTAVLLTILLVLFYIVPYYG
FT                   FSRIHAGLPIVMGVLVAAVGGFVVLSLVLLMVVFIVGHDVPFSKKLRSIAVKGLLPTLT
FT                   VVGKLIGLRKEEVQHAFVAVNNELVMAQCRNGHPPRNVLLLMPHCLQNADCPVKITYRV
FT                   ENCKRCGKCRIKDLLDLSEKYGVSLAVATGGTIARRIVIEKRPDLIIAVACERDLTSGI
FT                   QDTTPLPVYGIFNQRPFGPCLNTQVAMDQVESILKEVMEINREKS"
FT   gene            182171..183520
FT                   /locus_tag="Sfum_0150"
FT   CDS_pept        182171..183520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0150"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: gme:Gmet_0066 Fmu, rRNA
FT                   SAM-dependent methyltransferase:Nop2p"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15852"
FT                   /db_xref="GOA:A0LEK0"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK0"
FT                   /protein_id="ABK15852.1"
FT                   /translation="MINARVLAFQILLHMDRDASHPDRLIRGMLGRHERLEERDRALLT
FT                   ELVYGVLRWQGRLDWHIDQLSRTRPEKIDPAVRILLRLALYQILMLDRIPDHAAVNEAV
FT                   NMAKTTQPAYLVKFVNGVLREALRRRSRWIWPEAGEEPGKYIAVTTAHPIWYVERLLHE
FT                   FGFEETLDICNANNTVAPMTLRVNALKTSIDTILQWCAEHGIDAEPSGVVPTAVRLSGL
FT                   RRDLAETSIYRDGLVQVQDEASQIVSTLVAPRAGERVLDLCAGFGGKSTHLGILMGDRG
FT                   EVVAVDNSAWKLEELRKNARRQGLRIIKPRTADLFEFSPGTEDLFDRVLLDAPCSGFGT
FT                   LRRNPDIKWRRHLKDPRRFGRIQKEMLDHAARFVKPGGALVYSACTLFQEENDAVAEHF
FT                   AASHPDWQIEPVGPDLPDACRGMASGPFFRTWPHRHQVDGFFAARLKRPA"
FT   gene            complement(183521..184996)
FT                   /locus_tag="Sfum_0151"
FT   CDS_pept        complement(183521..184996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0151"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: glycosyl transferase, family 2; NodS family
FT                   protein; Methyltransferase type 11; Methyltransferase type
FT                   12; KEGG: gvi:gll2778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15853"
FT                   /db_xref="GOA:A0LEK1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK1"
FT                   /protein_id="ABK15853.1"
FT                   /translation="MKDKAQKRELFDSQAARRDHWKQKNQYYYKELESFLSFLIPSDAS
FT                   VLEIGCGTGDLLARLNPPWGHGIDFSPAMIEVARRKYPPDRFENLAFSVDDIEDLKHRD
FT                   TYDHIIMSDVLGDLTDVWAAFRNMRTVCHPGSRVIITYFNPLWEPVLRLGERLGMKIPQ
FT                   DYQNWLSLNDIHNLLDLNGFEVIKKGQLLLLPKQVPFLSTFLNRYVAKIPLLCRLPLVV
FT                   YLIARPVVPERTPDRRPSVSVIVPCRNEEGNIRPAVERIPEMGSHTEILFVDGLSTDGT
FT                   VAAIEDAIGEFKGIKDIKLLHQVPPGTGHAGREGKMLKLGKGDAVRKGFAAASGDILMI
FT                   LDADLTVPPEDLPKFYLALTEGVGEFINGTRLIYPMEEQAMRFLNKLGNKFFSLAFTWL
FT                   LDQRIRDTLCGTKVLFKKDYQKIANGRSFFGDFDPFGDFDLLFGAAKLNLKIVEVPIRY
FT                   RRRTYGDIKIERFKHGLILLKMSGVAMRKLKLR"
FT   gene            complement(184993..186771)
FT                   /locus_tag="Sfum_0152"
FT   CDS_pept        complement(184993..186771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0152"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15854"
FT                   /db_xref="GOA:A0LEK2"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK2"
FT                   /protein_id="ABK15854.1"
FT                   /translation="MSNERKTFLFGLIALTSISLALRLHDLDAESLFMDEARQISYYAL
FT                   SLRDIITYAATQVQPPLDYWIGHAVFLIDRSVFAARLPAALFGVGSVGLLAILLSRYCS
FT                   WQVSLLTGLLMAILPFHLYFSQEARPYSIVMFLLLVVLWQLDNFMRDSSLRARHLLALP
FT                   GACVLFLYSSGLSPLMVIVALFSVLGAPVLVSLVRPGRLAPERRKRSLAAMGTICIAIG
FT                   LYLPIFFILVQTSRRYAPHLSKADPAIYLTHLLNFSFFPLWRAYVTQLEPIGLLLLPFV
FT                   LAAIVLAIKRRGEPGFFLPKIVAATLPCAAVLHLFAYGANTESPFRPPYPMYILPLTLF
FT                   LAACAWHELASRLQAVKIPGRRVLLASITVLMFVFVLHSTWAFKTMRRKADVNGIREYI
FT                   AGVRHPGTVFFTGGLVGFGGWYPEFELGKSPHCPLEALPLVDDRRLLSEGEPVFLFFTF
FT                   HEYFLTPFSKYPIVPIPGDKTPLPLERLRNSPVLSCAEYIGYEGVRLKNPSGRLAEDAF
FT                   RIAEAILEQLPDNNALVDLRVATAKLGRALGRTDYEEHIRKSMAVLDPSERAVLTARLL
FT                   RASPPMIAHPKESNQP"
FT   sig_peptide     complement(186697..186771)
FT                   /locus_tag="Sfum_0152"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.915) with cleavage site probability 0.473 at
FT                   residue 25"
FT   gene            186884..187156
FT                   /locus_tag="Sfum_0153"
FT   CDS_pept        186884..187156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15855"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK3"
FT                   /protein_id="ABK15855.1"
FT                   /translation="MKEKHGTCAGRSVGAGTGRQRGAGRGGHSIESVGTARLPVDPMRR
FT                   RARPGGGRPAGKKAARRGFECSSMRSARAMCFKRLSSRPGQVFPW"
FT   gene            complement(187113..189023)
FT                   /locus_tag="Sfum_0154"
FT   CDS_pept        complement(187113..189023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0154"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: t-RNA-binding domain
FT                   protein; KEGG: sat:SYN_00558 methionyl-tRNA synthetase /
FT                   protein secretion chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15856"
FT                   /db_xref="GOA:A0LEK4"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK4"
FT                   /protein_id="ABK15856.1"
FT                   /translation="MNRFYITTPIYYVNAEPHIGHAYTTIVADVMNRFHKLMGFGTFFL
FT                   TGTDEHGDKIVQAAADAGTAPKEYADRISGMFKEAWSKLNISNDHFIRTTDPEHIRVVQ
FT                   HILQQVYDSGDITFSTYRGLYCVGCERFYTERELVDGKCPDHDKEPIEREEANYFFRMS
FT                   KYQNWLIEHIESNPDFIRPERYRNEVLAFLREPLEDLCISRPKERLAWGITLPFDERYV
FT                   TYVWFDALINYVSALGYPDGPLFGEFWPVVQHTIAKDILKPHGIYWPTIIKAAGFPVYR
FT                   HLNVHGYWKINEGKMSKSRGTVVRPLDMIPLYGLDAFRYFLLREMVFGLDANFSEDALV
FT                   QRLNSDLANDLGNLFSRTLAMTLKYFDGKVPPFGSEPDDMDRDLISRVERTVAEFREEL
FT                   PVFCFHKALMSIWECLNAANKYIDTVGPWGLAKDPSRHGRLETVIRILLELNKTMAVLI
FT                   SPFMPSTSEKMLERLGVVKRSIDLRLAEDGRWGTLVEGTPVSKGDALFPRIDIKEERKP
FT                   AVPRQPEKRQPSLPLLDLEAFKQVDLRTGVVKHAERVPKSEKLLRLLVDIGEERQVVAG
FT                   IAQSYSPEELTGKQVVVVANLKPAKLMGIESHGMVLAVRDGDALRLLTTEKPVPAGLRV
FT                   S"
FT   gene            complement(189187..189984)
FT                   /locus_tag="Sfum_0155"
FT   CDS_pept        complement(189187..189984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0155"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: cpe:CPE2448 signal
FT                   peptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15857"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK5"
FT                   /protein_id="ABK15857.1"
FT                   /translation="MEKVVGIRFRKGGKIYHFDPSEYALKKGDFVMVHTEQGIGLGQVA
FT                   EGPHGKDPRFHPSEVKKIDRPATTEEIRTHQNNLEVEQDAKNYCLDRIKAHQLAMSLVD
FT                   VEYFFDGSKIIFYFTADGRVDFRELLKDLVRRLRTRVELRQIGIRNQAKMVGGLGNCGR
FT                   PLCCATFLKNFHAVSIKMAKEQNLSLNPTKISGACGRLMCCLQYEYDTYRELKKDMPKL
FT                   GKKVEIPEGRGKVIRQNVMERSVTVLMEDGREIEKQLDPPPKG"
FT   gene            complement(189953..190960)
FT                   /locus_tag="Sfum_0156"
FT   CDS_pept        complement(189953..190960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0156"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: sat:SYN_02985 DNA polymerase III, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15858"
FT                   /db_xref="GOA:A0LEK6"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK6"
FT                   /protein_id="ABK15858.1"
FT                   /translation="MSFKDIPGQERTKRLLKRMARAGTLPHAVLFSGMAGVGKLRVARE
FT                   LAKLVNCLEPRDDESCDRCISCRKIDEGHHPDLFVIRSEGTFIKLDRIRELRERVRFRP
FT                   FEGRFRVVIIENAQHLHDESGNALLKVLEEPPRANLFLLTAIEPQMLLPTIVSRCSHLR
FT                   LQPLEDEVIAGELAASLKIPEAQARELTRLSGGSLDRAQWLAREEHLSHWKEIVENLRK
FT                   SERSGTADVLAMAGRWAQQKEDLEQDLECVKLWVRDLLLSRVIDGYRQAFEPDDPCAVC
FT                   GGEVSPDSLLTLYDRVEESIGRLRGNANKQLVMESICLNIKDVLYGKGCWNPLP"
FT   gene            complement(191014..192060)
FT                   /locus_tag="Sfum_0157"
FT   CDS_pept        complement(191014..192060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0157"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: sat:SYN_02192 HD-superfamily hydrolase;
FT                   TIGRFAM: metal dependent phophohydrolase; PFAM: nucleic
FT                   acid binding, OB-fold, tRNA/helicase-type; metal-dependent
FT                   phosphohydrolase, HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15859"
FT                   /db_xref="GOA:A0LEK7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK7"
FT                   /protein_id="ABK15859.1"
FT                   /translation="MSKTFIADIQPNQDIAAAFVVSEKQLRTTRSGTAFLTLRLVDRTG
FT                   EITGRVWDNAAELAAVIPLKGAVFLRGRSETYRDEMQLNIQEARPLKPEAVDPADFLPV
FT                   CPTDRDVLFEKLSGRISEVEDRPCKQLLKAIFKDRVLLSRFKSAPAAKSMHHAYLGGLL
FT                   EHTLSVVELVLRICRLYPFLDRDLLVAGAILHDIGKTDEYVYDLAIDYSHSGRLLGHMV
FT                   LGVQIVDEKLRLLKDFPEEKAWLIKHMILSHHGEAEFGAAKLPMTREAFVLHHADDLDA
FT                   KMNNLTRILSEPKMGNEVWTAYQPLFERFFYRGLPKEQAETPPLEGEETEDERGVQLNL
FT                   WNPEKPKK"
FT   gene            complement(192174..192446)
FT                   /locus_tag="Sfum_0158"
FT   CDS_pept        complement(192174..192446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15860"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK8"
FT                   /protein_id="ABK15860.1"
FT                   /translation="MAFAIAHVVRVMFRVYCLTDSIWNPSVSINFCGFPCKDFLVGNRI
FT                   SPVNPLLLALRDRVESGVELRYGHVPRRSRRSGVHFAIEINLIGE"
FT   gene            192519..192881
FT                   /locus_tag="Sfum_0159"
FT   CDS_pept        192519..192881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15861"
FT                   /db_xref="GOA:A0LEK9"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEK9"
FT                   /protein_id="ABK15861.1"
FT                   /translation="MSQKGERALSGFPLRAVMRAAADRWIVLRGLSERSPLVAVLLTKR
FT                   RHGVEECLMPLNIVALIAILSLPLVPTFWAILDIPKRRFASPRKKAVWFAIVSTFPFIG
FT                   AMIYIILIRRHTEPIS"
FT   gene            192901..194799
FT                   /locus_tag="Sfum_0160"
FT   CDS_pept        192901..194799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0160"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: pca:Pcar_1050 related to peptidyl-prolyl cis-trans
FT                   isomerase D"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15862"
FT                   /db_xref="GOA:A0LEL0"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEL0"
FT                   /protein_id="ABK15862.1"
FT                   /translation="MLNLFREHSKSWMIKALLILVAIVFVWWGGATYQSKSDTAVVQID
FT                   DEFISERDYYNVYEKMVTRYRTQLGKAWSEKLVEEMNLKGQVLDMLINRYLVSKAAREL
FT                   GLSASTEEVRRRILEYPVFLNDGRFDQLTYERVLRQERLTPEGFEKDIAESIAYERLLN
FT                   FIKRQVVVTDEEVTADYRTNYGQVQIAYALFDPKSFEDKVTVDEQGAQEYFQNHRERYM
FT                   EPEKRRFSLVLYKPEAYMDQAGVTGDDMRRYYDDHISEYRHEQQVRARQILFRLKEDAA
FT                   EEEIAKARSEAEKVLAEARKGKDFAELARKYSQDTATAKNGGDLGAFTRGQMLEPFSDA
FT                   AFAMKKGEISDLVETPDGFHIIKVEEIIPEKTTSFEEARSGIEQAVKRQKAREAAYEKA
FT                   RKLLDQVYAKKDLAKSAEEQNMPVTGGDMWIAETDPLPGFQTPLADISRKLFELPEKDF
FT                   SDIFDTPQGYLIAQVTGIQPPQVPSFDKVKQRVEKDCRAERARVLAQQKAAELLDAARK
FT                   ANSLETAASGLKLAVRKSDWFSRHAPDKDLRLLRGGAVDQVFRLEENQPFPDSSLEFGN
FT                   RFLVCQLLGRRLPEGELEKVRADIVKRLTQQKQSMMWTAWLQEQRGKSKIVALKKL"
FT   sig_peptide     192901..193008
FT                   /locus_tag="Sfum_0160"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.673) with cleavage site probability 0.292 at
FT                   residue 36"
FT   gene            complement(194949..195557)
FT                   /locus_tag="Sfum_0161"
FT   CDS_pept        complement(194949..195557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0161"
FT                   /product="Dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="KEGG: bld:BLi03054 similar to proteins; RBL01877;
FT                   TIGRFAM: dephospho-CoA kinase; PFAM: Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15863"
FT                   /db_xref="GOA:A0LEL1"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEL1"
FT                   /protein_id="ABK15863.1"
FT                   /translation="MRVNAKRIALTGGIASGKSTVARMFADRGALILDADVAAREAVEP
FT                   GSECWQRLREWLAPAFFDAEGRLDRRRLRDLIIRDPQCLVRLNAILHPFIFARMESQWR
FT                   REIEARTRRVVIFDIPLLFESHAADRFDIVILVHVPPEIQIGRLMKRDGLTRAEAEKTL
FT                   EIQLPIDSKIPLSQIVIDNSLDLDHTSRQVLDAWNRIAS"
FT   gene            complement(195589..195915)
FT                   /locus_tag="Sfum_0162"
FT   CDS_pept        complement(195589..195915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15864"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEL2"
FT                   /protein_id="ABK15864.1"
FT                   /translation="MKKKMHLLFIIPLLFGLLCTPVWAETLAPEPVSQRAQMLYESPPA
FT                   ELILADVFILRPAGIVATALGLAGSIVAYPFGVTSCSTEIIDQKLVREPWDYTFCRPVG
FT                   RIDY"
FT   sig_peptide     complement(195841..195915)
FT                   /locus_tag="Sfum_0162"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(195960..197186)
FT                   /locus_tag="Sfum_0163"
FT   CDS_pept        complement(195960..197186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0163"
FT                   /product="SufBD protein"
FT                   /note="PFAM: SufBD protein; KEGG: deh:cbdb_A794
FT                   iron-regulated ABC transporter, subunit SufB-related"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15865"
FT                   /db_xref="GOA:A0LEL3"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEL3"
FT                   /protein_id="ABK15865.1"
FT                   /translation="MYDRQELKERAAKAANKKAAIGPDVDLGEFRRTPVEHHYLSDRDL
FT                   RNVPAEDRERLIMSGVDVDENERIATYFQKDTSVVHCKSRQKDIQVIPIRQALKECDWI
FT                   RDYYWKLVSVDADKYTASAEMELHDGYVIRSLPGAKSEYPVQACLYLDKEGIQQNVHNI
FT                   VIAEEDSELHIITGCSTSPHLTKGLHVGVSEFYVKKNAKLSFTMIHNWAEDLVVRPRSV
FT                   SRIEEGGLFLNNYICMKPVRSLQMYPTTFLTGEGAVARYYSIIVGSPNSEYDVGGRIVL
FT                   QKPGTRAEIVARSISNGGRIISRGHLIGEVPDIRAHLECKGLILKGGMIYAVPELEGHV
FT                   DGVEMSHEAAVGKIAQEEINYLMSRGLDEEEATSTIVRGFLNVDIPELPSQLRAEIDRA
FT                   IEMSGKDVM"
FT   gene            complement(197165..197929)
FT                   /locus_tag="Sfum_0164"
FT   CDS_pept        complement(197165..197929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0164"
FT                   /product="Iron-regulated ABC transporter ATPase subunit
FT                   SufC"
FT                   /note="PFAM: ABC transporter related; KEGG: dde:Dde_1445
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15866"
FT                   /db_xref="GOA:A0LEL4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEL4"
FT                   /protein_id="ABK15866.1"
FT                   /translation="MLLIEDLQVELAGQVILKHIDLEIKWGETHVLFGPNGSGKTSLLM
FT                   TIMGYPQYKVIGGRILFKGVDITYMPINERARLGIGMSYQRPPTIHGLRIRDIVGICAR
FT                   REVPVEDLARRVDFEEFLDRDVNAGFSGGEIKRSELLQLLAQNPDLMLFDEPESGVDLE
FT                   NIALVGNTIAELLQKELEPTLLKSRLRMMRERTKMGLIITHTGYILDYVEVDKGQVLYD
FT                   GVLSCSTNPREILRCIGEMGYEECVRCTIDRN"
FT   gene            198297..199985
FT                   /locus_tag="Sfum_0165"
FT   CDS_pept        198297..199985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_2371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15867"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEL5"
FT                   /protein_id="ABK15867.1"
FT                   /translation="MAQVLDLEEKRLGKLSPRDLAGELMKVPAKKRLELILQRSDAASV
FT                   VAAMEVRDYYFSVMEIGPDDALPLLAMANVEQLIHLFDLEWWEADRVKVSRAIEWLERI
FT                   EKANERNLLEWLYKVDFELLVILFKKWIRVQLMPDDTDPVEAREQLPRNTIDDVYFWEA
FT                   LYPQYEDLINRMLSLLFEAHPGFYRELMNAAIWALDPEMEEDAYRFHRGRMEDQAIPDF
FT                   YDALEVYRSIGLREIKADKQPFESPSEEFRPPAFALALIPEGDLLDRALQEVRRKSSLD
FT                   LVQMELASLANKVIVADRLPPEEPEMLRRAVEKTVACVNLGLELLSDGDLAVAVGAVEN
FT                   IHLEQLFRLAQTEIGNLRNRLLELLRGGWLSRWPEGIRCLDREWLERAELLIRRTPKLL
FT                   RPASTAGARSGEDFFRRESDLLEAGRFIESVSRIGRLYAALMPDPDLLDRKLWRGGQIG
FT                   SLAEVTLGSMILTSASRAVLDGQWRLDLIPLERWPVLFGLARPETLRKVIVQWAQTVLP
FT                   DNDLQGGVLEYLDSVLVAFREDMSGFTSSDPPDPRNVPLLLFTQG"
FT   gene            complement(200007..201329)
FT                   /locus_tag="Sfum_0166"
FT   CDS_pept        complement(200007..201329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0166"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /note="KEGG: sat:SYN_00797 tRNA 2-methylthioadenosine
FT                   synthase -like protein; TIGRFAM: RNA modification enzyme,
FT                   MiaB family; MiaB-like tRNA modifying enzyme; PFAM: Radical
FT                   SAM domain protein; Protein of unknown function
FT                   UPF0004-like; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15868"
FT                   /db_xref="GOA:A0LEL6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEL6"
FT                   /protein_id="ABK15868.1"
FT                   /translation="MTSKKVAVETLGCKVNQYESSVMMESLMQANWQPVSFKGAADLYV
FT                   VHSCAVTSSAAFQTRQLLRRARRLNPGALIAVVGCDAQLDHDRLAAGELATHILGTAEK
FT                   FDIARWIEVPASFAAPCRAVKGVNDIPRLSAQAVSCMHTGRTRAYLKVQDGCNAYCSYC
FT                   VVPYTRGRSRSLPADEVLSRLRRFVEVGYREVILTGIHLGQWGKDLTPTRDLAGLLDRI
FT                   GDSDSPPRVRLSSLEPLEWSAGLLRRISTVPWICPHFHIPLQSGDDDVLAAMHRPYTAL
FT                   QYANLIRELRMLFPEAALGADVMVGFPGETQRRFLNTLHLVEELPLTYLHVFPFSPRPG
FT                   TPAADMPGRIPGDETKKRARLLQDIGTRKRRQFSERFLGRSVEVLVESAAPRAGWLRGT
FT                   TANYLQVLFPAGPPVLPGSIVRVQVVRSGDRELIAAAPAGG"
FT   gene            complement(201343..202431)
FT                   /locus_tag="Sfum_0167"
FT   CDS_pept        complement(201343..202431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0167"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="PFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   KEGG: ava:Ava_4065 tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15869"
FT                   /db_xref="GOA:A0LEL7"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEL7"
FT                   /protein_id="ABK15869.1"
FT                   /translation="MERSLRVAVAMSGGVDSLRAAILLKEQGNDVFGVHMRHVPPSRTG
FT                   RWCAGAMIREKEAFLCELGLRFGFPIAVVDLRDAFESHVIEPFMEAYLLGQTPNPCIFC
FT                   NPAVKFGFLMEKARALGAERFATGHYARVSPPGPTSRRFRLLRGSDLSKDQSYFLYGLS
FT                   QDQLASTLFPLGSTRKRDVSAWAGQLGIASLFPGESQEICFVPAGKYHEFLTERLDTLH
FT                   APAEGPILDLEGRELGRHKGIFAYTIGQRRGLGIASSAPLYVVGLEPAANAVRVGRVGD
FT                   LDRDRLEVGRVNWVSIPAPNVPVRCRVRIRNQHAPAAAVVTPVGERSASVRFEAPQRAV
FT                   TPGQSAVFYDGDVVLGGGTISK"
FT   gene            complement(202592..203017)
FT                   /locus_tag="Sfum_0168"
FT   CDS_pept        complement(202592..203017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0168"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: sat:SYN_00800 ferridoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15870"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEL8"
FT                   /protein_id="ABK15870.1"
FT                   /translation="MYARMLVLRFPKDIVDKPIITYLVRDYNLTFNILKAQIYPRKEGM
FT                   LVLELRGSKRDYDKGIKFLKQVGVVIEPVAQGIRRDDDRCYQCGACTAVCPTGALRIKR
FT                   PEMAVLFESERCSACELCVKTCPARAMIVTFDKTLAL"
FT   gene            203358..204476
FT                   /locus_tag="Sfum_0169"
FT   CDS_pept        203358..204476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0169"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: dps:DP0126 related to
FT                   Xaa-Pro dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15871"
FT                   /db_xref="GOA:A0LEL9"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEL9"
FT                   /protein_id="ABK15871.1"
FT                   /translation="MSESMFDVRLERFRKLCGEEGLDAFLVANPENRYYLSGYEADDMH
FT                   LTESSGFLLITPDRRYLLTDPRYEEAARKEAPGFAVRIYTQGLSQVLAELLPEIRPERL
FT                   GAESSYLTWSRYKDVEEQLRKANPSAVVLGFEGLVERLRVIKEPMEIEWIKASLRLTED
FT                   ALVAVWNELAPGRKEKDIAWRIERYIREGGGEAVSFPPIVAAGPNGALPHAVPGERRIA
FT                   KGDSLILDLGSKLRHYCSDMTRTWIAGNPEPKLAEIYRVVREAQLAAQDQLRAGIDSVE
FT                   VDRVARDLIAKAGYGEYFGHGLGHGVGLAVHEGPSLRRFHGTILEENMVVTVEPGIYLP
FT                   GYGGVRLENMVRITATGCEVLNTRDLFLEQAG"
FT   gene            complement(204808..205995)
FT                   /locus_tag="Sfum_0170"
FT   CDS_pept        complement(204808..205995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15872"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEM0"
FT                   /protein_id="ABK15872.1"
FT                   /translation="MNIKQGPRESTSGWLALIGLASLLIWPCPSAHAQANKPLAAGPPP
FT                   VPVRILLAIPDEFASFSYASLIRGRETRHLFGAEAQAAFKNMIAPEFMVFKTRRVSSPA
FT                   AAMAMLSPGDPNNAQTREFDYLAIPRFARVNVSARGRKYGFDVDILVDFHATDGRTITT
FT                   IEGHGESTTGVHFSISPQEAGNLALRCSMEALRDAIIGRRELFVPIRARVEPPREESSR
FT                   SGPQAGRGSAPLPVKVLLAVPDEFSRYAHQIDPGEGGIENDIGGEAERQFRIILSPGFE
FT                   TLVIRPTESESAAMELLSSHSPANIDARGFDYVAIPRFTRIDSRVRGSHYMFSAEIQLR
FT                   FYPVSGLREVTIKGLGKYEGDLDGGAAEEATGRAIKTAVKAIRESIDQRHDLFLP"
FT   sig_peptide     complement(205894..205995)
FT                   /locus_tag="Sfum_0170"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 34"
FT   gene            complement(206485..206883)
FT                   /locus_tag="Sfum_0171"
FT   CDS_pept        complement(206485..206883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0171"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mmp:MMP1016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15873"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEM1"
FT                   /protein_id="ABK15873.1"
FT                   /translation="MKDLKAGSVMTKPVVFARKDTTARDITVQLLNGLYSGMPITDEED
FT                   QVIGIVTELDLLEAASEGRDLGELTAEEVMTKDPFTTDIDTPISEVINLMREYNIIRLP
FT                   VTEQGALVGIVSRCDILRKIIDPAQYVL"
FT   gene            complement(207442..208797)
FT                   /locus_tag="Sfum_0172"
FT   CDS_pept        complement(207442..208797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0172"
FT                   /product="MmgE/PrpD family protein"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: rxy:Rxyl_2736
FT                   MmgE/PrpD"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15874"
FT                   /db_xref="GOA:A0LEM2"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEM2"
FT                   /protein_id="ABK15874.1"
FT                   /translation="MGKSPLLSLKLAEFVEGLHYEDLPRETIRMARLAFLDWLGSALRG
FT                   SREQPALMVLSVLSAQGGTPQATLLSSKERTSALSASLGNGVASHIMELDDVHRASIVH
FT                   IGASVIPAALAAAEMLHADGRRLIEAIVTGYETAARVGEAVTPAHYYFFHNTGTCGTFG
FT                   ACAAAGKLLGLDRRQMVWALGNAGTQAAGLWEFLVDGAMSKHLHPGKAAQNGLLAALLA
FT                   GEGFTGASAILEGDRGFCRAMASEFNLARITDGLGKPPYKVEENSFKIHSSCRHTHPAI
FT                   DVTIDLAARHAIDPSLVSGIVVRTYRTAVQITDNPAPGTIYAAKFSLPFCVALALVRGS
FT                   CGIEDFSEANLHDAQIRDLMGRVRLVVDDDLDAAHPAKWAVAVEITTRTRETYSGRTDF
FT                   PRGDPENPADEAELIAKFRRMAISSRDGQTVDRLLESVMNLENVEDCARLPL"
FT   gene            complement(209007..209669)
FT                   /locus_tag="Sfum_0173"
FT   CDS_pept        complement(209007..209669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0173"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: ferredoxin; KEGG:
FT                   sth:STH2640 succinate dehydrogenase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15875"
FT                   /db_xref="GOA:A0LEM3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEM3"
FT                   /protein_id="ABK15875.1"
FT                   /translation="MDVVLKISRFDPGMDTAPRFQRFVVGVEPNQTVLDALLCAWRQDI
FT                   GLSFRRSCRSAICGSCAVRINGRPALACQTLMEKAVAEGEPVTIEPLPHFKLLKDLVVD
FT                   LEPFFESLKAVVPWLILREDYGGRMSPEVARSLEHPATCILCGVCEADSETSETLHPAG
FT                   LVKALRLARDPRDALGAHRIRLLQVPVEVLRLFVRELPDKCPKGIEITDDILRRGVT"
FT   gene            complement(209671..211299)
FT                   /locus_tag="Sfum_0174"
FT   CDS_pept        complement(209671..211299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0174"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: plt:Plut_1995 succinate dehydrogenase or
FT                   fumarate reductase, flavoprotein subunit; TIGRFAM:
FT                   succinate dehydrogenase or fumarate reductase, flavoprotein
FT                   subunit; PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15876"
FT                   /db_xref="GOA:A0LEM4"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEM4"
FT                   /protein_id="ABK15876.1"
FT                   /translation="MNVSGKADAAVLSKVYPTRSHSGAAQGGFNAVMGEDDSIEAHVFD
FT                   TVKGSDYLGDQEAIEVLCSDGPRVILDLERMGVPWTRAEDGRIAQRSLGGAGFPRACFA
FT                   ADFSGHVVLHTLYEQALKRGVKTYPEWHLLEILVDKGRVFGAVIYDLARARLEVIRAKR
FT                   IVLATGGYGRAFLKTTNGHANTGDGMAIAYRAGAVLSDMEFVQFHPTTLYGTNILISEA
FT                   ARGEGGYLRNALGERFMAEYAPGKMELAPRDVVARAIFKEIKEGRGFEGHYVHLDLTHL
FT                   GERLVAERLPQVRDLAIRYSGVDPARVPMPIEPAQHYSMGGVRTDVWGMTGLEGLMAAG
FT                   EVANVSVHGANRLGGNSLLETVVFGARAGRKAAELAPGEPWPDVSSNTVKDALDRWNRL
FT                   CLAPSAHSRSDDDQFAVRREMATIMTNQVGVFRTGVELEDAVARLEGLRKRYRDLPVPV
FT                   GPQPFNYGLMDYIEVGHLLDLSEIIARGALARRESRGAHYRLDFPQRDDRNWLHHTFAH
FT                   TTDRGPEFSAGPVSITRFQPQERGY"
FT   gene            211739..212182
FT                   /locus_tag="Sfum_0175"
FT   CDS_pept        211739..212182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0175"
FT                   /product="Calcium-binding EF-hand-containing protein"
FT                   /note="PFAM: Calcium-binding EF-hand-containing protein;
FT                   KEGG: rso:RSc3104 putative calcium binding signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15877"
FT                   /db_xref="GOA:A0LEM5"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEM5"
FT                   /protein_id="ABK15877.1"
FT                   /translation="MRSYVHRFAVSVLVVLCLSGCAFTESQAQTAGLFETLDVNRDGQV
FT                   TRNEFSQGMKLRVFKAIDRNADGQITWEEWQKVDTSPKAREHFDAMDTKKTGKVTYEDF
FT                   LQASGAYMDIDDVYISLDTSRDGLLSRGETTGFKGVRLFTVRF"
FT   sig_peptide     211739..211813
FT                   /locus_tag="Sfum_0175"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.586 at
FT                   residue 25"
FT   gene            complement(212287..212691)
FT                   /locus_tag="Sfum_0176"
FT   CDS_pept        complement(212287..212691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15878"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEM6"
FT                   /protein_id="ABK15878.1"
FT                   /translation="MRIAAPGESCLSAASPYNSSRRSSMMTRWAVEDSAGAPHSSGRRR
FT                   AWCRRMNTRRHRHHVDCLMALVSPDVALRNGNIRFPGHSGKQAGNKRSRRSGGPSRGEV
FT                   FSREDGDPARLSRHSRLALSRPLHLPYKTA"
FT   gene            212797..213237
FT                   /locus_tag="Sfum_0177"
FT   CDS_pept        212797..213237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15879"
FT                   /db_xref="GOA:A0LEM7"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEM7"
FT                   /protein_id="ABK15879.1"
FT                   /translation="MTQIFSIVTYVLAVLLLTGCSSMGDSSPSQGVIEKVDMSRVEVLP
FT                   TEDVMQGAKVRSFRSMDKDGDGAITWEEWQQEDTSQEAEARFDTLDGDKDAKIGYDEFI
FT                   KSENSYVDSEDVYISLDRQKDGMLSRGEEKRLEGVKLFKIEF"
FT   sig_peptide     212797..212871
FT                   /locus_tag="Sfum_0177"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.984) with cleavage site probability 0.882 at
FT                   residue 25"
FT   gene            213694..215004
FT                   /locus_tag="Sfum_0178"
FT   CDS_pept        213694..215004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0178"
FT                   /product="cellulose-binding"
FT                   /note="KEGG: mmp:MMP0898 cellulose-binding, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15880"
FT                   /db_xref="InterPro:IPR010620"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013431"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEM8"
FT                   /protein_id="ABK15880.1"
FT                   /translation="MKRKRYVCFFLGILLGLIGSPGLQAGMTPVLAIDGDGNSYVAGSS
FT                   LLGSSTDFTLVKYNTAGVRQWVRRYDGPDAAGDWLKAIAVGPTGDIYLFGQVRNTGYQG
FT                   DFGTVKYDPDGHLLWARFYGRPTNDEPQAMAVDEAGNVFVTGSVELDSAKCISTVKYKT
FT                   DGSRVWVRPYRGVAGRHNEARVLAVDGDGNVYVAGPSRPSSGPYDRLLTLKYDSDGNLL
FT                   WSRIHAGLIDPQAMAVDGSGNVFITGSIIPSGGYKDFFTIKYAANGDRLWVRTANGASD
FT                   LGDAAYALAVDGSGNVHVTGYSTGADGYDYLTIKYDPAGTRLWVQRYDGAAGDTDMAYS
FT                   VALDPDGNVYVTGRSDVAGASGNYLTVKYDPDGSLLWTRQFNGATNGHDFATAVAVRGG
FT                   ALYVTGESDGANSLADYVTIKYDLDGRRRWARRFERQ"
FT   sig_peptide     213694..213771
FT                   /locus_tag="Sfum_0178"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.952 at
FT                   residue 26"
FT   gene            complement(215795..216802)
FT                   /locus_tag="Sfum_0179"
FT   CDS_pept        complement(215795..216802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0179"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain; KEGG: sat:SYN_01112 UDP-N-acetylglucosamine
FT                   4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15881"
FT                   /db_xref="GOA:A0LEM9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEM9"
FT                   /protein_id="ABK15881.1"
FT                   /translation="MNILVTGAAGFIGYHLAYRLLKDGNTVIGLDNVNDYYDVNLKRNR
FT                   LKRLAPFQSFAFLKLDLHDTAGIEAMFRENAFDAVVHLAAQAGVRHSLTHPHSYVESNL
FT                   TGFVNILEGCRHHRIKHLVFASSSSVYGANVVMPLSVHHNVDHPLSLYAATKKANELMA
FT                   HTYAHLFGVPCTGLRFFTVYGPWGRPDMALFLFTRAILAGEPIRIFNYGRMRRDFTYID
FT                   DIIEGVVRMIPAPPSPNPQWDRESSDPATSYAPYRVYNIGNNRPVELMEYVAAIESCLG
FT                   KEAQKEFLPLQPGDVPATCADVSDLERDFGFRPSTTIQEGITRFIEWYRAYYSV"
FT   gene            complement(216833..217315)
FT                   /locus_tag="Sfum_0180"
FT   CDS_pept        complement(216833..217315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0180"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: gme:Gmet_2678 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15882"
FT                   /db_xref="GOA:A0LEN0"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEN0"
FT                   /protein_id="ABK15882.1"
FT                   /translation="MSKESFSNIAFCTDFSENADLSFETARDLASHYGATLHIVHVMVN
FT                   FSLAPPIHATYMPIEYDPKFVEQVTEAARGSIQERYVSKLAGSQRFDVHLLSGYASTEI
FT                   IRVAEERDIDLIVMGSHGLTGLAHVLFGSTADRVVRRAPCSVLTVRMKKKKMPEKP"
FT   gene            complement(217346..217834)
FT                   /locus_tag="Sfum_0181"
FT   CDS_pept        complement(217346..217834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0181"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: sat:SYN_00726 UspA
FT                   family domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15883"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEN1"
FT                   /protein_id="ABK15883.1"
FT                   /translation="MERFLIALDCTPGPLRSVHYVNRVLRGAVDSGFVLFHVLPTASPN
FT                   LLKRAEVQRLESLQEESPRLRGYFWKREDEERMDRTFREARQLLIEGGFAESGIVTHFA
FT                   LESDEIAQIIFDAAREMGCSTVVVGRRRLSRVKELLLGSVSNSLVKLARGISVWVVDY"
FT   gene            complement(217845..218255)
FT                   /locus_tag="Sfum_0182"
FT   CDS_pept        complement(217845..218255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tko:TK1170 threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15884"
FT                   /db_xref="GOA:A0LEN2"
FT                   /db_xref="InterPro:IPR015011"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEN2"
FT                   /protein_id="ABK15884.1"
FT                   /translation="MKLLMFHAPEFWFKTFDKAIPDAPDCKEEKSFRQAVVIFYQVEGE
FT                   DVGREDGIVSKWVKNAKWIAGKFATRTVILHSFNHLSLSKAPPETAHRLAAQVRGRLER
FT                   AGFSVFETPFGYLNEWKLHVSGESLAKVFKEI"
FT   gene            218430..218672
FT                   /locus_tag="Sfum_0183"
FT   CDS_pept        218430..218672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15885"
FT                   /db_xref="GOA:A0LEN3"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEN3"
FT                   /protein_id="ABK15885.1"
FT                   /translation="MSANGCAFPPFRFRDEWPMKERFSQVRLRVLVLRILMGLVFGFMV
FT                   TRFFFPRSTMGFMLLISALLVFFAYGMEWVHKGRD"
FT   gene            218770..219822
FT                   /locus_tag="Sfum_0184"
FT   CDS_pept        218770..219822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0184"
FT                   /product="HflK protein"
FT                   /note="TIGRFAM: HflK protein; PFAM: band 7 protein; KEGG:
FT                   pca:Pcar_2262 probable lambda CII stability-governing
FT                   protein (HflK)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15886"
FT                   /db_xref="GOA:A0LEN4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEN4"
FT                   /protein_id="ABK15886.1"
FT                   /translation="MVWQNPPGRTPGHDSFKDFEEILARLKNRYKLPPITGGPVFLIVL
FT                   VAAMILIGYNSFYIVQPQETAVIQRFGAYSHTAEAGLHAKLPFGIDTVRKVPTGRVLQH
FT                   EYGYRTVKPGVRSTFKEKEYEEEAVMLSGDLNVVNLQWMVQYKIQNPADFLFRVHDVEG
FT                   TLDDISESVVRRIVGNRYSDDVLTVGRASIADMAKVEIQAILDTYQTGVKIVTVQLQNA
FT                   NPPDMVKAAFNEVNEAQQERERMINEAQQAYNQKIPKAMGEARQAISQAEGYALERVNR
FT                   SQGEVQRFQNILAEYEKAPDVTRRRMYLDAMGELMGRVEHLYVIDENQRNLLPLFDLNR
FT                   GNKGDAKPGK"
FT   gene            219834..220838
FT                   /locus_tag="Sfum_0185"
FT   CDS_pept        219834..220838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0185"
FT                   /product="HflC protein"
FT                   /note="TIGRFAM: HflC protein; PFAM: band 7 protein; KEGG:
FT                   pca:Pcar_2263 probable lambda CII stability-governing
FT                   protein (HflC)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15887"
FT                   /db_xref="GOA:A0LEN5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEN5"
FT                   /protein_id="ABK15887.1"
FT                   /translation="MRQTESRGTDVISRKMSVVAVLAVVVGIVLYFSAYIVTETEQVVV
FT                   TQMGAPVGEPVTKAGLYFMTPFIQTANYFEKRIMKWDGSPNQIPTRDKKYIWVDITARW
FT                   RIKDPLLFLKRVGSVQLAHSRLDGILDSVVRDYVSNNDLIELVRSEGWEEAWQRLKEAG
FT                   IPDFQSTDPGAASEHLVKGREKITREMVADAAKLLPEFGIELHDIRIKRINYVESVQKK
FT                   VFDRMISERKRIAAQYRSEGEGERAAILGQMERELAKINSEAYRKSQELRGKADAETTR
FT                   IYAEAFNRNPEFYSFYRSLELYRDFNSSGSSFVLGTDADVFKYLKNGGKAAGR"
FT   gene            220855..222069
FT                   /locus_tag="Sfum_0186"
FT   CDS_pept        220855..222069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0186"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   pho:PH1879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15888"
FT                   /db_xref="GOA:A0LEN6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEN6"
FT                   /protein_id="ABK15888.1"
FT                   /translation="MAFYEENPQHITKADLVVGIPSFNEAASIGHTVRVVEQGLKEYFG
FT                   SLNTVIVNCDNHSTDGTKEQFFASPGEIPRIYLSTAPGTSGKGNNLRNLFEKVRELSAS
FT                   VVVVVESDVRNIAPYWIRNLGEPIVRGAGYAVPLYVRHKYEATLTSSLIYPFLRCLYGR
FT                   RIRQPNVGDFGFKGQLVDKFLDSPVWTEAVRHFGIDIWMTNIALSSRVPICQSFMGCPK
FT                   IHRVKDPYAHLRVMFHQVLSTVFDLMSVYADFWRQVKWSKPAALFGTDAHEVETPMPVD
FT                   IQPVKLHERFLEGFDKYSGIWQRIYDQTVFPKLQEIRSLEPQHFSFPTPTWARVLFDAA
FT                   NVYRRSSEAERSTLLDSLLPLYVGKVLSFVKKTERMSLQQAEEYVENECVIFEEHKPYM
FT                   VKVWE"
FT   gene            222091..222459
FT                   /locus_tag="Sfum_0187"
FT   CDS_pept        222091..222459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0187"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   dde:Dde_3609 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15889"
FT                   /db_xref="GOA:A0LEN7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEN7"
FT                   /protein_id="ABK15889.1"
FT                   /translation="MMPKILVVDDEEHIRLLYSEELKEVGYEVITAESGFKLLELIEQE
FT                   KPDLVILDIKMVDYNGLDLLQDIRNRFYDLPVILSTAYDTFKEDMKSIAADFYVVKSFD
FT                   LTELKQKIAMALETRLPT"
FT   gene            complement(222668..223750)
FT                   /locus_tag="Sfum_0188"
FT   CDS_pept        complement(222668..223750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0188"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   sat:SYN_00415 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15890"
FT                   /db_xref="GOA:A0LEN8"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEN8"
FT                   /protein_id="ABK15890.1"
FT                   /translation="MRIIPRYVLRHFLPVFMLALFTFTSLYLIVDFFENMEQFIEKRVP
FT                   AADTIAYFLNKTPSVAAQGIPMAALLGALITLGLLKRNRELIALEAAGVKTVTYVTPIV
FT                   AAAFFIAAVHLVLGETVSRSMNQVSTKIWNEQVQRRKGHFSWGVENVWYHGQNVIYQVR
FT                   FYDKRTQTLEKVSLFFLDPSFRLVQRLDARRFRWDGARWQAEQGLFLKFSESGTEQETF
FT                   DQRAFTLQETPADFSGLETIPEELDWLDLYRYAEKIRQEGYNSLPYIIELHLRVAFPLS
FT                   AIVLAILGIIIALRQSMHGGIALGVGIGLLVGSSYFVVQQLGCALAGAGALPPVVGVWA
FT                   ANVIFLAAAVYLWISNPSGG"
FT   gene            complement(223747..225018)
FT                   /locus_tag="Sfum_0189"
FT   CDS_pept        complement(223747..225018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0189"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   pca:Pcar_1922 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15891"
FT                   /db_xref="GOA:A0LEN9"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEN9"
FT                   /protein_id="ABK15891.1"
FT                   /translation="MQGRPIRDSGRGRPRNAKPAGGESRRETDDAIMKMTLYRYLIKEQ
FT                   MVPLGVCLMGVSLVLITGRLFQLLKVLFTSSFTLGDLMALVALAMPKLMLFALPMASLL
FT                   GVLLAFVRLNSDNELIALRAAGIGFHQFFPAVVSLLLGVTLISFVNMIFVIPPTGKAFE
FT                   VKLRSMARSGLPVLMKEGTFITAIPKLTFFFQSVNPTELSVRGIFVQDRREEKVRLAIV
FT                   AESARIVYQRDSNHLTFKIANGSITRVADDMKNAQAVSFKAYDLSLSLDELIGSARGSK
FT                   MNKREMTLRELYRVIVEKTGDVGHALEFHQRLAFPSGCLLLGLIGAPLGAVFRQRGRIA
FT                   GITIGLVVFLAYYVILSAGKGLGENHLVHPFLACWAPNLLCIAASFYLWRKMRLETPFK
FT                   TFQLLQEWASSWYRLRRARKGKKT"
FT   gene            225125..226159
FT                   /locus_tag="Sfum_0190"
FT   CDS_pept        225125..226159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0190"
FT                   /product="putative deoxyguanosinetriphosphate
FT                   triphosphohydrolase"
FT                   /note="KEGG: dps:DP1797 related to
FT                   deoxyguanosinetriphosphate triphosphohydrolase; TIGRFAM:
FT                   putative deoxyguanosinetriphosphate triphosphohydrolase;
FT                   PFAM: metal-dependent phosphohydrolase, HD sub domain;
FT                   SMART: metal-dependent phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15892"
FT                   /db_xref="GOA:A0LEP0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEP0"
FT                   /protein_id="ABK15892.1"
FT                   /translation="MRHELEEREARFLDPRAQLSRETRGRLKPETECTLRTAYQRDRDR
FT                   IVHCKAFRRLKHKTQVFLSPTGDHYRTRLTHTLETSQIARTIGRALALNEDLIEAVALG
FT                   HDLGHTAFGHGGESVLNDLVPGGFFHNEQSLRIVDILEKNGEGLNLTHEVRDGILKHSK
FT                   GRADPILLDPEARAETLEGQVVRVADITAYLNHDLDDALRAEILSADAIPPDIRMHLGA
FT                   RHSQRIHAMVEDVIHSTLEGDLIEVRMSEAMLARVDQLREFLFEHVYDLPQVREEFRRV
FT                   RKIIEDLFDVLMKDDAVFREEIGTPRDGTLKERQVYDHIAGMTDRYALDLYKKIFLPKP
FT                   WMKL"
FT   gene            226341..227336
FT                   /locus_tag="Sfum_0191"
FT   CDS_pept        226341..227336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0191"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mag:amb0964 periplasmic protein TonB"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15893"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEP1"
FT                   /protein_id="ABK15893.1"
FT                   /translation="MKKGRRPIELEDHDRTLGRGLELGADRYDEDEIIDLDEIIEVDAG
FT                   VLEDDEDFDLDVELIDLDADLDLDDLEPEVASSTGKQREEPFRLEVTQWPAPSLSVDEL
FT                   KAPAAQITVPRIEIPPAFEVKVQEPPSELKGPARAPEPEVDPLADLLEGLRKGPAREPE
FT                   PEVKVEEPPPEVRMKEPDYFDTLLAAEMSRSLEKEPQPTVEEAVGKLPELVDVAVTAAA
FT                   VAPAVLAAEAVATVSPAPAPAAPPELVAEPVVPPVGTVEVMAPVVSEPEVPAPKTISPE
FT                   PISEAQLEDLASRIESKLLEAVREIVEARLPGIVEAVLREEIDRLKKELA"
FT   gene            227493..230171
FT                   /locus_tag="Sfum_0192"
FT   CDS_pept        227493..230171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0192"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="TIGRFAM: valyl-tRNA synthetase; KEGG: pca:Pcar_2315
FT                   valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15894"
FT                   /db_xref="GOA:A0LEP2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEP2"
FT                   /protein_id="ABK15894.1"
FT                   /translation="MSEGILPKAYAFDEVESYWYDFWEKHGYFHADERSSKPPFCIVIP
FT                   PPNVTGQLHMGHALNNTLQDILSRYKRLKGFEVLWLPGTDHAGIATQNVVERQLAAEGL
FT                   NRYELGRDAFQERVWTWKAKYGGIIINQLKRLGASCDWERERFTMDEGLSRAVREVFVK
FT                   LYEEGLIYRGKRMINWCPRCMTALANIEVDGEETDGFLYHLKYPLLDGTGALVVATTRP
FT                   ETMLGDTAVAVHPEDSRYAAYVGRKVLLPVMKREIPVIADAYVDREFGTGALKVTPAHD
FT                   FNDFELARKHGLQLVQVIAEDGRMTEEAGTYAGMDRYECRRKILKELEHGGFLVKVENY
FT                   HHRVGHCYRCKSVVEPMQSLQWFVSTRPLADRAMKAVRDGSTAIVPAKWEKDYFIWLEN
FT                   LEDWCVSRQIWWGHRIPAWYCRDCGELIVAREEPRECSMCKGTRLEQDSDVLDTWFSSG
FT                   LWPFSTLGWPDRTPELDKFYPTSVLVTAFDILFFWVARMMMMGIHAMHEVPFREVYIHA
FT                   LVRDAQGQKMSKSKGNVIDPLVMMERYGTDAFRFTLAAFAVQGRDVKLSEERIEGYKHF
FT                   VNKIWNAARLLLMNLQGEASLEEIPSKPVQLMHRWILSRLQRVVGEVDSALENYHFNQY
FT                   ANVLYQFLWREYCDWYLEMIKPDLYGEDEAAGRLAKSISVRVLEQILVLLHPVMPFVTE
FT                   EIYQKLPGITGSIMKASYPAVRPEWIDSEAERAMEIIMGVVSGIRNIRGEMNVPPATRV
FT                   EAVCLCENSAAKELLDAHAVTVIDLGRLSELKVGIAGEMQKPAQAAGAVIPGVEVHVVL
FT                   KDILDFESESKRLRKELAKLEKEFGITRMKLSNEDFLGKAPPEVIEKEREKSGRLGEKI
FT                   EKLSRQSGLIDGLRASAAAGE"
FT   gene            230173..231000
FT                   /locus_tag="Sfum_0193"
FT   CDS_pept        230173..231000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0193"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: cya:CYA_0945 nicotinate-nucleotide
FT                   pyrophosphorylase; TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15895"
FT                   /db_xref="GOA:A0LEP3"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEP3"
FT                   /protein_id="ABK15895.1"
FT                   /translation="MDQLDVLLRMALVEDVGHGDVTTEGTIDAGLTGRAVVFGREPLVL
FT                   SGSDPFRRTFRLVDPQVRVESLFSDGEEVPADVPFFRMEGSVRSLLTAERTALNLLQRL
FT                   SGVATLTRRMVNALAGTSCRLLDTRKTTPLWRVLEKAAVRHGGGSNHRFGLFDGVLIKD
FT                   NHVAAVGGVREAVRRARRSAPHGLKIEVEVETLEQLEEALQAGADIILLDNFTLDLLQR
FT                   AVAINAGRALLEASGGVTLERVRVIAETGVDFVSCGALTHSAPAVDITMEYSS"
FT   gene            231036..231743
FT                   /locus_tag="Sfum_0194"
FT   CDS_pept        231036..231743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0194"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: gsu:GSU0768 AzlC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15896"
FT                   /db_xref="GOA:A0LEP4"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEP4"
FT                   /protein_id="ABK15896.1"
FT                   /translation="MKDFRKIFVAGIKAAWPICLGYFPIGLAFGVLARKAGIEPLYIGA
FT                   MSLLVFAGSAQFIAVSMLSAGTDPVSIVLTTFVVNLRHILMSSSLSVYFQHCSRKFISL
FT                   TAYGVTDESFAVNQTRFRSGSWTPGEALAVNQVSNAAWVSSTILGGYCGELIPEGSFGI
FT                   DYALSAMFISLLVLQLRGRLYILTALISGSLAVLLAVLLPGNIHVMAASLVAATFGFVL
FT                   RRQASRRVKDTHA"
FT   gene            231736..232056
FT                   /locus_tag="Sfum_0195"
FT   CDS_pept        231736..232056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0195"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; KEGG:
FT                   sth:STH456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15897"
FT                   /db_xref="GOA:A0LEP5"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEP5"
FT                   /protein_id="ABK15897.1"
FT                   /translation="MPETEYLLLVAGMGLVTYLLRWVPLFFFSRMVLPRGLVEWLDLIP
FT                   VSIMSALVFPDLLTSGAPKHLDLFQVKSIVAVPTLLFAFKTKSPGGTVLVGMLLYWLAG
FT                   RL"
FT   gene            232215..232961
FT                   /locus_tag="Sfum_0196"
FT   CDS_pept        232215..232961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0196"
FT                   /product="Translation initiation factor 2 (IF-2;
FT                   GTPase)-like"
FT                   /note="KEGG: aae:aq_2032 translation initiation factor
FT                   IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15898"
FT                   /db_xref="GOA:A0LEP6"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEP6"
FT                   /protein_id="ABK15898.1"
FT                   /translation="MIHKLKKRRGIPAGPLRVIGSRAQRPGPAVETLEIVLKCDSFGTV
FT                   EAVTTLLGKIGGREVEIKVIHSGVGDVTKNDILMALTGSRLVAGFNVGLAPRLEQWTKE
FT                   HGVEVRLYNIVYTLAEDLGALARSLIQTEPEERILGRAKVIATFKSSRGSIIAGCEVLD
FT                   GVLAHGRNFRVVKAMGPVFTSRIESLQVEKRPVREVRAGQQAGLKVTGFVDVRVGDYIE
FT                   CFDPPVGRRSSAWSPRGAVLRFDENA"
FT   gene            complement(232995..233810)
FT                   /locus_tag="Sfum_0197"
FT   CDS_pept        complement(232995..233810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0197"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: ade:Adeh_2480 pyrroline-5-carboxylate
FT                   reductase; TIGRFAM: pyrroline-5-carboxylate reductase;
FT                   PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15899"
FT                   /db_xref="GOA:A0LEP7"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEP7"
FT                   /protein_id="ABK15899.1"
FT                   /translation="MPDQKNFGFIGGGNMGEALIKGLLRASLCAAGHIHVFDVSPARLR
FT                   DLESTYGVRCRTSAAEVADSAQAIFLAVKPQHMEPALDGIASHLSRSQLIISIAAGIPI
FT                   SMIADALPEGQPIIRVMPNTPALVLQGASALARGRHATDEHMDLALGLFRSVGTAVEVE
FT                   EKLMDAVTGLSGSGPGYVLLIIESLIEAAVLLGLPRAVARELVLQTVSGTAGLVRETGR
FT                   HPAELKDLITSPGGTTIRGLHVLEERGLRGALMSAVEAAALRSSELGKK"
FT   gene            complement(233813..234103)
FT                   /pseudo
FT                   /locus_tag="Sfum_0198"
FT   gene            234595..234978
FT                   /locus_tag="Sfum_0199"
FT   CDS_pept        234595..234978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0199"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 3"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 3; KEGG: syd:Syncc9605_0203 NADH dehydrogenase alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15900"
FT                   /db_xref="GOA:A0LEP8"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEP8"
FT                   /protein_id="ABK15900.1"
FT                   /translation="MLPMQLKIDFLAVGLYLLAGIGFAVVPLIVSRLIVRRSRGARRDE
FT                   TYESGMETIGSAWIQFTVAYYIYALIFLAFDVDVLYLFPVALVYGKYGLRDLIEVMIFI
FT                   GILSLAIVYAWRKGVFEWKSRTE"
FT   sig_peptide     234595..234669
FT                   /locus_tag="Sfum_0199"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.626) with cleavage site probability 0.626 at
FT                   residue 25"
FT   gene            234957..235487
FT                   /locus_tag="Sfum_0200"
FT   CDS_pept        234957..235487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0200"
FT                   /product="NADH-quinone oxidoreductase, B subunit"
FT                   /EC_number="1.6.99.3"
FT                   /note="KEGG: mta:Moth_0978 NADH-quinone oxidoreductase, B
FT                   subunit; TIGRFAM: NADH-quinone oxidoreductase, B subunit;
FT                   PFAM: NADH ubiquinone oxidoreductase, 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15901"
FT                   /db_xref="GOA:A0LEP9"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEP9"
FT                   /protein_id="ABK15901.1"
FT                   /translation="MEEQNRVAPEEPAIQFAVLEDILNLARANSLWPMTFGLACCAIEM
FT                   MAAGASRFDLDRFGAGVFRPSPRQSDLMIVAGTISKKMGPAVQMLWDQMPNPKWCIAMG
FT                   NCAISGGPFEYEGQYAIVPGAHLIVPVDIFIPGCPPRPEALIQGFLALGDKITGGEHRN
FT                   YLRRFHRRGGTRK"
FT   gene            235487..235960
FT                   /locus_tag="Sfum_0201"
FT   CDS_pept        235487..235960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0201"
FT                   /product="NADH dehydrogenase (ubiquinone), 30 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone), 30 kDa
FT                   subunit; KEGG: dps:DP1319 probable NADH dehydrogenase,
FT                   subunit 9"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15902"
FT                   /db_xref="GOA:A0LEQ0"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEQ0"
FT                   /protein_id="ABK15902.1"
FT                   /translation="MSKTADFCGELRGILGGEAISADDGYRTGVAFSVRVPMERLQEVA
FT                   AACNAGGFYLETITALDFKDTKELVYHFNCYEPGSRFALRVLCGHDQTPPTISTIFASA
FT                   GWLEREVHEFFGIQFAGSFDLRPLLLPEDAEFHPLRKTFGIVAAYRKRDEIYA"
FT   gene            235953..237074
FT                   /locus_tag="Sfum_0202"
FT   CDS_pept        235953..237074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0202"
FT                   /product="NADH dehydrogenase (ubiquinone)"
FT                   /EC_number="7.1.1.2"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 49kDa;
FT                   KEGG: dps:DP1318 probable NADH dehydrogenase, subunit 7"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15903"
FT                   /db_xref="GOA:A0LEQ1"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEQ1"
FT                   /protein_id="ABK15903.1"
FT                   /translation="MPKRFLAPVTEQIYTLNLGPQHPSTHGVLRVLLDLDGEFIVKADP
FT                   VIGYGHRGHEKMGENRLFKQFLPNTSRLDYLSGFLFNHGYVLAVEKLAGIPVPPRAQFI
FT                   RTICSEFNRIASHLLWFGTYVMDLGGFTPFLYAFDDRERILDILDWVTGSRLTYSYCRF
FT                   GGVDRDIDTRFTDMARDFIKRLRSRWPDYHNLVTRNIIFIHRTRGVGVITPEQARQFGV
FT                   TGPNLRACGIAFDTRKAEPYEVYDQFDFEIPVGSDGDALDRYRVRFEEMEQSLRIIEQA
FT                   LDRLPGGPFMNDSVPTRLKPPKGEVYFAFESARGQAAYYLVSDGTPSPYRCHIRVPSFG
FT                   NLHVLTEVLRGTLVADAISILGSVDLVIPEIDR"
FT   gene            237139..238128
FT                   /locus_tag="Sfum_0203"
FT   CDS_pept        237139..238128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0203"
FT                   /product="respiratory-chain NADH dehydrogenase, subunit 1"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase, subunit
FT                   1; KEGG: mta:Moth_0981 respiratory-chain NADH
FT                   dehydrogenase, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15904"
FT                   /db_xref="GOA:A0LEQ2"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEQ2"
FT                   /protein_id="ABK15904.1"
FT                   /translation="MGHEGGTEWVRLIVGLVIILAFSQLNALFLVWLERKVAGRIQLRP
FT                   GPMEVGPHGLLQTIMDGIKLVGKELITPRSVDRKLFILAPVLVFMPVLVGFLVLPFGPG
FT                   LILRDMNVGILLIFSFSTFTVLAILAGGWASNNKYALLGAIRSVGQNVAYEIPLLLTVM
FT                   SVVLMVNSMRFSEIVAAQGRVWFIFLQPVAGLLYLICATAETNRAPFDIPEAESELVAG
FT                   FHTEYTGMRFGLFFLAEYTNMFIVTAVATSLFFGGWHGPFGFDFGLPGVVWFLIKTYVL
FT                   IFVIMWVRWTFPRIRFDQLMNFSWKFLIPVSLVNLVVTAVVLKLIDLN"
FT   gene            238145..238594
FT                   /locus_tag="Sfum_0204"
FT   CDS_pept        238145..238594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0204"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: dps:DP1316 similar to NADH dehydrogenase,
FT                   subunit 8"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15905"
FT                   /db_xref="GOA:A0LEQ3"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEQ3"
FT                   /protein_id="ABK15905.1"
FT                   /translation="MGNLKEILEGGWSLVEGMRVTFRRLLRPVVTVQYPREVVTLSPAF
FT                   RGHIELKSFADTGTHKCIACGTCERMCPSNVIKVQGTKAQPKGAKVATHYVIDFTRCSL
FT                   CGICVESCPTGTLQYSTEYELAGESRWDGVIDLMQRFEARRPQSL"
FT   gene            238615..239142
FT                   /locus_tag="Sfum_0205"
FT   CDS_pept        238615..239142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0205"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 6"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 6; KEGG: mta:Moth_0983 NADH-ubiquinone/plastoquinone
FT                   oxidoreductase, chain 6"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15906"
FT                   /db_xref="GOA:A0LEQ4"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEQ4"
FT                   /protein_id="ABK15906.1"
FT                   /translation="MNVLTGMDAAAHAGFWIVVGLTLAGASFAVFPRNILHNVLGLILA
FT                   LSGIGGLYLSLGSFFMGLMQLLIYVGAICVAIVFAIMLSRPLHLEVPKREAPKVAMAVA
FT                   TSVVFLVAMVGVVLRTNWVPAVERGTDWSVEAIGDLLLTRYALVFEVISLILLIAIIGA
FT                   IITAGFSRRLSS"
FT   gene            239139..239447
FT                   /locus_tag="Sfum_0206"
FT   CDS_pept        239139..239447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0206"
FT                   /product="NADH-ubiquinone oxidoreductase, chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 4L;
FT                   KEGG: dps:DP1314 probable NADH dehydrogenase, subunit 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15907"
FT                   /db_xref="GOA:A0LEQ5"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEQ5"
FT                   /protein_id="ABK15907.1"
FT                   /translation="MNTLTTYLVIAAVLFCLGLLGILQRRNLVGMLISLELMLNGANLN
FT                   FMAFNRFLAPEPAVGQIIALIVMGLAAAEAAIGLSIIFALFRRMHSINVERAQELRG"
FT   gene            239453..241411
FT                   /locus_tag="Sfum_0207"
FT   CDS_pept        239453..241411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0207"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /EC_number="1.6.5.11"
FT                   /note="KEGG: dsy:DSY2580 NADH dehydrogenase I chain L;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain L; PFAM: NADH-Ubiquinone oxidoreductase (complex I),
FT                   chain 5/L domain protein; NADH/Ubiquinone/plastoquinone
FT                   (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15908"
FT                   /db_xref="GOA:A0LEQ6"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEQ6"
FT                   /protein_id="ABK15908.1"
FT                   /translation="MTELLKDPVLLAVVMGATLPFLAMAVILIFTRHNPRLSSFISIGA
FT                   VTVSVCAALYLLYKLHGAGRPVQYQTEWLSSDTLVVPFGYLLDPLSLLMLAIVACISFL
FT                   VQVYSIGYMAGDTGYSRYYAFQSLFAWAMMNMVIAPGMLQLFIFWELVGLASYLLIGFY
FT                   YDKESASQAGKKAFVMTRLGDLGFFLGLIVLTLGFGNLGILDLNEAARTHQISQLLMTV
FT                   SALLIFGGVIGKSAQFPLLTWLPDAMEGPTPVSALLHSATMVAAGVYMFSRIFPLFAAS
FT                   PDAMAMALAIGTATMLLSSTMAMVTYDIKQVWAYSTISQLGFMVMALAAGGYFAGVFHL
FT                   TTHAGFKALLFLCSGIFIHEYHSNDMRLIGKGGGRRLVIPMACMTVGALALSGLPPFSG
FT                   FFSKEAILGVLAAHPNKLWLAAGLLGALMTAYYSFRLIFFILFPRGGIETPHGHSQGHE
FT                   HEAHAGGHGGLIFWAMAVPVMILATLTLFLGFFQSSIEHFLTGNAGRLAAAAHGAAQEA
FT                   GKAAHDGHGAGHYVLLVFAVCMALGGLGWAWVEFGRKKAAQVGFLGRFPRMWDLFAERW
FT                   YLDRLYRQFLDRGIYAGITSLFTRNDRRVIDGGIDGLCFFTVTGGRLFSFLQSGMLQYN
FT                   LLVMIGGVGVVVLLFLV"
FT   sig_peptide     239453..239530
FT                   /locus_tag="Sfum_0207"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.993 at
FT                   residue 26"
FT   gene            241428..242948
FT                   /locus_tag="Sfum_0208"
FT   CDS_pept        241428..242948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0208"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /EC_number="1.6.5.11"
FT                   /note="KEGG: mta:Moth_0986 proton-translocating
FT                   NADH-quinone oxidoreductase, chain M; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain M;
FT                   PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15909"
FT                   /db_xref="GOA:A0LEQ7"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEQ7"
FT                   /protein_id="ABK15909.1"
FT                   /translation="MFRTLNQQSTATDWLMTSMEMAHFPILSTILLSTVLGLLVILFIP
FT                   ADRPKLIKQVSLGFAGLGLVLCLWLYQAYDLQKGGLQFVERFLWVESLGIYYFNAVDGI
FT                   NLPMLLLTAVVLFTGVWTMWDLELRVKEFFALVFLLVAGVYGVFMSMDLFWIFVWYDVS
FT                   LFPMYPLIAIWGSTRKEYGAMKLTLYLLAGSALILPGILYLWAQAGGVTFDLFELQKIG
FT                   FSPFAQKLAFIFFYIGFGILAAVWPLHTWSPVGHVAAPTAVSMIHAGVLMKLGAYGILR
FT                   LGMTLCPEGLAYWADLMALLGTVGIVYGAFVGLAQTDLKYVIGYSSVSHMGMVGLGLST
FT                   MTVNGINGAVFQMFAHGVMTALFFSAVGYIYDRTHTKMIPDLGGLSRTMPVASAFFIVA
FT                   AFSGIGVPCMASFWAELLVFLSAVKTYPVRGILAVFGLVVSALFMLRVVQRTFYGERNE
FT                   RWAHIPDVPLFLATPRIILVSIIIFFGIFPKLMLDVIQSAVIPFVGSL"
FT   gene            242973..244394
FT                   /locus_tag="Sfum_0209"
FT   CDS_pept        242973..244394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0209"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain N"
FT                   /EC_number="1.6.5.11"
FT                   /note="KEGG: dps:DP1309 probable NADH dehydrogenase,
FT                   subunit 2; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain N; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15910"
FT                   /db_xref="GOA:A0LEQ8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEQ8"
FT                   /protein_id="ABK15910.1"
FT                   /translation="MMKWVLFIPELYYLLMAVVFFACSLSRRLQSGVLYRWAVILAGGG
FT                   LLATVLAVNQNGFIFFDCYRVDLYSQLFKILLALGTFWVIFSCSELQGIDSRYHAEFFL
FT                   LTTVCTLGMMMLVSANELLTVYVSIELSSYSLYLLVPMRKQTEIYVETGIKYFMIGVTA
FT                   SAFMLFGISFIFGVAHTTYVPDLVKTLPSLIKEPAAIIGLVLTLCGFFFKQALFPFHSW
FT                   APDVYMGAANQVTTYIATASKMAAAAMVIRFVNLSGGESPLFTQVLVGLAVLSMTFGNL
FT                   VAIIQKDLKRLLAYSSIAHAGYMMIGILTMSEHGVASAIYYSAAYLVMNFACFMVIMKV
FT                   ADDGRNLQIKELAGLHKRSPLLAMTLMLGLFGLAGIPPTVGFTGKFLVFAAALRKGYLI
FT                   LVIIGMINATISLYYYLIVIKAAYLLEPERPYPDVRVDTWTRALSYGLIVLMIYLGVFP
FT                   DQFVALTEAAARSLP"
FT   gene            244516..245967
FT                   /locus_tag="Sfum_0210"
FT   CDS_pept        244516..245967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0210"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afm:Afu4g13630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15911"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEQ9"
FT                   /protein_id="ABK15911.1"
FT                   /translation="MGFWMDLIRDILREPWIPRDPKTRAREAAPAPRRAAVPEAKPFCD
FT                   PRSVRACVSVCVPRGECSCHCNAVRDALMEEIARRRVGVVVGGAKFGCRGNCRNGPFLG
FT                   FPQRDFFYCKVNPRDIPGIVNETLINGRILFPLVSVNPERSYRPDIIYERDSGMLVGID
FT                   EHVCMVDVARCFADMEGASAAKSPAVAAVMVRIQEKVRRISGGIGTRADLEALRAILDE
FT                   LRLEVKADPTELGSGLLSAVSHFQDEFRQHVEQGGCPLGVCSKLTEEQVLAATAATQAE
FT                   MAKKAKPEVPKAEKKGPAPAEESRPVEAPGGKREKVPAAAPAPEPSVPAAESATPAAAP
FT                   VHGGPVAARVEAAVPVAAERPAEAEVPAVMPVTTAVEEHGAGPAEMPEAVPEAADTVSA
FT                   AADLAHRECVLSEEMPEASAQAEAMGIETPPSCQVPPVEEAAAIPDVPRGEVEKQPLAP
FT                   KKEKKKSGRKKKDASSKGKSSKKKK"
FT   gene            complement(246429..247736)
FT                   /locus_tag="Sfum_0211"
FT   CDS_pept        complement(246429..247736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0211"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: gme:Gmet_0888 peptidase
FT                   U32"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15912"
FT                   /db_xref="GOA:A0LER0"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:A0LER0"
FT                   /protein_id="ABK15912.1"
FT                   /translation="MTNTAPKMSAKSPPELLAPAGSLEKCRIAFLYGADAVYLGGKAFS
FT                   LRAYARNLHDEELAAAVFLAHRSNRKVYVAVNVFARDSDLDRLPPFLEYLEGIRVDGLI
FT                   VSDPGVLVLARRHAPGTPVHLSTQANTMNSMSARFWQEQGIRRVNLARELTFQEIAEIR
FT                   LRTSLELEMFVHGAMCVSYSGRCLLSAFLSGRSANRGLCSQPCRWSYRLVEEHRPGQYL
FT                   PIHEDDSGTFIFNSKDLCLIDELGDLTAMGIDAFKIEGRMKGALYLASVVRAYRQALDT
FT                   CRTAPEIRGAGASRRLDLDRVSHRPYSKGLLFGDSAGPDGNIHATADYEQTHTLAGLVR
FT                   LDPRDAGADEFDAPLMSGRVCVEVRSRLVPGMDLDFLFPDGTTETLRLSDFEDLGGNRL
FT                   ECAHPNTRIRIPVHFPTFPLQVIRTSLGTQSRSHEK"
FT   gene            247920..249080
FT                   /locus_tag="Sfum_0212"
FT   CDS_pept        247920..249080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0212"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: gme:Gmet_0890 smf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15913"
FT                   /db_xref="GOA:A0LER1"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A0LER1"
FT                   /protein_id="ABK15913.1"
FT                   /translation="MDTPHGASSGESDRIAWLALRLVPDLGNRSVLRLINRFGSPRAVL
FT                   DAEPKELATVEGLRGKAISALQRKEFLRHPETEWETLQRKGVKLLALNDPEYPSNLSAI
FT                   PDPPAVLFVRGELQPRDLVAVAVVGSRAASPMGMIFTEKLSGELALNGVTIVSGFAVGI
FT                   DSAAHRGAIKAGGRTIAVLGCGLDIDYPYGQGGLRDEIAASGALVTEFPLGTPPVAGHF
FT                   PQRNRIISGLSLGVVVVEAAHRSGSLITARLALEQGREVFAVPGMAHHYRSVGPHRLLR
FT                   EGAKLVEGAEDVLEELRPLIRRSAAPPGEPDERETPVSGLEPDELQALRELDGNPRHID
FT                   EIARSTQWPVGKVMAVLSNLELKGVARQLPGKYFVHTWKQTCRKSK"
FT   gene            249092..251395
FT                   /locus_tag="Sfum_0213"
FT   CDS_pept        249092..251395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0213"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.6.2.2"
FT                   /note="KEGG: sat:SYN_02798 DNA topoisomerase I; TIGRFAM:
FT                   DNA topoisomerase I; PFAM: TOPRIM domain protein; DNA
FT                   topoisomerase, type IA, central domain protein; DNA
FT                   topoisomerase, type IA, zn finger domain protein; SMART:
FT                   DNA topoisomerase I, ATP-binding; DNA topoisomerase I,
FT                   DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15914"
FT                   /db_xref="GOA:A0LER2"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A0LER2"
FT                   /protein_id="ABK15914.1"
FT                   /translation="MSKSLLIVESPTKAKTLGRYLGKDFIVKASVGHVKDLPKNRLGIN
FT                   LEKDFQPEYQVIRGKKKVISELHEAAAKSGAIFLGPDPDREGEAIAWHIAEEIGATDKP
FT                   VYRVLFYELTRKAIQEALAKPDRLNRELYEAQQARRILDRLVGYMISPILWQKVKRGLS
FT                   AGRVQSVALRLICAREKEIRDFDSREYWTITALLGTQASADAPAKSASRRFKAELFRCG
FT                   KKKCTISTGEEARELVDRLRPLDYRVSKVERRKKKRHPAPPFITSTLQQEAARKLHFSA
FT                   RQTMNVAQRLYEGLELGKEGAVGLITYMRTDSTRLSADAVQAVRDYIAGHWDKAYLPAK
FT                   PAAYKSKAGAQGAHEAIRPTDVNRTPETVAGFLTKEQLKLYTLIWKRFTACQMAPAVLD
FT                   QTSVDIAAGDYVLRASGSIVEFPGFMTLYVEGRENGDEDSETEGLLPELKEGEVLRLED
FT                   LKADQHFTQPPPRYTEASLIKELEDLGIGRPSTYATILSTILDREYAVVRKKSLFPSEL
FT                   GWLIDGLMVENFPSVVDVDFTAKMEKSLDEIEQGQHPYRNLLAEFYEQFSKTLESARTN
FT                   MVNLKAVGRRTDLQCPQCGLPLHIRWSRNGPFLACSGYPDCRFSSDYRRDEKGNIEPVA
FT                   EESTGETCEKCGRPMILKKGRFGNFLACSGYPACKNTKAPGTGIPCPREGCSGELVERV
FT                   SRGGRHFFGCSRYPECKTAFSGRPVPGKCPSCGTGPLIEKGGKGGSVKRVCVNPSCKYV
FT                   ETVPAAADRKAAKD"
FT   gene            251398..252189
FT                   /locus_tag="Sfum_0214"
FT   CDS_pept        251398..252189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0214"
FT                   /product="type 4 prepilin peptidase 1. Aspartic peptidase.
FT                   MEROPS family A24A"
FT                   /EC_number="3.4.23.43"
FT                   /note="PFAM: peptidase A24A, prepilin type IV; peptidase
FT                   A24A domain protein; KEGG: gme:Gmet_0959 peptidase
FT                   A24A-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15915"
FT                   /db_xref="GOA:A0LER3"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:A0LER3"
FT                   /protein_id="ABK15915.1"
FT                   /translation="MPVVLPMTIQQVLVFVVGCCLGSFFNVVIHRLPAGESLVHPGSRC
FT                   PGCRREIAFYDNIPLLSYVLLRGKCRHCGKPIGLRYPFVEALTGLFAVLLFRRYGWHAQ
FT                   FGIEFFFISLLIVITYIDLDTFKIFDLFSLGGLVAGFGFSFISIQVTWEESLVGIILGG
FT                   GLFFLIEKGYQWIRHDEGLGRGDVYLLAMIGAYVGWAGVVFTILVASVIGAAVGMIAMR
FT                   RANEGLKTAIPFGPFLSLGAIGYIFFGHSFYAWYLGDLLGI"
FT   gene            252205..252969
FT                   /locus_tag="Sfum_0215"
FT   CDS_pept        252205..252969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0215"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   sde:Sde_0467 PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15916"
FT                   /db_xref="GOA:A0LER4"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0LER4"
FT                   /protein_id="ABK15916.1"
FT                   /translation="MTRKRFFVERAVPGEGTIDLGVDAAHHIEHVLRLRAGEEVELIDG
FT                   VGGGWLGAIVEAGTGTVRVRITGRLGPPAESSLNLSLALAFSRADRMDLVLRQATEIGV
FT                   NRFIAFRSRRSQYALTGRAAGKRLERWQRIAREAVCQCGRLNVPEMVILSDVRELLAKI
FT                   EQRERSGNLLRILAFERGNGKGIVDLHRAFPQCTEVMVAVGPEGGWSSEEAELLTRNGF
FT                   HAVHLGPRILRLETAAAIVLSSVQLLWGDLGA"
FT   gene            252991..253632
FT                   /locus_tag="Sfum_0216"
FT   CDS_pept        252991..253632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15917"
FT                   /db_xref="UniProtKB/TrEMBL:A0LER5"
FT                   /protein_id="ABK15917.1"
FT                   /translation="MRCSKCGFVSFDHQSECKGCGASLAAVRDELGLPHVKSALPFTLG
FT                   SLTKEIDTKQTEVKGLVLDEPYDSTLPDIEFDDEYQGGSKPSAEQAPAPPSGGAARVSM
FT                   EDLISRSDAGADKEDSFSLDLDFLQTEEPTSRAQAPAASAVDAGAGKGNVGRYMPQAAP
FT                   SPAAPAKPSGTADDSLVIELSDSDLENILEDLKDVPPDPPHPGKGRAKIS"
FT   gene            253670..253745
FT                   /locus_tag="Sfum_R0006"
FT                   /note="tRNA-Phe1"
FT   tRNA            253670..253745
FT                   /locus_tag="Sfum_R0006"
FT                   /product="tRNA-Phe"
FT   gene            254353..254949
FT                   /locus_tag="Sfum_0217"
FT   CDS_pept        254353..254949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pcu:pc0490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15918"
FT                   /db_xref="UniProtKB/TrEMBL:A0LER6"
FT                   /protein_id="ABK15918.1"
FT                   /translation="MDSVDSKIRNRIRRCGKGCVVTPRDFLDLGSRKAVDVALHRLVNE
FT                   GSLRRLSRGLYDNPRVDPDLGTLSPTIDSVVNALKGRDKIRLQPSGGYAANLLGLSEQV
FT                   PTKIVFLTDGPKRQVRLGKQLIILKQTTPRTMATAGRVSGLVIQALRQLGQRRVDASVV
FT                   KRLRDQLSTQDKKQLLRDLRYAPAWIADKMRLIAQ"
FT   gene            254965..255960
FT                   /locus_tag="Sfum_0218"
FT   CDS_pept        254965..255960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pcu:pc0489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15919"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:A0LER7"
FT                   /protein_id="ABK15919.1"
FT                   /translation="MERFYGISAEKQRKFCEEAKSIVGYPPITIEKDFWVCFILRELFG
FT                   LQNWGQHLAFKGGTSLSKGWQLISRFSEDVDVVIRRGFLGFPDDHLGSKRREKLRKECG
FT                   RRIQEDLKPTFESRLREVLPDDLEWSLTLEDAIGDPDRSMFFQYPTIFKTEISYLKRIV
FT                   KVELGARSETEPIEDRPIQSYLAEAFPNIFGNSTFFIRTVTARRTFWEKAMLLHEETFR
FT                   PTDKPRKGRLSRHYYDLWCMINKSIGKEALADVELFDRVAQHRKIFFRQSWVNYETLKK
FT                   GSLRLVPPPEQMAEWRKDYEAMREDMFFDDPPPFDQLLEVILAFEEEFNR"
FT   gene            256576..259470
FT                   /locus_tag="Sfum_0219"
FT   CDS_pept        256576..259470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0219"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="PFAM: TPR repeat-containing protein; type I
FT                   phosphodiesterase/nucleotide pyrophosphatase;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: ape:APE1182
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15920"
FT                   /db_xref="GOA:A0LER8"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LER8"
FT                   /protein_id="ABK15920.1"
FT                   /translation="MIYWIMRLHFHSASTRGFAVAKVPDRRVLLIGWDAADWKVIGPLL
FT                   DAGKMPHLDRFINSGVMGNLATLYPDLSPMLWTSIATGKRPFKHGILGFIEPDPHTGGI
FT                   RPITNLSRKTKTIWNILSQTGRKCNVVGWWPSHPAEPINGVMVSNRYQKAVGPLDRPWP
FT                   LVPGTVHPARLVRNLANLRFHPQQLHSGHIHPFVPKFSEIDQDRDHRLESLAKIISECL
FT                   SIEAAALALMHHEPWDFTAVYFDGIDHFCHGFMRYHPPRADWVDERDFELYSRVVESGY
FT                   ILHDIMLGRLLEKAGEDATVLLVSDHGFKSDNLRPRHIPREPAGPAVMHRHYGVFAMKG
FT                   PGIKEDERVYGAGILDVCPTVLSLFGLPVGLDMDGKPLGGAFQDRPGIETIASWDQLEG
FT                   SAGMHGPEMKIDPVDASEAIKQLVALGYIEKPSEDREEAVAETVRELRYNQARSCMDAN
FT                   RYADAVSILEDLVEGWPFEHRFGIQLVTCYQAMGWLADARKLLESLFRRKEEDALASRE
FT                   KLRLFTEERTGKKPEEWSEEELRELRELRGRSSWNPYAVEYLMGSLLFSEGQKEAALDH
FT                   LKRAEAAAPGEPGIHAKLGAVYLRMKRWEDAELSFGKAVALDPDCAEAYRGLALCHLPR
FT                   RRNTDAAQAALEAIGRVYFDPMSHFLLGVALHRLGHIPRALEALKVAVSQNPNFPRAHR
FT                   RLSLIYKNRLQDVERAAIHHALAVEAARRVWNVRRKRVATSREEAAEAIGMRAGIEPVA
FT                   AKVDTCSVPAVSPTCGAVDLRETVVVVTGLPRSGTSMMMQMLAAGGIEPLTDGKREPDA
FT                   LNPKGYFEFEPAKNLQRDASWLPGARGKAVKVVAQLLPHLSPGLDYRVVFMEREMEEVL
FT                   QSQERMLGHRSKEGAVPASGKLKEVFSAQVSAIRKMLASRGIPTLSIAYGDSLEKPRET
FT                   AARVNAFLGGGLDEGRMAAAVDPRLKTVIGAKSA"
FT   gene            259524..261128
FT                   /locus_tag="Sfum_0220"
FT   CDS_pept        259524..261128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0220"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gvi:gll0640 similar to
FT                   glucosamine-6-sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15921"
FT                   /db_xref="UniProtKB/TrEMBL:A0LER9"
FT                   /protein_id="ABK15921.1"
FT                   /translation="MTRPRRDEDSLLTAHLAKRLTAYSAAAGVVLAMSPRAEAAIRWFQ
FT                   PATPLTVDHSTSISIDMDNDGIPDFSFAWTGSTFDVASVVVNRKHAANRFDGTGNVAQR
FT                   LLKGYVVHPTLDVGAALLMRAEWDCLPSSSARRIARPMTCYPTYLWGAGAFNEGASGYV
FT                   GVRFRGGGGEDYNGWIHFTGGTSAQHLSGRIDEWAYEDSGGAIKAGASTIAHAFLDDLN
FT                   GNGFSEYALLRVIQGASYFSSVLTNDIVTRTRIKEVPCLGPQFRPVGMTRINNVDGNGN
FT                   PALAILGVRENAAKEILAVRVELRNPASGELIRNIGFAKGYRPSGLRWLNRDMNGNGVG
FT                   EIAVLGTHPATGRSVVEIRDLLTGALVKRITVGPDSTVESIGLSYSNDLNGNGSQELVV
FT                   LQRNAKTLRSRLNVVDTKTGKRIKTIPCLSESWVPVGIASVGDLNGNKSLEQGILARRA
FT                   TANKVVVKIMDVRTGSILRTVSFNSRYSPQALATGDVDGNGVHELGVLGTNPADATNRI
FT                   EIRDPVTGSLKETILIP"
FT   sig_peptide     259524..259643
FT                   /locus_tag="Sfum_0220"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.947) with cleavage site probability 0.921 at
FT                   residue 40"
FT   gene            261500..263107
FT                   /locus_tag="Sfum_0221"
FT   CDS_pept        261500..263107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0221"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gvi:gll0640 similar to
FT                   glucosamine-6-sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15922"
FT                   /db_xref="UniProtKB/TrEMBL:A0LES0"
FT                   /protein_id="ABK15922.1"
FT                   /translation="MTKPRNNEDGLLAAHLAKRLTAYSAAAGLVLAMSPQAESAIHWFH
FT                   PSTPFEVDHSHTKTIDMDNDGTGDISFGLQPMGKTFWSLAVNRKNAAGRFDGTGRLVRR
FT                   LEKGSMVTPSLDADAAVLMNERYFTTCYPANGTNTSIICRWWTVWGDGAFNKEAKGYVG
FT                   VKFRGGSGKDYNGWVHFTGGNDPADLSGTIDEWAYEDSGGAIKAGAVTSQAAHAFLSDL
FT                   SGNGSPELALLQVTQGSSFGGSVLIRDIATGDEIRQVQCLGPLFRPVSMARISNVDGNG
FT                   NPALAILGVRENAAKEILAVRVELRNPASGELIRNIGFSKGCRPVALRWLNRDMNGSGV
FT                   GELAVLGTHPDGGRSMVEIRDLLTGALVKRITVGPDSTVESIGLSYSNDLNGNGSQELV
FT                   VLQRKAATQVSHLKVVDTGTGRTIKTIPCLSESWIPVDIASIGDLNGNGSLEQGVLARS
FT                   ATGEKVVVKIMDLRAGKALRNVSFNSAFLPQKLAAGDINGDGVYDLGVLGINLLDATTG
FT                   IEIRDPVTRSLIKTILIP"
FT   sig_peptide     261500..261613
FT                   /locus_tag="Sfum_0221"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.876) with cleavage site probability 0.642 at
FT                   residue 38"
FT   gene            263940..265433
FT                   /locus_tag="Sfum_0222"
FT   CDS_pept        263940..265433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0222"
FT                   /product="peptidase C1A, papain"
FT                   /note="PFAM: peptidase C1A, papain; KEGG: mma:MM3203
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15923"
FT                   /db_xref="GOA:A0LES1"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR040528"
FT                   /db_xref="UniProtKB/TrEMBL:A0LES1"
FT                   /protein_id="ABK15923.1"
FT                   /translation="MRSPGKYAAWRILCTVSLVVVIGVFFAVSPGVSQAQQLRQAPLNP
FT                   DFLKYREQLGQGRSPLRVTGEGHALGYIPPPIDLSYAKNLPDADSRAAAVEAVTYPATY
FT                   DLRTQHRVTSVRDQGDCGSCWAFATYASVESKLKGASGTGPSTNYSEQHLNATHGFDWA
FT                   ECDGGNDFISMAYLGRWSGPVNEADVPYPYAVDETAAVVRKHIQDVDQIKDRANYTDNN
FT                   RIKAAVTNHGALYISFKWLDTRYNAAKYAYWNNGTSGEGHAVAIIGWNDNYSRTNFKKA
FT                   GTALPGGNGAFLVKNSWGTTWGNKGYFWMSYYDKSLQTGTSFRGIQATSNYKRSYQYDP
FT                   LGWVTSLGVDTTVLWGANIFTARSDAPAIKAVSFYTGAPNTKVTIYVRKNVSATNPKSG
FT                   TQVGAAVTKTIPTMGYHTVVFSTPKAVTAGKKFSVLIKFNTPGFKYPLPVELAAADYSS
FT                   GATASANQSFYSTDGVAWTDITTYDSTCNVCIKAFGRAS"
FT   sig_peptide     263940..264047
FT                   /locus_tag="Sfum_0222"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.967 at
FT                   residue 36"
FT   gene            265672..266172
FT                   /locus_tag="Sfum_0223"
FT   CDS_pept        265672..266172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0223"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: sat:SYN_02087 hypothetical cytosolic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15924"
FT                   /db_xref="GOA:A0LES2"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0LES2"
FT                   /protein_id="ABK15924.1"
FT                   /translation="METWSQRDRPVLDIHSHQTGKDPVIEVMKDILRENDMCVLATCAD
FT                   NRPHCSLMAYVTDEAAQTVYMVTLKSTRKYRHVCENPHVSLLVDTRHKSATDRGGTRAL
FT                   TVHGTFHPLSDAAAKEKILAAIRGRHPHLRKLVDDADAEVLAVRVESLQLLEGAYRASY
FT                   ESL"
FT   gene            266567..267211
FT                   /locus_tag="Sfum_0224"
FT   CDS_pept        266567..267211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cya:CYA_2713 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15925"
FT                   /db_xref="GOA:A0LES3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LES3"
FT                   /protein_id="ABK15925.1"
FT                   /translation="MLFSRMDEEDDRVFYERDRLVAHLDSVALRTVESLIGRLVTGPKP
FT                   AILDLMASWDSHIPDSVQPSKVVGLGLNRNELAHNRTLTEFILHDLNRNPELPFDDDTF
FT                   DAVINTVSVDYMTRPFEVFAQVGRILKRGGLFLVVFSNRFFPQKATKLWRDSKEGARVV
FT                   LVKDFFRSVPVFDFPEDFLSAGKPRPKDDKYAHLGIPSDPIYAVYARKKES"
FT   gene            complement(267341..267559)
FT                   /locus_tag="Sfum_0225"
FT   CDS_pept        complement(267341..267559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15926"
FT                   /db_xref="UniProtKB/TrEMBL:A0LES4"
FT                   /protein_id="ABK15926.1"
FT                   /translation="MVELVDGQKYRLPNGEVVTARLYDGSFILEYRRKYRYPLAVGKDG
FT                   RLFLRGEGMSWTVQDLSPDEEEEQTVN"
FT   gene            complement(267812..268279)
FT                   /locus_tag="Sfum_0226"
FT   CDS_pept        complement(267812..268279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0226"
FT                   /product="GreA/GreB family elongation factor"
FT                   /note="PFAM: transcription elongation factor GreA/GreB
FT                   domain protein; KEGG: sat:SYN_00542 transcription
FT                   elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15927"
FT                   /db_xref="GOA:A0LES5"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A0LES5"
FT                   /protein_id="ABK15927.1"
FT                   /translation="MKVPITRLGYHRLLRELFFLRHVVRPEVIEELQEARTGGIKIENQ
FT                   QYMLARERHMVLQKKIQDLERKLASCEIVVGRKFFFKQAEFGTIVVIQNIETGETQRYQ
FT                   LVGPYESNVVDGKLSIDSPVGRHLVGRREGEEVLVYTPAGVRMYRVVSITL"
FT   gene            complement(268291..268848)
FT                   /locus_tag="Sfum_0227"
FT   CDS_pept        complement(268291..268848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0227"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: nma:NMA1263 ADP-ribose
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15928"
FT                   /db_xref="GOA:A0LES6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0LES6"
FT                   /protein_id="ABK15928.1"
FT                   /translation="MEEKIKTLSMIFASHFSAQLDVVRLRTGRLTERIKIDHPEAAAVV
FT                   PFLDAERILMVRQWRYAIGKETLEIPAGKADPGEELEACAARELREETGYEAARILPIF
FT                   EYYPAIGYSNEVIRLYAASGLRRITGKWDEDEISKVEIVGLDRVQDLILRGLIQDGKTV
FT                   IGVSLFKARREKGEIPEGFFRD"
FT   gene            complement(269107..269328)
FT                   /locus_tag="Sfum_0228"
FT   CDS_pept        complement(269107..269328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0228"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: gme:Gmet_1063 twin-arginine
FT                   translocation protein TatA/E"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15929"
FT                   /db_xref="GOA:A0LES7"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A0LES7"
FT                   /protein_id="ABK15929.1"
FT                   /translation="MFSLPELAVILAVVAVVFGPGKLPDIGKSLGKGIRNFKKATDEES
FT                   PVPQVPSKTAPAELEAAERIEQRPASNE"
FT   gene            269699..270307
FT                   /locus_tag="Sfum_0229"
FT   CDS_pept        269699..270307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0229"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: pai:PAE2336 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15930"
FT                   /db_xref="GOA:A0LES8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A0LES8"
FT                   /protein_id="ABK15930.1"
FT                   /translation="MAEKKMQPIKLSHPRTRGSVSIEEALLKRRSVRSYTGVPLSIEDL
FT                   SQLLWAAQGMSHPRGYRTAPSAGALYPLELLVAAGRVGALSPGVYRYDPHRHEIVLHRE
FT                   GDRRANLRRASLDQSAVGNAPAVLIFCAVYERTTRKYGERGVRYAMMEAGHAAQNVHLQ
FT                   VVSLGLGTVLIGAFRDDQVKSVLELGGNEEPLYLMPVGK"
FT   gene            270633..271286
FT                   /locus_tag="Sfum_0230"
FT   CDS_pept        270633..271286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0230"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="TIGRFAM: channel protein, hemolysin III family;
FT                   PFAM: Hly-III family protein; KEGG: dvu:DVU3295 hemolysin
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15931"
FT                   /db_xref="GOA:A0LES9"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:A0LES9"
FT                   /protein_id="ABK15931.1"
FT                   /translation="MRYKPRELMNGLTHCIAALLAVAGLVVLMLRAVDPPRPLHLLSFF
FT                   VFGTALILLYLTSTAYHWAQCSVKGLQRLRRLDHIMIFVVIAATYTPICLIPLRGPWGW
FT                   TLFGGIWALACAGVLMKMVWLQTPRWLSTTVYVAMGWLAVVAVYPLYRALQPAAFAWLV
FT                   AGGLFYTAGALVYALKKPDPWPRAFGFHELFHVLVVMGSFSHFWVLYEYVVRID"
FT   sig_peptide     270633..270731
FT                   /locus_tag="Sfum_0230"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.992 at
FT                   residue 33"
FT   gene            271546..274056
FT                   /locus_tag="Sfum_0231"
FT   CDS_pept        271546..274056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0231"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="KEGG: gsu:GSU1529 sensory box histidine
FT                   kinase/response regulator; TIGRFAM: PAS sensor protein;
FT                   PFAM: response regulator receiver; ATP-binding region,
FT                   ATPase domain protein domain protein; histidine kinase A
FT                   domain protein domain protein; PAS fold-3 domain protein;
FT                   PAS fold-4 domain protein; SMART: PAS domain containing
FT                   protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15932"
FT                   /db_xref="GOA:A0LET0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0LET0"
FT                   /protein_id="ABK15932.1"
FT                   /translation="MPAWAFRFMPVLTKRSFTDKVQTSVALFRTMKNDTPGGPQWIAPS
FT                   LEGNAVKVSMESPEDAMSECSSLRERVRELESAENPFRTALEDHDELIVRFRPDFTLVY
FT                   ANQAYCRHLADTEAPCVGGNFLDCVNPADHDRVREEIGSLVPDGPVKTVEHGVLLGGRE
FT                   VRLSRWVYRAMIGERTDVIEYLGMSCVQGERIAHPGPWNEYRFLAEKTGNAAYRLRCDS
FT                   RTYDHLGPAITRLTGYPLDEFDVSKFSELIEKIEIPGEEDVTPDTLIGFRKEGRTGEYR
FT                   ADYLIRTRLGERKWVRDHSFPWYDESGGLVGSVGILSDVTECKRAEEALQESEERFRNM
FT                   AGLSPFPIAIVDRNGKIIYLNQRFVDLFGYTASDIPTLWDWFNQACPDPGESRTIIERI
FT                   RSDLQAASKYEVISHEHRVRCKDGSSREIRFRLVSMENGDKFVTCEDLTEHMKIQEERI
FT                   KASKLESIGVLAGGIAHDFNNILTAIIGNISLAKLYGGQGGRVSEKLTEAERACMRAKN
FT                   LTQQLLTFSKGGEPIKKVIDVSDFLHEAVHFVLTGSNVRSVFFLPDDLWPVQCDEGQMG
FT                   QVINNLIINAKQAMPDGGTIEISAENVILNAGDQALPLKPGRYLRIGVKDYGHGIPEEA
FT                   LTRIFDPYFTTKLKGSGLGLATAYSIIKKHEGYIQVESRVGEGAAFHIYLPVAGWSLRE
FT                   HDKMGDDTLRGRGRVLVMDDEDIILNCTYDLLRYLGYEVELARDGAEAVELYQEAVGLS
FT                   RPFDAVIMDLTVPGGVGGVEAMQRLREIDPKVNAIVSSGYSNDPIMSQYREYGFRGVIT
FT                   KPYKLEQIGELLKTIVRRKWDAVE"
FT   gene            complement(274155..274583)
FT                   /locus_tag="Sfum_0232"
FT   CDS_pept        complement(274155..274583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0232"
FT                   /product="uncharacterized domain 1"
FT                   /note="TIGRFAM: uncharacterized domain 1; PFAM:
FT                   thioesterase superfamily protein; KEGG: mta:Moth_0402
FT                   phenylacetic acid degradation protein PaaD"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15933"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0LET1"
FT                   /protein_id="ABK15933.1"
FT                   /translation="MMDEAVREAIVRRMSEEPFANKLGIRLVAIEAGYSKVRMEVTSEM
FT                   ENLCGMAHGGAVFALADAAFETASNSHGTVAVALSMTITYLAASSAGAVLVAEATEVNR
FT                   TRKTACYDIRVHDGDEKLIAMCQATVYRKETPLPYLGV"
FT   gene            274640..274924
FT                   /locus_tag="Sfum_0233"
FT   CDS_pept        274640..274924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15934"
FT                   /db_xref="UniProtKB/TrEMBL:A0LET2"
FT                   /protein_id="ABK15934.1"
FT                   /translation="MPMMSRAVPHHRTDRASPSYRMGSLSQPILPAGGSGVNFHRTNDV
FT                   CAARPGGSTATLPGKGAPVIPVQCMSREVPSLRRIGSVPRRVFWLAKDS"
FT   gene            275413..275958
FT                   /locus_tag="Sfum_0234"
FT   CDS_pept        275413..275958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0234"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="KEGG: gme:Gmet_1305 transcriptional regulator, MucR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15935"
FT                   /db_xref="GOA:A0LET3"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:A0LET3"
FT                   /protein_id="ABK15935.1"
FT                   /translation="MSKKLLEITAEIVQAQATVGKMSPEEIELTLVRTFATLQRMQTAE
FT                   DGGKPLDPGAPCEDSRLEDRTGDKGGPMDSIQENKVVCLECGVEMRQLTAKHLGSHNLN
FT                   PREYKRKWGLPLKQSLSAKSLSKARSKAARKRGLPANLVKFQEERKRKKAEASRAAAPQ
FT                   GQRPGEGKKTGGPPKPVE"
FT   gene            276032..276505
FT                   /locus_tag="Sfum_0235"
FT   CDS_pept        276032..276505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0235"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: chy:CHY_2251 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15936"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A0LET4"
FT                   /protein_id="ABK15936.1"
FT                   /translation="MFSVSEIVDVAIQLERNGERFYRRGIEMVSDDSMRQLLRWLADEE
FT                   VRHREQFAAIKAGFLRREESRAERVGGSILQSAVSDHAFSLDEVDYSSIVDEAMLVDIA
FT                   IGFEKDGITFYEIMQGFIDEPETLALIREISDEERKHIEVLTERKDVLESRAV"
FT   gene            276536..277189
FT                   /locus_tag="Sfum_0236"
FT   CDS_pept        276536..277189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0236"
FT                   /product="protein of unknown function DUF1121"
FT                   /note="PFAM: protein of unknown function DUF1121; KEGG:
FT                   dde:Dde_2335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15937"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR009501"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0LET5"
FT                   /protein_id="ABK15937.1"
FT                   /translation="MDKPFDHYWQLRLSDLKETLEANNFEVFLADNKEQACKLVLERII
FT                   PGIGAKSVSWGGSMTFVATGLYEKVKALPGLEVIDTYDRSIPREEATERRRRALLVDLY
FT                   ITGTNAVTETGKLVNLDMTGNRVASIIFGPRNVILLIGRNKVVPDLEDAMLRVKNFTAP
FT                   VNAMRLDMQTPCVSTSFCEECKSPSRICNTWTITEKSFPKGRIKIVLINEDLGI"
FT   gene            277620..278678
FT                   /locus_tag="Sfum_0237"
FT   CDS_pept        277620..278678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0237"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_1936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15938"
FT                   /db_xref="UniProtKB/TrEMBL:A0LET6"
FT                   /protein_id="ABK15938.1"
FT                   /translation="MDKGSCNVVVTGDLTGEMEPEQAKNHLCRSFGCDRAVADILVGGQ
FT                   AVVIKKNVSRAVAMQYATVLREAGVVCEIEDAAELEAEPTRPGSGEERPAAPVVGTPPV
FT                   VCPNCGHAGSSPEECVKCGIIYARYRQAKVPETGADDSFSISTGKGREKGTPFKLLLLL
FT                   VVLGLGVYFIRFKGEVRHPPGILVDSEPTQIIGRSSQSWVKGTKTVVPLARFRIKARVL
FT                   STERYRFGEQAELCPLDLALGWGIMSDQRMLDKLVIAQGNRRYALEPLDPNVRLPWAEI
FT                   MSHSSNVHIIPANEEIEEAVFRFRPGDIVELQGYLVGVKENGQWVWFSSLSRTDLGDGA
FT                   CEIFWVERAAVR"
FT   gene            278822..279436
FT                   /locus_tag="Sfum_0238"
FT   CDS_pept        278822..279436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0238"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: cef:CE1106
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15939"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0LET7"
FT                   /protein_id="ABK15939.1"
FT                   /translation="MSRILLIRHAHTDMIGVALSGRMPGVCLSNRGREQAERLAADFVQ
FT                   VPLDVICSSPLERTLETAQAISGTTGAPVEIRDGLIEIDYGEWTGWKLTDLMTDEQWRM
FT                   FRSFHGGMRIPGGEHIDEVRVRMVGEVEELQRRFPTGVVALVSHADPIRAVLAHYAGIP
FT                   PELSHRVTISLASVSVLAMNDGPPRILCINRTEDLRHYLEA"
FT   gene            279792..280568
FT                   /locus_tag="Sfum_0239"
FT   CDS_pept        279792..280568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0239"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   tbd:Tbd_1473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15940"
FT                   /db_xref="GOA:A0LET8"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0LET8"
FT                   /protein_id="ABK15940.1"
FT                   /translation="MTMQPYSESRPNEASFTVASYNTHRCVGIDRKYDPERTARVIREL
FT                   DADIIGLQEIDAGFYRSQGSRQLERLADATGLNVVNGPTKRGTGGHYGNVLLTSRKVVG
FT                   VRRIDLSVYGREPRGAIDVDLDVDGEIVRVMVVHLGLGGLERRRQVNRLLHGCSSEQEQ
FT                   LHVVLGDINEWFPLGRPLHRLHRHFGKSPARRTFPSFLPVLALDRIWVKPLDALMEISV
FT                   HDTVLSRVASDHLPIKATITRMDATAACAGSLSGVK"
FT   gene            complement(280561..281214)
FT                   /locus_tag="Sfum_0240"
FT   CDS_pept        complement(280561..281214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0240"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: dde:Dde_2191
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15941"
FT                   /db_xref="GOA:A0LET9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A0LET9"
FT                   /protein_id="ABK15941.1"
FT                   /translation="METDSGDRYRRLAPLYDGLTAPFLWSVRSDIRRIVQECGYRTVLD
FT                   VCCGTGRMAMMLHGSGFSVSAVDLSPSMLARARKNSPPGIRYFLEDAARLHFQTASFDC
FT                   AIISFALHEMNPSKRMHVLAETSRVTRKGGAIIVADYIRPRGMLANGFRAVVNIVERIA
FT                   GKDHHANYVTFVREGGLEPLAAGLGMKLTVRRRAFMDNAAVMVIEANGTPRTLI"
FT   gene            281321..282484
FT                   /locus_tag="Sfum_0241"
FT   CDS_pept        281321..282484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0241"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pca:Pcar_2468 major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15942"
FT                   /db_xref="GOA:A0LEU0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEU0"
FT                   /protein_id="ABK15942.1"
FT                   /translation="MLYSPTFFSMAVANLSCLASFSVFYLFPLFITQHGGDKADVGIIM
FT                   GATALASVVFRPWISEMIDRMGRKRSYTLGSFLMTVLPLVYLYFDGTIVSFYLPLLIIR
FT                   IVHGIGFAVCITAAFTFVADLVPKDRLNEGIGMFGVSGLVGSALGPAVAELIIRRFDFD
FT                   TLFYSAAGFSLIGLLVHLPLTETYIHTLKTVKVPFFAVLKQGRILGVAVIAVLFGIGLA
FT                   AVNNFVSPFAHAVHLSFISVYYVAYSTAAILTRVGGARLVDSLGEDRIIPYALLLTGLG
FT                   LMSMVFLGGTGVLFAAGLLTGCGHGILYPSLNVRAIRGQPIEIRGKIVGVYTGSIDAGV
FT                   FAGSIILGYVGDLLGFRVLFLSAGVALLAGLGIFAATAGRALRARGI"
FT   gene            282742..284157
FT                   /locus_tag="Sfum_0242"
FT   CDS_pept        282742..284157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0242"
FT                   /product="cardiolipin synthetase 2"
FT                   /EC_number="2.7.8.-"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   zmo:ZMO0314 cardiolipin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15943"
FT                   /db_xref="GOA:A0LEU1"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEU1"
FT                   /protein_id="ABK15943.1"
FT                   /translation="MDGFLTAAQWIIPIAMVPVAAHGHSPVGALAWLLFIFFKPWAGLI
FT                   LYFLFGTNLVMRRLTKSYCQRLREVRSFSDLAIMEPHVFGLSSEQTEHRLAKMTERLAC
FT                   MPILQGNEVEFIDNGFAVIDRMIADIGKARDHVHLLFYIFNDDEVGRRVAEALAGAAAR
FT                   GVPCRVVVDAFGSRSLNGSLGEWMVKRGIDFQTLMSINPFRRHLTRLDLRNHRKLAVID
FT                   GTIAYTGSMNIETKDYDQGRAEAWHDLMVRVTGPVVMQLQLVFGEDWYLATDKLLEGPG
FT                   IYPVLDRGGTVPMQAVPTGPMDPTTVLRDLLIAAVSGARERIIITSPYFIPDESLRVAL
FT                   HLASLRGVSVELVIPFNADHPVVGAVARAHFECLIDGGVNIYFHRGVLHAKTMSVDDEV
FT                   SLVTTANFDRRSLFLHSELSLFLYGREVTARLRDLQSKYIAHSDKVDPARWKRRSVIRR
FT                   SRDEILKLLSPVL"
FT   gene            284217..285914
FT                   /locus_tag="Sfum_0243"
FT   CDS_pept        284217..285914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0243"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein; KEGG: xac:XAC0422 ABC
FT                   transporter substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15944"
FT                   /db_xref="GOA:A0LEU2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEU2"
FT                   /protein_id="ABK15944.1"
FT                   /translation="MTISLKPEHLKRYKDLVWLLVKYGRSDIISQAGLDTIIPEQELPS
FT                   PVVSPKVDELPHDLEKLGPTYIKLGQFLSTRSDLLPPQYLEALSRLQDSAEQFPFEKVE
FT                   EILILELGQRTTREFASFDPVPLAAASLAQVHRAVLRDGRLVAVKVQRPGIRRRVIQDL
FT                   EAFDELAEFLERHLSLAKRFMLQATVAEFRKAVMRELDFRQEAQNLIVLARNLRDYDLI
FT                   VVPTPIEEYSSTRVLTMDYLEGRKLTTIGFTEPLAAERSKLADHLFRAYLQQIFLDGFY
FT                   HADPHPGNLYLTGDGRLALVDLGMVARISGASQQKLLRMMVAIGEGRSEEAAEFAVELG
FT                   EKTLLFDEKRFRKEISDLIIRYQRATIKEIQAGKILLELLKAAGNSGIRFPSEFTMLGK
FT                   TLMNLDAIGRILDPSYDPNAALRRYSGQLLRQRIRKTVSAANVFEMLIDSQDFLRLLPK
FT                   RIGKIIDLVAENRVRMQANVIDEKYLMTGLQKIANRLTLGLILAALIVGAALMMRIRTE
FT                   FTLFGYPGIPILFFLVAVIGSLALVFSIVIHDERVRRMKRPRDEDGEK"
FT   gene            complement(286140..286481)
FT                   /locus_tag="Sfum_0244"
FT   CDS_pept        complement(286140..286481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chy:CHY_0896 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15945"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEU3"
FT                   /protein_id="ABK15945.1"
FT                   /translation="MFELIRKSFLAGLGVVVLTKEKVQEFTRMLVEEGRLSTEEADKLA
FT                   DDLVKSGQRQWDEINAKTQETVKKLVNAVDFVRRKEFQDLTARVEALEQRLGMTADTKE
FT                   ADEPKAEGS"
FT   gene            286842..287123
FT                   /locus_tag="Sfum_0245"
FT   CDS_pept        286842..287123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0245"
FT                   /product="transcriptional regulator containing an HTH
FT                   domain fused to a Zn-ribbon"
FT                   /note="KEGG: hch:HCH_05553 predicted transcriptional
FT                   regulator containing an HTH domain fused to a Zn-ribbon"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15946"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038767"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEU4"
FT                   /protein_id="ABK15946.1"
FT                   /translation="MKTVRQEMIEELVKGEQTALGLSKSLRRSEKDIYEHLEHISRSLT
FT                   SQGKRLTIVPARCLECGYLFESRNRFTSPGRCPRCKGTHIEDPRYRIE"
FT   gene            287176..288366
FT                   /locus_tag="Sfum_0246"
FT   CDS_pept        287176..288366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0246"
FT                   /product="protein of unknown function DUF362"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF362; KEGG:
FT                   gme:Gmet_3040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15947"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEU5"
FT                   /protein_id="ABK15947.1"
FT                   /translation="MRIPSGREGLILCREPAAHGICEKCRFDPMTKVILERASYEYGSL
FT                   RTHIFSMLESCGISVGEGRKVLLKPNLLAPASPEKAMLTHPLVVRVAAEYVLEKGGVVQ
FT                   LSDSPAMGGFDKVLRESGIKDALAGLPVEFKEFRDSVPVEVGPPFNRLELAADALDADV
FT                   LINLPKLKTHGQMLLTLGVKNLFGCVVGLRKPQWHLRTGVDREMFAALLVTIYRKLMPS
FT                   VTILDGILAMEGNGPGRGGKPKELGLLMASTDAIAVDMTVCEMLGLPADALFTNAAAAR
FT                   AGIAPARIDVRGDKFRIQGFQLPKMTPLVFGPKFTHKLMRKFLVQRPQADPLLCKACGD
FT                   CRKYCPAGAITQAGSKIEFDYDRCIRCYCCIEVCPHGALRAVEPYPGRLFNRIIRR"
FT   gene            complement(288481..289383)
FT                   /locus_tag="Sfum_0247"
FT   CDS_pept        complement(288481..289383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15948"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEU6"
FT                   /protein_id="ABK15948.1"
FT                   /translation="MRFSKGYDRKPELLPARPGTATSPRSRTSFLLLVSFLLFTCVFPA
FT                   WASDEKDPWKVLDEGLGVAEFSSSSSDELEYRITVVRIDPRYYAFKLINASENTREKMT
FT                   AREWSRQFNLIAAVNAGMYQEDGLASVGYMKNFDHVNNPRLGRDKTVLAFNPSGPDVPE
FT                   VQIIDRECQDFNSLRQKYRTFVQSIRMISCDRKNVWRQQAGRWSTVAIGTDETGKVLLL
FT                   FCRSPITVHDFIEVLLTLPLSLQRAMYLEGGPQASLYLSTGKTTLERYGSWEPALEQNS
FT                   SIQIPLPVPNVIGIVKKTP"
FT   sig_peptide     complement(289240..289383)
FT                   /locus_tag="Sfum_0247"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.998 at
FT                   residue 48"
FT   gene            complement(289787..290029)
FT                   /locus_tag="Sfum_0248"
FT   CDS_pept        complement(289787..290029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0248"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   sme:SMc00796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15949"
FT                   /db_xref="GOA:A0LEU7"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEU7"
FT                   /protein_id="ABK15949.1"
FT                   /translation="MTRWFQYRRKASGLPRKEVKKGVFPMIAWALIFLAVAIAAGVLGF
FT                   GGIIGAQAWIAQVLFILFLVFFLVSLLSGRKPPVT"
FT   sig_peptide     complement(289910..290029)
FT                   /locus_tag="Sfum_0248"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.490 at
FT                   residue 40"
FT   gene            complement(290425..292389)
FT                   /locus_tag="Sfum_0249"
FT   CDS_pept        complement(290425..292389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_0728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15950"
FT                   /db_xref="GOA:A0LEU8"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEU8"
FT                   /protein_id="ABK15950.1"
FT                   /translation="MYEDKELKEYRDLLKPPEKFEEGFGWKSIVGAIFIGFLMMPGSMY
FT                   LGLVVGTGIGPAARWVTIILFAEIAKRAYTRLSQQEIFVLYYMAGAALASPFSGLLWNQ
FT                   YLVQSEAARMLGLTQHIPAWIAPQPGSEALVDRTFFHRDWLIPVLLMVGFELISAVDHF
FT                   GLGYALYRLTSDVEKLPFPMAPVGALGNMALAESTEKEESGWKWRVFSVGGMIGLAFGA
FT                   LYVLLPAASGVILSEPIRLFPIPWIELTHATEDFLPAVATGIQLDLGLLFLGMVLPFWA
FT                   VIGGGVGLIITMVANPILYNYGILHRWHKGMGTVDTVFANNFDFYMSFSIGLGLAIAVI
FT                   GIVHVSISFRQKYQGTLKERFRVLFSPPPGRGDFSVWIAIAIYVVSTTAYVILSSLLVP
FT                   GFPWIFLVAYGFIYTPIISYVSARMEGIAGQFVSLPMVREASFIAASRFFGYTGIGIWY
FT                   APIPFHNYGKATVRWREIELTGTSFRSIIKAEILVIPVVLIASLLFSQYIWKLAPIPST
FT                   QYPYAQELWHLQALNSLLLQSATLEGNSPFFQALKLNYLGWGMGLGMATYWLLAALRLP
FT                   VMLIYGVTRGIGQTTPHGIILEILGALLGRYYFTKKYGLSWRQYAPVLLAGFSCGMGLM
FT                   GMLAMGFTLIMRSLRSMAY"
FT   gene            complement(292505..294484)
FT                   /locus_tag="Sfum_0250"
FT   CDS_pept        complement(292505..294484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP1756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15951"
FT                   /db_xref="GOA:A0LEU9"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEU9"
FT                   /protein_id="ABK15951.1"
FT                   /translation="MRELRIRFPALAFGLVLVLLCCVFTPYNNIRLQNSPVAGGHFPLA
FT                   SFVCLFIILVVVNPALGAINRKWRFHYHELLLIWAMVTVATGIAYTGLMRTFIINITSP
FT                   TWLKLSSGETGQLLQSFLPSALFPNDPEMVRTLYSGFSGGIDMTWWQVLSRIPWSAWLT
FT                   PMFWWAIFIGLVYMAMLGMVGLFSHQWIENEKMNFPLLRVPEVLSQEAEDKTLRRFLTH
FT                   RYFIVGLTIPVLLHLLNGLHTYFPQVPQIPTLVLAQPYIPKEGLLSGFYKMKIYIYPAF
FT                   IGFAFLASKQVSFSLWSFFILGGLLPGILKLVGWRFPAAALGTTFGPVLSKVEEMQMIG
FT                   AFGMYFFFLLWLSRQHLLAVLKSAFSRSRETPEYCGLMSPRPALYLFFIGIVGITAWLT
FT                   FFGMSLLSAILFLAVCFMLQLVASRLICQGGLPYFTLTLAPSDGFLAFLDTRLIGPATL
FT                   GMAVILQKVTFLDMRESLMPSICHASKLSDGSRPRNRFLWGIVWAIALGMVVSFAAMLA
FT                   LYYRYGVNALPDDWAIESTRRVHENVTHLFSHPEEPKSWSIAFTLIGAAFMGLLVMGYH
FT                   RFIWWPLHPIGYLVTYSSAMQILWFGFFIGWLCNTLVLRYGGANLYREIRRLFIGLIVG
FT                   DMIMAVIWLIVGLFTPISYHVLPL"
FT   gene            complement(294563..299332)
FT                   /locus_tag="Sfum_0251"
FT   CDS_pept        complement(294563..299332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0251"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   dps:DP1755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15952"
FT                   /db_xref="GOA:A0LEV0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEV0"
FT                   /protein_id="ABK15952.1"
FT                   /translation="MPTDAKTRSGFNRAARIVLLAWLTACPLWSGLFPGVGYGREVMDH
FT                   VAFFTDLKDRSAGSPGSDAAADYILDFFKKAGLSEVASQQFLTPVPEVVSASIEAEGRT
FT                   VNLYPWGPNLVYLPMTPENGLRGQLIYAGRGDFKDFDRTRLYESIVLMDMESSGNWINA
FT                   ASFGAAAIVFIGRDDSVKGQFEEKDTRTPLTIPRFWVPAGDGEALKRLAMEKTPQAVVK
FT                   SKTRWQNKLVRNCYGLLKGSDPKLRKEMVVVDAAYDASFRVLGLAPGADEATSVAALLI
FT                   LAEEFSRHPPARSVLFVATVGNNESHDGMRHLIWSVKTKKKSLKKLTNQLKDTKARIDD
FT                   QYDLLEKGRYLEQEKPADRESILEILVEKAKDRADALSREIQYRRSASALELAEAQEGP
FT                   RAYRQIAMVNDIGRLTAQQRELAVQLLDEAVEDRRATHKELKVRVQAMKSSTALRGLLE
FT                   EYTQVLFFDLHLSSHYETLGLIETGETFPVRESIRKISRAGRLIGLFTQSGRETAAETG
FT                   IPDIFRDTSRGASPEEISVRAGSVCHPASDVASIAGLPAVSLVSLEDRRLLWSTPADTL
FT                   DRMDRKKVETLSGFLPPALRRLFSEPSLKSAVDAGVSGLSNLEGQAMFIRQGELFPDQP
FT                   ASGTIISILQGDSVFRTMVLRDGTYFMPGLANKRVSLEKLILEPYGIDPATGRIGIAAD
FT                   KAKTGKENYRISVKSDLASAPLIMFRCLQTDILPIFNPRNMGYLTKLELIDAATEAPPL
FT                   RHWYSRVDGRDTMSISLFLEKGTRFKLIMSESLLGKEFFLLNGIPENPNGIGFLVGEPP
FT                   TVSVAPYHVAKDLYSLVGGRLRNLFQHGIVNVHLEELYRQAGTELEQGILALSEHRYGD
FT                   FWDRVATAWAKLDIVYAEVEGNQRDVLGGVMFFIALFVPFAYCMERYIFCFRGIYQQIV
FT                   AFFLILIMTILAIRGLHPAFQLTYSPMVVIIAFFIVGLSLLVSAIIFIRFEKEMEDLQT
FT                   RQAHLRTPQASKWQAFGAGFSIGVSNLNRRKLRTGLTCVTLIILTFTVMSFTNVKSLHR
FT                   STLTRIAEDNPYEGVLLRHQFRLPMTMLTLEDMKARFGPEGASIWPRGWIEPAGLTERT
FT                   ISAVYASGRHAPVEGLLGLGPSAPEVFTRLVTKGRWLNETDDRAVLLPLAMAARLGLDP
FT                   ERDLNVPVEIMGARFTVVGFFDGSALDEAKDLDRHPITPAYLEVSHGEELSEVEIEAMQ
FT                   TGEELLPQTERFRYAAGNRTVIMPFAKCVEYGGKLKAVSILPRSSPTEIADRLSTWLAY
FT                   PLFVGENGTWYHSASTTLRYSGVANLLVPILIVIFITLNTMIGHVHERQKEISTYTSVG
FT                   LAPTHVGFLFIVEALSLAVISTVLGYILAQLSAKYLGNTAMFSQLTFNYSSLASVACMF
FT                   LVFSVVFLAALYPARLAAQIAMPDVNRSWTLPAPEGDVIHMNLPFLLKAEEEAGIMKFL
FT                   KAFYGSHQDVAHGSFIVDEIDMDDALPPVRPGQNPIPVCIVIRTNAWLAPFDFAIKQRV
FT                   HLHCCPSEENPGYLEIAIQMTRISGERSAWVRANNSFIKALRKQMLLWRLLDADTKAIY
FT                   YLPEQSETAG"
FT   gene            complement(299332..300066)
FT                   /locus_tag="Sfum_0252"
FT   CDS_pept        complement(299332..300066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0252"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dde:Dde_0731 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15953"
FT                   /db_xref="GOA:A0LEV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEV1"
FT                   /protein_id="ABK15953.1"
FT                   /translation="MNPVLSHNVVRLSEVTKVFKMGNNVVEALKGVNFSIKAGEYISIM
FT                   GPSGSGKSTLFNMIGALDKPSTGRVFIDEVDVAQLDAYELAWLRCRKIGYIFQTFNLIQ
FT                   VMTAIENVTLPMIFAGMSRDEYMEKGMVLLRLVGLAERCHHKPSELSGGQQQRVAVARA
FT                   LANDPAIILADEPTGNLDLSTGEEIIALLKQLSTERKVTIISATHDIKMLNVSDRVVWI
FT                   RDGRIDRVEERDKLKISIGQVA"
FT   gene            complement(300093..300749)
FT                   /locus_tag="Sfum_0253"
FT   CDS_pept        complement(300093..300749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0253"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   dps:DP1753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15954"
FT                   /db_xref="GOA:A0LEV2"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEV2"
FT                   /protein_id="ABK15954.1"
FT                   /translation="MDDRIQRQVVLPFSQLVKISFNSIRVRFFRSLITTLTLALAVAFV
FT                   SFTWSGYELLNAFFPHADGTVQAGILAGGYELENGRFGAGAKDQWLVILSLLVCVVGIV
FT                   NAQLMAVTERFREIGTFKCLGALDSFVVRIFVLESIYQGLFGGFVGGLAGVLIATGSFL
FT                   FRAGWICLACWPPGSMLLTVAGTTLLAVVLSLLGAIYPALVAAKMQPAIALRNEE"
FT   gene            complement(301178..302302)
FT                   /locus_tag="Sfum_0254"
FT   CDS_pept        complement(301178..302302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_0735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15955"
FT                   /db_xref="GOA:A0LEV3"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEV3"
FT                   /protein_id="ABK15955.1"
FT                   /translation="MKIMFYSQHVLGIGHFFRSMELASALANHEVLFVEGGDALPGYVP
FT                   PPHVRRLPLPGLMMDQDFKAIHAVEGTVGETRARRKQLLLGTFLSFRPDVLITELFPFG
FT                   RKQFRFELMPLLECIRQEGMSTGVICSLRDILVEKADQDAYEKGVLEILNAHYHHLMVH
FT                   SDPRIMRLDETFSRVDEIAIPMSYTGFIARKPGRRRRPPRRRTIVVSSGGGKVGVDLLE
FT                   AALTAFRLLPELDAGLRMFIGPFMEAADRNVLASLAARDSRTSIEEFSYDFLDCMAESS
FT                   LSISMAGYNTCMDILSAAVPALVYPFPQNREQMLRARKLEELGFLKVLDGLDPHGMASA
FT                   AAAAMARRKLQSESMPPDLAGAANAALIVEKCLG"
FT   gene            complement(303178..304347)
FT                   /locus_tag="Sfum_0255"
FT   CDS_pept        complement(303178..304347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0255"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   gme:Gmet_2405 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15956"
FT                   /db_xref="GOA:A0LEV4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEV4"
FT                   /protein_id="ABK15956.1"
FT                   /translation="MFLLARYSYRNLWVRRLTTALTAGGMGLVIFVFAAVLMLAAGFQK
FT                   TLVTTGSPDNAVFVRRSSEAEVQSLVSREEAAIVESMPEIGLGRDGTKLAAREAVILIN
FT                   LSRRDTGNLAHVTVRGINPKLSMQLRPRVRISAGREPRSGTSEILAGRSIMQRFAVGGL
FT                   GQTMSFGSRTWTVVGILDAGGTGFDSEIWADVEVLMTTFRRSAYSSVIGRLREPSAFQD
FT                   LRKRAMSDPRLTLETWRETDYYASQSELMARFIRILGLTLTLIFSLGAVIGSMVTMYSA
FT                   VANRVSEIGTLRALGFRRATILTAFLLESVFLSLVGGGLGLAAASFMNRISVSTMNWQT
FT                   FSELSFRFALDSSIVVNALAFAVVMGLVGGILPALRAARMNIVTALRLQ"
FT   sig_peptide     complement(304243..304347)
FT                   /locus_tag="Sfum_0255"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.919 at
FT                   residue 35"
FT   gene            complement(304391..306253)
FT                   /locus_tag="Sfum_0256"
FT   CDS_pept        complement(304391..306253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15957"
FT                   /db_xref="GOA:A0LEV5"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEV5"
FT                   /protein_id="ABK15957.1"
FT                   /translation="MSELLHSFHIPVMGTAFTIESPFKVARYGISSVISLVDDTLIEKM
FT                   RRFYCRVMGRECTHIRKQDHDSRADRITAYLNLMDEAVKEQFEKLKASAFEMGSEITKY
FT                   FELLPETSPLKQLYKAMQSLKDSVEKRRIQDELRERIKPGAIDVNIMTKVDRHTFDGNG
FT                   EPLPSEFSDALAALRGYARSSVESSIVFSAGFNGRLYGYAEQFDDFHADENGNIKKKIV
FT                   IKVNDYRSALTQGKFFAKKGLWVSEFRLESGLNCGGHAFAHGGALMGPSLEEFRNRKDE
FT                   LIATLFEIYNRALRQKKKRTFDRPHALRITAQGGIGTAGEQSFLLRHYRLDATGWGTPF
FT                   LLVPEATTVDPTTLKRLCEAGREDLFLSDVSPLGVPFNNLRTSLSEEAKRARIRTGKPG
FT                   SPCTKGYLKSNTEFSETPICVASRAYQERKIEQILAGGSDPESARAAIEAVTSKSCLCT
FT                   DLGGTAILTHGLAESEDGPCVPAICPGPGLAYFTRAVSLREMVDHIYGRADIIENRTRP
FT                   NLFISELEMYIDYFDNELRRSLPHPNEQTAKYLREFETNLLEGIAYYQELIPRWSDGPP
FT                   EYRARMKRDLGLCRERLLEVASHFHDMPSLDPDAGLAIGRETAL"
FT   gene            complement(306763..308058)
FT                   /locus_tag="Sfum_0257"
FT   CDS_pept        complement(306763..308058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0257"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   ade:Adeh_3810 tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15958"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEV6"
FT                   /protein_id="ABK15958.1"
FT                   /translation="MNQAISQRDWITLVEILDAAINLLRGKNVDPVRLAILHFGNNASM
FT                   FGLPALARVANKLDAFLIQHLTPDYEDEPASLLCFAMEGVRTKMKTLGYDQDFSASLEE
FT                   TVQFLEFFSEAENWPSHTGYTLTNDARVTVPARQAHPPESSPETPDEPVSLDYSLDSAG
FT                   LEESPQSVQSSTETPGSEPLHPGDSTPRQLEMTFPGGAPAAAHAAPPQGAEGASSAGEK
FT                   RRTRRALQHLIEEAGRAAAAFKPEDQSADEVMAYKTLLKHDPRSLVFAMLADALCSQGR
FT                   WAEAVEVCEQGLIFHPQHLRARVLLGWALWELKESREAFVVLSGAREEMEKNALVYLVL
FT                   SKIVETEEPEKSREYREIHRKLQPAGGKPPIPEDVPAEPETAAMQSSTLLSFLSRLGAE
FT                   FHDRKLLRQRGIDLLSARERQALMEAFRSAMN"
FT   gene            complement(308166..308858)
FT                   /locus_tag="Sfum_0258"
FT   CDS_pept        complement(308166..308858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0258"
FT                   /product="Endonuclease V"
FT                   /EC_number="3.1.21.-"
FT                   /note="PFAM: Endonuclease V; KEGG: pca:Pcar_0602
FT                   endonuclease V"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15959"
FT                   /db_xref="GOA:A0LEV7"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEV7"
FT                   /protein_id="ABK15959.1"
FT                   /translation="MSDGIRHSWDLTPREAIALQRELAGRVVLRALPRNFRILGASDIG
FT                   YVKAGERLAAVMLTFSWPDLLPLEAVHAICPVRFPYIPGLLSFREIPPLIEAFEQLKKR
FT                   PDVLLCDGQGIAHPRKFGLAAHLGLYLGLPTIGCAKKRLCGIHASPPNKKGCSVPLYLD
FT                   REAVGSVYCSRDNVKPIFVSPGHLCDQKSAERLVARCLGRYRIPEPLRQAHLLATKLRL
FT                   EISISSNG"
FT   gene            complement(308896..311082)
FT                   /locus_tag="Sfum_0259"
FT   CDS_pept        complement(308896..311082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0259"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase large subunit, N
FT                   terminal domain protein; KEGG: gsu:GSU1871
FT                   ribonucleoside-diphosphate reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15960"
FT                   /db_xref="GOA:A0LEV8"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR024434"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEV8"
FT                   /protein_id="ABK15960.1"
FT                   /translation="MTLVKKEHPLRMTPNALVVLRKRYLEKDDEGKPIETPEELFWRVA
FT                   RTIAQADVAFQGPEKAEETADRFYALMTSLDFIPNSPTLMNAGRPLGQLSACFVLPVED
FT                   SIDSIFEAIKHAAMIHKSGGGTGFSFSRIRPENDKVLSTQGVASGPVSFMSVFDTATET
FT                   IKQGGTRRGANMGILRVDHPDIEKFITCKTDNDRMTNFNISIAVTDSFMKAVEEDAEYE
FT                   LISPRTRERVQSLSARKVFDEITQSAWRNGEPGIIFLDVMNRHNPTPHVGEIESTNPCG
FT                   EQPLLPYESCNLGSINLASMHRDGNIDYEHLKEVVWDAVHFLDNVIEVNNYPLQIIEDM
FT                   TRGNRKIGLGVMGFSDLLISLGVPYNSEAAVETAEKVMSFIQQESKAASAHYGKERGNF
FT                   VNYAGSIYERPETPHMRNATTTTIAPTGTISIIAGCSSGIEPLFAISFVRKVLDGQELV
FT                   EVHPLFQKVARERGFYSDDLMKKIAEKGSIKNFLEIPADVRNVFVTSHDVTPDWHIRIQ
FT                   AAFQKHTDNAVSKTINFPFSATPEDVSSAYLQAYKLGCKGLTIYRDGSRDVQVLNIQRK
FT                   PQYPQVEPRPRPDRTTGITERVNTGCGKLYVTINSDEYGFCEVFAQMGKAGGCAYSQIE
FT                   ATSRLISLALRSGVKVEAVIRQLVGIRCPSPTWGNGEQVVSCSDAIAKVLNRHAHANVT
FT                   SVGDEMGACPDCGAAVEHEGGCIVCRSCGFSRCS"
FT   gene            311600..313495
FT                   /locus_tag="Sfum_0260"
FT   CDS_pept        311600..313495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0260"
FT                   /product="chaperone protein DnaK"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; KEGG: sma:SAV7237 putative DnaK protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15961"
FT                   /db_xref="GOA:A0LEV9"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEV9"
FT                   /protein_id="ABK15961.1"
FT                   /translation="MAKAVGIDLGTTNSVVAIWENGAATVIANSEGSRTTPSVVGYTED
FT                   GQRLVGQIARRQAILNPSATVYSAKRFIGRKWGEVDEESKIVSYKVVRGQGDVVRFEVR
FT                   GKTVAPEEVSAQVLRKLVDDASKYLGEKVTEAVITTPAYFNDAQRQATKDAGEIAGLKV
FT                   LRIINEPTAAALAYGLEKKKNETIMVFDLGGGTFDVSILDVGEGVCEVRSTSGDTHLGG
FT                   DDFDKRVVDWLADEFKKETGIDLRGDRQSLQRLYEAAEKAKCELSSTTETQVNLPFITA
FT                   DSTGPKHLVMKLTRAKFEDLTHELVQRCMKPVEQALADARLTAKDIDEVILVGGSTRIP
FT                   AVQELVKKLTGGKQPNMSVNPDEVVAVGAAVQAAVLKGEVEDVVLLDVTPLSLGVETLG
FT                   GVMTRLIERNTTIPSRREEVFSTAEDNQSAVDIVVLQGEREMARDNRVLGRFRLEGIRP
FT                   APRGVPQVKVIFDIDANGILSVTARDQETGKEQNVTISESTNLPKSEVERMVNDARSHA
FT                   SEDKTRRETIENRNQADSLAYQLERSLKDFGDKVPLHEKARSEQLVQDARAAVKDESTG
FT                   KERYQQLISDLQQAVQMVSAAAYSQAGGAQAGAAGGTRERPAGGDDVIDAEFTER"
FT   gene            313700..314674
FT                   /locus_tag="Sfum_0261"
FT   CDS_pept        313700..314674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0261"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: noc:Noc_1382 heat
FT                   shock protein DnaJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15962"
FT                   /db_xref="GOA:A0LEW0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEW0"
FT                   /protein_id="ABK15962.1"
FT                   /translation="MAVKFRDYYEVLGVPRTATQEEIQRSYRKLARKFHPDVNKARDAE
FT                   DKFKEINEAYEVLKDPEKRKKYDLLGENWKTGQEFRPPPGWDYQYDFGRGGGQGEFQWG
FT                   GSGGFSDFFEMLFGGQRGGRARGGARRGGGPVWSQAGADQEATVRISLEDAFHGATKSI
FT                   TLQMQSLTPDGQVAVQEKTYEVKIPVGIMSGRKIRLSGQGGEGMGGGPRGDLYLKIEIE
FT                   PHAVYRLKDRDIYVDLPVAPWEAVLGADVQLTTLSGQVTLKIPPGTQSGQKLRLRGKGM
FT                   PNPKETAGDLYVVVQIMVPKHPSRREQELFEELRKESAFNPRL"
FT   gene            314693..315025
FT                   /locus_tag="Sfum_0262"
FT   CDS_pept        314693..315025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0262"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="KEGG: sma:SAV7240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15963"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEW1"
FT                   /protein_id="ABK15963.1"
FT                   /translation="MVEKRYFMINVKTVTSSSPFLTRNELAVHCGIHPDLIDRFIRLGL
FT                   IDFMDRDSDGEAVFSAEVIPLVRRILRLRNELGVNYAGIGVVLELMARVETLENHIKEL
FT                   ESRIFA"
FT   gene            315111..317732
FT                   /locus_tag="Sfum_0263"
FT   CDS_pept        315111..317732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0263"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; Clp N
FT                   terminal domain protein; ATPase associated with various
FT                   cellular activities, AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: pca:Pcar_0359 putative ATPase with
FT                   chaperone activity, two ATP-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15964"
FT                   /db_xref="GOA:A0LEW2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEW2"
FT                   /protein_id="ABK15964.1"
FT                   /translation="MDLNKLTIKSQEALKAAETKAIRYGHVEVDVEHLLLALLEQSQGL
FT                   IPSLLRKMDVQVDRLRERLEQELEKKPRVSGPGIEPGKVYITQRLNQLLIKAEEEAGRL
FT                   KDEYVSVEHLLLAFIQEGGATPAGRLLQENRVGKDAFLQTLTSVRGNQRVTSASPETTY
FT                   EALQKYGRDLVQEARTNKLDPVIGRDSEIRRVVRILSRKTKNNPVLIGEPGVGKTAIVE
FT                   GLAHRIVRGDVPEGLKDKAIFALDMGALVAGAKYRGEFEERLKAVLQEIKESEGGILLF
FT                   IDELHTIVGAGKAEGSMDAGNMLKPMLARGELHCIGATTLDEYRKYIEKDAALERRFQP
FT                   VLVDQPTVEDTISILRGLKERYEVHHGVKIQDSALVAAAVLSGRYITDRFLPDKAIDLV
FT                   DEACAMIRTEIDSRPEELDEVMRRVMQLEIEEVALKKEKDKASQERLEALRKEIGELRA
FT                   RTDAMSAQWEAEKQAIKKVQAIREEIEKVRRDIEVAERQFDLQKVAELKHGLMPDLEKK
FT                   LKTEEGGLSADPDGNRLLREEVTEEEIAEIISRWTGIPVTRLVEGEREKLLRLDEVLHR
FT                   RIVGQNEAVSLVADAVIRARSGIKDPRRPIGSFIFLGPTGVGKTELGKALAEALFDSED
FT                   NVVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEAVRRKPYSVILFDEIEKAHPDV
FT                   FNVLLQLLDDGRLTDAQGRTVDFKNTVVIMTSNIGSVYLLDGVTDDGQIKERAREQVMS
FT                   DLRRQFRPEFLNRVDDIVLFKPLTVGEIEKIIDLLTKDLTRRLKDRRIELELTGQAREF
FT                   IARAGYDPVFGARPLKRFLQHNLETRIGRALIAGDIPDGSTIRVDIQDGDLSVTHTVNE
FT                   NE"
FT   gene            317974..318318
FT                   /locus_tag="Sfum_0264"
FT   CDS_pept        317974..318318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0264"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: sat:SYN_00341
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15965"
FT                   /db_xref="GOA:A0LEW3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEW3"
FT                   /protein_id="ABK15965.1"
FT                   /translation="MRTFIKVMKALSDPNRLKILKMLQERTLCVCEIQASLGLAQPTVS
FT                   NHLKLLENAGLVCAKKNGPWVDYSLSDGSVNRYAAALLGNLKHWLRDEPEILRVTENLP
FT                   NIRRQDVCGK"
FT   gene            318485..319588
FT                   /locus_tag="Sfum_0265"
FT   CDS_pept        318485..319588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0265"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: pca:Pcar_0049 possible
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15966"
FT                   /db_xref="GOA:A0LEW4"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEW4"
FT                   /protein_id="ABK15966.1"
FT                   /translation="MKTIDQNACCCPVANHEGAAPAEASGERRALVRYLLAGVLVLAAW
FT                   VLVYLNLEAFSRLVVFNLLALPPNNHFSSAMQFFLYDTPKVLMLLTLVVFGVGVVRSFF
FT                   TPERTRRILAGRSETAGNVLASLLGIVTPFCTCSAIPLFIGFVTTGVPLGVTFSFLVSA
FT                   PMVNEIAVVLLFGLFGWEVAAVYLGTGLMIAMVSGWVIGRLRMEHQLEDWVMQVQMGEG
FT                   CVVEEQKTWTDRIRYGLDAVRDIVGKVWKYVVLGIAVGAVIHGYVPEGFMASIMGRGAW
FT                   WSVPLSVLIGIPMYSNAAGIIPVVHALLEKGAALGTVLAFMMSVIALSLPEAIILRKVL
FT                   KPRLIGVFFGTVGVGIVIVGYLFNLLI"
FT   gene            complement(319694..320533)
FT                   /locus_tag="Sfum_0266"
FT   CDS_pept        complement(319694..320533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0266"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: gka:GK0592
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15967"
FT                   /db_xref="GOA:A0LEW5"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEW5"
FT                   /protein_id="ABK15967.1"
FT                   /translation="MKAEEIRKAVRSGYARVARLEGSCCGKTGRSCCGGDAGSLPDDVG
FT                   LQIGYGEDELKTVPEGANLGLGCGNPTAIAALREGETVLDLGSGAGFDCFLAAAKVGPS
FT                   GRVIGVDMTPEMIAKAQENALKGGYANTEFRFGEIENLPVEDSSVDVIVSNCVINLSPD
FT                   KPKVFKEAFRVLKPGGRFIVSDIVLTAELPEFIRNSMDAYVACLSGAVLKREYLAGIET
FT                   AGFRHVRVVNETVFPIELVAADPAVRETAGNSGLSSEDACSFADSITSITVAAIKPL"
FT   gene            complement(320553..320843)
FT                   /locus_tag="Sfum_0267"
FT   CDS_pept        complement(320553..320843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0267"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   KEGG: mhu:Mhun_0877 transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15968"
FT                   /db_xref="GOA:A0LEW6"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEW6"
FT                   /protein_id="ABK15968.1"
FT                   /translation="MSTEKTEGSCFSQSACRSCCRVESVVSLDERGQILLPKDLRRKAN
FT                   LRAGDKLAVISWDKDGEICCLTLIKADTLAAQVSDFLGPLVKGMLAGQDDR"
FT   gene            321196..322602
FT                   /locus_tag="Sfum_0268"
FT   CDS_pept        321196..322602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0268"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="KEGG: bfs:BF1288 putative
FT                   amidophosphoribosyltransferase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15969"
FT                   /db_xref="GOA:A0LEW7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEW7"
FT                   /protein_id="ABK15969.1"
FT                   /translation="MGGLFGIVSRDDCVSDLFYGTDYHSHLGTRLGGMAVCNSKGIQRS
FT                   IHNIENSYFRTRFESDLARFSGNKGVGVISDTDPQPLIARSHLGTFGIVTVGKINNMEE
FT                   LLHKAFDERRSFFDTAGGVVGPSEMVAKLICSEDNLEDGIRKVQASIRGSCSLLLLTDD
FT                   GIYAARDRLGRTPLVIGRRNGARAVSSESCAFPNLGFEVERFLGPGEVVYVACDGWEQR
FT                   LPPGRDMQICSFLWVYYGYPASDYEGINVEFVRNACGCALARDDDAEVDYVAGIPDSGI
FT                   GHALGYANERRIPYRRPFVKYTPTWPRSFMPQDQRLRDLVARMKLIPVRSLIEGKRLLF
FT                   CEDSIVRGTQLKDNIQILFDYGAREVHMRPACPTLVFPCEFLNFSASRSTEDLIGRKII
FT                   HELENGRDKDLQSYITAGSKKNLAMVEEIRKRLRLTTLRYQRLDDLVASIGLPKEKLCT
FT                   HCWDGSSKGA"
FT   gene            322987..325224
FT                   /locus_tag="Sfum_0269"
FT   CDS_pept        322987..325224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0269"
FT                   /product="peptidase S15"
FT                   /note="PFAM: peptidase S15; X-Pro dipeptidyl-peptidase
FT                   C-terminal domain protein; KEGG: sfr:Sfri_3839 peptidase
FT                   S15"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15970"
FT                   /db_xref="GOA:A0LEW8"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEW8"
FT                   /protein_id="ABK15970.1"
FT                   /translation="MPGHAGEGGRPAAAGPPEGIDSLPAPFPARDKVPDPERITFTVRY
FT                   PGKDPIKLEGHFWYNKDARAAGRKCPAIVELNPYRRRDGMMSSDSGYYPWFAYHEYLCF
FT                   RVDLQGAGDSQGILIDEYTDEELVYCTQVIEQIAVHPSCDGNVGMTGTSWSAINSLMVA
FT                   ARADCPPALKAVLVICGTDDRYNDDVHYMNGAMMQDNIGWASSMFGWLAQPPDPLVVGD
FT                   RWKSMWRERIRAADFWFKHWGKHQARDLYWSASSVRDRYGRVQVPVYIVSGYQDGYKNP
FT                   VPRVVGGLRAAGMPVQGLLGPWGHACPNSGYPGPRIDWLPYVLTHWWDRWLKGKTPDPD
FT                   AELPEMTVWLGESKEPGSSSCRPEKGRWAAEDGEWTTRVRERIFYLWPDGRLRSGLPDS
FT                   GATYVGTGDLVVAARMLETSSWGHCGNNDLPGDQSQADAASLHFDSAPLPKDLDCFGYP
FT                   TACLKLSCNKPVASIAVRLCEVSPDTGASHLVSYRFFNLCCRDGDMAKPRPVEPGVVFD
FT                   VVVPLNVIGHTFKQGWRIRLSVSPSFFPTMCPSPELATITVYAGRAGTGSRMSALSLPE
FT                   RKPRPEDGRLESLLPPAPRILWVDSGTYVPTVTARNGEDSRLVRQFTVLGRKGTVVRKT
FT                   TDYGRYRYDGPLEGLWVDEVDRENFIVVHDEPLTFCGFTSSRVILDRNTGGSHWKVMAR
FT                   RTTKVSTEWDSGGRLVFRYKATIRTFIGKPGGGWEPFENKTVEGTIPRLWV"
FT   gene            complement(325248..325730)
FT                   /locus_tag="Sfum_0270"
FT   CDS_pept        complement(325248..325730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0270"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   tko:TK0711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15971"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEW9"
FT                   /protein_id="ABK15971.1"
FT                   /translation="MQGLTCFPVGVIRSPYKEIQGMPIQAKGAEGVPGTVELNAELEGG
FT                   LKDLQGFSHIILIYHFHRSEGYSLEVKPFLDDRCHGVFATRAPRRPNPIGISIVRLLKV
FT                   EGNILHIEDVDVLDGTPLLDIKPYIPEFDARETDRIGWLSGKAGRVKETRADDRFK"
FT   gene            326007..327197
FT                   /locus_tag="Sfum_0271"
FT   CDS_pept        326007..327197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0271"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: sat:SYN_03745 hypothetical membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15972"
FT                   /db_xref="GOA:A0LEX0"
FT                   /db_xref="InterPro:IPR031563"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEX0"
FT                   /protein_id="ABK15972.1"
FT                   /translation="MSADDRVEGLESGGTVNAETAAAPRTKNSYNKMEWAGAFGDVGTL
FT                   IPFVVAYITIVKVDPLGLLFMFGICLLVAGFYYKTPIPIQPMKAIGAAAIAGGISPAAL
FT                   FGSGLTTGIFWFLAGATGAIRPIARLATKPVVRGIMLGLGLSFMVDGVNRMKTAPVLAG
FT                   IALVVTYFLLTNPKIPAMFMLLIIGIVSAVIMNPEFLSQLAGIHVGFRLPVFSLDMINW
FT                   NDIVTGTLLFTIPQIPLTLGNAVIAITAENNELFPDRKVTEKKIAVSQGIMNLVSPFFG
FT                   GVPMCHGAGGMAGHVRFGARTGGALVILGSIVIVLALFFSESVALIFKIFPNAILGVIL
FT                   FFAGSELAIVVRDIGDKKSDFYVMLIVAAFAMWNMGVAFLVGIILDVSLRRGWIKV"
FT   gene            327262..327879
FT                   /locus_tag="Sfum_0272"
FT   CDS_pept        327262..327879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0272"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   aba:Acid345_1342 sigma-24, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15973"
FT                   /db_xref="GOA:A0LEX1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEX1"
FT                   /protein_id="ABK15973.1"
FT                   /translation="MRQPDGGCSGRGGQRAMSMDDPDLALVNAAGRGDVDAFESLVGRY
FT                   QGPLLNFIARILGDRGAAEDLAQEVFLRVYRAAPRFEARTKVSTWVFRIAYNLAMTELD
FT                   RRKRRRTLAEALHRNGEEASREALADPGEDREFQEEIASALDGLPGNQRAVLLLRLHQD
FT                   LSYREIAEILGTSLGSVESLLFRARKTLRESLRRRKQQGGTK"
FT   gene            327876..328283
FT                   /locus_tag="Sfum_0273"
FT   CDS_pept        327876..328283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0273"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15974"
FT                   /db_xref="GOA:A0LEX2"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEX2"
FT                   /protein_id="ABK15974.1"
FT                   /translation="MKCEAIRLRLVAYMDGELDTELHGQFTAHLRQCEDCRKELEALGD
FT                   VDALVTGLPRYGPSADFARILVSKVRYTVAPVRKGPILQRAWKTLLEYTGRFVELLEPE
FT                   RRVGTRSLDEFNDIPDSFIGYAYFKVLGPQR"
FT   gene            328294..328785
FT                   /locus_tag="Sfum_0274"
FT   CDS_pept        328294..328785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15975"
FT                   /db_xref="GOA:A0LEX3"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="InterPro:IPR025961"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEX3"
FT                   /protein_id="ABK15975.1"
FT                   /translation="MNAASFFYGFVAAVILVSVALSVAYLALSKARARKGDIKGYLDLI
FT                   PDLTEEQRARLREIRTVFLPRVEGIRREMRLRRGELAELLFGEPADRERIYEVADGIIG
FT                   KQSELEHEVIEHILEEKDLLTPAQKRRFYEIIVDQFSGGGLGVHDVRAGKKTGEAGRNR
FT                   "
FT   sig_peptide     328294..328377
FT                   /locus_tag="Sfum_0274"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.893) with cleavage site probability 0.375 at
FT                   residue 28"
FT   gene            329068..329865
FT                   /locus_tag="Sfum_0275"
FT   CDS_pept        329068..329865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0275"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sat:SYN_00840 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15976"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEX4"
FT                   /protein_id="ABK15976.1"
FT                   /translation="MMIRAYVGFDDTDCPDSDRGTGKLARWFQRELPEGCNVWGVVRQQ
FT                   LLVHDDIPYTSHNSSACVIVEMPDAGLLDDLASRAARHLERHSLEGSDPGLCVACDGDP
FT                   SLAGLVAFGQRCTRQVVKQKDAMRAARNMHLSGHGGTNDGIIGAAAAVGLTVHGWSGRF
FT                   IEFGTLRGLPERVRVSELERLDIMPVSLDRDGQVPGPEDLVDTRGWLRPRLWGNRPILP
FT                   VIPREKGVWESLGEKRRKGAKEAGRHLGGARQPVEESPGQSRS"
FT   gene            complement(329911..330327)
FT                   /locus_tag="Sfum_0276"
FT   CDS_pept        complement(329911..330327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0276"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: rxy:Rxyl_2392 transcriptional regulator, PadR-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15977"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEX5"
FT                   /protein_id="ABK15977.1"
FT                   /translation="MLHGYRSRKDMPEPKGKKARPEQGKRERYMQPSILLGLYPKPSYG
FT                   YELIQNIQRFGFVEGQAPPGMIYRHLHQLEGDGLVSSEWDTGAGPAKRMYRLTEEGRQM
FT                   LALWVEYMERQARNLSAFVEQYRSTRAAGSAEPS"
FT   gene            complement(330666..331526)
FT                   /locus_tag="Sfum_0277"
FT   CDS_pept        complement(330666..331526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0277"
FT                   /product="aspartate/glutamate/uridylate kinase"
FT                   /note="PFAM: aspartate/glutamate/uridylate kinase; KEGG:
FT                   swo:Swol_2454 uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15978"
FT                   /db_xref="GOA:A0LEX6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR030669"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEX6"
FT                   /protein_id="ABK15978.1"
FT                   /translation="MAKLVKEGSEKGRLHIESPLMGESLVSKEFLKRTEAKEYFRMQPE
FT                   INVVKIGGQSIIDRGATAVLPIVDVLVQAKEQYKIILMTGGGSRARHVYSIGIDLGMPT
FT                   GVLSKLGDKVSWQNAEMMSVLLNKHGGVKIGHGDNLEQLTMFCRRGYLPITYGIPPYGF
FT                   FEHPAEIGSIPPHRTDCGAFLLAENIGARSLIYLKDERGLFSNDPKKVAKAERKKLRFF
FT                   DRISARELLELDLDDLIIERPILTLLQRAKCLKELQIIDALHHPEHILDALEGKHVGTI
FT                   IYKEE"
FT   gene            331731..331979
FT                   /locus_tag="Sfum_0278"
FT   CDS_pept        331731..331979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15979"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEX7"
FT                   /protein_id="ABK15979.1"
FT                   /translation="MPPGADRVSLTVFLLCAIVTYILAAPAVSLGFRGQFLPHQSPIRI
FT                   RVVSERIPVFSTLSARGGPENLRFHAMSKRFFKPHGC"
FT   sig_peptide     331731..331805
FT                   /locus_tag="Sfum_0278"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.809) with cleavage site probability 0.789 at
FT                   residue 25"
FT   gene            complement(332111..333193)
FT                   /locus_tag="Sfum_0279"
FT   CDS_pept        complement(332111..333193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0279"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: pca:Pcar_0532 ISGsu4, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15980"
FT                   /db_xref="GOA:A0LEX8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEX8"
FT                   /protein_id="ABK15980.1"
FT                   /translation="MGLYAGIDLHASSNYLAIVDESGKRTLRCKLPNDGEEVVSALEPY
FT                   RDQMMGVAVESTFNWYWLVDTLNESGLRVHLANPAAIQKYSGLKHCDDKYDAFWLAEML
FT                   RLGILPEGYIYPKEERPLRDLLRKRGHLVKLRTSLILSLQNIVARNRGLRVNANEVKRL
FT                   KKNRIPPLLEENEDLAMAGRVSKETIDFLTRMIRDIEIAVARKTSLKDSYRNLLTIPGI
FT                   GRILALTIMLETGPIGRFPKVGNYVSYCRKVGSRWTSNEKAKGKGNKKNGNKYLAWAFS
FT                   EAAELARRFDPECRSYYNRKMHRSNFLVAHQALAHKLARAAYYLMKDNVVFMPEKLFGR
FT                   SPPAQEPGRAHVPCRERGTR"
FT   gene            333984..334586
FT                   /locus_tag="Sfum_0280"
FT   CDS_pept        333984..334586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0280"
FT                   /product="protein of unknown function DUF1287"
FT                   /note="PFAM: protein of unknown function DUF1287; KEGG:
FT                   hch:HCH_06899 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15981"
FT                   /db_xref="InterPro:IPR009706"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEX9"
FT                   /protein_id="ABK15981.1"
FT                   /translation="MLLAATVPLSAAQESPESRVVRAAREQVGKTIRYDPGYEKLAYPG
FT                   GDVPLERGVCSDVVVRAYRAALQMDLQKLVHEDMILNFGGYPRLWGLKRPDSSIDHRRV
FT                   PNLQTYFKRMGYALPVTREAKDYKPGDLVTCTLPPNLPHIMIVSDRTNAGGVPLVIHNI
FT                   GAGAKEEDRLFEFPLTGHYRIKTNEPRVRRSVQGRAR"
FT   gene            335354..337420
FT                   /locus_tag="Sfum_0281"
FT   CDS_pept        335354..337420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0281"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: ana:alr1229 two-component sensor histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15982"
FT                   /db_xref="GOA:A0LEY0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY0"
FT                   /protein_id="ABK15982.1"
FT                   /translation="MQDEEKSREQLIRELEEMRRRLGRQDKELAELKGMEEALRESAGR
FT                   YRQMAENIREVFWMADLQESRMLYISPAYEGVWGRTCDSLYANPTSWMEGIHPADRERV
FT                   DELLAQRASGGYSVEYRVVRPDGSVRWVLDRGFPISDAAGTPYRIAGIAEDITDRKNVE
FT                   AELHEYRDRLEDLVKERTADLARANEQLTHEIEERKKAEQKLRESQQMLQSVLDTIPVR
FT                   VFWKDFDSNYLGCNGPFARDAGLQSPEEIVGKNDLVMIWADLAELYRADDRMVMETGRP
FT                   KLGYEEPQTTPSGGRVWLRTNKVPLLDSEGRIKGVLGTYEDITESKRIEEMLRVSETKY
FT                   RIVADNTHDWEYWMSPEGRFLYISPSCERITGYPAGAFEADPRLLSRIVHPDDVNRFNA
FT                   HVAMDRTAHTRHGLEFRIINRDGATRWIGHLCQPVFDEKDCFMGRRGSNRDITDRKLAE
FT                   EALQDSAEKLKLFAYSVAHDLKSPAIGIYGLTKRLNRNYRSLLDEKGKVCCDQILRTSE
FT                   HIAALVDKINVYIATKEAPLAIEEINIAEIIRMLRDEFSAQLSLRRIDWLEPEARIEIR
FT                   ADRVAMLRAFRNFVDNSLKYGGEKLSTIQTGYEESEDFHIFSFSDNGKGLKEGDAERIF
FT                   GAFQRNPASKGVEGAGLGLAIVKEIAAQHSGRVWVEPRAKRGITFCMSISKNL"
FT   gene            complement(337655..338125)
FT                   /locus_tag="Sfum_0282"
FT   CDS_pept        complement(337655..338125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15983"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY1"
FT                   /protein_id="ABK15983.1"
FT                   /translation="MLKIEIPGCEPLHLSDLVLDYNGTIAASGRLIDGVKERLEVLSQS
FT                   LDIHVLTADTFGSVRSELSEAVCRLYVIPPGNQAQAKVDYVRRLGCEGVVCVGNGRNDT
FT                   LMLGEAALGIAVIQSEGAFSRAVLSADVVTTDILDALDLVIHPLRLAATLRA"
FT   gene            complement(338235..339017)
FT                   /locus_tag="Sfum_0283"
FT   CDS_pept        complement(338235..339017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0283"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dvu:DVU2664 phosphate ABC transporter, ATP-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15984"
FT                   /db_xref="GOA:A0LEY2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY2"
FT                   /protein_id="ABK15984.1"
FT                   /translation="MENNVIDQQVEPSVTIRGLSVRFSERTVLDRISFTACPGRIIVIV
FT                   GPSGSGKTTLLRAVNRLNECFPNCRTEGSVELRLNGRDGDIYRDFVPLPDLRRNVGMVF
FT                   QTPSVLPFSTRKNLAMPLKVTLGLDGARLSERVEWALREVSLWDEVKDRLHADASTLSG
FT                   GQQQRLCLARVLALEPQILLLDEPTASLDFKATEKIEELLTRLKKRYTILAVSHSLSQT
FT                   RRLADRVCVLREGRIVRELDHQHLQDLNEFQRLVEDAF"
FT   gene            complement(339002..339880)
FT                   /locus_tag="Sfum_0284"
FT   CDS_pept        complement(339002..339880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0284"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: dvu:DVU2665
FT                   phosphate ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15985"
FT                   /db_xref="GOA:A0LEY3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY3"
FT                   /protein_id="ABK15985.1"
FT                   /translation="MKTAADLLLTAYAWFCAIAVFLATSFLLGFLFKRGMGVMHPSLFF
FT                   GDTPWFSALLGASPVFEGIWPALVGTLALVLVSSVMAIPVGIASGIYLSEYASARVRSM
FT                   LGFAVDVLSGTPSIVMGLFGFTMILFLRKTALPQARPSLFLAAVCIALLILPYVIRTTQ
FT                   TAMEAIPEHLRLLGPSLGLTRWHHVRHVLLPSASRGILSGAILALGRASEDTAVIMLTG
FT                   VVARAGLPASLWDKFEALPFRIYTLAAEHRSVQELDQGFGMALVLLLMTGSLFAVASFL
FT                   QRSLEKRWKTT"
FT   gene            complement(339864..340748)
FT                   /locus_tag="Sfum_0285"
FT   CDS_pept        complement(339864..340748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0285"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: lip:LI1029 phosphate
FT                   transporter permease PstC"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15986"
FT                   /db_xref="GOA:A0LEY4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY4"
FT                   /protein_id="ABK15986.1"
FT                   /translation="MNHVQLVRERWIRRSLLIATGISAGAILFIFVLLVYFCLPLITSG
FT                   GMSSVLSWQWKPFAGEFGILPMCAGSLLLSVFALGLAFPAAIGICGFATVLAARSLARF
FT                   TLVLVHFMTSIPTVIYGFVSVFLLVPLVRDWFSTGTGFSFLTAGLSLSLLILPTIVLVF
FT                   HARLQQIDPALRLAAEAMGLTPVRQFLHVLVPAASRGLVVAAILGFGRAIGDTLISLML
FT                   AGNAPRIPDSLFDSIRTLTAHIALVLATDSQSMSYRSVFASGLILFLLMGAANFFIRRM
FT                   DRGPGENRYENGR"
FT   gene            complement(340790..341635)
FT                   /locus_tag="Sfum_0286"
FT   CDS_pept        complement(340790..341635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0286"
FT                   /product="phosphate binding protein"
FT                   /note="TIGRFAM: phosphate binding protein; KEGG:
FT                   dvu:DVU2667 phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15987"
FT                   /db_xref="GOA:A0LEY5"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY5"
FT                   /protein_id="ABK15987.1"
FT                   /translation="MGIQKRRVDGVVILAVCFFFGLMQGVAFCGALDGFSGLEGTIAIA
FT                   GGTAHIPVMNDAAKNIMTVNPGIRITVEGGGSGVGVQKVGEGLADIGNTGRALSELEIA
FT                   KYGLKSFAFALDGVAAAVHPENPVSDLSPQQVRDIFAGSITNWKAVGGMDAPIHLFCRD
FT                   EASGTREVFWEKLLKKGPVAATANIVASNGAMKVAISQDKNAIGYVGIGHVDQSLKALK
FT                   LEGIAATQENAMNGSYPVVRKLYMNTRGEPSKLVRTFIDYVMGPECADIIKKYGYIPLK
FT                   "
FT   gene            complement(341876..343729)
FT                   /locus_tag="Sfum_0287"
FT   CDS_pept        complement(341876..343729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0287"
FT                   /product="3-octaprenyl-4hydroxybenzoate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /note="TIGRFAM: UbiD family decarboxylases; PFAM:
FT                   Carboxylyase-related protein; KEGG: chy:CHY_1808
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15988"
FT                   /db_xref="GOA:A0LEY6"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR022390"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY6"
FT                   /protein_id="ABK15988.1"
FT                   /translation="MSMKTAFRNLQDFIADLERAGELLRIKAPVSSDLEITQITDLASK
FT                   SPGGGKALLFENVEGSRFPVLTNAFGSERRICMALGVSHLDELARRLKSFIEMKPPKSL
FT                   ADALRLIPLGLELLRFLPRKTRKAPCQEVVTTGRDVDLSMLPVLKCWPSDGGPFVTLPV
FT                   VITRSLVTGKRNAGMYRLQVYDRKTTGMHWHIHKDGSHYFQEFRERGKRMPVAVAIGTD
FT                   PAVTYAATAPLPRGIDEMMLAGFIRRKPVPMVRCLTVDLEVPAESEFVLEGYVDPGELR
FT                   VEGPFGDHTGYYSLVGEYPVFHVTALTHRRNPVYFATVVGRPPMEDCFLAKATERIFLP
FT                   LLNAVFPEIGDYWMPWEGVFHNITVLSIRKEYPGHARRMMSAIWGQGQMSFCKAAVLAD
FT                   PSVDLGHPRRVLEHILNNIDIESDITLSEGILDVLDHSAPEPLFGSKIGIDATRRLPGE
FT                   KERPAARPVGALPDAERIASALRDVSEFLVAFHVPDLEVRNRLLCVNFLKNGSVPAQSF
FT                   AQQLLDHPVLQPFAIFLLYDATIDLRDGSLILWKLFNNVDPRRDTVRSGGRIVVDATKK
FT                   GPEDGHHRPWPDDIVMDPEVAARVARRAKELGIEAFLPAGS"
FT   gene            complement(343847..344731)
FT                   /locus_tag="Sfum_0288"
FT   CDS_pept        complement(343847..344731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0288"
FT                   /product="4-hydroxybenzoate polyprenyltransferase,
FT                   putative"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyltransferase,
FT                   putative; PFAM: UbiA prenyltransferase; KEGG: gme:Gmet_3393
FT                   4-hydroxybenzoate polyprenyltransferase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15989"
FT                   /db_xref="GOA:A0LEY7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY7"
FT                   /protein_id="ABK15989.1"
FT                   /translation="MRESERVAMLLTRIRTYGRLIKFSHTIFALPFALAAVLLANRHQP
FT                   VSWATLAWIVLAMASARSAAMGFNRLADYEFDRRNPRTSDRPLTSGAIDRKSVLCFIFI
FT                   SSSVFVLSAAALGRLCFVLSVPVLLVLFFYSYTKRFTAFSHLVLGFGIGLAPIGAWIAV
FT                   TGSLTPGIVLLSLALMTYIAGFDILYACQDIDFDRQSGLFSLPARWGASRALTASSLLH
FT                   AATFLCLLAVTFAFSLGRVYLLFLALISLLLIIEHLLVRPDRLDRVNVAFFHVNSAISV
FT                   LLFVGILADVAVY"
FT   gene            345412..346878
FT                   /locus_tag="Sfum_0289"
FT   CDS_pept        345412..346878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0289"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmA family; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM;
FT                   (Uracil-5)-methyltransferase; KEGG: dvu:DVU0924 23S rRNA
FT                   (uracil-5-)-methyltransferase RumA"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15990"
FT                   /db_xref="GOA:A0LEY8"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY8"
FT                   /protein_id="ABK15990.1"
FT                   /translation="MWGGRHGSKDRLPTMDDLKKGREYELLVEKLVFGGKALARVEGLV
FT                   VFMDHAVPGQRVRALITRKKRQYCEARVVEVLSQSEAHTEPVCPHFGVCGGCQWQDIAY
FT                   EEQLKWKRVQVADSLEHLAGAQGVKIEAAVPSDRLIHYRNKMEFTFSDRRWLTPEEIDA
FT                   AGMRDAYTFTLGLHVRSWFDKVFNVEDCLLESAEAVEIVKETRDWCRGSGVPAYGIKSQ
FT                   RGFWRFLVIREGKRTGQTLLHLVTSDQPEHEAAVNTLTRHLVSRFPHITTVVHSVSRKK
FT                   AQVAFGDQSRVVAGPGVIEERLGGLRFRISAESFFQTNPFSAEKLYDEVSRLAAFQGTE
FT                   TVWDLYCGTGSIALSVAPRVARVVGFEVVDQAIEDACVNARLNGIENARFISGDLKERI
FT                   NHARGPGSGEHHPDIVITDPPRAGMHPQVVGALLEMGPGRIIYVSCNPATLARDLAFFT
FT                   ERYEIGTVRPFDLFPHTPHIECVVRMDRKR"
FT   gene            346945..349218
FT                   /locus_tag="Sfum_0290"
FT   CDS_pept        346945..349218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0290"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: pca:Pcar_2557 penicillin-binding protein 1B;
FT                   TIGRFAM: penicillin-binding protein, 1A family; PFAM:
FT                   glycosyl transferase, family 51; penicillin-binding
FT                   protein, transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15991"
FT                   /db_xref="GOA:A0LEY9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY9"
FT                   /protein_id="ABK15991.1"
FT                   /translation="MMSFTDKAVRKRSIWWRLVVLLGLVCVLFATSYYFYLYNEVRQRF
FT                   ESRRWSIPARVFSATVPIYPGHSLALSQLRQMLEERRYRESLREPLRAGEFKLHRGSLI
FT                   VFLRDFKFPGHWLRAQRVMFEFQQNRLVRIRSQEGDLAYLELEPIEIARLFGRNRESRL
FT                   LVNIRQVPKHLSDAVIAIEDHRFYEHGGVDWVGILRAVWTDVLARRLVQGGSTITQQLV
FT                   KNYFLEPERSLKRKMLEVSMASIIESMYEKDEILEMYLNEIYLGQRGGVAIHGIGEASR
FT                   FFFGRNVEDLTLAESATLAGMIRSPNNCSPLTHPDAALERRNTVLKRMLDLEKITAQEY
FT                   EQARAERVRVPGTFLPVNTAPYFVDYVRRQLQELYEPGVLESEGLNIYTRLHPEMALAA
FT                   HKAVVEGLQELEKERAEGARGEGDASPPLQAALIAIQPKTGAVLALVGGRDYAESSFNR
FT                   ALEAHRQPGSTIKPFIYLGSLDRYTAASWIPDEPTPYVVDGDSWTPRNFDDHYRGRVTF
FT                   RLGLEESINAATVNLASTVGLDGLIKTIRSLGIQSPLQPVPSLALGAFEVTPIELAGGY
FT                   AALDNDGQRPFLLSLKEVVAENGEVQERRDMDFVTVTTPAKAFLITNLLEGAMERGSGK
FT                   SVRRMGIDFRCAGKTGTTSDYRDSWFVGYTTDLLAVVWVGYDDNRPTGLTGARGAGRIW
FT                   ARFMNEVRPWMNPQAFRVPPGVVQRVICGQSGKLANPRCPDKRMEYFLAENELKEYCNI
FT                   HRRE"
FT   sig_peptide     346945..347037
FT                   /locus_tag="Sfum_0290"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.801) with cleavage site probability 0.412 at
FT                   residue 31"
FT   gene            349445..350029
FT                   /locus_tag="Sfum_0291"
FT   CDS_pept        349445..350029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15992"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEZ0"
FT                   /protein_id="ABK15992.1"
FT                   /translation="MVGLLLLASSGCGSRKQVQIPSEWRTPPSATTQAQRAPAAVPPST
FT                   APPPAPGLILKPPPQFKEKDVEPGLETIQPPVPEKKQAVVHPPQHLASMHLVDQARAEL
FT                   SRGRPDAAIPVLEQAVQVDVHNGDAFLGLARAWKMKGARRKAVEFAKKAEVLFQDDSRK
FT                   LKEAYLLEAELYRELGDTNKSNLYKQKASEL"
FT   gene            350070..351245
FT                   /locus_tag="Sfum_0292"
FT   CDS_pept        350070..351245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0292"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   dde:Dde_2448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15993"
FT                   /db_xref="GOA:A0LEZ1"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEZ1"
FT                   /protein_id="ABK15993.1"
FT                   /translation="MSKRFLETLNGTPRFPGYRPFLLVVLFYSLYLTYLILHPFLDTLI
FT                   MSIVISSLFYPLQTWLVKKYRGRQTLAALTIVFIITFVIAIPIFFFASTLIAQGVQTIN
FT                   QINDWLRAGNIQKLAQDPRVMELMDWVQTRLSFLDLKKLDVSSNIMALSKNFGQFVLSR
FT                   AATILGNVASLVTHFFILVFISFYLVRDGAAMLDAARGFSPLRKDQEDRLLGGIRVVAR
FT                   SVLMGAFMTALCQGLIGGIGVALIGLPGLFWGTVMGFASFIPIVGTALVWVPMAAYLVL
FT                   LGTWKSALFLAIWCIVLVGSIDNFVRPYLMRGQSNLSPFYIFLSIIGAVQYFGLTGILY
FT                   GPLIVSFAMIMLYLYGAEYREDLAESKSGTHAVEEKAQETPGGELPASTGE"
FT   gene            complement(351433..351750)
FT                   /locus_tag="Sfum_0293"
FT   CDS_pept        complement(351433..351750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15994"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEZ2"
FT                   /protein_id="ABK15994.1"
FT                   /translation="MEQKIVSERLYVKIDETGKLVEASYLPMVDSRIEPVPTPLIPAAT
FT                   TKSASFQINEEGIIVEASPPNLNGHKLVLHAKSDSALGRTDAVTPKRVWVPDGKGGWIC
FT                   V"
FT   gene            complement(352631..355846)
FT                   /locus_tag="Sfum_0294"
FT   CDS_pept        complement(352631..355846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0294"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: ade:Adeh_2805 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   histidine kinase A domain protein domain protein; PAS
FT                   fold-3 domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15995"
FT                   /db_xref="GOA:A0LEZ3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEZ3"
FT                   /protein_id="ABK15995.1"
FT                   /translation="MLDSGIVLSAFCLYMACLFLIALWVERKSAAGRSPANNPFVYSLS
FT                   LAVYCTAWTYYGSVGQAATSGFLFLPMYLGPTIAIMLWWSILRRLVHLRNSRRITSIAD
FT                   FISARYGRSQSVAAMVTLIALVGITPYVALQLKAIISTFEIITAADASSWIRADVGPLV
FT                   VVLMVVFTIILGVRRLDPTERHEGMMMALAVECVIKLLALLTVGIFVTYFMYDGFGDIF
FT                   RRFSESPFHHVFELGRHDAGSYVTWTGYLVLSMSAILFLPRQFHVAVVENHDEKHILTA
FT                   MWLLPLYLLLVSMFVLPIAAGGLLDGRPPDQADTFVLRIPLQHGKPWLSLLVFIGGFSA
FT                   AAGMIMITSVTMATMITNHLLLPLVQWIPGLAFVKRHLLKCRWGAVAGFIIIGYWFEER
FT                   IGESYMLVNIGLISFAAGLQFAPAILGGLFWRGGNKTGAILGLAGGFAVWSYTLLLPSF
FT                   IKSGWISNALLEKGAWGIELLKPEELFGLTGLNPLSHAVLWTMFVNIGLYVAGSLCSRE
FT                   RDEERSLAEEFVGVLGTPAPLRRARRWDAYIELAPKRSEIEKVFGQYFAEPEATAMVEK
FT                   CLFQTGIHQAARISIVQLVELHNEVERSLAGAIGSAAAHKALQQGTIFTPREAQELSEV
FT                   YGEILADLKVLPSELSERIDYYQERERLLLQQARELEEKVNELRKQIRKRKRAQAALRE
FT                   SEERYRTLVESTSDAILMVDKDRMIVSTNQAFLDLFGYERGELEGQSIRVVHPSEESYV
FT                   VFGQRAHHAIRTGAPFRTEWNLVRKDGTILPMEGSYSAIRGPDGSPTAYVAVIRDITER
FT                   KKAEEELKNYRDRLENMVRERTLQLEAAQKALVQREKLKTLGAIAAEVAHEIRNPLMSL
FT                   GGFAMRLQKKYPESPEVEIILEESRRLEKILDRIKDYLRPVDIRSRECPVNTVAAECVG
FT                   LLAQDLERERVVWQLDLAPELPPALVDPDVLGEVFVHVITHIAKVMDKQGLLTIRTYES
FT                   DRNIQIDFRYRLPAHKSVQDPERLFLPFEEGDATGGVPLSYRLLKGMGGLLFVTQEERD
FT                   TLFTVSLPRVPESSGDTKQSIDE"
FT   gene            complement(355839..356081)
FT                   /locus_tag="Sfum_0295"
FT   CDS_pept        complement(355839..356081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15996"
FT                   /db_xref="GOA:A0LEZ4"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEZ4"
FT                   /protein_id="ABK15996.1"
FT                   /translation="MKRLRSVLQRSEFHTLLFVLGFALLNWPFLDIFRLKRPEVLLAYI
FT                   YILWAIGIILLFLVSRIVSKSASGDEVRKRKDHGA"
FT   gene            complement(356499..358205)
FT                   /locus_tag="Sfum_0296"
FT   CDS_pept        complement(356499..358205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0296"
FT                   /product="thiamine pyrophosphate enzyme TPP binding domain
FT                   protein"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; thiamine pyrophosphate enzyme, central region;
FT                   thiamine pyrophosphate enzyme TPP binding domain protein;
FT                   KEGG: sco:SCO6584 acetolactate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15997"
FT                   /db_xref="GOA:A0LEZ5"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEZ5"
FT                   /protein_id="ABK15997.1"
FT                   /translation="MGSADPFFNNFRTHSKEETQMAGLTGGKLVAKTLATEGVQAIFTL
FT                   CGAHVMDIYSGCLDEGIRIIDVRHEQTAAHAADAWTRLTGVPGVAVVTAGPGVTDAVTG
FT                   VANAYRAQVPMLLIGGQAPIRNLLKGGLQEMNSVDMMRPITKFSGTVFDTVRIPEMIGL
FT                   ALREACNGRPGPSFLEIPQDVLDREVEENEVRVPVQSRSQCRLTGDRKLMARAAGLLAK
FT                   AQRPALIAGTQVWSCRAVEQLRLFVERAGIPTYLNGAARGCLPVDSPHAFNRTRKFALS
FT                   KADVVLVIGTPFDFRLGYGSRIAEGAKIIQVDLDYAELCHNRDVEVAIQADAGAFLEEL
FT                   EGAVSPAGGTRKWLDELRTMETELLERESRFLSSDAVPIHPLRLAREIDAFLRDDSILI
FT                   ADGGDTVTMSASVIRPRGPGQWLDPGPLGTLGVGTPFAIAAKAAMPARDVVVLFGDGAF
FT                   GLTGFDYDTLIRFNLPMVGIVANNGAWNQVRYVQLLKYGPQKGNTANLLHSLRYDRIIE
FT                   AMGGHGEHVTEPGEIRAALDRARNSGKPACVNVLVDRETFSSSTRDLTIYK"
FT   gene            complement(358325..359821)
FT                   /locus_tag="Sfum_0297"
FT   CDS_pept        complement(358325..359821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0297"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   gvi:glr1122 probable long chain fatty acid CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15998"
FT                   /db_xref="GOA:A0LEZ6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEZ6"
FT                   /protein_id="ABK15998.1"
FT                   /translation="MSILLAAQAARYSDRDAISTPEGVFSYRRLLDASARVASFLLGGS
FT                   SDLEEKPVAFLAPPGFHYVAVQWGIWRAGGIAMPLSLFHPRPELEYVLDDTHPAAVIAH
FT                   PQLAAVLKPLSEDLRLRFALSTEALEHAPGVLPTIVADRRAMILYTSGTTGRPKGVVTT
FT                   HANLAAQVTSLVLAWGWTSEDRILNVLPLHHVHGIVNVLACALRVGAVCEILPRFDPAE
FT                   VWGRFLRGGLTLFMAVPTIYVKLIDHWEKSSPADRERMSEACRGMRLMVSGSAALPVGT
FT                   LEQWRRISGHVLLERYGMTEIGMALSNPLEGRRIPGSVGSPLPGVEVRLTDESGKPVAI
FT                   GTPGEIEVRGPTVFLEYWNRSEDTLKAFRDGWFLTGDIAVEEHGTYRILGRNSVDILKT
FT                   GGYKVSALEIEETVRTHPDIRECAVVGVPDPVWGDRVCAALVMREGAKVELESFRAWAG
FT                   ERLAPYKIPREIAILSELPRNAMGKVSKPALKERFQREKP"
FT   gene            360215..361168
FT                   /locus_tag="Sfum_0298"
FT   CDS_pept        360215..361168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0298"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: eca:ECA3182
FT                   probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15999"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEZ7"
FT                   /protein_id="ABK15999.1"
FT                   /translation="MEKRKLGHSGLEIAPIAFGGNIFGWTVDEPTSFGLLDAFVGAGFN
FT                   CIDTADVYSRWAPGNRGGESETIIGKWLKRSGNREKVVIATKVGKEMGPTAKGLSKAYV
FT                   LRAVEDSLKRLQTDRIDLYQSHEDDPETPLEETLEAYAQLIRQGKVRAIGASNHAAGRL
FT                   SEALEVSGRKGYPCYTSLQPLYNLYDRREYERELEPVCRREGLGVLPYFSLASGFLTGK
FT                   YRRGADASKSARARYLERYLNDRGFHILDALDQVAREHHATPARVALAWLIARPGVTAA
FT                   IASATNMEQMNELIRAPELAPAPADFELLDSASAYE"
FT   gene            complement(361395..361976)
FT                   /locus_tag="Sfum_0299"
FT   CDS_pept        complement(361395..361976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0299"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: dde:Dde_0046 pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16000"
FT                   /db_xref="GOA:A0LEZ8"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEZ8"
FT                   /protein_id="ABK16000.1"
FT                   /translation="MYHQVLIAGFGGQGVLLCGQILALAAMIEGKHVTWMPSYGPEQRG
FT                   GTASCVVTLSDRPIGSPLAEKLSAALIFNRPSLLKYEPQLSDGSLLILNSSIVQAHSGY
FT                   DRHHVYHVPADTIARKAGLRRASNIVMLGAYLAATGVVSFEAARDAIAHHLGPAKAHLV
FT                   AADLKALAAGQSFMRAFQAGPSERSLKHAV"
FT   gene            complement(361984..362787)
FT                   /locus_tag="Sfum_0300"
FT   CDS_pept        complement(361984..362787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0300"
FT                   /product="thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: chy:CHY_0576 putative keto/oxoacid
FT                   ferredoxin oxidoreductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16001"
FT                   /db_xref="GOA:A0LEZ9"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEZ9"
FT                   /protein_id="ABK16001.1"
FT                   /translation="MSRAASIRPKTLTAARFHYCPGCGHGVAHRLVAEVIDELGLREKT
FT                   VGVASVGCSVLIYNYLDLDMQESPHGRAPAVATGIKRVLPDRIVFTYQGDGDLASIGLS
FT                   EIVHAAARGENITVIFINNANYGMTGGQMAPTTLPGQKTTTSPAGRDVTRAGYPLRMAE
FT                   LLAGLDGPVYIARAALYNPAQVVRAKKCIRKAFLCQERGMGFSLVEILSSCPNNWGMEP
FT                   TAALRWVETQMTARYPLGVFKDATVPTVRGDTAGSREDSSPEPGK"
FT   gene            complement(362784..363833)
FT                   /locus_tag="Sfum_0301"
FT   CDS_pept        complement(362784..363833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0301"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: sth:STH222 2-oxoglutarate
FT                   oxidoreductase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16002"
FT                   /db_xref="GOA:A0LF00"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF00"
FT                   /protein_id="ABK16002.1"
FT                   /translation="MKGNEALAEAALRAGCRYYFGYPITPQTELMEYMARRLPEIGGTF
FT                   LQAESEVAAVNMVYGAAGAGARVMTSSSGPGISLKQEGISFLASAELPCVIVNVMRGGP
FT                   GLGTIQPSQGDYFQATRGGGHGDYRVPVLAPSSVQETADLVFESFDLAEQYRTPVLLLT
FT                   DGVLGQMMEPLRLPEVRTPRTSRAPWITDGCKGRQRRIVKTLYLDPRALEAHNLHLQAK
FT                   YAQLAREEVRSEVYGIDGGMDVLIVAFGICARAARTAVDNLREKGLRAGLFRPVTLWPF
FT                   PGAALEAAALAARHVLTVELNAGQMVEDVRLALSGREIAFHGRMGGIMITASEIEAEVQ
FT                   RISEGSEAA"
FT   gene            complement(363833..364105)
FT                   /locus_tag="Sfum_0302"
FT   CDS_pept        complement(363833..364105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0302"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: sth:STH221 putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16003"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF01"
FT                   /protein_id="ABK16003.1"
FT                   /translation="MFAARDLAFETRKRHTFKPVIHADRCKGCGICAAFCPEKILVPGS
FT                   HLNAHGYPVVKLVKGALCSGCRRCVLMCPDLAITFAHEENGSCAS"
FT   gene            complement(364399..366129)
FT                   /locus_tag="Sfum_0303"
FT   CDS_pept        complement(364399..366129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0303"
FT                   /product="transcriptional regulator"
FT                   /note="KEGG: sth:STH1831 transcriptional regulator;
FT                   TIGRFAM: PAS sensor protein; PFAM: sigma-54 factor,
FT                   interaction domain-containing protein; helix-turn-helix,
FT                   Fis-type; ATPase associated with various cellular
FT                   activities, AAA_5; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16004"
FT                   /db_xref="GOA:A0LF02"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF02"
FT                   /protein_id="ABK16004.1"
FT                   /translation="MEQQMEQSQIKAFLDAAHEGVLAVDADGRVTLFNTAAERLTGISA
FT                   DVVLGHHVRDVIPNTRLHIVLETGEAELDQIQDTGMTTVMTNRVPVRNARGEIVGAMAI
FT                   FRDISEIKRLGCEIAELKETRTLLEAIVNSTQDAISVVDERGMGLLINPAYTRLTGMTE
FT                   REVLHRPATVDIAEGESMHLQVLRTRQPVKHVPMKVGAARREVLVDVAPIVVDGALKGS
FT                   VAVIHDVSELRSLTEQLDRAHRLIRRLDTKYTFEDIIAVSPIMQELLEQARKAAATPAT
FT                   VLLSGESGTGKELFAHAIHHSSDRAQRPFISVNCGAIPDTLQESQLFGYIEGAFTGAKR
FT                   GGQKGHFLEAQGGTIFLDEIAESNLAVQTKLLRVLQEKEIVPVGASRPVPVDVRVITAT
FT                   NVDLASLVEKGHFRSDLFYRLHVLPIHIPPLRERREDIPPLLSVLLNKLNQEYSRHVEG
FT                   ISPEALEMFCSYHWPGNVRELENMLGRALINMQPGEKTVRAEHLPHTLSAFARPEARRD
FT                   EGAEPLRVGRSLAEAHAVWEKALLEKALAMTNANRTQVARQLRISVRQLYNKLKRYGLG
FT                   "
FT   gene            366463..367569
FT                   /locus_tag="Sfum_0304"
FT   CDS_pept        366463..367569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0304"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bcn:Bcen_1312 alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16005"
FT                   /db_xref="GOA:A0LF03"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF03"
FT                   /protein_id="ABK16005.1"
FT                   /translation="MTIRTRAAVVRRRGGPFLFEDVEIDDPRADEALVRMVACGICHTD
FT                   IAGRDGALGVPLPAVFGHEGAGVVECVGSRVGRFRAGDKVVLSFSSCGECPGCLGGHPA
FT                   RCGEFDALNFGGARPDGSSTIRDAKGAPLGSSFFGQSSLAGYATVRERGLVGVEAVDED
FT                   ELTILAALGCGIQAGAGTVLNELKPRRGESIAIFGAGTVGLAALMAARLAGAAPIVVVD
FT                   VVASRLELALELGAAVAIDGRAGDVVEHLRETAGSIDHAVETTGVSRVIDCAMKALGSR
FT                   GNISLLAVSADEGEERVHPKSRDPGQSVIYSVAGDSDPQTFIPFLIRKHKEGAFPFERL
FT                   IRIYPASRINEAVKDSLSGITVKPVLRF"
FT   gene            367758..368117
FT                   /locus_tag="Sfum_0305"
FT   CDS_pept        367758..368117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16006"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF04"
FT                   /protein_id="ABK16006.1"
FT                   /translation="MTLKRSSWIAWCLTAAVVATCLVFGGPQTGFAQSATECDDYAKDY
FT                   ANRHTNAGADVVGGAVAGAASGALIGGIVGGGRGAGKGAAIGAGVGAVSGGAHHAGNWQ
FT                   YHYDVAYRNCMRGNR"
FT   sig_peptide     367758..367856
FT                   /locus_tag="Sfum_0305"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.860 at
FT                   residue 33"
FT   gene            complement(368569..370080)
FT                   /locus_tag="Sfum_0306"
FT   CDS_pept        complement(368569..370080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0306"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: chy:CHY_0521 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16007"
FT                   /db_xref="GOA:A0LF05"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF05"
FT                   /protein_id="ABK16007.1"
FT                   /translation="MSRKIFIFDTTLRDGEQVPGAKLNKRQKIEIAQQLAVLGVDVIEA
FT                   GFPCSSPDDLAAVKAISENVKGPVITGLARAVVEDIDIAWEAVRNAERPRIHVFLGSSD
FT                   IHLQKKLRQDRATALRQAVDAVKYAKRFCEDVEYSTEDASRTDFEYLCRVLDAVIKEGA
FT                   TVVNVPDTVGYAVPDEFGEIIRKLREKVPGLDKVTLSVHCHNDLGLAVANSLAAVSNGA
FT                   NQIECTINGVGERAGNASLEELVMVLKTRHATFDAHTDVKSQEIYRTSRMVSRLMNVPV
FT                   QPNKAIVGANAFAHSSGIHQDGILKDRSTYEIMKPEDVGIRQHKIVLTARSGRAALRHR
FT                   LTELGYTILPEVFDRVYNRFINVADRKKEIGSEDLHSIVEIELTRVPETYTFHSLQLMS
FT                   GSSMVPLASVTLTREGVKITDAATGNGPVDAVFHGIERIVGVSGKLRDYDLKAVTMGRD
FT                   ALGEAMVRVEIEGTVYSGTGASPDVIEASARAYLNAFNRYFANSH"
FT   gene            370587..370901
FT                   /locus_tag="Sfum_0307"
FT   CDS_pept        370587..370901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16008"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF06"
FT                   /protein_id="ABK16008.1"
FT                   /translation="MAFLVSLSCPVAENLSDNQGNTEAQGDLYRKNEQIKRELACRKIL
FT                   DDAVRFLHDLTGLCRVHLAPPTDSVRDPCSASYISSQPICKLIILSDRKTSRPESDQQV
FT                   "
FT   gene            370998..372281
FT                   /locus_tag="Sfum_0308"
FT   CDS_pept        370998..372281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0308"
FT                   /product="Polynucleotide adenylyltransferase region"
FT                   /note="PFAM: Polynucleotide adenylyltransferase region;
FT                   KEGG: ade:Adeh_1480 polynucleotide adenylyltransferase
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16009"
FT                   /db_xref="GOA:A0LF07"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032810"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF07"
FT                   /protein_id="ABK16009.1"
FT                   /translation="MREKVGFDIVPPDVMAMMGILSDAGHGVWLVGGALRDHFLGQAPR
FT                   DFDLATDASADEVVRLFPRVIPIGIRHGTVQVHTRTRDVEVTSTPGSGLEGILEDLGRR
FT                   DFTINALALSYPEGSFLDPHGGCNDADARILRAVGDAGRRFREDPLRVLRVFRFVSELG
FT                   LDVEPGTCAAARSEANGLAAVAGERVREEVFRILSGGNAVSALRLMEESRVLRTVLPEL
FT                   HESGCSHAIDTMGRCPNRLRIRMAALLHGLVEEEASLGAVSPCGRCVSSRRAEEVMVRW
FT                   RLSRRQIQGVLGILENPLPGDSANWTDADLRRFIARTGPEFAGDVLELARACRAAGGDS
FT                   AGAEQLSGLYRRYRGEVELRPVPRLRDLPITGEDVMRITGLKPGPRVGKILERAHLEVI
FT                   ENPFMNERKILMDFIRKEFHKEAEIETS"
FT   gene            372314..373006
FT                   /locus_tag="Sfum_0309"
FT   CDS_pept        372314..373006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0309"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   dvu:DVU2774 CBS domain protein/ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16010"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF08"
FT                   /protein_id="ABK16010.1"
FT                   /translation="MLVKNWMSKTVVTIEEDDSMQHAMSLMKEHKIRMLPVVARGKLVG
FT                   VVSDTDLKRASASDATTLDMHELLYLISKIKVQDIMTKTPITVSQNFTVEETAELLMRK
FT                   KISGCPVLDDDGLVVGVITRDDLFKVLIMLSGLGKKGIQLAFQVEDRSGSIKNITDVIR
FT                   KYDGRIASILSSYEYAAPGHRIVYIRTYDIDRAVLPKLVEELKQVAMLIYIVDHRDNKR
FT                   EIFHDLVA"
FT   gene            complement(373166..373870)
FT                   /locus_tag="Sfum_0310"
FT   CDS_pept        complement(373166..373870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0310"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ade:Adeh_2428 ABC branched-chain amino acid
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16011"
FT                   /db_xref="GOA:A0LF09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF09"
FT                   /protein_id="ABK16011.1"
FT                   /translation="MLRMENVNAGYGDVQVLWDVSFEVKAREFVVLVGANGAGKSTIMK
FT                   TISSLLHPTSGTIWFEDQRLDHVQPYHIIDVGIAHVPEARQLFPEMTVLENLEMGSLCA
FT                   RAKPHRKESIEWVLDLFPRLRERRKQLAGTLSGGEQQMCAIARGLMSKPKMLLFDEPSL
FT                   GLSPLLTQEIFRLASKIHGEGMTILMVEQNVKQTLAICDRAYVLENGRIALEGKGRELL
FT                   ENEEVKQAFLGI"
FT   gene            complement(373875..374588)
FT                   /locus_tag="Sfum_0311"
FT   CDS_pept        complement(373875..374588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0311"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ade:Adeh_2427 ABC branched-chain amino acid
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16012"
FT                   /db_xref="GOA:A0LF10"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF10"
FT                   /protein_id="ABK16012.1"
FT                   /translation="MNFFQTHRLVKAFGGLLAVNDLTFEVEKGEIYGLIGPNGSGKTTV
FT                   FNLITGYYPITSGYIEFQGKRLNGLPTWRVCKQGIGRTFQIVKPLRRMTVLENVMTSAF
FT                   NRTSREAEAREKALEVLDFCELTKKQDYPAKGLTIGDRKRMEIARALATAPELLLLDET
FT                   MAGLTPQEQADGVQLIRKVRNSGITIIIVEHIMHVIMNLCDRILCINYGQEIARGTPAE
FT                   VANNQAVIEAYLGKE"
FT   gene            complement(374591..375571)
FT                   /locus_tag="Sfum_0312"
FT   CDS_pept        complement(374591..375571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0312"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: gsu:GSU2007
FT                   branched-chain amino acid ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16013"
FT                   /db_xref="GOA:A0LF11"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF11"
FT                   /protein_id="ABK16013.1"
FT                   /translation="MKSIRWSTLVILLLLAVFPLVIQSDYYRHILIIALMWVVIGSSWN
FT                   LLSGYTGQVSFGHAIFFGIGAYTAGLCTTQLDISAWYGMLLGGPVALLIGLVIGWICFR
FT                   LRGPYFALATIAVGEIFRLVATEWVDFTEGMQGILIIQTFRSKIPYYYLALGLAAACIY
FT                   SIHTVMNSKWGYYFLAIREDQDAAEALGISSFRYKSLSLMISAFFTGLAGAFYMNYMAF
FT                   IDPQVVFSLHFISIMAILVGIIGGVGTLWGPPTGAFIMVLLQETFRSAFFGMLPKWVSE
FT                   AHVLVFGLLVIFVIRYMANGIVGDWGKIRQVFSGRKASPSAGSGN"
FT   sig_peptide     complement(375497..375571)
FT                   /locus_tag="Sfum_0312"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.681 at
FT                   residue 25"
FT   gene            complement(375585..376460)
FT                   /locus_tag="Sfum_0313"
FT   CDS_pept        complement(375585..376460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0313"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: gsu:GSU2006
FT                   branched-chain amino acid ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16014"
FT                   /db_xref="GOA:A0LF12"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF12"
FT                   /protein_id="ABK16014.1"
FT                   /translation="MEVLIQTLVAGILMGGIYALVGLGMTLIMGVMKIVNLAHGQLMMI
FT                   AMYITFVLFDHFHIDPYFSLLVSMPALFLLGAFIQKYLLNPLLKVDSILPENQVLMTVG
FT                   IGMILTEIVRFIFQSDYKSVKTSYSFSTMYLGTISFNTSMVVAFCIAVLLTGGLFFFLA
FT                   KTDVGKSVRATAQNKDAALLMGVNAEWITILTYGLGAALVAAAGTLLLPIYYLFPDVGG
FT                   RFTLKAFVITILGGMGSTVGAIVGGVFLGIAESLGATYISMALSDAVGLVIFLLVLIFL
FT                   PGGLKKLTKI"
FT   gene            complement(376540..377733)
FT                   /locus_tag="Sfum_0314"
FT   CDS_pept        complement(376540..377733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0314"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   gsu:GSU2005 branched-chain amino acid ABC transporter,
FT                   periplasmic amino acid-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16015"
FT                   /db_xref="GOA:A0LF13"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF13"
FT                   /protein_id="ABK16015.1"
FT                   /translation="MKRMVSAIVTLSFALAFLVLPAFAQETVKVGIILPVTGEKAKFGE
FT                   IEKKSFEMALEEINAAGGINGKKLEFLLEDDTGRPDVARSAAEKLITKDKVVMLGGGYG
FT                   SSETFAIAGVAQQSRIPFLVNTGSDDKITEKKWEYIFRLNPPVSEYPKGLESFLTEVVK
FT                   PKTAVILYENTNFGSSGSKEFKATCERLGIKVLMMEGYEHGGVDFKPLLIKVKQANPDL
FT                   VYMISYLMDASLLMRQSLELRVTPKLFVGGAAGFTLPEFQKNAGKASDMVYSATLWYQT
FT                   LPYPGAKKYFDDFKKKFGVDTEYHGAEAYAAAFVIADALKRTKSMGPEDVRQALAATDM
FT                   MTVFGPVKFIAYDTMTNQNKLPTYLVQWIDGKLELVWPKDVASKPYVYPIDWEKVWK"
FT   sig_peptide     complement(377659..377733)
FT                   /locus_tag="Sfum_0314"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            377948..378937
FT                   /locus_tag="Sfum_0315"
FT   CDS_pept        377948..378937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0315"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ani:AN2451.2 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16016"
FT                   /db_xref="InterPro:IPR019438"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF14"
FT                   /protein_id="ABK16016.1"
FT                   /translation="MENLHESPRAFPVLESIAPVVERSRWVTFHPASAELCIERWGHLL
FT                   DSVPTWKQPWHFFDGGLETVRWVFVLDVLNHCFWPDENEPLWSVRYRGNEYSGYAGLAA
FT                   SLKRAMESGVPVTNASFLAGLSPGTLREILAGTGEIPLLEARLENLREAGRVLLARWEG
FT                   DIVNLVASAGRSAVDVVKGVVDSFSSFRDECGYRGRPVYFWKRAQLFAADLHSAFDGRD
FT                   WGAFEDIERLTAFADYKLPQVLRRFGLIVYHPELAERIERRERLPAGSEEEVEIRAATV
FT                   WAVEALKKAFERRGAEPTSMRVDGWLWQLGQLEYFRKYPYHLCRTIYY"
FT   gene            379420..380574
FT                   /locus_tag="Sfum_0316"
FT   CDS_pept        379420..380574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0316"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG: mac:MA3328
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16017"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF15"
FT                   /protein_id="ABK16017.1"
FT                   /translation="MPEITRKQLLMAVISGRGPAYLRGVDLSNLDLSSAGWLAEADLRN
FT                   ADLSSANLSRSNLRNANLQQANMQNCNMAIANLEGAILQSARINVANLRAVNLAGANLR
FT                   EATLVGTTLVKANLKEANLESADLEGANLQGANLWKAKLSQANLRMTNLRGANLSEAYL
FT                   EGKLVDHYETPPKNPSQYQGFVGSVGGIQLTDLIQIVCLSRSNLMFKIESESGCGTIHV
FT                   GSGRVYHAQLDRLDGEDALFKMLAWEGGRFETVTLEEVGASTINKPVENLIIEAMRRRD
FT                   ESMPAFMRGKHGSMLREIRRYLPIPAYPSRELMKLTVAEGKNIRPTQEVQIIDAFASTD
FT                   TGEILCSIVAEEDVFIAPLRFIRIKRNHPLFDLTVNYHKEMKKT"
FT   gene            380716..381132
FT                   /locus_tag="Sfum_0317"
FT   CDS_pept        380716..381132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0317"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG: dps:DP2777
FT                   similar to gliding motility regulatory protein (MglB)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16018"
FT                   /db_xref="GOA:A0LF16"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR037587"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF16"
FT                   /protein_id="ABK16018.1"
FT                   /translation="MSLIVTREQILQLESIVGKELLDAGADHVIIVDMSGNLIMQQGSM
FT                   HMEDIFSLAALSAANFAATAEIAKLIGEEDFSLLFHKGDKRNIHFSRLGREHIIITLFN
FT                   ESVSLGLIRLKLNRAIEQMASIFKGLEGKNKWPL"
FT   gene            381120..381737
FT                   /locus_tag="Sfum_0318"
FT   CDS_pept        381120..381737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0318"
FT                   /product="gliding motility protein (MglA)"
FT                   /note="KEGG: dps:DP2776 gliding motility protein (MglA)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16019"
FT                   /db_xref="GOA:A0LF17"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF17"
FT                   /protein_id="ABK16019.1"
FT                   /translation="MAFIDLNKNEIQAKIVYYGPGRGGKTTNLLFIHESMSKQVCGKMV
FT                   TIDTKGDRTLFFDFLPLSIGKILNLSIRIQLYTVPGQVMYNTTRKLVLRGVDGVAFVAD
FT                   SLRVQKQKNVESLLNLAENLTDEGLDIHDIPLVLQYNKRDLMESNIPLLSVEEMQEDLN
FT                   KDLKVPAFEASAMRGNGVYETLREISKRTIKNVIQKVGGDLK"
FT   gene            381762..382082
FT                   /pseudo
FT                   /locus_tag="Sfum_0319"
FT   gene            382084..384603
FT                   /locus_tag="Sfum_0320"
FT   CDS_pept        382084..384603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0320"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ani:AN5649.2 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16020"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF18"
FT                   /protein_id="ABK16020.1"
FT                   /translation="MSEKQNDDAAEKKRKIDFDAFELQIDQEIDSLFIPAGQTAQDAGS
FT                   SAAIGKEAQPAPPRPAPATSPKVAPEIVAGIAPEMVPKLTVEPVPETAPKPAATSLSGI
FT                   APERLSKPDVEPVPEISLETAFKAVGPAVAEKVPEIPAQTVPKVVPDLPESAEGFHRMT
FT                   ELQPEAAAPVAGGGELEVEIDREIDLLFQAETAASPKSEPTAAQSRPVPDILATGKIKT
FT                   EDIMEEPVFEPLKAEAPPATPSSPVKPVEIKSGDFELQLDQEIDSLFVPSSPIPPAPSA
FT                   KTPTAEFQFEIPGAEAKAEEPPAPRVAAEQPAPKAPQVDLLADLNLEEILSAEPHKPAS
FT                   DLFRAAPEKAEPAPTAVMPAPDWFKPVSDAPAVTPAPVLDEVRAEKAETAPAAELEAEE
FT                   GTELAALLDAFKIAYLSLDWEFSVENISSLQASLSSLEPHCRKSAGANSIYKILKAVLE
FT                   RLKTKPHAINPQLIEMVRDSQELLKPILLKEGHLDRQEKEKVKNLIARFQTQRDKTSLD
FT                   KAPITSRLATEADAGMEVDQAVPLATLPEDQIAFVDRRPISALKGWLEASRALVSETVQ
FT                   GLEFENRRLRQIEQILGKTKALEPLVARLEGIRANVEKHVLAFKSREPEWDERIRWLGE
FT                   LDVTISSRGGQVPRPAEDAVELEEVVLEAEELREPGYAPAFSVEGDVRPDQVYYFSMGG
FT                   RKFAVLASQVVKIDKVSGAKVKKFVKQGYASLNDFKPMFKNIKAGLFGTWGGLPLEVLK
FT                   GYRFVPIPAEVFGGESLPARSGGAILLSSGKRHGIVFCDSAVVDLHNDVEIVIGKASDD
FT                   RMLGSIMGVADAPVEVLNLDRTVRSLG"
FT   gene            385139..386773
FT                   /locus_tag="Sfum_0321"
FT   CDS_pept        385139..386773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0321"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: serine/threonine
FT                   protein kinase; KEGG: gka:GK1176 serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16021"
FT                   /db_xref="GOA:A0LF19"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF19"
FT                   /protein_id="ABK16021.1"
FT                   /translation="MAYGDLFQSYLNRLEEARLYLEQGLGEGAGEIVKGILEDLEQSAL
FT                   SEEEKSDLRSRIEKQHGHIPEETAAGEPPSAPQGPAYGMAEPDQTFEYGLALMDGQFWD
FT                   EAIREFKTAAAVGFRVMQCWELCGDCAGKLGKWDEAIRYYENIYADPAADEQLKRQILL
FT                   KITKCSQNRKKNDVSSTIQARSEAVAAAAAGPAPPPKVAKPESETLSPSLSSLDQHSLD
FT                   QLIGQHAASWNDSRNSFVAGEKHTYTISNLLHVGVTSLVMQVTDDDTGEMLAGQILSGP
FT                   YGAGVDPAVLSRWARAQMMSNSQHIVRIHDIAQCEDRIFIIREHLPLSLVDIFNMGEVL
FT                   PIPLAIGLSYQILEGIGDLHLHMGKDEEIRKIHHLDLRPSKILLHDDRFLVKICNGGLL
FT                   SELERANPRAASLKHLPLPLLAYRAPEQFRPYLSRKKPPFFTDIYLFGALLYEMLTGIQ
FT                   AFSGSSIEEFEIQHCEQYPTPPKVWRPEIPEVMNEIIMNCLICDPMKRWRSATQISLTF
FT                   EKSFSEWVGRGVERQYYELLDRLRSKI"
FT   gene            387069..387344
FT                   /locus_tag="Sfum_0322"
FT   CDS_pept        387069..387344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_2240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16022"
FT                   /db_xref="InterPro:IPR021734"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF20"
FT                   /protein_id="ABK16022.1"
FT                   /translation="MLFLAIFSYSPEDRDDVIQRGMGTGTKHQGVEVKGEWFDISGHRV
FT                   FRLFEADDEVHLAASVYAWTDLGIAEIIPVMETEKALKFLKRVGTK"
FT   misc_binding    387371..387573
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 90.88"
FT   gene            387698..388759
FT                   /locus_tag="Sfum_0323"
FT   CDS_pept        387698..388759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0323"
FT                   /product="Nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /note="PFAM: Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase; KEGG: mta:Moth_1721
FT                   nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16023"
FT                   /db_xref="GOA:A0LF21"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LF21"
FT                   /protein_id="ABK16023.1"
FT                   /translation="MEKLDRLLERIEPASKDWEAKAWERLHAQIRPRDSLGRLEVIAAR
FT                   LAAIKRSLTPAVGRKIIFTMAGDHGVAAEGVSAYPQEVTAQMVGSFVRGWASINILAVH
FT                   CGAAVRVVDCGVASDLPPDWPVLRRKLGKGTANIAVGPAMSREVAVRGLTIGAEIVQDA
FT                   HLKEGYLLFGTGDMGIGNTTPSTAIIAALGGKPVRDLTGRGTGIDDVAFERKVRVIERA
FT                   LAVNRPDPNDPLGVLAGVGGFEIAALGGAVLGAAALRVPIICDGFIATAGALVACRLAP
FT                   KAADYLFVSHRSREVGHTAMVDMLGMRPILDLDMRLGEGTGSALAMNIVEAAAKVLVEC
FT                   KTFEEAGVTDTGH"
FT   gene            389099..389299
FT                   /locus_tag="Sfum_0324"
FT   CDS_pept        389099..389299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16024"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF22"
FT                   /protein_id="ABK16024.1"
FT                   /translation="MTTVMPEGEAIRRAVKWISASLEEHPDKAAQSLVQEAVLRFDLSP
FT                   KETEFLMEFYKKAKPDASSDA"
FT   gene            complement(389459..390025)
FT                   /locus_tag="Sfum_0325"
FT   CDS_pept        complement(389459..390025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0325"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   sat:SYN_02920 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16025"
FT                   /db_xref="GOA:A0LF23"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF23"
FT                   /protein_id="ABK16025.1"
FT                   /translation="MVAFNGSARQDGNTAILLRTVLAELDKEGIETELIQLAGKPLQGC
FT                   TACYSCFKTKDGTCAVETDELNEYLAKMIEADGILLGSPTYFADVSASMKALIERCGLA
FT                   VRAGGDLLRRKAGAGVVAVRRAGAVHAFDSLNYFFTISQMIVVGSSYWNIGIGMDPGDV
FT                   HRDEEGLQTMRTLGENMAWLLKKLR"
FT   gene            390570..391037
FT                   /locus_tag="Sfum_0326"
FT   CDS_pept        390570..391037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0326"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: rpc:RPC_3011 Sel1-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16026"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF24"
FT                   /protein_id="ABK16026.1"
FT                   /translation="MKRIAFLIGLVVLAGPAWADFESGKAAYSRGDYETAFREFEILAK
FT                   KGHAEAQVALGQMHLKGEAVGQSDVEAVKWFRKAAEQGNSFAQGKLGAAYEEGRGVPKD
FT                   YVKAYMWLILAAAQGERGMAGFRDHIAQKMTPEQVARAQEMARNWRPRVAK"
FT   sig_peptide     390570..390629
FT                   /locus_tag="Sfum_0326"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            391206..391463
FT                   /locus_tag="Sfum_0327"
FT   CDS_pept        391206..391463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16027"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF25"
FT                   /protein_id="ABK16027.1"
FT                   /translation="MNSTRLADASCGVAVGKIVPVWENRAGKQEESVFREISPCKAAAK
FT                   KCSGRRVAHRTSFRWSLVEGNPARLSGQPRYALHNDCVAE"
FT   gene            391640..391715
FT                   /locus_tag="Sfum_R0007"
FT                   /note="tRNA-Ala1"
FT   tRNA            391640..391715
FT                   /locus_tag="Sfum_R0007"
FT                   /product="tRNA-Ala"
FT   gene            392003..392446
FT                   /locus_tag="Sfum_0328"
FT   CDS_pept        392003..392446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16028"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF26"
FT                   /protein_id="ABK16028.1"
FT                   /translation="MAVPLAGHLQARKKARFHVQVKIGNIPTDIQTPAQVLVEGTVVRI
FT                   FRSDGNLRPGDRVVFPVWVCRPGDDVPVGPVCGFLDRLASATHIEVYLNGAPPRCDVAL
FT                   DEWLPLETASDEPRLTVEELERQIREARKKKRRWWWFRPNTTP"
FT   gene            complement(392648..393967)
FT                   /locus_tag="Sfum_0329"
FT   CDS_pept        complement(392648..393967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0329"
FT                   /product="fibronectin, type III"
FT                   /note="KEGG: gme:Gmet_2469 fibronectin, type III"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16029"
FT                   /db_xref="InterPro:IPR010620"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF27"
FT                   /protein_id="ABK16029.1"
FT                   /translation="MLKIRPGFLMRWRLNLFFAFAAFFCTLGCAAAVSAEWVKEYDGPG
FT                   NGRDYSTAIAVDGGGNVYVTGHSDGISTSLDSDYATIKYSANGSREWVARYDGPASDSD
FT                   SPTGIAVDGDGNVYVTGRSSAVVSEFEGDYDFATVKYDTDGNQKWVTRYGTLEGIHDIP
FT                   AGVAVDGLGNVYVAGGSTDGTLCLDATVIKYDADGNCIWIRRFDGGAYAIALDDSANVY
FT                   VTGTVTIKYDSDGNRKWVTRSSGMTSSIAVDDTGNVYVAGQIKRTSSGYDYLIVKYDAN
FT                   GSRKWVKRYNGPANGSDFAHAIALDGAGNVYVTGVSEGTSSGEDYATVKYDANGNRKWV
FT                   KRYNGPANGGDSASAIALDGKGNVYVTGWSDSDSSGKTYDCATINYDENGNQKWVRRYE
FT                   QASGSSMVVGGGGNLYVTGTTLTTTGLEHYLTIKYDAGGN"
FT   sig_peptide     complement(393860..393967)
FT                   /locus_tag="Sfum_0329"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.491 at
FT                   residue 36"
FT   gene            393986..394276
FT                   /locus_tag="Sfum_0330"
FT   CDS_pept        393986..394276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16030"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF28"
FT                   /protein_id="ABK16030.1"
FT                   /translation="MGASHVAQSRFRLNGKVSEPAFNSPCLLPNPRLAGPRCASNGTPG
FT                   RPEFHGFCRGDRRGPPGGCIIEAGTGVFGLGLQEYFVNGLYSLKIFKVKAL"
FT   gene            complement(394590..394982)
FT                   /locus_tag="Sfum_0331"
FT   CDS_pept        complement(394590..394982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16031"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF29"
FT                   /protein_id="ABK16031.1"
FT                   /translation="MFRAIGITLRHFARLGGRARLSSTAIARDDRTIAKALQVSPKGFA
FT                   FRRVACLRINFNPSPDSLIGASASMFMPPPLPGGSPVAAHHPRPWLHRNGRICCGFKTF
FT                   RMQNAMNKKARRNQEKGAANTCEKTG"
FT   gene            complement(395006..395467)
FT                   /locus_tag="Sfum_0332"
FT   CDS_pept        complement(395006..395467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0332"
FT                   /product="Cache, type 2 domain protein"
FT                   /note="PFAM: Cache, type 2 domain protein; KEGG:
FT                   ade:Adeh_3161 cache domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16032"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF30"
FT                   /protein_id="ABK16032.1"
FT                   /translation="MSKKLLIAVVIVVLGLSWAYAQQQQAVDEKALAKAMVEKAAAFLN
FT                   ENGKEKTIAEINKPDGQFVQGELYVFAYDLNAVMLAHPKNPKLIGQSLMDKPDSKGKLF
FT                   RKEIIDKAKSAGSGWVDYFYLNPQTGKEEAKTTYLKKAGDMVICCGAYR"
FT   sig_peptide     complement(395402..395467)
FT                   /locus_tag="Sfum_0332"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.364 at
FT                   residue 22"
FT   gene            396201..396512
FT                   /locus_tag="Sfum_0333"
FT   CDS_pept        396201..396512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16033"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF31"
FT                   /protein_id="ABK16033.1"
FT                   /translation="MSFEQWGYEFDGAYSVADRLQPRAGVYVVWCKIEDKWKVIGVGQS
FT                   ENVGKQLVDGERTLCWADECKPGTIYFAATYTDGAPESERKCIEQLIRRLTNNLREGA"
FT   gene            396530..397195
FT                   /locus_tag="Sfum_0334"
FT   CDS_pept        396530..397195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16034"
FT                   /db_xref="GOA:A0LF32"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF32"
FT                   /protein_id="ABK16034.1"
FT                   /translation="MPSGCSFRRREGDAANGKALSPTPAAASPGGEVHPLPVAGTSEHL
FT                   RIDPPQSGETLHRPPVSLMSLSLNDKTSAMLYNDCVRAGGSPIRPEDRGLRSGVRRKRG
FT                   ADDSRALAGKGTAPSVQVPATPGVSGHASACGTIHKMRNAAPSGPGYEERLRFFNYIRH
FT                   LGRTIAWAMIVLLIGIASGTFFLREGSSAEACLLPLALCVIPVAVLTVVKPGRRDAGG"
FT   gene            complement(397278..397592)
FT                   /locus_tag="Sfum_0335"
FT   CDS_pept        complement(397278..397592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16035"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF33"
FT                   /protein_id="ABK16035.1"
FT                   /translation="MPPGAMHRACGNFPAVHFVRLFTAASVSSSLPSPASRAVLAFLTG
FT                   AWVCSRKTFGDSAAGVSTLVAFFSGSFALEQPAAPAHQIKDRIAIPAKIRLMAASSLLQ
FT                   "
FT   gene            complement(397600..397965)
FT                   /locus_tag="Sfum_0336"
FT   CDS_pept        complement(397600..397965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0336"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG: gsu:GSU1192
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16036"
FT                   /db_xref="GOA:A0LF34"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF34"
FT                   /protein_id="ABK16036.1"
FT                   /translation="MNEREFTRVTLHTTAEVRWGDEVVTGEVENLSLNGVFVKSSAQVP
FT                   ADTPVEITILLVGASSELSVRIKGEVVRREPHGFAVRFQGMNLDSFFHLRSFFVARNAD
FT                   EKAIRAEYREHIRKKGS"
FT   gene            398038..398445
FT                   /locus_tag="Sfum_0337"
FT   CDS_pept        398038..398445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16037"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF35"
FT                   /protein_id="ABK16037.1"
FT                   /translation="MEILPGYGSAVAGGRASLARARPGITTRKRATLRWIAPHPFPVCG
FT                   FASIRTGTVASRGFTTKREKPLPRSRAGASPGRHSGLPVLAGMTAAFSHKPGVKKTKWE
FT                   GGRTDRIALPMFLPPSVSRDSRAGECSKFDQ"
FT   gene            complement(398439..399479)
FT                   /locus_tag="Sfum_0338"
FT   CDS_pept        complement(398439..399479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0338"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /note="TIGRFAM: cytochrome d ubiquinol oxidase, subunit II;
FT                   PFAM: cytochrome bd ubiquinol oxidase, subunit II; KEGG:
FT                   dvu:DVU3270 cytochrome d ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16038"
FT                   /db_xref="GOA:A0LF36"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF36"
FT                   /protein_id="ABK16038.1"
FT                   /translation="MLESIWFVLWGVLWAIYFMLDGFDLGLGALMPVLARGENDRRTIY
FT                   RAMGPFWDGNEVWLITAGGVTFAAFPVAYAVMFSGLYSALMLVLFALIFRGIALEYRSH
FT                   LASERWRKTWDTCLTVGSFAAALLLGVAFANIFKGIPIDGEGVFQGSLLTLLNPYGIFG
FT                   GVLFVLMFTVHGSLWLTLKSDGELHARAARLAEKLWIVLAVAAVGFLVATWYATRLYDN
FT                   YLKEPMLFAVPIVLIPVITIAALAFIRVGIVKRRYWRAWFASSVFIVGVTLFGVAGLYP
FT                   NLLPSSLDPAFSVNVHNASSSPLTLRIMLVVALVFVPVVLAYQTWAYRLFKSRLEDGES
FT                   LHDEAY"
FT   gene            complement(399494..400816)
FT                   /locus_tag="Sfum_0339"
FT   CDS_pept        complement(399494..400816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0339"
FT                   /product="cytochrome bd ubiquinol oxidase, subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase, subunit I;
FT                   KEGG: dde:Dde_3204 cytochrome d ubiquinol oxidase, subunit
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16039"
FT                   /db_xref="GOA:A0LF37"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF37"
FT                   /protein_id="ABK16039.1"
FT                   /translation="MMDVLMLSRLQFAAATFFHFLFVPLTLGLSILIAVMETIYVRTGD
FT                   EEYRNMARFWGKIFLINFAIGVVTGITLEFQFGTNWSRYSRYVGDIFGSLLAIEATVAF
FT                   FLESTFIAVWALGWKRLSPKAHAATIWLVAVASNVSAFWILIANAWMQHPVGYTIRNGR
FT                   AELTDFTAIVTQSFALNEIVHTLGAAYILTAFFMMGISAYHLLRKQHVAFFTRSFRMAV
FT                   TFGLIFAVVEVVQGHMHGAEVARVQPAKLAAMEALWDTTAQAPQHLFLIPDEKNETNLA
FT                   VFGTIPGALSMLAYHDPKATVKGLKDFPPEERPPVTLPFAAFRIMISLGFLFLFLTAYG
FT                   WIRRDRLMESPRYLKLMLFAVPLPYLAIQAGWALAEVGRQPWVVYGVMKTADAVSKLSA
FT                   SQVWASFLGFIVVYTLLGIAAFTLIVSTARKGPETHPATAQ"
FT   gene            complement(400885..401340)
FT                   /locus_tag="Sfum_0340"
FT   CDS_pept        complement(400885..401340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0340"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="PFAM: flavodoxin/nitric oxide synthase; KEGG:
FT                   mba:Mbar_A2071 flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16040"
FT                   /db_xref="GOA:A0LF38"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF38"
FT                   /protein_id="ABK16040.1"
FT                   /translation="MAKALIVYATRLNQTRKIAELIAQGLRAGNVEPVLLNVTEAGFKG
FT                   LKTDDFDALVLGSATYHGEMMQSMKTFLFSLENLNLAGKVGGSFGAFGWSGEAPGRIFD
FT                   TMKNLFGMEMVGGPLRVKSASESGAAKTAEDYGRQIAAKLGPAAPKA"
FT   gene            complement(401413..401721)
FT                   /locus_tag="Sfum_0341"
FT   CDS_pept        complement(401413..401721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16041"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF39"
FT                   /protein_id="ABK16041.1"
FT                   /translation="MRPGDVFIERTLELVEKMISIADEGDRTREDRGCGVLCGVLRDSA
FT                   FKIRRLAEEERELHARQGPSGPEQPLRGARAPSGRGASARNSGRGKSRGKPAGTASK"
FT   gene            complement(402002..403336)
FT                   /locus_tag="Sfum_0342"
FT   CDS_pept        complement(402002..403336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0342"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="KEGG: sat:SYN_01181 transcriptional regulator with
FT                   sigma 54 interaction domain; TIGRFAM: PAS sensor protein;
FT                   PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; ATPase associated with
FT                   various cellular activities, AAA_5; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16042"
FT                   /db_xref="GOA:A0LF40"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF40"
FT                   /protein_id="ABK16042.1"
FT                   /translation="MSDRAFDRILADKRNLEHILDNLMEGIISHDRNRRILFFNRAAEN
FT                   ITGYAREEVIGRDCHEVFGSPFCGQRCSFCGESPDLIDHKSYVVNILTRKGEPRRIEMS
FT                   VTGMVDEDGRFLGVLAAFRDLTDLFGMKLRLGEINSFAGIIGKDHKMLQVFDQIRDLAT
FT                   NDFPVHISGETGTGKELAAAAIHNESHRGGGPFVPVNCGALPEGLLESELFGHVKGAFT
FT                   GAIRDKKGRFELAHGGSIFLDEVSELPRFMQVKLLRVLQEGTFTRVGGESTIVVDVRVI
FT                   SASNRDLKKEVESHNFREDLYYRLNVVPIRIPPLRERKNDIPLLAAHFLEQAVKRGQKS
FT                   AVLSEDALAAMMDYSWPGNVRELQNAVYFALVKSRGSTLHVDDLPLELARTAPICKPGP
FT                   ARKLDRDSVAAALKQSGGNKARAARLLGVGRATLYRFLDDFENVP"
FT   gene            complement(403852..406767)
FT                   /locus_tag="Sfum_0343"
FT   CDS_pept        complement(403852..406767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0343"
FT                   /product="DnaK-related protein"
FT                   /note="KEGG: mca:MCA1306 DnaK-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16043"
FT                   /db_xref="GOA:A0LF41"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR021030"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF41"
FT                   /protein_id="ABK16043.1"
FT                   /translation="MTANASMEAETPSFQYIIGIDLGTTNSAVGYVDLSASGADDAAVR
FT                   FLEIPQLVAPGELGNRPVLPSFLYLPGPYELPPGSTALPWAPERSYAVGEFAREQGALV
FT                   PGRLVSSAKSWLCHGGVDRTHAILPWGAAENLDRISPIEASSRILLHIREAWNEVMAHG
FT                   REEHFLEEQLVVLTVPASFDEVARELTVRAAHEAGIRRIVLIEEPLAAFYAWLWKHEAD
FT                   WRTLMRPGQLILVCDVGGGTSDFTVIAIREDALGLRLDRLAVGEHLMLGGDNMDLALAR
FT                   HVEEVMQGGTGRLDSRRWQQLWHHCRKAKETLLGTVESAGPPAGRPSAPDSVDLTIVGS
FT                   GGRLIAGTLTATLSRETVKELTLDGFFPFTNLDDVSPPAAGAVLSEGGLPYVGDPAVTR
FT                   HMAAFWRRHRPLLLRETGRSRLYPDFLLFNGGALIPETIRDRLLRVVREWFRAEAGDEW
FT                   SPVELENPRPDLSVAIGAAYYGRVRLGRGVRVGAGSPRTFYVEVAPPGDRTVEEGHRTA
FT                   VCLLPRGAEEGYEAELERPEFQVRTNQPVSFGVLASSTRIGDSPGEILSLPNHELTVLP
FT                   PIRTALRYGRKGSAAALPVRLAVHLTDIGTLELWCRSTSGPHRWQLQFDVRHNAEDETR
FT                   PSPAGETFEAGRIDEAGAAIAAVFRRSAGRTLRPPERLVKDLVEIFEVKRERWPASLVR
FT                   KLADALLEDREGRSLTAQHEARWLNLLGFCLRPGYGDPLDEWRAKEAWKLYPAGLSFAR
FT                   QPQNRSEWWIFWRRAAGGLSAGQQQRICQEVLPGLQLEEQRKKGTTRKGGAPRTVQEEL
FT                   ETWMMLANLERLPAAVKTSLGRLMLRRLQRGAPRPQELWTFARFGARVPFYGPLDQTVP
FT                   REEAALWLAALLDLDLEPTQPLARTLVSLSRLTGDRARDLDRADRDRVLRRLESIPGTS
FT                   HLRALVNDARTDLEGTEREWLYGESLPSGLIVVEGAETVEP"
FT   gene            complement(407048..407584)
FT                   /locus_tag="Sfum_0344"
FT   CDS_pept        complement(407048..407584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16044"
FT                   /db_xref="InterPro:IPR021212"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF42"
FT                   /protein_id="ABK16044.1"
FT                   /translation="MAQGRSLVARVEAAAQSVLPSPAPQTDKPEPKTDRPAPAAPSPAA
FT                   EPSPQPVIQLLSSLQSKGRFIDFLQEDLSPYGDAQIGAVARSVHQGCNRALAEYVEMKS
FT                   IFDESEGSEVAVPPDFDVNSVRLTGNVSGNPPFHGILRHRGWKAVKVRLPKAAAGRDKE
FT                   PVLAPAEVEIGATAP"
FT   gene            complement(408046..409005)
FT                   /locus_tag="Sfum_0345"
FT   CDS_pept        complement(408046..409005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0345"
FT                   /product="protein of unknown function DUF402"
FT                   /note="PFAM: protein of unknown function DUF402; KEGG:
FT                   pfu:PF0022 putative RNase E"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16045"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF43"
FT                   /protein_id="ABK16045.1"
FT                   /translation="MTIRAKIRSIYSTALTKLLLDSGHRVVEPSVKIRERFSIEPCDET
FT                   HDVLLMDRDDFQGLDIFGEAESICRLLDCIRKHLLDAVLVELDQDDSDDGLMSARMELP
FT                   GASKEALDQLRYAVTPTLLRHHRLRIVDSTALERAEGTLSLHPEKKGELEKDLFLQAIL
FT                   APLEKAGVVRVEHVRPSGKSMRPREGVLVNATPESILFRRSFSKGGTYDGLDVPIQAGD
FT                   YGLTTIREGAWFVKHAYYTKDDKLIGEYYNVNTPVELYPYGARYLDLEVDVVKKAGRRP
FT                   RLLDREKLALLSRRGAIGSALESKAMAVAGELMQTLAG"
FT   gene            complement(409211..410356)
FT                   /locus_tag="Sfum_0346"
FT   CDS_pept        complement(409211..410356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0346"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="KEGG: sat:SYN_01563 tetraacyldisaccharide 4'-kinase;
FT                   TIGRFAM: tetraacyldisaccharide 4'-kinase; PFAM:
FT                   Tetraacyldisaccharide-1-P 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16046"
FT                   /db_xref="GOA:A0LF44"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LF44"
FT                   /protein_id="ABK16046.1"
FT                   /translation="MQTSIILGTGRFQAIRRLSARVRRLWYSAPETLRGGPLLSAIKLT
FT                   SMTYRAGFEMDRRRSRFRRRRLPAYVVSVGNLAVGGTGKTPLTLWLARYFKNGGRRVAV
FT                   LSRGYGRSGSAPGRVPSSGELSVLALEYGDEPAMLALELGDTPVYVGKHRWESGILAIE
FT                   SSRADLVILDDGFQHHALERDLDLVLLDASNPFGNGFTLPLGPLREPKAHLARAHAIVL
FT                   TRAVEPESVARTRAQLDKAFPDKPVFAAQHILRGFHAGLGGAVVPLRSMVARPAVAFAG
FT                   IADPKSFFSLLEALEIDLRMAFAFPDHHRPTARDTAALFDAVRACSADLLITTQKDAVR
FT                   LPGFLRRVVCVPDLEIDFGEDETRFRRFLDRETRGRQAMPE"
FT   gene            410877..411689
FT                   /locus_tag="Sfum_0347"
FT   CDS_pept        410877..411689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_2762 conserved hypothetical protein
FT                   TIGR02757"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16047"
FT                   /db_xref="InterPro:IPR014127"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF45"
FT                   /protein_id="ABK16047.1"
FT                   /translation="MSRQYIVRGSLHLGRLSESKPGKAAFDELYDRFNRREYVHPDPVE
FT                   FLHEYDDPRDREVVGIVASALAYGRVRQILGSVAEALRRMGASPADFVRSSSPGLIRNV
FT                   FEGFKHRFTTGHEVASMLIGVKRMLERHGSLEDCFASFRKNADETVLPALCAFVGELDG
FT                   SPGSRSMFLPSPARGSACKRFNLFLRWMIRRDEVDPGIWTAVPASQLVVPVDTHMHRIG
FT                   RALGFTVRNGADLRTALEITDAFRTICPSDPVRYDFALTRIGILNENS"
FT   gene            411908..412153
FT                   /locus_tag="Sfum_0348"
FT   CDS_pept        411908..412153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0348"
FT                   /product="glutaredoxin"
FT                   /note="PFAM: glutaredoxin; KEGG: dvu:DVU0883 glutaredoxin,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16048"
FT                   /db_xref="GOA:A0LF46"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF46"
FT                   /protein_id="ABK16048.1"
FT                   /translation="MADCDVMLYALSTCIHCKNTKEYLDGCGVKYDCVEVDKLEGDERK
FT                   NIIEEIKKVNPSCSFPTIIIGDKIIVGSGRKKSRRL"
FT   gene            412158..412493
FT                   /locus_tag="Sfum_0349"
FT   CDS_pept        412158..412493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_2738 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16049"
FT                   /db_xref="GOA:A0LF47"
FT                   /db_xref="InterPro:IPR004209"
FT                   /db_xref="InterPro:IPR036644"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF47"
FT                   /protein_id="ABK16049.1"
FT                   /translation="MMDKEQLYEMLERAQEAKGYYFNKDRKKVLELLESLLINRERYGY
FT                   MACPCRLASEDRERDRDIICPCVYREPDVAEFGSCYCNLYVSREWNEGKIPETYVPERR
FT                   PVEKMLF"
FT   gene            413214..413747
FT                   /locus_tag="Sfum_0350"
FT   CDS_pept        413214..413747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0350"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="PFAM: ROSMUCR transcriptional regulator; KEGG:
FT                   dde:Dde_0303 transcriptional regulator, MucR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16050"
FT                   /db_xref="GOA:A0LF48"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF48"
FT                   /protein_id="ABK16050.1"
FT                   /translation="MDKKLLELAVEIVQAQVSIGKMTGEEIESVLVRVYNALHRMRRAE
FT                   EEGRPVAMEEIGYGAADEHEPPGKGDPRDSIQEDQVICMECGSQFRQLTANHLRTHQLT
FT                   PREYKRKWGFPLKQPLAARVLTKLRSRSAKKRGLPQKLQQYLEDQRRRKGLATPEMHET
FT                   TKRRPGKSVKTGSA"
FT   gene            complement(414257..414898)
FT                   /locus_tag="Sfum_0351"
FT   CDS_pept        complement(414257..414898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0351"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_0401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16051"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF49"
FT                   /protein_id="ABK16051.1"
FT                   /translation="MPATRLRGREAGPPFPFHRLCPVPITRTEESSEFRRPMTDECWQD
FT                   AVRTLAGQIDPAHRRLLEAVANEISLNIKALDTLMDRYCRETCPSCGNPCCDGREVFYN
FT                   RADLLYLLGTGKPVPPGQTRRTPGEACRYLTSGGCLLPRDERPYVCVWFLCEPQMGLFQ
FT                   AEKPATQRQVINTLLDTRSYRLGLESLHDKSGCRLKEVHSTGSECPCTEK"
FT   gene            complement(414900..415379)
FT                   /locus_tag="Sfum_0352"
FT   CDS_pept        complement(414900..415379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0352"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: plt:Plut_1294
FT                   universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16052"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF50"
FT                   /protein_id="ABK16052.1"
FT                   /translation="MVDIGKILVLVDFSRNSAEAVRYGLTLAHSLGARLCFLHTVNQRI
FT                   MDALQELSSKGYKGDFLQALRKLMEDRENDLREFVSKEELAGVEAEFLIRKGEPVEEVV
FT                   SAAGEYSIDLIVVGSQGHAASANGSVGTVAQDVINRARCPVLVVRPIEHDFIEEP"
FT   gene            complement(415426..416094)
FT                   /locus_tag="Sfum_0353"
FT   CDS_pept        complement(415426..416094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0353"
FT                   /product="DNA-3-methyladenine glycosylase III"
FT                   /EC_number="3.2.2.-"
FT                   /note="PFAM: helix-hairpin-helix motif; HhH-GPD family
FT                   protein; KEGG: gme:Gmet_0070 HhH-GPD"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16053"
FT                   /db_xref="GOA:A0LF51"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF51"
FT                   /protein_id="ABK16053.1"
FT                   /translation="MMTDRNGLIRLIFDRLHGFFGPQNWWPADTPFEVIVGAILTQNTS
FT                   WKNVARAVANLRDHGLLSFEALCAVPEPLLAELIRSSGYYNQKARKLKAFCRHVCETGH
FT                   AGLDGFLAQDTDTLRSELLRIRGVGPETADSIVLYAAHKPSFVVDTYTHRVFSRHGWVQ
FT                   ESPSYDELRGFFMDCLEPDVGLFQELHALLVRTGHLFCRKTPRCGGCPLEGLRAGTAAG
FT                   "
FT   gene            complement(416091..417104)
FT                   /locus_tag="Sfum_0354"
FT   CDS_pept        complement(416091..417104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0354"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: gsu:GSU1728 pyruvate-formate
FT                   lyase-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16054"
FT                   /db_xref="GOA:A0LF52"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF52"
FT                   /protein_id="ABK16054.1"
FT                   /translation="MKEAMFYRKLDGNETACFLCPHHCRILPGKRGKCAVRENRDGKLY
FT                   SLVYGKLIALHIDPIEKKPLFHFCPGTTSFSIATAGCNLQCRFCQNADISQAPRDHRTI
FT                   FGEDIQAAVVVERARQHGCATISYTYTEPTVFMEYALDTARRARAAGLGNVFVSNGFMT
FT                   EEAFEAVAPFLDAANVDLKAFNDAFYREQCGARLDPVLKTLERMKKRGIWLEVTTLLIP
FT                   GLNDGDEELKSLAGFLVELGPETPWHVSRFHPDYLMTHVPPTPVETLRRARRIGIEAGL
FT                   WYVYTGNIPGDEGEHTFCRNCGLKLIDRFGFTIGRKQLSQGACVNCGTLLHGVGIR"
FT   gene            complement(417283..418182)
FT                   /locus_tag="Sfum_0355"
FT   CDS_pept        complement(417283..418182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0355"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: dvu:DVU3369
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16055"
FT                   /db_xref="GOA:A0LF53"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF53"
FT                   /protein_id="ABK16055.1"
FT                   /translation="MERSVGYVFRPEDALMVEELSQTPAGRLALLIEQELLLRLWRPLT
FT                   PQRVLEVGCGTGLFLERLVREGHIVTGIDASPAMLEIARRRLAPRVALRQGFAEDLPFD
FT                   DNEFDTVALIGTLEYVNDPVAALREAFRVARQHVLLGAANRYSLETFKLCAQRLWKRSF
FT                   YDHARFYSVYRLRHLVERALAGSVPVRWGTCLSFPLGLLKYVRFLERSRLLQWHPLGHF
FT                   IGMRVDMVYPMQTIQTPLFAEVTSRMDRSRARASCWRSLAGDKGFCRFAPGLDGTGAFH
FT                   PPSTAGRMRISRPPISDR"
FT   gene            complement(418188..419861)
FT                   /locus_tag="Sfum_0356"
FT   CDS_pept        complement(418188..419861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0356"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: sat:SYN_01708 dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16056"
FT                   /db_xref="GOA:A0LF54"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LF54"
FT                   /protein_id="ABK16056.1"
FT                   /translation="MRSDLMKKGVEKAPHRSLFKAMGYTQTELDRPLIGVANSANEIIP
FT                   GHIHLDKVAEAVKAGIRLAGGTPIEFSTIGVCDGIAMNHAGMRYSLASRELIADSVEIM
FT                   SMAHPFDGLVAVPNCDKIIPGMLMAMLRLDIPAILISGGPMLAGRAGHKQVDLVSVFEA
FT                   VGSFKAGTITMEELEQLEDYACPGCGSCAGMFTANSMNCLSEALGLALPGNGTIPAVTG
FT                   ARMRLAKLAGMRIVELIKADIRPRQIATQKAFENAITVDMALGCSTNTVLHVPAIAREA
FT                   GIDLDLGLFNTLSSRTPHLCSLRPGGPHFLENLDQAGGVQAVMKELLARDLIHRDAMTV
FT                   TGLTVGKNLESSKNTDPTVIRPISDPYHNEGGIAILYGNLAPEGAVVKQSAVAPEMLQR
FT                   TCRARVFESETDAAGGILDGKIKPGDVVVIRYEGPKGGPGMQEMLTPTAAIIGMGLGKD
FT                   VALITDGRFSGGTQGAAIGHVSPEAAVGGPIALIEEGDEILVDILNKRLELMVDDATLK
FT                   ARRDKWKAPAPRMTQGYLARYAHMVTSGSTGAVLRTEQDK"
FT   gene            421365..422867
FT                   /locus_tag="Sfum_0357"
FT   CDS_pept        421365..422867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0357"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG:
FT                   syd:Syncc9605_0819 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16057"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR032633"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF55"
FT                   /protein_id="ABK16057.1"
FT                   /translation="MADKPLSNKKVAILVESQYIPEELRAYREKFEAYGATCHFVSRLW
FT                   GQSSQTFISELEDPQGTPETFRVDIDVESVRPEDYAAVIMAANYTSVRLRYFSPPHTMR
FT                   DTPAVKFFADAMRNPRIVKGALCHGLWILTPTPELLTGRKVICHEVVASDIVNAGAVIT
FT                   PSTSGIVVDRDLVTGHSKNEAGAMVDAIKELLTAPALIPDPPRFSLSDVKPGRRRVLVL
FT                   LSEFGYWGEELVGPVEVFDAAGYRADFLTPTGKRPVAITVSMNPEYTDPPLGRSVTSKE
FT                   VAARTREWDDPATVQGRRLETPLNLSEWFPDRPYWSAPQFIRAMEHYNRALDRARREIE
FT                   NYDALLIVGGSGPICDLANNHRVHDLILGFHRADKPIAAECYGVACLAFARELEDRKSL
FT                   IWGKHVTGHCKEYDYKDGTGFMKARGQFYDINMGPPPYPLEYILRDATGPEGGFHGNVG
FT                   RETSVIVDYPFITGRSTPDSYLTGQKLVEVLDGEPPLRRFGW"
FT   gene            423156..425162
FT                   /locus_tag="Sfum_0358"
FT   CDS_pept        423156..425162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0358"
FT                   /product="N-acyl-D-glucosamine 2-epimerase"
FT                   /note="KEGG: hch:HCH_06731 N-acyl-D-glucosamine
FT                   2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16058"
FT                   /db_xref="GOA:A0LF56"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF56"
FT                   /protein_id="ABK16058.1"
FT                   /translation="MKSLNQKMTVLGTVVDVQDLGFTLRLRTGDNLTVCVGAGTSFMVL
FT                   SNLDGLIYDRFPEPDNVPVVAGDDDITKGIKYKVKKYICSGQKMYVQGTFFQNAGNERF
FT                   EALAVRPFHYQPDKFLFEHHTHWWLSQMATMADQWLQSLFGDSRTYDESDFSRLYRTNL
FT                   NIYGGKTDDDIQDMATLSRLIYGLSSAYLLLGDRRYLDAAAAGVDFQRTAFRSLSHDGR
FT                   TIIWSHARRKLVNGNLTYIPSLMGDDAGTIPLYEQIYALAGMTQYFRITGDPEVLDDIM
FT                   RTVRAFNTFFLDDSAVVPEYPGKKGYFSHIDPATMRADSPALAHNRLRKNWNSIGDHIP
FT                   AYLVNLILALDPLPQGAGKDIERFLKKCEDMLDLTTDLIIEKFPEADCPYVNERFFADW
FT                   TPDQGWQWQQNRAIVGHNLKIAWNLTRVANYYSYKGQDQKAKRAMQLAEQLGKAMVDAG
FT                   LDKVRGGCFDAVERKPKSPGEIQFVWGNHKDFWQQEQNVLAYLILYGYTGTNLYRDLFR
FT                   DAAAWWNTFQLDRDNRGVFFRVSDNGDPFISGRGMAGFDIAGYHSFELNFLAHIYLRTF
FT                   VYSGAGVATKDDRSEAGADFCLYFWPAERSQIQSLNVLPDFMSPGVLDITSIKVNGKER
FT                   KFMAQEDFQIPLQPDELGKEIVVSFRSGRLHKQ"
FT   gene            425356..427839
FT                   /locus_tag="Sfum_0359"
FT   CDS_pept        425356..427839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0359"
FT                   /product="alpha amylase, catalytic region"
FT                   /note="PFAM: glycoside hydrolase, family 13 domain protein;
FT                   alpha amylase, catalytic region; alpha amylase, C-terminal
FT                   all-beta; SMART: alpha amylase, catalytic sub domain; KEGG:
FT                   rba:RB548 1,4-alpha-glucan branching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16059"
FT                   /db_xref="GOA:A0LF57"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF57"
FT                   /protein_id="ABK16059.1"
FT                   /translation="MSWIPVHFTYHVGLQGGIFRNVRLVGSWDANGSHSDQWTGVPMRE
FT                   EVSDSGCPCFRATVNLNGDQAGWTFGWGVLLDGPGGANRWGITTEVHDRNSSERFRGFQ
FT                   LKGPEQFNEYHLTHCRRLGANKLHRPGGGEPAVRFAVWAPNALHVEMVRGDAATGYIDD
FT                   NGTGALAAFPMHKEMVDGTWTGIWRTDDDSEGLESFAQFDHTPYMFRITKDDDTVCYRT
FT                   DLYSRCQIGSGKKNPEGKKYDGRPTGLAGSVSCSVVVDPERVTELFDEPFPQKQWLDAD
FT                   EFWKNEFDPLRPVPTRIDDLVIYEMHVPGLGCGKTDAAGEPFTGDLKDAVQMLDYLVDL
FT                   GVNAVEVLPMNEFEGWAAWGYATSHYFAVEYAGGGRDQFKHFVRECHRRGLAVLLDVVY
FT                   NHYAHNAERAEWMYDSNRHEKNIYYWYEGMPSDYRDYEHAAGDPTLDPRKRPASGHGGY
FT                   VDNMSTGYAPRFCEEMVRKMFISSAAALVHEFHVDGFRVDQTTSIHSYAVVHADGRAAA
FT                   DARIFGAKFLRELTRTLKLIKPTVMLIAEDHSGWSAVTEPPDKGGLGFDAYWYADFYHH
FT                   LIGDTDKGADYAKLIKTCGFGDDRPLAVDYFVGALRHAGNLTVVYHESHDEAGNAKFSG
FT                   RTIAVAVNRATLSGETRRWAEARCRLACGLNMLSPGVPMFFMGEEVGFQKDYPYDLFLS
FT                   QREDFLRERGGSGANLFRFYQDIIKLRRRKPALRTAGLVPLHVRNDNRVLVFRRSLENE
FT                   HLIVFASFNNYAFVDGYRVNEAEIPDGAWREIFNSDAAVYGGNNVGNGGMVRESRYGSM
FT                   DAVIPANGFVVFERL"
FT   gene            428254..428691
FT                   /locus_tag="Sfum_0360"
FT   CDS_pept        428254..428691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0360"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: dsy:DSY3064
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16060"
FT                   /db_xref="GOA:A0LF58"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF58"
FT                   /protein_id="ABK16060.1"
FT                   /translation="MEPERQKALYPIGIVAELLNIHPRTLRIYEQEGLIKPARRGGKRF
FT                   YSNIDLQWLRCLRKLLTDEGLNIAGIKKLLTIAPCWSIRDCDEETRKQCPAILNFPVPC
FT                   WELKPRCCKDSDLACSDCEVYRHKMDRVIMLKCPDSGVEKT"
FT   gene            428830..429771
FT                   /locus_tag="Sfum_0361"
FT   CDS_pept        428830..429771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0361"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: dps:DP0197 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16061"
FT                   /db_xref="GOA:A0LF59"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040084"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF59"
FT                   /protein_id="ABK16061.1"
FT                   /translation="MRTIFGPVPSRRLGRSLGIDVIPPKTCSYNCVYCESGLTTHLTVK
FT                   RRAFVRPEDVLAELREYFLEHPGGADALTFSSAGEPTLYEPLEELVRAVKEAYASLPLI
FT                   VLTNGSLLWHPEVRRALLRADRVVPSVDAISDEAFKCVNRPHPELDNDSILDGLRAFRK
FT                   EYKGQLHVEVMLVSGLNDNREELLRLSRFVEELGPERVELNTVVRPPAQWGTTGLSARR
FT                   MEECASFFPAGKTDVIGRFQRAEGQGEDPDLSGRILELVSRRPCSIEEMAASLGVPEVE
FT                   LRRAVMSLEADNRLTRYLYNEIEFLCSPECRR"
FT   gene            complement(429914..432646)
FT                   /locus_tag="Sfum_0362"
FT   CDS_pept        complement(429914..432646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0362"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   mxa:MXAN_1141 peptidase, M16 (pitrilysin) family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16062"
FT                   /db_xref="GOA:A0LF60"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF60"
FT                   /protein_id="ABK16062.1"
FT                   /translation="MICRLLFGICVALSLLGPGVVARCAAAQICPSLPPPLQPSVQRIL
FT                   SSKPGDLFVVLKNGLTLLMSQKPNYDVVSAQVFVRAGSIYEGKYLKSGLSHYLEHVVSG
FT                   GTTRSFTEDQAKERLKKIGGNSNAYTSHDRTVYYINTSAEHWKDALDLLLSYVSECTLE
FT                   PTEVAREKPVIQQEIKMGESNPSNELWKLFLRTAYQVSPVRNPVIGYEEVFVRLDRQAL
FT                   LDYYAQRYQPENIVVVVAGNISPEAVLSFVADKTKDFLGTAGEFDAVPVEPAQSTTRRQ
FT                   EKEIPVARLTQAMVGFPSVDLNHQDMYALDVLSLLLGGGETCRLHCRLKDMENKVLSVS
FT                   ASNWTPSYTKGQFIVSFTLPPDEWPGVLSQLGEEIEVFKRDLVPMKELDKAKKTAMASH
FT                   VFSNETVSSIAASLGSSYFSTGDPYYDDTYVEEIRRLTPEGIRSAAQRYLIMDRINVAA
FT                   TKPLSRQAAATPDTASCPPREASPAHMSKLDNGLKVLLKRDDSLPMVTMHLYGLGGLML
FT                   EDGDKPGIASLTSALMTSGTLTRTRQQILQSIEDVGGSIETQSENSTYHVSIKILKEDF
FT                   HTALDILADIVRNAQYPEEEIEKKRQDTLLAIQRMDESWQAEIVRLFKKNYFEKSPYRN
FT                   DRLGTRESVESISRDDLLRFHRRMVNPGQAVLAVYGDIDAEKTSERVRQLFGTWEQGEV
FT                   KYPELPDETTQISANRVVEKKNEKGSAALFVGTNGFAIRNSRRATLDVLDAVLSGAGNP
FT                   GGRIFEALRGKQDLVYVVGAFPFYGNNAGYFGVITQTTMANLDKVQGIILDNLRILARE
FT                   PVPADELEKAKSQIVTAHRLHMESLDAQAGSAAINEVLGLGWQYDKEYLKEVQAVGPAD
FT                   VRNLAKELFAHTLIARTIPERPVEVLSVPPPSKSDVRAQ"
FT   sig_peptide     complement(432563..432646)
FT                   /locus_tag="Sfum_0362"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.529 at
FT                   residue 28"
FT   gene            complement(432918..433862)
FT                   /locus_tag="Sfum_0363"
FT   CDS_pept        complement(432918..433862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF61"
FT                   /protein_id="ABK16063.1"
FT                   /translation="MFWRVPRSIAIPCMERQSLSAAHPVYVALARGLESCAAVLTLGLR
FT                   ESIGAYSAEERDLLREARVVFFPSIRFVDVLEATGKRTFPSPSTYRFQRSRLQQELLIR
FT                   YLGIPHPRTRFYYGARQKRHILEGFEYPFLAMGPGHVSSPPRIVRNADDLGRACRAFNP
FT                   VVIQETPAWDERLRLICVGDACAGALRLHGGGGEAAGWEPVDIEAMRTGDARATRLPGG
FT                   SETAAGSTRVHGHTGSGKRAPGRGGAEAAVFRSTHDLMRTAGLDDMVFEWARAGTCWYL
FT                   VRMERPPSTWLTPAGRVHHGRHLCKLIQSGAFS"
FT   gene            complement(433974..435395)
FT                   /locus_tag="Sfum_0364"
FT   CDS_pept        complement(433974..435395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0364"
FT                   /product="type III restriction enzyme, res subunit"
FT                   /note="PFAM: type III restriction enzyme, res subunit;
FT                   SMART: DEAD-like helicases-like; KEGG: lpf:lpl2488
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16064"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF62"
FT                   /protein_id="ABK16064.1"
FT                   /translation="MFVKVLNILVAEWIKIPAEGLSPLLERKLHERLVFTNPDYEMRHN
FT                   RGEWIGNIPPQISCLRQKGRHYLLPRGFLDQFVDLCKKFQQPYRIVDRRRTFEPLPIEF
FT                   HGELKSYQQDAAEAVLDHDCGTLVGGHKSGKTVIALYTIAQRRQPTLILLPKLDLLEGW
FT                   LTKIENFLQIPSSEVGMFSTGVHQIGKYITIGHTGEVIRYWRKLWEHVGYLIVDECQRC
FT                   PSKILTNLIPNFDCRYILGLTNTTQRKDRLSRLVYYYVGDVVYTINDKDAREGRGIIHA
FT                   HVVTRQTDFEYPYSSRADYPTMLQALMKDEKRNRIIADDIEAELQKSPHPLIVLSGGEE
FT                   QEDTLGGELRRRGISVFQYRAAEPEGGGDTDSPPCPQMPVSEAPQAVFVTAQTLTRCSQ
FT                   ALSSKTLVLAVPLYFRKNLALAIRDLFQNGSSPESKFKIYDYVDHKIGLLENFFRMRSY
FT                   NYGVHPDVLLNPSLN"
FT   gene            complement(436136..437680)
FT                   /locus_tag="Sfum_0365"
FT   CDS_pept        complement(436136..437680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0365"
FT                   /product="MltA domain protein"
FT                   /note="PFAM: MltA domain protein; 3D domain protein; KEGG:
FT                   sat:SYN_02860 membrane-bound lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16065"
FT                   /db_xref="GOA:A0LF63"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF63"
FT                   /protein_id="ABK16065.1"
FT                   /translation="MCPGRKPSSAAPDMLPKILSLAFAALVLFAGCTPQPAPKPTAVSV
FT                   LQRLPEEQLPDFSDDMDAASLLTAAERSMKFFDRVPADRLYSLGEVQVRADLLKSTLQR
FT                   FLELCRAQRLDRKTIAAAFDVFLVAPPDRPSLVTGYYEPILEARGRRDETFRHPLYGVP
FT                   PDLLTIDLPSFDPVKFPTGRLIGRLNERKVVPYFTRAQIDGEKALDRWGSELAWLADPV
FT                   DAFFLHVQGSGMLRMPGGDRRIGYAGANGRPYRSIGKVLIDRGVMTVDEMSMQAIRAYL
FT                   GAHPELMEEILWHNESYVFFQWVKEGPMGSINVPLTAGRSIATDPQFHPSGAPCFLETQ
FT                   KPRLDERGNVLGWEPLHRWVLNQDTGGAIKGPGRVDLFCGTGEQGEWQAGRLKHPGKLM
FT                   ILIRKGGIPSGSSQPAVLRRTDAGLPELRPQETCGASPRGAAIAWRSRRHWKRIRISSK
FT                   HRLSTMMAFRGSSSLRSMSETDAREVSRNIWAALNRSVVSSPRSLTWRSNMEGSAC"
FT   gene            complement(437684..438940)
FT                   /locus_tag="Sfum_0366"
FT   CDS_pept        complement(437684..438940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0366"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: aae:aq_1180 S-adenosyl-L-homocysteine
FT                   hydrolase; TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase; D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16066"
FT                   /db_xref="GOA:A0LF64"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF64"
FT                   /protein_id="ABK16066.1"
FT                   /translation="MEFDVKDPGLAEKGKLRIEWAAQSMPVLRSIHKRFAAEKPLQGTR
FT                   IAACLHVTTETASLAQTLKAGGAEVRICASNPLSTQDDVAASLVVNDSIPVFAIKGEDK
FT                   DTYYRHINSALGHSPHITMDDGADLVSTLHSDRRELLQGILGGTEETTTGVIRLRSMAD
FT                   KGVLQYPIIAVNDASTKHLFDNRYGTGQSTVDGIVRATNRLLAGSGFVVSGYGWCGRGV
FT                   AMRASGMGAKVIITEVDPLRALEAVMDGYQVMPMEQAAVVGDFFCTLTGDIHVIRREHF
FT                   AVMKDGAIVCNSGHFNVEIDLDALASMAVARREIRDFVEEFKLADGRRVYVLGEGRLIN
FT                   LAAAEGHPSSVMDMSFANQALCTEHMVKHHTTLKKQVYRVPMEIDKNIAKLKLASMNVD
FT                   IDTLTPEQDAYLHSWEMGT"
FT   gene            complement(439135..440304)
FT                   /locus_tag="Sfum_0367"
FT   CDS_pept        complement(439135..440304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0367"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="PFAM: S-adenosylmethionine synthetase; KEGG:
FT                   gsu:GSU1880 S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16067"
FT                   /db_xref="GOA:A0LF65"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LF65"
FT                   /protein_id="ABK16067.1"
FT                   /translation="MSMSNFLFTSESVTEGHPDKVADQISDSILDAIITEDKTARVACE
FT                   TLVTTGLAFVAGEITTSSWVDIPDIIRSTIKGIGYNDSSMGFDWSTCAVITSIDKQSPD
FT                   IAQGVNPGEGLFEEQGAGDQGLMFGFACNETPVFMPMPIYYAHRITRKLAEVRKNGVLE
FT                   FLRPDGKSQVTVEYDDHRPKRIDTIVVAAQHAPNVSYSMIRESIIEEVIKKVFPPELID
FT                   DKTKYFINSTGRFVIGGPMGDCGLTGRKIIADTYGGQGSHGGGCFSGKDPSKVDRTASY
FT                   MARYVAKNIVAAGVADKVEVQVAYSIGVAEPVSLMIDTFGTGKIPSDRIAEIVRKLFSF
FT                   KPANMIKQLRLLRPIFKKTACYGHFGRNDPDFTWEKTDMVEPIRELAGI"
FT   gene            complement(440423..440797)
FT                   /locus_tag="Sfum_0368"
FT   CDS_pept        complement(440423..440797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0368"
FT                   /product="L-aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: cvi:CV1637 aspartate 1-decarboxylase
FT                   precursor; TIGRFAM: aspartate 1-decarboxylase; PFAM:
FT                   aspartate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16068"
FT                   /db_xref="GOA:A0LF66"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LF66"
FT                   /protein_id="ABK16068.1"
FT                   /translation="MQRLMLKSKIHRARVTEANLHYEGSLTIDETLMKAADILPYEQIK
FT                   VYNVFNGARFDTYAIAGPAGSGVFCLNGAAARMGAAGDLIIIATYAQYDEAEIARHQPK
FT                   VVLLDGDNRPLSQGLKACLS"
FT   gene            complement(440851..441702)
FT                   /locus_tag="Sfum_0369"
FT   CDS_pept        complement(440851..441702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0369"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: sat:SYN_00420 pantoate--beta-alanine ligase;
FT                   TIGRFAM: pantoate--beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16069"
FT                   /db_xref="GOA:A0LF67"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LF67"
FT                   /protein_id="ABK16069.1"
FT                   /translation="MRIIETVSEMQQQADDWRRAGKRIGFVPTMGYFHEGHLMLMRKVR
FT                   GEADMVVASIFVNPAQFGPNEDLATYPRDLDRDLRLAGEVGVDVAFVPQVGEMYPDGYQ
FT                   TYVEVTKVTAPLCGRSRPLFFRGVATVVVKLFHIVKPHVAVFGEKDYQQLVTIRRMVKD
FT                   LNLDIEILGHPIVREPDDLAMSSRNKYLTPEQRPLALRLSRALKAARARVALGERNGSV
FT                   ILKEVKELLDAGGEVRIDYAELRDPATMEEVGSMDGPSLLALAVFVGTTRLIDNCILRP
FT                   AA"
FT   gene            complement(442421..443479)
FT                   /locus_tag="Sfum_0370"
FT   CDS_pept        complement(442421..443479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0370"
FT                   /product="lipopolysaccharide heptosyltransferase III,
FT                   putative"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase III,
FT                   putative; PFAM: glycosyl transferase, family 9; KEGG:
FT                   dar:Daro_0152 lipopolysaccharide heptosyltransferase III,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16070"
FT                   /db_xref="GOA:A0LF68"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011916"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF68"
FT                   /protein_id="ABK16070.1"
FT                   /translation="MTLNNINNILVIKFKHIGDVLVTTPLFRNLRIHFPDARICASVIH
FT                   NTVEMLSDNPDIDAIFPVNRRSGLWTQLRLIGELRRNRFDLVIDLSEGDRGAIVAFLTG
FT                   SPCRLGYRRRRSKFMGRDLLFTDLMSSVDNDKHAVRYHLEPLRALGLPVKTEKMRLQWT
FT                   DAVEEKVDRLLRERGLKEQPFVVVHPTSRWLFKSWTPEGNSAVIDFLRERCRLPVVVTC
FT                   SDDPNELAVVKSIMHGVRVPVVDLAGQLTLKELASLIRKAVLFFGVDTAPMHIAAAVGT
FT                   PVVALFGPSGDHMWGPWGHSHVVVSQPWDCRPCGRAGCNDSGSSRCLETIRAETVIDAL
FT                   SAKLRDLGFTPS"
FT   gene            complement(443514..444650)
FT                   /locus_tag="Sfum_0371"
FT   CDS_pept        complement(443514..444650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0371"
FT                   /product="glycosyl transferase, family 9"
FT                   /note="PFAM: glycosyl transferase, family 9; KEGG:
FT                   dar:Daro_0162 glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16071"
FT                   /db_xref="GOA:A0LF69"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF69"
FT                   /protein_id="ABK16071.1"
FT                   /translation="MRMTGNQSHHDNRTGGADAESSAPPGLRLPSRERVKFLLIRRDNI
FT                   GDLVCTTPSILALRRTFPQSRIDLMVNGYNADAIVGLPELDTVHIYHKSKHGRFRYGWQ
FT                   NHFHLLDLFRKIRRERYDVAIGVAGQFNKTTARFTLMSGAFHRIGYASRASAIPLFERL
FT                   CYTRLVAPPDPGCGAHEVELSYRLLAPLGIRDTPGPMKLAVRRECLQEIRDLLLSRNAV
FT                   GPVVGLHISSRRPENRWAPENFVELARMVSRERPETKFLILWAPGDASNPYHPGDDRKA
FT                   RDIAEALRDCAVPCRTDTIPRLTAAMSACRLVICGDGGAMHIAAALQRPVVAIFGSSDA
FT                   SRWRPWGTKCELLQKGRKADDNSVEEVYRCCGKLMIGS"
FT   gene            complement(444786..445895)
FT                   /locus_tag="Sfum_0372"
FT   CDS_pept        complement(444786..445895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0372"
FT                   /product="glycosyl transferase, family 9"
FT                   /note="PFAM: glycosyl transferase, family 9; KEGG:
FT                   dar:Daro_0157 glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16072"
FT                   /db_xref="GOA:A0LF70"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF70"
FT                   /protein_id="ABK16072.1"
FT                   /translation="MRLFHPTFKWIIRKISGRMPPPLDLETFRPDAVNSILIVSSTAIG
FT                   DALMSTPAIRSVRTSYPEANIVLLARHRYRELFENNRHVDKIVSYHGGYKKFLQTVRLL
FT                   RKEAFDLAVILHGNTPQAVPLAYLTGARHLVTLPVEREFAYLISNRNGDHSSRLPQHTI
FT                   RQRLGIAQLAGGAGTSVDMELEVTGEARRQVDAWLHGAVDIPDPLLVGFQAGASKPYKQ
FT                   WPVKSFAELGKRILASHPRARIFAIGSPKEKALCAEVVRAIGSDRAVSVAGRFPLTQVA
FT                   ALIGRLELLVTNDTGAMHIAIALKTKTVSLFCPTSSRVSGAIQDPVLHRAIEKDLPCRP
FT                   CIGKKCTTPFCMEQITVEEVFRAFREFEC"
FT   gene            complement(446074..447234)
FT                   /locus_tag="Sfum_0373"
FT   CDS_pept        complement(446074..447234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0373"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   cvi:CV0817 probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16073"
FT                   /db_xref="GOA:A0LF71"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF71"
FT                   /protein_id="ABK16073.1"
FT                   /translation="MPPRIAFVRYKYTAFGGAERFTDMLVESMAGRGVEVHLYARKWKE
FT                   TPGNNVVLHRVEGPSRPALLGQAGFVFAVHRMLARGRFDLVHSNERILSADVYRAGDGV
FT                   HARWLELRRSRQNVLRRLIVLLNPHHVFRLWLERRLLEHPALKAVIVNSTMVREEILAR
FT                   FRIDPSRVYTIYNGVDLERFHPDNRRSIGVELRRLRALAEDTPVVLTVGSGFERKGLEP
FT                   LLRGMASAEGNAELWVVGKGRSGRYADIARRLGIAHRVVFWGPREDTAPFYAGADIFAL
FT                   PALYDPFPTVILEAMASGLPVITTAQCGAAEIISNGREGFVLRSPDEVATLAERLRQLY
FT                   SAPFRAAMSERARVAAEAFPVERTMRELEALYAGILDSDCRSGSGQ"
FT   gene            complement(447307..448056)
FT                   /locus_tag="Sfum_0374"
FT   CDS_pept        complement(447307..448056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0374"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   gme:Gmet_2344 probable beta-1,4-glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16074"
FT                   /db_xref="GOA:A0LF72"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF72"
FT                   /protein_id="ABK16074.1"
FT                   /translation="MKPGISAVVITWNEASNIRDCLASVRWAAEMIVLDRFSTDDTAAI
FT                   ARECGARVYQEEWKGFARQKNSAVEKAVSPWILSLDADERVSPLLAEEIQAVVGRPYAL
FT                   DGYHIPRKNFFDGRWIRHGGWHPDYVLRLFRKGSGRFQDRRVHERLVLEGKSGYLRSPI
FT                   EHYTYRSVSDYLARMDRYSLLAAQETESDGKAAWSSLCLRPAFTFFKMYLLRGGFLDGK
FT                   AGFFLAVSYAYYTFLKYYRASIGDASE"
FT   gene            complement(448053..449141)
FT                   /locus_tag="Sfum_0375"
FT   CDS_pept        complement(448053..449141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0375"
FT                   /product="lipopolysaccharide heptosyltransferase I"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase I;
FT                   PFAM: glycosyl transferase, family 9; KEGG: pca:Pcar_1264
FT                   heptosyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16075"
FT                   /db_xref="GOA:A0LF73"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF73"
FT                   /protein_id="ABK16075.1"
FT                   /translation="MTISKPLRKMLVVKPSALGDIIHALPFLDAVSRSHPGIAIHWVAA
FT                   RGLHEILVDHPMIRKLWIIDKNAWKRPAALPRTVHEIMNLASGLRRERFDIVVDLQGLL
FT                   RSGMICAVSGAGMRLGFSDAREGSPLFYTHGINGGRDVHAVTRCLRMAETLGCDTREVR
FT                   FPLPALPARNLFPQWCGDDYLVIAPGAGGAAKQWPVRFFGELAARLPLKSLVVGGASDA
FT                   VLAAEVQRLSHGHAVSIAGMTGLRELAAVIGGARALVSSDTGPMHIAAALNVPVVAVFG
FT                   PTNPARTGPFGSIHTAVVADVPCSPCYKRKRCREWRCMESIGVRQVLDAVLSRLAEPPP
FT                   AATYGDDDRAGPAVRLQNEKAS"
FT   gene            complement(449261..450160)
FT                   /locus_tag="Sfum_0376"
FT   CDS_pept        complement(449261..450160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0376"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   aba:Acid345_2346 lipid A biosynthesis acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16076"
FT                   /db_xref="GOA:A0LF74"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF74"
FT                   /protein_id="ABK16076.1"
FT                   /translation="MNIDPVPPISRLLDALARMDRGTCARLADLAGDLWHRFDRRHVEI
FT                   VHSNLRRAFGDDLNDADRNKLCRAVFRNLARVILEFPFLRVLDRRVDEFMCFEGYEHVV
FT                   QARAKGKGVLIMASHFGNWEMMSLGCSYRCTPFSVVVRPLDNRVLDELVNDMRSAGGNR
FT                   IVPKKGSIREVLRILRRGELVALLVDQNVDWYDGVFVPFFRDIACTNKALAVLALRTGA
FT                   PVIPLHNFRRPDGKYQVVIEPELELIRTGDTTSDIEENTALFNRVIEGYVRRYPEQWFW
FT                   VHQRWKTRPWQPWPKGRE"
FT   gene            complement(450362..451420)
FT                   /locus_tag="Sfum_0377"
FT   CDS_pept        complement(450362..451420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0377"
FT                   /product="lipopolysaccharide heptosyltransferase II"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase II;
FT                   PFAM: glycosyl transferase, family 9; KEGG: pca:Pcar_1263
FT                   ADP-heptose--LPS heptosyltransferase II, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16077"
FT                   /db_xref="GOA:A0LF75"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF75"
FT                   /protein_id="ABK16077.1"
FT                   /translation="MTRSSEPLPDLRRIMIRSVNWIGDAIMTTPAMAAIRAACPDAEIA
FT                   VVANPPVAELLAHHPACDRIILFDKKRECKGIGGFLRFCAELRDERFDAAFLFQNAFEA
FT                   AIMAFAASIPIRVGYRTDGRRMFLSHGLSPSISRGLHHTLYYLRLVERFGMTGGDRRIT
FT                   LACTPEEMDRAGELVPHRRFAVINAGAAYGSAKRWFPERFAAVADAVFEEFGLHPVLIG
FT                   GLGETQIGAEIVRAARTRVLDLTGTTTVRRMMALIARSALMITNDSGPMHVGAAFGVPL
FT                   VALFGPTDPEATAPVSAAALVVRHSVECSPCRRRVCPTDHRCMHSITVDDVLEAARAVL
FT                   RETKPPSASSPA"
FT   gene            complement(451701..452891)
FT                   /locus_tag="Sfum_0378"
FT   CDS_pept        complement(451701..452891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0378"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   gme:Gmet_1823 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16078"
FT                   /db_xref="GOA:A0LF76"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF76"
FT                   /protein_id="ABK16078.1"
FT                   /translation="MNGNTRLRVLFIVATAFALALCPLWTGARAADPIKIGAFFALSGP
FT                   ASSIGTPTKLVAQMVVDKINKEGGINGTPLELVVGDTESDPTKALMEAKRLIEAGKAAA
FT                   LIGPTRTDEGMAVKAYIEDTAHIPIVMTIGGDPVIAGGKFGPFKWTFKAPQRTSVAARK
FT                   TYDFIRSLKLTKIAVLTATDGFGKDGLTWLEQLAPEFGLEIVAKEAFGVTDTDMSPQLL
FT                   KIKASGAQAVICWTIGPAGARVAKNVKQLALGIPLVQCHGQPDPKYIELAGDAAEGSIM
FT                   PSTKLMVVDQLPDSDPQKAVIMEFIKLYTDVYHFDKQYPINTHSGYAWDAIYLAANAMR
FT                   KVGTDAEKLRAAIEQTKGYVGVSGVFNLTPEDHNGLGTDSLVMVKVEKGKWVLLKP"
FT   sig_peptide     complement(452799..452891)
FT                   /locus_tag="Sfum_0378"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.904 at
FT                   residue 31"
FT   gene            complement(452982..454280)
FT                   /locus_tag="Sfum_0379"
FT   CDS_pept        complement(452982..454280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0379"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="KEGG: gsu:GSU2051 phenylacetate-coenzyme A ligase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16079"
FT                   /db_xref="GOA:A0LF77"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF77"
FT                   /protein_id="ABK16079.1"
FT                   /translation="MSVSFMPVRASREDLHALQLQGLQWTVSHAYRNSPFYRAKLDAAG
FT                   VGPDAVRSLDDLSRLPLTTASDLKDGYPFPLRSVPFEKIVRIHASSGTTGKRKVLCYSQ
FT                   KDIDDWACMFARCYEMARLTREDRVQIAVGYGLWTAGVGFQLGCERFGAMAVPIGPANT
FT                   EIHCQMLLDMQSTVFCATASMALLIAEEIERRGIQKKIALKKFIFGAERHSAGMRRRIR
FT                   EITGVNELFDIPGLTELYGPGTGLECPAHEGVHYWADYYILEILNPETLEPVAPGEVGE
FT                   MVVTTLRKEAAPLIRYRTRDLTRLIPGDCPCGNPLPRHDHLLGRSDDMFIFRAVNIYPG
FT                   QIDHVLSQISGIGSEYQVHLYRREDGRDVMLVKVEQVGSDSPDADRKLAETVAAEVRRQ
FT                   IMVRCQVEILEYGTLPRTERKSRRVFDHRTVED"
FT   gene            complement(454735..456447)
FT                   /locus_tag="Sfum_0380"
FT   CDS_pept        complement(454735..456447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0380"
FT                   /product="glycosyl transferase, family 39"
FT                   /note="PFAM: glycosyl transferase, family 39; KEGG:
FT                   mag:amb0262 4-amino-4-deoxy-L-arabinose transferase and
FT                   related glycosyltransferase of PMT family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16080"
FT                   /db_xref="GOA:A0LF78"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF78"
FT                   /protein_id="ABK16080.1"
FT                   /translation="MFRSEGPTPYILLVVLCCLLYLPGLTRLPVVDRDEARYAQATRQM
FT                   LESGDFVRIRFQDEPRHKKPIGIYWLQAASVSLFSASEGKDIWPFRVPSVLCATLAALL
FT                   TFALGRRLFDARRALLGAALLAACVMLIFEAHQAKTDAALLAATLAAQGSLALVYLRAK
FT                   SEEPALVWPVISFWFALGVGILIKAPVAPVLSGFTIAALVIADRNGQWLKRLRPLPGIL
FT                   LLALVVCPWAFAIYKATGGSFFYDSVARDILPKLISVHESHGSPPGYYLLLSTITFWPA
FT                   SACLGPTLHGAWKKRRSPGVRFCLAWIVPYWIFFELAPTKLPHYTLPVYPALALLTADA
FT                   LFTLKEGGAKWPRFWPRWVPILVWSITGAAMFGISIFFPWYFDGRFLPEALLPGLAAVA
FT                   AVALAIRSLAGERPVKSAIIMIVGSTVIFGFALHRILPEVRGFWPTTTVVDAVHALERA
FT                   RGTRIPVASVGYQEPSLVFMLGTDTGLLTSANAVSLLARNPRALVIVDNKSEEEFHRDL
FT                   DAARVSVREIGSVRGFHYTKGRWITLRFCVSTAAPSEEGTNLPGTNPARLPGP"
FT   gene            457023..457685
FT                   /locus_tag="Sfum_0381"
FT   CDS_pept        457023..457685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0381"
FT                   /product="phosphoesterase, PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   plt:Plut_0466 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16081"
FT                   /db_xref="GOA:A0LF79"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF79"
FT                   /protein_id="ABK16081.1"
FT                   /translation="MRKKVLLYSFPVFLAICALSYFTLDRPVAVYCRGLDKSVRDVFRT
FT                   VTYLGVSTWYMAASAAVFAFFRFVRKREAWSNRGLLVFLSVALSGIITDLIKFVLGRAR
FT                   PTLLFEKDWYGFYFFETKYAFLSFPSGHAATVAALAVALYFMFPRYGFLYALGMLLVMA
FT                   SRVVIGSHYPGDVIFGAYLGAITALAVGRVMDSKGFGTGIGGRSERMIPVQGTDGAA"
FT   sig_peptide     457023..457094
FT                   /locus_tag="Sfum_0381"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.718) with cleavage site probability 0.614 at
FT                   residue 24"
FT   gene            complement(457775..459103)
FT                   /locus_tag="Sfum_0382"
FT   CDS_pept        complement(457775..459103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0382"
FT                   /product="Phenylacetate--CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="KEGG: gme:Gmet_1818 phenylacetate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16082"
FT                   /db_xref="GOA:A0LF80"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF80"
FT                   /protein_id="ABK16082.1"
FT                   /translation="MAVSQNPIAVMSRDEVGQLQLERLQMTLNRAYFKVDFYRKRMDVL
FT                   RMLPEDVGTFEDFRQFPFTTREDLTDHYPYGLFAVPLRSIVRLKITSPPLRDQTRPIVV
FT                   GFTRHDTAMWQTLMVRLFEQLGVTDRDIVQVAFNFSLFPGAFTFNHAAEMLGATLAPSA
FT                   TISATMQLRIMQDFRSTVLATTAAFALHIVDTMERQGWDASGLHLRLILLGPDPLSEIT
FT                   RRRVEAVFGVPVYGLYGVAEMGEPGMAGECPSRQGLHLAEDQFLAEIVNPATGEPLAPG
FT                   QEGELVLTTLTAEGYPLIRFRTGDITVLRDTPCACGSTLARIIPILRRTDNRVSIRGIP
FT                   VYPEHVEELLKGVDPGMEDFRLVIHTQYGIGEQMEILICRSATDDLPGGNRAQYLELLR
FT                   SQVRRALGLGVRVQVVEPERLPREGLTYKTVFRNVSPFSNDVP"
FT   gene            complement(459107..459832)
FT                   /locus_tag="Sfum_0383"
FT   CDS_pept        complement(459107..459832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0383"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gsu:GSU1730 branched-chain amino acid ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16083"
FT                   /db_xref="GOA:A0LF81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF81"
FT                   /protein_id="ABK16083.1"
FT                   /translation="MLRVKGLSVRYGSVQVLRRVSFHVAENEIVALIGANGAGKSTLLR
FT                   ALSGINRPFEGEILFRGEPLLKVSPERIVRMGLVQVPEARQLFPNMTVLENLELGGYLY
FT                   GLKHVRAKLAEIYELFPVLMERSRQKAGTLSGGEQQMLSIGRALMARPRLLVLDEPSMG
FT                   LAPLIVEEIYRTVEALHREGTTVLLVEQNAMGALAVAERGYVLETGRIVLSGRADELME
FT                   HDDVQRAYLGKDYEYKWER"
FT   gene            complement(459851..461695)
FT                   /locus_tag="Sfum_0384"
FT   CDS_pept        complement(459851..461695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0384"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: inner-membrane translocator; ABC transporter
FT                   related; SMART: AAA ATPase; KEGG: atc:AGR_C_2606
FT                   branched-chain amino acid ABC tranpsorter, ATP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16084"
FT                   /db_xref="GOA:A0LF82"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF82"
FT                   /protein_id="ABK16084.1"
FT                   /translation="MNLIIVPRQWRALLPLAVVLWGLPLVMRNDYLLLLCNVMALNAMV
FT                   VLGLNLLIASTGQVSLGHAAFYGLGAYLSAIASTTWQWPLFAALAFAAASVAVIAFLLA
FT                   LPTLKLEGHYLVMATLGFNIIVFICFNQMESVTGGPSGFSGIPRLALGSFALNTDLRFY
FT                   VFIWTLFLVAFALTLNLLDSRLGRALKAIHQKELTAEVLGIPARRYKIVTFVLSTVYAA
FT                   VAGFSYAHYVTFISPKTFDIFYSVQIVTMVAVGGMGSLWGGLAGTILLTALPEFLHHFE
FT                   DLHVLLYGLTLMGVLVFCPQGLLPALKSLLSARLKTGGTAILRPAGMDRPPASVRAGRG
FT                   RIVSAPFPAGHPAGTGMQGDLPALKLSDISLDFGGLQALNQVGFDIPGGRVVALIGPNG
FT                   AGKTTLLNVVSGLLRPRNGQILLRDRSLIGKSPCLVAREGIGRTFQAVQIFQDFTVLDN
FT                   LLLGYHLQGRAGFLAGYLHTRAERREEAVLRDRALEHLDDFGLAEKAHSPAQQLSLLEQ
FT                   KLLELARALALSPSILLLDEPVGGLNPRESEVLVETISGLRERGIGVLLVEHDMNVVMQ
FT                   LSDRIEVLQHGNRIASGPPREIRQDPRVIAAYLGTRRR"
FT   gene            complement(461731..462612)
FT                   /locus_tag="Sfum_0385"
FT   CDS_pept        complement(461731..462612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0385"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: bbr:BB3150
FT                   putative ABC-transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16085"
FT                   /db_xref="GOA:A0LF83"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF83"
FT                   /protein_id="ABK16085.1"
FT                   /translation="MPWQLIPHFFVSGVTNGSIYALIALGYCLIQNATGLVNFAQGEFV
FT                   MLGAMIVITLHNVMGLPMPLAFVLSTAAVAIIGTALERGPIRLSRNRDVLTLIMITVGA
FT                   SIAIRGASMMLWGKSSHVFPSFGGDDPIIVLNAAILPQSLWIMALSLAALVLLYLFFHR
FT                   TLLGKAIRGVADNSLGAVLIGISVRRLVALSFALSGALGAMAGVLITPITSMSYDGGLM
FT                   LGLKGFAAGILGGYGSTLGAVVGGLLLGVLEAFGAGLVSSAYKDAIAFLVLLTILFVRP
FT                   AGLFGSVRVHRL"
FT   gene            complement(462836..463363)
FT                   /locus_tag="Sfum_0386"
FT   CDS_pept        complement(462836..463363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0386"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: gsu:GSU2052 indolepyruvate ferredoxin oxidoreductase,
FT                   beta subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16086"
FT                   /db_xref="GOA:A0LF84"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF84"
FT                   /protein_id="ABK16086.1"
FT                   /translation="MQQIIVSGIGGQGVLFVTKLLAQTAVDTGRSVLLSETHGMAQRGG
FT                   NVISHLKVAPREQSGTSPVSPLVRPGHADVLLALHPDALAAHGFFLRPGGRAFCNASGT
FT                   TAEGSLDASAIAGSLGSAVSANLVLLGFAAASGALFCDPAQLETTLARIGGKRTESSLA
FT                   AFRAGLKAASAP"
FT   gene            complement(463381..465231)
FT                   /locus_tag="Sfum_0387"
FT   CDS_pept        complement(463381..465231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0387"
FT                   /product="Indolepyruvate ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.8"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: gme:Gmet_0948 indolepyruvate ferredoxin
FT                   oxidoreductase, alpha subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16087"
FT                   /db_xref="GOA:A0LF85"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF85"
FT                   /protein_id="ABK16087.1"
FT                   /translation="MTERSILLGNEAIALGLLEAECTMAASYPGTPASEILRALASLKE
FT                   RHKLDLHLEWSINEKAAFEVALANSYTGRRSATIMKQVGLNVAADPLMSAAYTGVKGGF
FT                   VLISADDPGPHSSQTEQDSRLIAMVAKIPVFDPSSPEEAREYARRACALSEKHEIPVML
FT                   RPTTRVCHARQDMDLRPVPHPKQFPLFEKNPGRWAATPKFRLVLHRQLNEKLARISRDP
FT                   DCAPQLVNGDALGPGTRDGGRACIVGSGVVTAHAQEILGELGLWDRVPFYRLPMPYPLP
FT                   ESFRDDLLSSYDRILILEETDPVIELQLQNREKIFGRTTGHVPTAGELLPEVVEGILRS
FT                   FLGLDPSPPVEPPAYPGRRPTLCAGCPHRAAFFAIKKAFPKGIYPGDIGCYTLGLNLGV
FT                   VDTVLCMGASINQAAGFYHAYRSARRDMPPICATIGDSTFFHAGVPALMNAVVQGARFV
FT                   LVVLDNSTTAMTGHQPTPALGRNLDGIPVPRLSIAELAKACGVRSVAEGDPYDFDRFLD
FT                   LLKAAGRHAGAEDGGVAVVIAKRPCLMDRNQPRTWPRLRIEVNEKCKGCDFCVKQFECP
FT                   ALRPRGEKEPIVIDDSLCSGCGVCVRVCPHGALEAVSEGH"
FT   gene            complement(465980..467491)
FT                   /locus_tag="Sfum_0388"
FT   CDS_pept        complement(465980..467491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0388"
FT                   /product="Acetyl-CoA hydrolase"
FT                   /EC_number="3.1.2.1"
FT                   /note="PFAM: acetyl-CoA hydrolase/transferase; KEGG:
FT                   ecs:ECs3790 putative coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16088"
FT                   /db_xref="GOA:A0LF86"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF86"
FT                   /protein_id="ABK16088.1"
FT                   /translation="MSIVGSYPKPSPEEAVSHIFHGATVAFSGFTNAGAAKIVPRALAA
FT                   RARAVHEKGDPLKIRVLTGASSGESIDEPLAQAQAISYRAPYQSGPRLRKQINSQEVEY
FT                   VDMHLSHLPQTVLSGFQGRLDFAVVEATEITSDGRVYLTSSIGASPTYLKYADKVIIEI
FT                   NHHHSPRLREMTDILIMARPPHRSPLPLHDPLTKVGYPYAVVDPRKVIAVLETDEPDRV
FT                   PKFTAGDPRSHKIAEHVVRFLLDEMLAGRIPNEFLPLQAGVGNVANSVMAALGENPYIP
FT                   PFKMYTEVFQDSLVDLMQNGKVLAASTTALTITPEVLGRIYANMDYFVSKIVLRPQEIS
FT                   NHPGAIRRLGVISMNTALEFDIYGNVNSSHLYGTDIMNGIGGSAEFTRNSYLSLFMCPS
FT                   IAKGGRISSVVPMCPHIDNNEHSVQVVVTDRGLADLRGLGPMQRARTIIEKCAHPLYKD
FT                   YLYRYIEKSRIGHIRHNLEDCFELHSNLMDHGAMLPDLDLSGVTE"
FT   gene            complement(467524..469047)
FT                   /locus_tag="Sfum_0389"
FT   CDS_pept        complement(467524..469047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0389"
FT                   /product="Acetyl-CoA hydrolase"
FT                   /EC_number="3.1.2.1"
FT                   /note="PFAM: acetyl-CoA hydrolase/transferase; KEGG:
FT                   ecs:ECs3790 putative coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16089"
FT                   /db_xref="GOA:A0LF87"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF87"
FT                   /protein_id="ABK16089.1"
FT                   /translation="MPNSSSCPFPKLTPEEAAALISNGATVAFSGFANAGAAKVVPGAI
FT                   AARARQLHESGAPFKIRVLTGSSSGNNIDEELAMAEAITWRAPYQSSPTLRKQINRQEV
FT                   EYVDMHLAHAPQVLAAGFFGRLDYGIIEATEVTRDGRVYLSSSIGASPTYLRYADRIIL
FT                   EINRYHSMRLPEIADITTLPPPPRRNPIPIHDPLTKIGYPYALVDPKKIVGVVETNEPD
FT                   AVRPYTGPDRKSERIAEHVVKFLFGEMITGHIPKEFLPLQAGVGNMANSVMAALGRNPY
FT                   IPPFKMYTVVFQDALVELMEQGKLEAASATSLTLTPAVLRRIYDNMDYFVPRLVLRPQE
FT                   ISNDAGVIRRLGVIAMNAAIEVDIYGNVNTSHVYGTDIINGIGGSGEYTRNSYLSMVMC
FT                   PSISRNGRISSVVPMCPHIDSNEHSVQVVVTDQGLADLRGLGPMQRAKLIIDQCAHPVY
FT                   RDYLHAYIRDSKVGHIRHNLRKCYELHRNLMEHGAMLPDLKLSEITDAV"
FT   sig_peptide     complement(468940..469047)
FT                   /locus_tag="Sfum_0389"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.928) with cleavage site probability 0.914 at
FT                   residue 36"
FT   gene            complement(469357..471522)
FT                   /locus_tag="Sfum_0390"
FT   CDS_pept        complement(469357..471522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0390"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein; KEGG: dvu:DVU3033 iron-sulfur
FT                   cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16090"
FT                   /db_xref="GOA:A0LF88"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF88"
FT                   /protein_id="ABK16090.1"
FT                   /translation="MITTPRNMKEYKAQVRRALKNRFLATTLENFAAAYPVSRANAFEG
FT                   IDVEALVEEIARSKDACIPYLEELYARFKTNAEAAGMKVHRARTALEANALIAGIARES
FT                   GVTRIVKGKSMTAEETFLNDRLEKDGFKVTETDLGEWIIQLRGEGPSHMVMPAIHLSRR
FT                   EVAELFRRVTGRPMDPDDIDGMVKVARRELRQAFLEADMGISGANFAIADSGTIGLVTN
FT                   EGNGRLVTTLPRVHVALVGFDKLVPDLESALRILRALPRNATGQVISTYVTWITGAVEC
FT                   PPAPGGRKETHIVFLDNGRLALARDPLFAEALRCIRCGACANVCPIYKLIGGHNYGHVY
FT                   IGAIGLILTFFYHGRENARTIVRNCLNCQACKAVCAAGIDLPRLIKEVYGKILRIEGGK
FT                   PLKNRLLGRVLKDRPLFHFLLRRAYLAQQPLTRGRPMLRHLPLFFSGEHGFRSLPAIVA
FT                   TPLRDRWEKINPPVPNPRLRVGLFGGCLVDFAYPEQAEALIRLLEGRRIRLEYPMGQTC
FT                   CGLPAKMTAEDETARRVAAQNLRAMDPDRYDHILTLCASCGSHLRENYPRLLASDARMS
FT                   AKARQFAARVIDFSSFMIHVLHVEPGSFQGGGRKVAYHSPCHLCRGLGVTREPRELLAA
FT                   AGFEYVRCKDEDVCCGFGGSYSLDFPMISAELLKRKLDIVTSSGAELLVTDCPGCVLQL
FT                   RGGMDKREGPKVEVKHIAEAVADARKS"
FT   gene            complement(471519..472076)
FT                   /locus_tag="Sfum_0391"
FT   CDS_pept        complement(471519..472076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0391"
FT                   /product="protein of unknown function DUF162"
FT                   /note="PFAM: protein of unknown function DUF162; KEGG:
FT                   dde:Dde_3244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16091"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF89"
FT                   /protein_id="ABK16091.1"
FT                   /translation="MDRGELIAKLKERAAAVQSVALEIGSFDAAMRYAVDLTARQGGRS
FT                   IAAPGLPDDRLSDLATLCAGRDIELLTGGLRQRLSGLHTGLTEADWGIAETATLVLDSS
FT                   AEDIRIATMLVETHVAILPASRLRATAFDLEPELGRMLRGRPSYLAFISGASRTADIER
FT                   VLTVGVHGPQELHILILEDNGS"
FT   gene            472346..473728
FT                   /locus_tag="Sfum_0392"
FT   CDS_pept        472346..473728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0392"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   dde:Dde_3239 glycolate oxidase, subunit GlcD"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16092"
FT                   /db_xref="GOA:A0LF90"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF90"
FT                   /protein_id="ABK16092.1"
FT                   /translation="MIGRALIAEFEKLLGRDNVFADEADRHTYSYDAAVLDPVLPALVV
FT                   RPTSSEGLGRSVRLCGENALPVTVRGAGTNLSGGTIPARGGVVIVTNGLNRILEINEAD
FT                   LYAVVEPGVVTARFAAAVESRGLFYPPDPGSQAVSTLGGNVAENAGGLRGLKYGVTGDY
FT                   VLGLSFFDANGEIVKTGARTVKCVAGYNLAGLMVGSEGTLGVFDRIILKLIPIPAARKA
FT                   MLAVFDDIAKACEAVSGIIADKIVPATLELMDNFTIRAVEDYGHAGLPVDAAALLLIEV
FT                   DGHAAQVEEDASRVEAVCRGRGAMSLRVARTAAERDKVWEARRAALSALAKLKPTVVLE
FT                   DATVPRSKIPAMMNSLEAIASRYRLTIGTFGHAGDGNLHPTILTDRRDRAEWSRVEAAI
FT                   DAIFDEALKLGGTLSGEHGIGLAKSRFLEKETSRATILYSRRIKTALDPKNILNPGKII
FT                   GE"
FT   gene            473731..475044
FT                   /locus_tag="Sfum_0393"
FT   CDS_pept        473731..475044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0393"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein; KEGG: dvu:DVU3028 iron-sulfur
FT                   cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16093"
FT                   /db_xref="GOA:A0LF91"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF91"
FT                   /protein_id="ABK16093.1"
FT                   /translation="MRSMKHLALLLREVEDQLVVCMRCGMCQSVCPLFAETGRESDVAR
FT                   GKLALLDGLMQEMFKDPAGVSDRLNRCLLCGSCAANCPSGVRVLDIFIKARAILGGYMG
FT                   LSPLKKLLFRQMLARPALFDRIVEMGSRFQSLFIRSVDDLLGTSCARFQSPLGERHFKA
FT                   LAAVPLHVRTPALNAPAGGSGIKVGVFVGCLVDKVFPEVGEAVLKVLRHHEVGVFMPDG
FT                   QACCGIPALSSGDLESYRALVRHNLSRFAPGEFDHLITPCATCTSTIRKIWPLMAGDLS
FT                   AEERERVRLLSEKTLDVSQFLVDVLHAALAEGAEETGERRLITYHDPCHLRKSLGVYAQ
FT                   PRSLIRANPRYAFREMAEPDRCCGCGGSFNLQHYELSAAIGRRKRDNIAASGCSEVATG
FT                   CPACMLQLSDMLSRAGDRVRVRHVVEVYAEALDDNRQS"
FT   gene            complement(475141..475449)
FT                   /locus_tag="Sfum_0394"
FT   CDS_pept        complement(475141..475449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16094"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF92"
FT                   /protein_id="ABK16094.1"
FT                   /translation="MSSFRAIVRTIFSISRTTASRNIATWHRTPVRKPGSRSLRLTAAG
FT                   CSRPGRRRTAAPGHRPFAAIEERHADAFRSLPSNTMREGTVARVKERNMQMIFGGCL"
FT   gene            475535..476026
FT                   /locus_tag="Sfum_0395"
FT   CDS_pept        475535..476026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0395"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC2488 uncharacterized conserved protein,
FT                   YTFE family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16095"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF93"
FT                   /protein_id="ABK16095.1"
FT                   /translation="MLRVCEKEIEKVKESNKLDVIFIDAVVDFIRTYADRTHHGKEEDI
FT                   LFRDLEKKQLSPEHARIMKELVDEHVHSRETVKQLVEAKERYLRGEGTAREVVAHLEAL
FT                   ARFYPLHIEKEDKHFFHPCMEYFTKEEQDRMLAEFYEFDRKMIHEKYRDVVERMEARGA
FT                   "
FT   gene            476246..477436
FT                   /locus_tag="Sfum_0396"
FT   CDS_pept        476246..477436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0396"
FT                   /product="hydrolase (HAD superfamily)"
FT                   /note="KEGG: tth:TTC1884 hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16096"
FT                   /db_xref="GOA:A0LF94"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF94"
FT                   /protein_id="ABK16096.1"
FT                   /translation="MIRKGLIDKLFEAASIQRWNDHVRPVEFTELDKQAHKMIIAYVLG
FT                   KLEEGQRLARIDWRKLIEGGIFEFLHRVILTDIKPPVFHKMMSKKGAEINAHVCRKLEQ
FT                   DVRDIGGDFAEKLKSYLFDRDYSPFEKRLLKAAHYLATNWEFQIIYSAAPFIYGIEKTK
FT                   EEIENQIEDHYDLIGVQKISLRKKSFGFIDLCGQLRFQQRWAHSPRVPKTSVLGHVLIV
FT                   AMLCYFLSVEIDACDRRVYNNFFAGLLHDLPEVLTRDIIHPVKRSVEGLEEIVKEYEEI
FT                   QLEEKILPLLPSSMREEIVYFLQDEFKNKIIDAGAVKKGVSGETMDACNSDAYSPLDGE
FT                   IIEVCDKLAAFIEASLSIQHGIKSHQLEEGKRFSYENYRDKRVGKLRFGYLFDYYN"
FT   gene            478143..480464
FT                   /locus_tag="Sfum_0397"
FT   CDS_pept        478143..480464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0397"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_3562 translation initiation
FT                   factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16097"
FT                   /db_xref="GOA:A0LF95"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF95"
FT                   /protein_id="ABK16097.1"
FT                   /translation="MREMVESFAQRRAEDEKRAYPRFMTPEGLTGRIDPGNLSGMLLYR
FT                   KDRPRGQQHGTASDRHGDGPEGHSAPGGDFEKVSDICILDFSEEGAQVYFRCENPFKIT
FT                   QNRLFFQIGASRLPVWLRWYQISREGNTAGFEFAEARERNQDLAHVLVSLSDRLVSFLI
FT                   GEYLPKAKKDHAQACVYAYLSILYNLRLRFLETVASFYKAQACAEKCVTSRHHREIMGT
FT                   LFEFESLRTLHFRQARALGGDKPFKATLEFFMKPYRDHQCGLSGRHQKVCFLENDVMNA
FT                   LMDSIVFWNWSIPPPDELNDRIKPVYKSFLALRSHLPGVFDGAEFDRQFIYYSFLIRSV
FT                   ILLKDKLIDVVSSSCPFAGQGRWGEGTAAGTGAGKSGLSVKASDLLGKEEFEEIGTPAL
FT                   ERKLTETFGPDADVEPAVVHEARRVSGTWRGFPRMDRYLVMGPLILAICFGIAVLMWSK
FT                   ERPSSEAPVRPERSSLQAEAAPGPPAVGVVPRGAGPAEGAGVSPEPDVHASDDARGTLR
FT                   RRAIASIPASVPEQALASVPGSGPAPVKEQPSSETTARPERSPLQAEAASVPVAAGVPG
FT                   LTNTSVPNPAPNERNDSQGNAPDRTASPVPGDTPDGGAGKFAGSTASISGGGQEPKGEA
FT                   AEPGEEKIAMVGGPQVAMAVPVPSARTSAPEKSKDVAPAAPPGTPLVHDFVVEAIEPSW
FT                   LQVTIDKGKPWATTLQPGNRFEWKVRDRINLVVGNAGGIRIVWDGQALDPPGNPGQPVR
FT                   LTLPEPQREPQRKAKSRTRR"
FT   gene            complement(480646..481314)
FT                   /locus_tag="Sfum_0398"
FT   CDS_pept        complement(480646..481314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0398"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; KEGG: tfu:Tfu_2783
FT                   thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16098"
FT                   /db_xref="GOA:A0LF96"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF96"
FT                   /protein_id="ABK16098.1"
FT                   /translation="MRPRPSIRVQMKPISPKFVTFEGIDGCGKSTLIDELASWLDRTRV
FT                   PYVKTREPGGTSLGEKIRGLLLDPAHRGMNRQTEVLLYTASRAQLVAEIILPALKSGAW
FT                   VLADRYIDATLAYQGYGRELDPDPLRRLQHWATQALVPDKTVLLDCGIDTAAARMSARN
FT                   HRPDRIEMEERAFHERVKAGYLDLASLDPGRFIVLDAEKPLPEVIADFRAAFREIVPAP
FT                   "
FT   gene            complement(481336..481956)
FT                   /locus_tag="Sfum_0399"
FT   CDS_pept        complement(481336..481956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16099"
FT                   /db_xref="InterPro:IPR014871"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF97"
FT                   /protein_id="ABK16099.1"
FT                   /translation="MKDIFDRQMQLNIYTLRNIGLDFSTTVADPLEKTVWIENYRKAFS
FT                   AELAELVREVRERGVGTHNGRIEVVDLLHFLVSLSQIVGVAPSAAFSMMSDGNPGKGGV
FT                   AGGTAEQAVMECVVETFLALDDLQGCMKWKWWAKGGGFKPDMAEKAVLDLWKRFGEVCA
FT                   LFDLDFDTTKRIYTAKNEVNFRRQDRDYNEDTKDESDNLAIEA"
FT   gene            complement(482019..483035)
FT                   /locus_tag="Sfum_0400"
FT   CDS_pept        complement(482019..483035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0400"
FT                   /product="thymidylate synthase complementing protein ThyX"
FT                   /note="PFAM: thymidylate synthase complementing protein
FT                   ThyX; KEGG: dps:DP2228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16100"
FT                   /db_xref="GOA:A0LF98"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF98"
FT                   /protein_id="ABK16100.1"
FT                   /translation="MSVQFVKTRVQPQGIAPAEEGRALQLVELCGRTAYKSEDKITPDS
FT                   ARNFVLMLKSHGHLSVLEHSNIVLEIEATPSSGATQALSSISELYGALLDGLGFRTAYH
FT                   RIHLSARTSPGALFIAGNLRSWIETLTHLGNGGSPLHALLSAALRDFFPIIFGGEETVS
FT                   SNLSFKVTLVREDEQLALLRRDAACDLPVFVFKFVCDRGITHEVVRHRVLSFTQESTRY
FT                   VNYKNKGMVLILPEELYPFYDDATQQLTGRSPLVDMWIDRAEKLFAWYREDLDREKPEI
FT                   ARDILPNLLKSEIFVSGRWSGWKHFVQLRDSKHAHPRIRAIAKEVRNHFDSLGMTVE"
FT   gene            483482..484270
FT                   /locus_tag="Sfum_0401"
FT   CDS_pept        483482..484270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0401"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cps:CPS_4536 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16101"
FT                   /db_xref="GOA:A0LF99"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF99"
FT                   /protein_id="ABK16101.1"
FT                   /translation="MIRIERLRKSYDGLVASDDVSCRFEKGKITVILGGSGSGKSTLLK
FT                   QLVGLERPDSGKIFFEDRELTGLSRSELYEIRKKMGMLFQGAALFNSLNVFENIAFPLR
FT                   EHTRLAEPVIRAMVTMKLEMVGLRGMEQLMPSQLSGGMAKRIGLARAIVMDPRAVFYDE
FT                   PTSGLDPISAGVINKLIVDLNTAMGVTSVVVSHDIPSSFRIAHRIIILFFGRKIAEGTP
FT                   EEIRGSEDARVLQFIRGEPEGPIPFNRTEKNYYDDILRVP"
FT   gene            484267..485043
FT                   /locus_tag="Sfum_0402"
FT   CDS_pept        484267..485043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0402"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   gsu:GSU0817 putative ABC transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16102"
FT                   /db_xref="GOA:A0LFA0"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFA0"
FT                   /protein_id="ABK16102.1"
FT                   /translation="MTISSAFGLNGRRCVHAVRLAGRSLLFLGEALGYGFVPPLKIRRS
FT                   LEQIVFIGAKSLIIIFVTALSTGMVLALEALHMLRGGATENILGALVALSIVRELGPVL
FT                   SALIVTGRAGSAMTAEIGIMRLTEQIDALEMMAVNPIKHVVTPKIVAGVVSMPVLCAFF
FT                   DVVGILGGYFVGVVIYGVPEVHFFGGMTKAVAYLDVAGGLFKSAVFGLAMSWICSMMGY
FT                   GAAATAEGVSRATTNAVVITSIAVLVLDYMVTSLLL"
FT   gene            485217..485657
FT                   /locus_tag="Sfum_0403"
FT   CDS_pept        485217..485657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0403"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: gsu:GSU0815 mce-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16103"
FT                   /db_xref="GOA:A0LFA1"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFA1"
FT                   /protein_id="ABK16103.1"
FT                   /translation="MYRPSLEITVGVFFILGVVCMAYLSLVVGGPGALGEPHYRVNALF
FT                   NSITGLRRGAAVEIAGVRVGKVLDITLENNQARVVMAIRDGVRLSDDTVASIRTKGIIG
FT                   EIFVKLIPGGSGRDIGPGDTLIETESAISIEELIGKYMFEKK"
FT   gene            485788..486393
FT                   /locus_tag="Sfum_0404"
FT   CDS_pept        485788..486393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0404"
FT                   /product="toluene tolerance family protein"
FT                   /note="PFAM: toluene tolerance family protein; KEGG:
FT                   gme:Gmet_0784 toluene tolerance"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16104"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFA2"
FT                   /protein_id="ABK16104.1"
FT                   /translation="MVGKMVIALLLAASLFIAAPASAGEPMEQLRVSVEKVVEILKDPS
FT                   LKSPDRMLERRNRIFKVVEERFDFSEMAKRCLGEFWPKISEAEQREFEVAFASLLETSY
FT                   IATIERFDEESVVFEEERPKGRQYFVVHTAVVSGGRSISVDYSVRNVNGQWLVYDVNIE
FT                   EVSLVAGYRVRFAETFRREGFRGLMKKIAEEAGGPGKG"
FT   sig_peptide     485788..485859
FT                   /locus_tag="Sfum_0404"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            486487..487233
FT                   /locus_tag="Sfum_0405"
FT   CDS_pept        486487..487233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0405"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   sat:SYN_01017 deacetylase family protrein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16105"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFA3"
FT                   /protein_id="ABK16105.1"
FT                   /translation="MKVVTHEDFKQVYTHEPAAAPGRIEAILGAIRDEAVFEDAYPAGA
FT                   EDIAAIHSKSHIQSVTHQGLYNIACLAAGGAIQTALTGLKEPCFGLIRPPGHHASADSY
FT                   WGFCYFNNMAVALDHLKRNGHIKTAYVLDFDMHYGDGTVNILKPKGYVAIHNPESHDRK
FT                   EYLSDVSRHLESAAADIIAVSAGFDNHVQDWGGVLLTEDYQAMGRMVHDTAKRLQVGCF
FT                   GLLEGGYNHQVLGENVRAFLRGLSGS"
FT   gene            487330..488166
FT                   /locus_tag="Sfum_0406"
FT   CDS_pept        487330..488166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0406"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; Rubrerythrin; KEGG:
FT                   dvu:DVU1973 rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16106"
FT                   /db_xref="GOA:A0LFA4"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFA4"
FT                   /protein_id="ABK16106.1"
FT                   /translation="MTAGSGSGDVKSLYPDEAKEFIDEHKEGTYLLLDVRQPTEYEQGH
FT                   LPGAQLIPLPSLPDSIGGLDRKRPVLVYCAVGGRSATAASFLAHHGFSEVYQLLGGIQA
FT                   WEQPTAANPVKFHLEFASGRESPREAVLLAYAMEQGMLDFHEAVRVRTTEPDLADLLVK
FT                   LVRAEESHKKTLRELLRQHAPDEPPPEDVPGGSSRIMEGGLDIQDFMKQNESFMKTTAG
FT                   YLDIAMMVESQALDLYLRMGAASSNEKTRRILFHIADEEKAHLSMLAELLEKKMSA"
FT   gene            complement(488459..488956)
FT                   /locus_tag="Sfum_0407"
FT   CDS_pept        complement(488459..488956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0407"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dge:Dgeo_2717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16107"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFA5"
FT                   /protein_id="ABK16107.1"
FT                   /translation="METGRPTADCSGPVAQPGNSEGPGGIRHMKVFFDTSAFVKRYVEE
FT                   PGTEKVLEICDKADQLVLCVICLPEMISTLNRLVREGRLQNDEYRKLRDLVLEEIEDAE
FT                   ICFLTPEVVAQTIKCLESNVLRAMDALHLGCALVVEPDLFVSSDRRQLEAARRAGLKVM
FT                   EA"
FT   gene            complement(489220..490572)
FT                   /locus_tag="Sfum_0408"
FT   CDS_pept        complement(489220..490572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmp:MMP0898 cellulose-binding, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16108"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013431"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFA6"
FT                   /protein_id="ABK16108.1"
FT                   /translation="MRQSERANPYLGTIAAALFVFSVLCCGAARAGGTDEGRAILVDAH
FT                   GNVYVCAKSWRSSDQQFGIVTMKYSSSGKRLWARRFTDINNNGTWGQGSVALDGNGNFY
FT                   LTGQTLDRKLLVLKYTPAGSPVVSKYSFGGIPVGSGSNGRAIHVTPDGKGIYVTGEYWN
FT                   SSNSTWDIVTARLGPDPDMEWTTRRIASKHQFARAMVVGTNGNVTVTGQNFDAEADTYD
FT                   YLTIKYNALGKIEWAKTYNKGTWDEPFSVAVDPGGNAIVTGSAGSAEATRDFVTVKYSP
FT                   GGVQSPAWIYDGAAHALDYAETVKTDANGNVYVAGTSSGAYNWDIVLLKYNSSGQKVWT
FT                   RSYSNLCNDFFDEMALDKNGNIYVAGHSGSGGSGTWDYLTMKYNPNGKRAWTKFFNSSH
FT                   NSADMALSLTVDGSANVYVTGKSYNGTDYDCLTVKYDTNGNLVWSRRYDSA"
FT   sig_peptide     complement(490477..490572)
FT                   /locus_tag="Sfum_0408"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.993 at
FT                   residue 32"
FT   gene            complement(491264..491563)
FT                   /locus_tag="Sfum_0409"
FT   CDS_pept        complement(491264..491563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0409"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: pfu:PF0573
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16109"
FT                   /db_xref="GOA:A0LFA7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFA7"
FT                   /protein_id="ABK16109.1"
FT                   /translation="MPLVRVIRNGQITIPKKLRATLGIEEGDLLEVKLSQGGMTIKPKT
FT                   AVDKELSKGRFFRMVEEIRESVKDADPREVDAALAEAVRAAGKATSKKMKPRRS"
FT   gene            complement(492634..496077)
FT                   /locus_tag="Sfum_0410"
FT   CDS_pept        complement(492634..496077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bth:BT4627 DNA modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16110"
FT                   /db_xref="GOA:A0LFA8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR011639"
FT                   /db_xref="InterPro:IPR025931"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFA8"
FT                   /protein_id="ABK16110.1"
FT                   /translation="MDKQQARKLIKQTFEQPFEKTRFTTLIKNLLNRCEEAPLSYKGQY
FT                   IPDAYKPYISALDRIGKFHDGEHAVDILVIKLKKETSLERARTMQRNFVAWYLNGSRGD
FT                   KLKDAALVAFVSPEETDWRFSLVKMDYRFEQTKTGKMKVKEEFTPARRWSFLVGTNEQS
FT                   HTAQSRLINLLANDEQTPTLAELEEAFNIETVTTEFFLKYRDLFIRTKEALDRVVRGDP
FT                   RIEAEFEAKQVNTVDFAKKLLGQIVFLYFLQKKGWFGVGRDAPWGTGSRQFLRELFEQK
FT                   HGRYGNFFDDILEPLFYEALRNDRSHDDDYYSRFNCKIPFLNGGLFDPIDDYDWVHTNI
FT                   NLPDSLFSNQNRTAEGDIGDGILDIFDRYNFTVKEDEPLEKEVAIDPELLGKAYEKFNA
FT                   IRPDNFEEYKQVLRSGKKGDENKFNKQFGVYYTPREIVHYMCRQSLINYLHTELGKDIV
FT                   THKKLFEKQTTMFGNQAKRGQLDCTIEYKLTPQISRKDIETLIHLGEQVSANEARVENK
FT                   GKETVTYSYKLPESIRKNAGPIDRKLADITVCDPAVGSGAFPVGMMTEIVRTRNVLSTF
FT                   IQEDKPTPYDLKRRCIEHSLYGVDIDAGAVEIAKLRLWLSLIVDEDDIKNIKPLPNLEY
FT                   KIVCGDSLLGYPYKPMGLDEVEKLKEQFLEEVNPKRKKELRNRIDAAIYGLFKNTEKSL
FT                   GYQVTMDFRTNFSEVFRTKGGFDVVVANPPYVRQEAIRHLKPKFKKIFKDFYCGTADIY
FT                   TYFYKCGVDLLKSNGHLCFIAPNKFMRASYGKNTRTLLTTRATPRLVIDFGDLPIFDAT
FT                   TYPSILLIEKRKPDGRDKAVTATFTDASQLAKLEDSLLDIAFLMPVKALSKEGWNLERS
FT                   DVLSLMEKLKKIGVPLGEYIQGRFYRGVLTGLNKAFVIDAATRERLIAEDPASADVIKP
FT                   WLRGRDIRKWKAEWAGLYVINIASSSNKTWPWSNVKTEAEAVRQFEETYPAIYRHLAPW
FT                   EKELQKRDDQGKFWWELRSCAYYEAFEGTKIIYPDISQASKFSWDQSNSYLGNTVYMIP
FT                   TDKLWLVGLLNSKFIWWYYSNITSTIRGGFVRFFSQYMETIPISLISDSQKTSIIERTR
FT                   AILAAPGSPAVPTLEAEIDQIVYVLYNLTPEEIRIVEGVN"
FT   gene            complement(496079..499339)
FT                   /locus_tag="Sfum_0411"
FT   CDS_pept        complement(496079..499339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0411"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   enzyme, res subunit; SMART: DEAD-like helicases-like; KEGG:
FT                   hhe:HH0797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16111"
FT                   /db_xref="GOA:A0LFA9"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFA9"
FT                   /protein_id="ABK16111.1"
FT                   /translation="MVQQQCSNSKNFEEPSSSSAEHMHTDLSFITNEQHQSLRDRFEVL
FT                   IKDTSFFDCLVGYFYTSGFHALYHSLEKTEKVRILIGISTNRQTYDLLVKAGSPTQEVM
FT                   QFSHAETKEEIEKLVEDEFADSEDNRNVEAGVHKFVAWVKDKKLEIRAYPSHNIHAKLY
FT                   IMTFCEGDRDVGRVITGSSNFTQAGLIDNLEFNVELKNRSDYEYSRKKFEELWQSAVDV
FT                   GERYVQTIQQKTWLSRNITPYQLYLKLLYEYFKDELSQTDEVFIKYLPEEFKKLEYQEQ
FT                   AVLNAKKILLEYGGVFISDVVGLGKTYVSAMLAGQLSGRTLIIAPPVLLEKTNPGSWPN
FT                   VFSDFRVSADFESLGKLDDLLKRGTEKYENIIIDEAHRFRTETTATYEKLAEVCRGKRV
FT                   ILVTATPYNNAPKDILSLLKLFQKAKKSTIPNLPDLEGFFSRLEQKLKNLDRQKDYDKY
FT                   ISTVKENAREIREKVLKYLMVRRTRTEIVKYFAEDIHQQRLKFPVVERPVPLFYELNGK
FT                   EDLVFTKTVELIAQKFKYARYMPLLYYQGKVDQLEKQSQRNMGRFMKILLVKRLESSFF
FT                   AFRNSIDRFLRSYELFIKEFDNGNVYVSKKHTRKIFELLENDDDDAVQRLIDESKAERY
FT                   PSSEFAEALRQDLQHDRDVLLEIKELWTRVKRDPKLFTFLNELSTDAGLKKNHLIIFTE
FT                   SKETADYLFANLEHHYPEKVLCYTGASGEATRDKVIENFDARARHPKQDHRILVATEVL
FT                   AEGVNLHRSNTVINYDIPWNPTRMMQRVGRINRIDTPASTIHTYNFFPTTQSNDQIKLR
FT                   EAAEAKINAFLTLLGGDAELLTEGEPIGSHELFDRLLSKHTLEGDEEQGETELKYLHVI
FT                   KEIRDKHPDLFEKIKRLPRKARTAKTHAEQADSLITYFRRGKLQKFFLAADHPEAKELD
FT                   FLLAAKFMESGSEDAKRELPSQFYDLLDKNKEAFVLATTEELPQPRAKGGGRDSAANLL
FT                   KILKVTQKNTQKLTDDQELFLKKVFTQLAEGGLPKQTVKQTLKALNDLKNELINPFKVL
FT                   AVLQTHIPPKLLEGHYAEQNPSVSGKREVILSMYLSGE"
FT   gene            500176..501096
FT                   /locus_tag="Sfum_0412"
FT   CDS_pept        500176..501096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0412"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: cps:CPS_4233
FT                   UbiA prenyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16112"
FT                   /db_xref="GOA:A0LFB0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFB0"
FT                   /protein_id="ABK16112.1"
FT                   /translation="MGRLILWFKETRPQFLFLSVVLAFLGTAIAWYYGSFNLGYALLAG
FT                   FGLVLTHGSANAINDYFDYKSGIDLHVVRTPFSGGSGLVPDGKLPLGHALWVGVVTSVA
FT                   ALMIGVFFVIVSGWQLIPLLVAAILCLVLYTPVILRTNRPEWSPGLGLGILPIMGFYFV
FT                   QTGRYDWVVLVASVPSGILVHNLLLLNEFPDVEADRMGGRKTTPVVYGMEAAARVFRIA
FT                   TVSVYVWIVGCVLLTVATGRVVMPVYCLIALFTLPLAVKAMRGAGEYRDMSRLVPALGT
FT                   NVMFILLTQVLLGVGYILGKIFPIS"
FT   sig_peptide     500176..500268
FT                   /locus_tag="Sfum_0412"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.876) with cleavage site probability 0.849 at
FT                   residue 31"
FT   gene            complement(501542..503296)
FT                   /locus_tag="Sfum_0413"
FT   CDS_pept        complement(501542..503296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0413"
FT                   /product="uncharacterized domain"
FT                   /note="KEGG: dps:DP1955 hypothetical protein; TIGRFAM:
FT                   uncharacterized domain; PFAM: TPR repeat-containing
FT                   protein; protein of unknown function DUF181;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16113"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFB1"
FT                   /protein_id="ABK16113.1"
FT                   /translation="MSSRVFVADCFKAFRHDQDKARSPDDTVAWVRKRLSGLNVDILNK
FT                   TIRIDTGRLDIPVYISLCGSDATRLTGTKKQMGKGASPIQAEASALMELMERYSFFSFI
FT                   HQSDFPTLRYREVPQQVVSPEDFKRSIHDETTPVDLVRSFLQDFPLRWAVARNLTQKIY
FT                   QMIPIDWFYLINEYNGPAAGNTIEEAILQSLCEVVERHVGSVICYGERPTPTIDPGSVR
FT                   DPAAVELIDKFRKQGIVLHLKDFSLDTGIPSVGALAYDPSTFPDRSEIVFTVGTTSNPE
FT                   KSLCRALTEIAQLAGDFENRTSYRPTLPKYASLDQARYLTDDHETIPISALPDLSHDNM
FT                   RIEIERCVDALKRIGMEVMVINVEHPELQVPAVYTVIPGAHFLEHTRDTDFAQHAARTI
FT                   LRGCAPGEVVAQMERLLNLFGPRYDLTFFLAHGLELEDKPGPAIPLFRKALEQEPDPRE
FT                   LASIHVHIASCHKALGEYEPALEALERAELLNSELKEIYNLRGFCYFKLKKHHEAIEAF
FT                   EKAIELDPGSAIDYANIGSNLRDLGHREEAIKVYRIALELDPGIDFARENIDRLEADLA
FT                   RERAAGQS"
FT   gene            complement(503385..504272)
FT                   /locus_tag="Sfum_0414"
FT   CDS_pept        complement(503385..504272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0414"
FT                   /product="3'-5' exonuclease"
FT                   /note="PFAM: HRDC domain protein; 3'-5' exonuclease; KEGG:
FT                   ade:Adeh_1602 3'-5' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16114"
FT                   /db_xref="GOA:A0LFB2"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFB2"
FT                   /protein_id="ABK16114.1"
FT                   /translation="MNPVVVIEKPSELDALVRQLSTARHLAVDTESNSFYAYFDRVCLI
FT                   QISSPERDYIIDPLSLKDLSVLGRLFENPRIEKVLHAASNDVLGLRRDFQFRFNGLFDT
FT                   AIACKLLGYKQLGLSKILETHFGVSLNKRWQRYDWGKRPLVPDQLDYARLDTHYLIALR
FT                   HMLAADLQSRELWAEACEAFEKASEQQVPEKTFHPRGFLQINGARSLDAAGKSILKALY
FT                   MFREKEARRRDRAPFRIMSNEALLRLADARPDSVDEISRIKGLPRSFHDPKAASFLIEI
FT                   IRQNNNSNDTEARE"
FT   gene            504331..505092
FT                   /locus_tag="Sfum_0415"
FT   CDS_pept        504331..505092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0415"
FT                   /product="Smr protein/MutS2"
FT                   /note="PFAM: Smr protein/MutS2; KEGG: ade:Adeh_3940 Smr
FT                   protein/MutS2-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16115"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFB3"
FT                   /protein_id="ABK16115.1"
FT                   /translation="MRKRKTGSPDPAQRPREKKQRVQAFYTPFSALGQHPAAPPSKNRA
FT                   KKTRPAHDVPAAVSVEAEESDRLFREAMKGVVPIDRAGQERVPPPAPVGTPARFLQQEE
FT                   LEALTHLEDLVSGDIPFELVYSDEYVDGAVVGLSPKVLKKLRNGDFSYQEYVDLHGYTR
FT                   AEARAVVIDFVQESFARKLRCILIISGRGLNSRDKEPVLKQGLVSWLIRAPLKSMVLAF
FT                   ASARSYDGGAGAFYILLRRNKGGAPLVTPAN"
FT   gene            complement(505267..505824)
FT                   /locus_tag="Sfum_0416"
FT   CDS_pept        complement(505267..505824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0416"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: gsu:GSU3293 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16116"
FT                   /db_xref="GOA:A0LFB4"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFB4"
FT                   /protein_id="ABK16116.1"
FT                   /translation="MDSRVNLFCASGCRPKHDGYVEQFNKQTQEVEMSTVSCSSMDDVI
FT                   NFAISREEAAMDFYQKCADRARNPGIKKFFQEMVQEEERHRALLKDLNPMDLGTLTLDK
FT                   VEDLRISDYLVEVKFTEQVTYQEALTLAMKKEEKAHAFYEAWKNKCMHEKTAKLFEMLA
FT                   VEELKHKRKIETLYDEEILTWD"
FT   gene            complement(505888..507618)
FT                   /locus_tag="Sfum_0417"
FT   CDS_pept        complement(505888..507618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0417"
FT                   /product="Adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /note="KEGG: chy:CHY_0699 adenine deaminase; TIGRFAM:
FT                   adenine deaminase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16117"
FT                   /db_xref="GOA:A0LFB5"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LFB5"
FT                   /protein_id="ABK16117.1"
FT                   /translation="MKWDTGRMARIIEAAQGKRVVDLCIRRCRLVNVLSGSIDTVDLAI
FT                   HEGFVAGWGSYRAAREIDADGMYVCPGFIDGHIHIESTLLAPAQFCAAAVPQGTAAVVA
FT                   DPHEIANVLGLSGIRYFLEASEGLPLDFFFNLPSCVPATPLETSGAALRAPDLDALLPH
FT                   ERLIGLAEMMNFPGVLSGFPDVIDKLLLFQARRIDGHAPQLGDLGLNAYVAAGITSDHE
FT                   CTTLEEAREKLAKGMTVMIREGGQSRDLAALLPAVDEHTWPRCCFVSDDVHPDGLLREG
FT                   HMNVIVNRAMSLGMAPVRALSLAALTPARHFRLDRRGALAPGYHADFSMSPTLNPWQPE
FT                   RVFKAGVEVARDGRLLLDLGNGNGVAAPPSPMHITRLLAEDLVVPAQPGLLRIIGVREG
FT                   TLLTRKIVLPPKIHEGAAVADLDRDILKLAVYNRYVPDRPPAVAFVQGLGLKEGAIATT
FT                   VAHDSHNLIVAGASDADILHVVDAVRKSGGGMAAGRTGAEVDVLALPIAGLMSDQPVER
FT                   VAERLEQLQGRARAAGSGLRNPFMALSFLALPVIPELKLTDLGLIDVSTFSPVSLFETS
FT                   "
FT   gene            complement(507737..508234)
FT                   /locus_tag="Sfum_0418"
FT   CDS_pept        complement(507737..508234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0418"
FT                   /product="protein of unknown function DUF151"
FT                   /note="PFAM: protein of unknown function DUF151; KEGG:
FT                   sat:SYN_02150 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16118"
FT                   /db_xref="GOA:A0LFB6"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFB6"
FT                   /protein_id="ABK16118.1"
FT                   /translation="MFKEMKVTGLVMDPQTNTPILILRDVKDDTTLPIWIGLLEATSIA
FT                   TELEKIQFPRPMTHDLIRNFFNHLDVKVERIEVCDLRNNTYYALIYIRDRDRVSSIDAR
FT                   PSDAIAIALRTQAPIYVKEEVISKFQKSDESAKPVFDKENREKWSELLEGLNPEDFSKY
FT                   KM"
FT   gene            complement(508345..509715)
FT                   /locus_tag="Sfum_0419"
FT   CDS_pept        complement(508345..509715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0419"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /note="KEGG: sat:SYN_02149 tRNA 2-methylthioadenosine
FT                   synthase; TIGRFAM: RNA modification enzyme, MiaB family;
FT                   tRNA-i(6)A37 thiotransferase enzyme MiaB; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM; Radical SAM
FT                   domain protein; Protein of unknown function UPF0004-like;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16119"
FT                   /db_xref="GOA:A0LFB7"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LFB7"
FT                   /protein_id="ABK16119.1"
FT                   /translation="MITPLAKTAPAPRYLYVRTFGCQMNEYDSQRALRLLCAVGYRPTS
FT                   DIADADVIFLNTCSVRDKAEQKVYSFLGRLRRLKAHRPWLKIVVAGCVAQQLGDGLLKR
FT                   FEHVDLVVGTRGIGSIASLLEEVERSKRRVAHLPAEELQGFTTDKCRTVGTGDVVAQVT
FT                   IMQGCNNFCTYCIVPHVRGRERSRAPDDILREIDFLASRGAREVLLLGQNVNSYGRGLP
FT                   DPISFPDLLRRIGKETSIRRVRFTTSHPKDLTEDLIECFAGLPFLCKHLHLPFQSGSDG
FT                   ILKLMHRGYTARQYLEKIARLREVCPEIALSTDVIVGFPAESEEDYLQTLRLIEEVRFD
FT                   SLFSFRYSDRPLTRAAGFPDKVPMDVKVRRLARLQSIQADITLQKNLAETGTVREVLVE
FT                   GPSKASNGQMTGRTQQNRIINFQCPVDLTGKIVPVRIVAAYSHSLKGELLSQPGKES"
FT   gene            complement(509723..510490)
FT                   /locus_tag="Sfum_0420"
FT   CDS_pept        complement(509723..510490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0420"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: dps:DP2226
FT                   probable type IV pilus assembly protein (TapB)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16120"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFB8"
FT                   /protein_id="ABK16120.1"
FT                   /translation="MHAIVDNVEEERSGLNPAQALEIHTYRYGDEIFREGEECSCFFVI
FT                   LSGQVRISQRGKKVRVLEDQDVFGLENVIFKRAAHYTARALTKSRVAAYGPEALDHVIR
FT                   ESPRMVRSVLVSTLHQLSQTTKHLLHDADAFALEDVSVNFYNDGEIIIEEGTTGSSFYR
FT                   LVSTQGGLRVTIAGHEVARIEKPGEFFGEMAGLLSLPRQATITSLGDSVVEIYNIDDLE
FT                   IIIRDYPDVALQMMRTLVSRLVEINRKFAGSLA"
FT   gene            complement(510709..510987)
FT                   /locus_tag="Sfum_0421"
FT   CDS_pept        complement(510709..510987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16121"
FT                   /db_xref="InterPro:IPR032587"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFB9"
FT                   /protein_id="ABK16121.1"
FT                   /translation="MSVPTNCTIHRFLMDPIQIHYLRFVLEAYEGMAILSTIDRKLGLV
FT                   QLNIAPGCERDLDAILHQERKFLKYRPIDIENRPERPARSGEPAGFM"
FT   gene            511266..513023
FT                   /locus_tag="Sfum_0422"
FT   CDS_pept        511266..513023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0422"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cel:C15A11.1 Hypothetical protein C15A11.1"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16122"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFC0"
FT                   /protein_id="ABK16122.1"
FT                   /translation="MTHAARKCVVTGLALAALLLTSAFGLDPRDGWSQTVFFSQGQAPY
FT                   DPQNRQKSQQNAVREFQVQAITQAVGTFLSTSQMGTKFQAIKDKVLRQPERYVDAYQVF
FT                   SETVENGRYQVAGQVTVAMGLLKKDLIAFDIYASDDAGEDGKRDEDAVPPRAGPGEPAP
FT                   VRPGARVTDDSNGGAKAPPGGPAGDADEDGEGVTDQESDEESVGEQGGIPAGARKEPSA
FT                   RIRPGAPSDDAEANGDTVTDEPGDEQEAEDQGGPPAGAREEPSARIRPGAPAGEAEDDG
FT                   DAASDTAGGEPAREGQGGAPAGAQGKARPEAREAAPVPAGGPRGITSTSNEIFWAVSEK
FT                   WDQTWYLPGDLKDPRGLFAASVVQELLDYRYTLHFPEPGALKVDNMGNASSSQAVSQAR
FT                   MLGIRNVVVGRVVLHQRSKEPARLDAELQIIEAASGKSLGKLRKTRNLEELTNQEGAME
FT                   LAGDVTNELTGLLSGDTRAAAPAGPVPVAGEGEWVLRLQAADHHAYWREVEKLLREQAR
FT                   GMTMLGMEMGPQETVIRLGGIDGRTLSSLDGRVLSGGVTIKIDDLSPDTRTTRVLFVRQ
FT                   AVPQPGPKP"
FT   sig_peptide     511266..511343
FT                   /locus_tag="Sfum_0422"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.984 at
FT                   residue 26"
FT   gene            513020..513568
FT                   /locus_tag="Sfum_0423"
FT   CDS_pept        513020..513568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0423"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   sat:SYN_01716 CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16123"
FT                   /db_xref="GOA:A0LFC1"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFC1"
FT                   /protein_id="ABK16123.1"
FT                   /translation="MTVPNLLTILRILLTPVLVWLLLENRLNEALTVFFIAGATDGLDG
FT                   LIARVFHQKSKLGAYLDPLADKILLVTSFVLLGHMGYIPYWLVIVAVSRDAIILLGLLS
FT                   LMFHQVRVEIQPVLLSKLTTLFQLGTILATMGSGLFQLPQGGYTALFVTTAVLTVAGGV
FT                   QYIMIGIALLDSRRGGHAD"
FT   gene            513785..513859
FT                   /locus_tag="Sfum_R0008"
FT                   /note="tRNA-Val1"
FT   tRNA            513785..513859
FT                   /locus_tag="Sfum_R0008"
FT                   /product="tRNA-Val"
FT   gene            514085..516019
FT                   /locus_tag="Sfum_0424"
FT   CDS_pept        514085..516019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0424"
FT                   /product="threonyl-tRNA synthetase"
FT                   /note="TIGRFAM: threonyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); Anticodon-binding
FT                   domain protein; Threonyl/alanyl tRNA synthetase, SAD; KEGG:
FT                   gme:Gmet_1411 threonyl-tRNA synthetase, class IIa"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16124"
FT                   /db_xref="GOA:A0LFC2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFC2"
FT                   /protein_id="ABK16124.1"
FT                   /translation="MSAEISVTLADGTTKSFPRGVSAGEVLKASGGPNGWVAAKVNGVP
FT                   VDLIVGIEEDAAVEGIRADSEVGLEILRHSAAHVMAQAVKSLFPEARVAIGPAIDNGFY
FT                   YDFEVERPFTQDDLDRIEAKMKELVGAKLKFERKVLPRDEAIDFFTRRGEGYKVELLQG
FT                   FSDPTVSFYTQGDFVDLCRGPHVPHSGYVRAFKLTSVAGAYWRGDEHNAMLQRIYGTAF
FT                   ADRDALKKYLHFLEEAQKRDHRRLGRELDLFSFSDEVGAGMVIYHPRGALLRHILEAFE
FT                   KREHLRRGYHIVMGPTLLKTELWKRSGHFEHYRENMYFTEIEEQSYGIKPMNCLAHMLI
FT                   YKSRLRSYRDLPLRYFELGTVHRHERSGVLHGLTRVRQFTQDDAHILCTPEQLHGEIQS
FT                   IIDFVIEVMGIFGFNHEMEISTRPAKSIGSDEDWERATSALIDALEDKGIPYQVCEGEG
FT                   AFYGPKIDVKLRDALDRKWQCATIQCDFTLPDRFDLTYVGVDGNRHRPVMVHRVVLGSL
FT                   ERFIGVLVEHFAGAFPTWLAPVQAIVVTVTDGQIEFARNMYDRLREAGVRVELDDRNEK
FT                   LGYKIREAQMQKVPYMLVIGDREVAAGGVAPRRRDGTQLELIAPEAFAAMIQKECLEAT
FT                   KGRVGLGIV"
FT   gene            516107..516622
FT                   /locus_tag="Sfum_0425"
FT   CDS_pept        516107..516622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0425"
FT                   /product="translation initiation factor IF-3"
FT                   /note="TIGRFAM: translation initiation factor IF-3; PFAM:
FT                   initiation factor 3; KEGG: gsu:GSU1516 translation
FT                   initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16125"
FT                   /db_xref="GOA:A0LFC3"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFC3"
FT                   /protein_id="ABK16125.1"
FT                   /translation="MVLDKQVNVNERIRSSEVRVIGQDGQQLGVLSLKKALELAAQDEL
FT                   DLVEVAPNADPPVCKIMDYGKFKYQQNKRTQEAKKKQTVIQVKEVKIRPKTDEHDLLVK
FT                   IRHIKRFLAQKDKAKVTILFRGREIAYTDQGTKVLERVREELKEDAVIEQPPKMEGRNM
FT                   VMILAPKA"
FT   gene            516861..517058
FT                   /locus_tag="Sfum_0426"
FT   CDS_pept        516861..517058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0426"
FT                   /product="LSU ribosomal protein L35P"
FT                   /note="PFAM: ribosomal protein L35; KEGG: dps:DP1426
FT                   probable 50S ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16126"
FT                   /db_xref="GOA:A0LFC4"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LFC4"
FT                   /protein_id="ABK16126.1"
FT                   /translation="MPKMKTNRAAAKRFKRTGTGKFMRARANKSHILTKKSPQRKRRLR
FT                   QGTAVDAINVRALEHMLPYL"
FT   gene            517092..517445
FT                   /locus_tag="Sfum_0427"
FT   CDS_pept        517092..517445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0427"
FT                   /product="LSU ribosomal protein L20P"
FT                   /note="TIGRFAM: ribosomal protein L20; KEGG: gme:Gmet_1414
FT                   50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16127"
FT                   /db_xref="GOA:A0LFC5"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LFC5"
FT                   /protein_id="ABK16127.1"
FT                   /translation="MPRVKKAVKSRERRKKILKLAKGYRGGRGKLIRSASETVDRALKF
FT                   AYRDRKTRKRQFRSLWIMRINAAAREHDLSYSRFMHALKKANIDMDRKALAHLAVNDPA
FT                   AFAKLARIAKEAA"
FT   gene            517447..518457
FT                   /locus_tag="Sfum_0428"
FT   CDS_pept        517447..518457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0428"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="KEGG: gsu:GSU1519 phenylalanyl-tRNA synthetase,
FT                   alpha subunit; TIGRFAM: phenylalanyl-tRNA synthetase, alpha
FT                   subunit; PFAM: phenylalanyl-tRNA synthetase, class IIc;
FT                   aminoacyl tRNA synthetase, class II domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16128"
FT                   /db_xref="GOA:A0LFC6"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LFC6"
FT                   /protein_id="ABK16128.1"
FT                   /translation="MEDAVRKLLNSADHEVLALANDARAIEQLKVRFLGRKGELARLFK
FT                   EMGKVPEAERPAVGKVLNEAKVRLEALFAEALERGGEQGAGRREQIDITVPGRRPPRGR
FT                   LHPISQVAREVCRIFNWLGFEIVEGPEVELDYYNFEALNIPRDHPARDMQDTFYVSDDV
FT                   VLRTHTSPLQVRTMEKRRPPIRVIAPGKTYRCDSDVTHTPMFHQVEGLMVGKDISFGDL
FT                   KGILTIFVHQMFGADVGLRFRPSFFPFTEPSAEVDIQCVMCKGEGCRVCSQTGWLEILG
FT                   SGMVDPEVFRMVGYDPEEVTGFAFGMGIERITMLKYGIDDLRLFFENDFRFLRQF"
FT   gene            518756..521158
FT                   /locus_tag="Sfum_0429"
FT   CDS_pept        518756..521158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0429"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit;
FT                   KEGG: sat:SYN_01723 phenylalanyl-tRNA synthetase beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16129"
FT                   /db_xref="GOA:A0LFC7"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFC7"
FT                   /protein_id="ABK16129.1"
FT                   /translation="MIVSLKWLRDYVETSLSVEELTHRLTMVGLEIDGCHPLHPCLGRV
FT                   VTARVEKVEPHPRADRLSVCEVSDGHGRYSVVCGAPNVKAGQIVPLALPGAELASGVKI
FT                   GQATIRGVASLGMLCSQKELGLGEDASGIWPLPGEVPVGVPLSEALDLDDTILDVAVTP
FT                   NRGDCLSIVGIAREIAAISGVRLRYPAVACRETGPEVDSLASVRIDAPDGCPRYAARVI
FT                   EGITVGPSPQWLKDRLEAVGLRSINNIVDVTNYILMELGQPLHAFDFDLLREQRIVVRY
FT                   AREGERFTTLDGTERILFGDTLMICDGVGPVAVAGIMGGLDSEIGARTRRVLIESACFE
FT                   PRCIRRSSRKLGLRTESSYRFERGVDPEGVIRALDRAAQLMVEVGGGDLATGRVDAYPR
FT                   PAEKPVLVLRTDRVNRFLGTDLTPAEMAGALRSIEMQVEENGGGLEVIPPTFRPDITRE
FT                   VDLAEEIARLAGYDRVPVTYPEVRMEAASLDRHLQARMDIKGYLEGAGFFEAINYSFVS
FT                   MESLRKLKFPAGDRRLNPVQIRNPLSEEQAVMRTTLVPSLLQTARYNFDHKNDDLKLFE
FT                   LSKVFLPVEGAPLPEEVHEVAGILAGKRSLNLLYGGDDDVDYADAKGIVEGILELLHIE
FT                   GVRFDSEAPPPYLDAACAATIMHGELNLGAVGRVAADVRAAFDLKKPVFVFDLDFERLF
FT                   GIARPPAFFSSLPKFPSVSRDMALVVDESVPVQGPFDFIRSQGEALLEHIDIFDIYRDP
FT                   QLGAGRKSIGYRLVYRAADRSLTDEEVNRLHEGLVSKVLVEFDARLR"
FT   gene            521180..521563
FT                   /locus_tag="Sfum_0430"
FT   CDS_pept        521180..521563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0430"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16130"
FT                   /db_xref="GOA:A0LFC8"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFC8"
FT                   /protein_id="ABK16130.1"
FT                   /translation="MSERERPSSKDGGPEKKQPCLVTYFMGDQLRRGTSMHFNERGILV
FT                   VCQEPAPLNAKLRLVLQFPGMRNPVEVYGEVVWANIHGPSDALTPRGMGVKFVNAERDT
FT                   ERLLAELAEQYPAIGVSYSCYYT"
FT   gene            521762..522310
FT                   /locus_tag="Sfum_0431"
FT   CDS_pept        521762..522310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0431"
FT                   /product="protein of unknown function DUF204"
FT                   /note="PFAM: protein of unknown function DUF204; KEGG:
FT                   pca:Pcar_2070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16131"
FT                   /db_xref="GOA:A0LFC9"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LFC9"
FT                   /protein_id="ABK16131.1"
FT                   /translation="MSVVETVLVALALGCDAFAVGMGVGTRFCNPRQIFRLSFHFGLFQ
FT                   MMMPIAGWFVGSRAADLVSTWGPWISFALLLFIGGKMAYESFRSLEAEDGECPDPTKGS
FT                   SLVMLSVATSMDALGVGFSFGILGQQLFLSAVWIGITAGIMTWGAMRLGNRLSRQFGRR
FT                   METVGGLILVAIAVKLLLF"
FT   gene            522328..525357
FT                   /locus_tag="Sfum_0432"
FT   CDS_pept        522328..525357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0432"
FT                   /product="Phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: gme:Gmet_1941
FT                   phosphoribosylformylglycinamidine synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16132"
FT                   /db_xref="GOA:A0LFD0"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFD0"
FT                   /protein_id="ABK16132.1"
FT                   /translation="MATRLEISLKEHLFDAEGAGLCRKIKDYFGWDVQRARVIHILTLD
FT                   TGLTGVELEAVRKEIFTNPVTQVSVYGTSAVRFDWAIWVGYRPGVRDTAGSVAVEAISD
FT                   LLGRKLGAEESAYTSRLYLLSGTRLGKTEVETVARELLANDIVQQWRIYRYDEWDPAGG
FT                   VGIILPRVVLPHTPETREMPIESPEDLMRLSDERNLALNPLDVPVILDYFARPEVVRAR
FT                   REMGLGAPTDVELEAISQARSDHCNHNTFRGKFHYRDLATGERTVVDNLFKTCIEAPTL
FT                   AIQAEKDWVVSVLWDNAGVARFDDNNNYVITGETHNSPSNMEAYGGALTGIVGIYRDIM
FT                   GTGKGARLTAGLYGYCVGPKDYRGPLRPHLHPRRLLDGIVEGVKDGGNKHGVPTPFGNL
FT                   FFHPSFLGKCLVFVAALGIMPRLVRGEPSDLKRPDPGDFIIMSGGRVGKDGIHGVTASS
FT                   EIYSESTPAGHVQIGDPYTQKKMHDFLLEARDEGLISFITDNGGGGLSSSVGESARFCG
FT                   GARVELDKVPLKYEGLDQWEIWVSESQERMTVAVNPRHLDRFMELSRRHEVESTAIGTY
FT                   GSDGRLHLTYRGKTCACLDLSLFTEAFPQWEFEADWQPPDNRGLHEPVLAEPADYGRLL
FT                   HDVLARPNVCSREWIQRQYDHEVQGGSVIKLMTGVDRDVPNDAAVLRPALESRRGLAVS
FT                   QSINPTYSAIDTYHMVAATIDEAVRRLVAVGGRLEEIGGVDNFCWPSVQYDPVSNPDGR
FT                   YKAAQLVRANWALRDICLAFGIPLLSGKDSMYVDGHLGGAYGERHKISGLPTMQFTATT
FT                   VVPDISDCQTMDVKTAGDLVYVLGWTHDELGGSEYYDCFGYLGRNVPELDPESVLPVYR
FT                   VVEKAIREGLVASCHGIYRGGLGVHAAMAAMAGGLGMRLDLEKVPVAHAGAQAKSGPGP
FT                   RDDHILFSESCGRFILTVSPAMRGAFEAMAGGLPCAPVGEVLAEPVFVVAGRSGNVLLE
FT                   EPVGELKHSWKFGAGGERGE"
FT   gene            525404..526213
FT                   /locus_tag="Sfum_0433"
FT   CDS_pept        525404..526213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0433"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   I; KEGG: sat:SYN_00522 phosphoribosylformylglycinamidine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16133"
FT                   /db_xref="GOA:A0LFD1"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFD1"
FT                   /protein_id="ABK16133.1"
FT                   /translation="MSRVKALVLTGFGLNCDLETAYALTIVGADVERVHLNSLAQREKR
FT                   LADYRIFVVGGGFSWGDDHGAGVIMGMRLKHRLGDDLQAFVASGGIVIGICNGFQVLVN
FT                   LGLLPGFEPGVLKREVALINNDCGNFRDQWVNLIGNAASPCVLTEGIEAIELPVRHGEG
FT                   KFFAETDVLERLERRQQVILRYAGADGKVAGGAFPANPNGSVADIAGICDPTGRVAGLM
FT                   PHPEAFNDWTNHPEWTRKRELARRSGTVAPREGEGLKLFRNAVNYFR"
FT   gene            526280..527131
FT                   /locus_tag="Sfum_0434"
FT   CDS_pept        526280..527131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0434"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein;
FT                   KEGG: ade:Adeh_1254 phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16134"
FT                   /db_xref="GOA:A0LFD2"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFD2"
FT                   /protein_id="ABK16134.1"
FT                   /translation="MSESDSRLRIAVLVSGSGTNLQALIDRARDGRLAAEIVVVASDRP
FT                   GIRGLARAEAAGIPARVVDYRGFLKQDWTVLERKLPVDVDAVDRAQNILHHEDREERLK
FT                   RLVRLMSAEAEMIAAIEAYRPDYVCLAGFMRLVTPFFLHHFNRAGKLRVINIHPALLPA
FT                   FPGQHGYEDTFSYGCRWGGITIHFVDEGEDSGPIIAQAVYPILPEDDVEKVRQRGLQLE
FT                   YEMYAQVINWLAAGRVELVPAAGGRARTVIRDPEYSRIMESWVRKVLDAGPQDCRFSDP
FT                   SA"
FT   gene            complement(527757..528122)
FT                   /locus_tag="Sfum_0435"
FT   CDS_pept        complement(527757..528122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0435"
FT                   /product="HicB family protein"
FT                   /note="PFAM: HicB family protein; KEGG: sme:SMa1990
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16135"
FT                   /db_xref="GOA:A0LFD3"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFD3"
FT                   /protein_id="ABK16135.1"
FT                   /translation="MITMRYGKYIASVEFDQQAGILYGEVTNLNDVVTFQGRSVSELEQ
FT                   ALKESIESYLNACARFGKEPERPYTGVFQVRIRPEVHRWAVMAAQSEGKSLNKWVSEKL
FT                   EEALKGEHRIANDQPVR"
FT   gene            complement(528170..528466)
FT                   /locus_tag="Sfum_0436"
FT   CDS_pept        complement(528170..528466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0436"
FT                   /product="HicA protein"
FT                   /note="KEGG: ana:asl5277 HicA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16136"
FT                   /db_xref="GOA:A0LFD4"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFD4"
FT                   /protein_id="ABK16136.1"
FT                   /translation="MDGCTMNEEEGLDPAQRRTLYEILENSFRAKSGWDKVEGLFRALG
FT                   AGFADNGDSRIQVFLNDVVAVFHRPYTQKEIHKGALMSVKRFLIQAGVAKPGE"
FT   gene            complement(528572..528688)
FT                   /locus_tag="Sfum_0437"
FT   CDS_pept        complement(528572..528688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16137"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFD5"
FT                   /protein_id="ABK16137.1"
FT                   /translation="MSKDKKETVLPENTPIGQAKTITIKGDGKRKIVREGSF"
FT   gene            complement(528864..530036)
FT                   /locus_tag="Sfum_0438"
FT   CDS_pept        complement(528864..530036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0438"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: afu:AF1615
FT                   cofactor modifying protein (cmo)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16138"
FT                   /db_xref="GOA:A0LFD6"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFD6"
FT                   /protein_id="ABK16138.1"
FT                   /translation="MPGLHLSRKGPFPRKRLLFSMKTRINLAFLKSLFSRARGRPFGAW
FT                   QIELTTRCPLRCRMCIRSGNPSWHHADMDIERFRALAPYFRNVESAVLEGWGETLLYPH
FT                   LVEAVRIVKEAGTAAGFVTSGWGLDAHRSAELVEAGLDFMGFSVAGATPAMHDAVRINS
FT                   SLDAVLAAVEEVRRAKTDRKALTPSLHFVFLMVRDNCADSVPLIDLAGENGIDTVLLIN
FT                   LVHVADAWQDRQRMFVCSGEADESVLVEANARAVELGVKLRRASLSACDIAVCEENPLR
FT                   NLCISVNGEVTPCVFLCPPVPSPFKRIYCGTEVFVPRVSFGNIFEEPFEAIWNDPRYVA
FT                   FRDVFSQREKSFREMYSALMSDSNRFAALRRHAPPPPPEPCRTCHKMLGV"
FT   gene            complement(530040..530939)
FT                   /locus_tag="Sfum_0439"
FT   CDS_pept        complement(530040..530939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0439"
FT                   /product="RNAse Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   tde:TDE1951 ribonuclease Z"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16139"
FT                   /db_xref="GOA:A0LFD7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFD7"
FT                   /protein_id="ABK16139.1"
FT                   /translation="MMPMPGRYLASMAVRLDGRLYLFDAGEGTQLAWKTCRIGLRGLSV
FT                   VAVTHLHADHCLGIPGLMMLKAQLDDPEPLTVMGPPGIREFILENHRILDFHLNYPLEF
FT                   IEWSADAPDWKAYEDELLRIFWEPLEHTRFCLGYRVEELERPGRFHPDAADALDIPEGP
FT                   LRGRLQRGESVTLPSGTVVAAHQVSGPPRRGRHLAYVVDTRPTPAIQRLCQGADLAFIE
FT                   GMFLPEHAEQARAKGHLTVVEAARAARKAGARRAVLIHISPRYGEEDLDRLERAAREHF
FT                   QDAVVGRDLQVYSVPLPD"
FT   gene            complement(531028..531633)
FT                   /locus_tag="Sfum_0440"
FT   CDS_pept        complement(531028..531633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0440"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: bth:BT0181 putative NADH
FT                   dehydrogenase/NAD(P)H nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16140"
FT                   /db_xref="GOA:A0LFD8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFD8"
FT                   /protein_id="ABK16140.1"
FT                   /translation="MQNALIVSLLMGMIMIPVVDAFAQPKDANIPDAVTVIHSRKSVRN
FT                   FTGETVGRDVLEKIVRAGMAAPTAVNRQPWSFVIVTDRKTLDTLNDALPYAKMLKKAGA
FT                   AVIVCAIPGKAFENSTEFAVIDSTCASENILLATEAFGLGAVWTAAYPYKDRMDIVRKT
FT                   LNIPESVIPLNVIPIGHPTGTDRPKDKYRPENVHWEKW"
FT   sig_peptide     complement(531562..531633)
FT                   /locus_tag="Sfum_0440"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.720 at
FT                   residue 24"
FT   gene            532102..532671
FT                   /locus_tag="Sfum_0441"
FT   CDS_pept        532102..532671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0441"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: gsu:GSU2788
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16141"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFD9"
FT                   /protein_id="ABK16141.1"
FT                   /translation="MSFQAAEQRDERTVNGVDVNRLFDTIDAVKAEPEIAKFRFRVKNK
FT                   WIGGGHNHTTITDFYGALKDHPHEKPFELDADEPEVLLGEDKGPNPVEYLLTALAGCLT
FT                   SSLVYHAAAKGIELKGVESRLEGDLDLRGFLGLSKDVPVGYREIRVYFTIDADLSEQEK
FT                   QELIREAQKYSPVFNTVSNSTRVTVQ"
FT   gene            533088..533588
FT                   /locus_tag="Sfum_0442"
FT   CDS_pept        533088..533588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0442"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   gka:GK0894 menaquinol-cytochrome c reductase iron-sulfur
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16142"
FT                   /db_xref="GOA:A0LFE0"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE0"
FT                   /protein_id="ABK16142.1"
FT                   /translation="MASDTTCGYPDESIRPGRRAFIKCALLAGATGVLAGVPLLSYVAA
FT                   PALKKGTTRWIDFGPVDQLKPGGIEMLSYEFMVKDGWLVLPQRGFVWAKLDSPGKITVF
FT                   SSTCTHLACNVIWRKEKGIFECPCHSGQFDINGRPIAGPPTKPLVAWAHKVEEGKLMVL
FT                   MPA"
FT   gene            533619..534596
FT                   /locus_tag="Sfum_0443"
FT   CDS_pept        533619..534596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0443"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP3001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16143"
FT                   /db_xref="GOA:A0LFE1"
FT                   /db_xref="InterPro:IPR019020"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE1"
FT                   /protein_id="ABK16143.1"
FT                   /translation="MKTPAILLLFLAVLICGNAFMADLATSAAIETLAAAKVPKGPTSL
FT                   DDPVWQKAKPLDIPFAGKEKFAGKKANVITQAVYTDDEIFFLFKWKDATNSVTKGAWQF
FT                   DGEKWTHLKGDEDRISLLFEINRINNFATKGCAVTCHGAAGAAVKDFKFATASAGEKGD
FT                   LWHWKAARSDPYKSADDGWLTAAGEKTGRKDDAGGGGDARNETADKSKPQFMQDPSKKP
FT                   SAPGVLLAEDTVEITDHGKFKANDTLTYRMPKKPSGSRADIKAESRYADGGWTVMLSRK
FT                   LDTGNDDDVAFNTKKKYSFALALFDDSMDYDSYDSEALVLEFGR"
FT   sig_peptide     533619..533693
FT                   /locus_tag="Sfum_0443"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.364 at
FT                   residue 25"
FT   gene            534682..535686
FT                   /locus_tag="Sfum_0444"
FT   CDS_pept        534682..535686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0444"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP3001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16144"
FT                   /db_xref="GOA:A0LFE2"
FT                   /db_xref="InterPro:IPR019020"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE2"
FT                   /protein_id="ABK16144.1"
FT                   /translation="MKAGIARALTLVLVVALGVILTGRCHLEAAEPSWVVTAKYLQKAP
FT                   TGLDDPAWQQVRPVEVRLKGRGSFAEEEVTVTAMAAYTAESIYFLFKWKDPTESVVKQS
FT                   WKFDGQNWTHMKGDEDRIALLFEISRINGFATKGCTVVCHSPPDVPSKEWKFATETPAE
FT                   KGDLWHWKAARSNPYHHADDGWLTLADNPSGSYRTTGRRADGGGGGDVNNETPDKTRPL
FT                   YMQDPSRIPSAPGFLLFEEAVNIPDDAVFKAGDIIPYRMPKKPDGSRSDVKAIGQYADG
FT                   GWTVMLYRKLDTGREDDVAFNPRKEYSFAMAVFDDSGDDHSKATRAMILRFSR"
FT   sig_peptide     534682..534771
FT                   /locus_tag="Sfum_0444"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.846) with cleavage site probability 0.601 at
FT                   residue 30"
FT   gene            535711..536787
FT                   /locus_tag="Sfum_0445"
FT   CDS_pept        535711..536787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0445"
FT                   /product="Cytochrome b/b6, N-terminal domain"
FT                   /note="PFAM: Cytochrome b/b6, N-terminal domain; KEGG:
FT                   ade:Adeh_2404 cytochrome b/b6-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16145"
FT                   /db_xref="GOA:A0LFE3"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE3"
FT                   /protein_id="ABK16145.1"
FT                   /translation="MNGTGQSSGKLLNRLALDGYAERLCAVRVASDAFGWTRFCGSLSL
FT                   VLVVMLFLSGAFLMFYYSPTPGAAYDSVDFAQFSVPFGDIVRGVHYYAWNLLLVVLGLH
FT                   LAGTFLTAAYQAPRQFVWISGVLIMLVVPLFIITGDLLPWDQKGYWTTQVRNSIISSIP
FT                   VVGDLTLRLLQGGPRTGIVTLTRFYVLHCLFLPSLLVALIVIHLHFLAHRGLSEPLREG
FT                   KTDRGCIPLVPDLINRWLLLFAAVAVVLGLVSAYWPAPLDSPADPTDSAYVPKPEWWVL
FT                   ALNQLVSIFKGPFMFIGTAVIPGGLAALLIALPFLDRSPSRHPAKRKTVMVLGVIMLIL
FT                   LSGLSLLGYIEHFMTPRP"
FT   gene            537513..538175
FT                   /locus_tag="Sfum_0446"
FT   CDS_pept        537513..538175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0446"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: dvu:DVU0436
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16146"
FT                   /db_xref="GOA:A0LFE4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE4"
FT                   /protein_id="ABK16146.1"
FT                   /translation="MGMLKGGGRSADTRERLLEAAGETFAARGFRDATVREISRRAGVN
FT                   VAAVNYYFGDKEGLYSAVLKYTLDSALKKYPPDLGLDGDATAEDRLYAFIRSMLYRVTD
FT                   EGRPAWHGKLMIREIAQPTKALDEMVLTGFGPLHRSLMSIVRELAGAGGDEEQIRLCAM
FT                   SILGQCLYYHLCRPVLKALYAQSFDVPEIERLAGHIMRFSLNGLRVLQAKTDNPRMG"
FT   gene            538393..539931
FT                   /locus_tag="Sfum_0447"
FT   CDS_pept        538393..539931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0447"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: dde:Dde_0400 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16147"
FT                   /db_xref="GOA:A0LFE5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE5"
FT                   /protein_id="ABK16147.1"
FT                   /translation="MIDLQGMKRFRWTRSLILGLVAVVGGCMVGPNYRTPPSEMPGQWS
FT                   EEPKGVEVAAAPDISRWWTLFEDPKLNDLIERAVRANKDLKIAAARVREARAQRGVTAA
FT                   DLFPTVNADGSYVYSQKSLTTTNPPLVSSGSSPAATVGGVSTGSTNLFQVGFDAGWELD
FT                   LWGGTRRAVEAADANLAASVENLRGVLVTLVSDVAVSYMQIRGFQLRLGIARNNIASQR
FT                   QTLELTEARFEAGLSSELAVAQQKAQLAATEATVPAFESGMRQAIHQLGVLLGGKPELL
FT                   LEELLEEEPIPPVPPGVPAGLPSDLLRQRPDIRASERQLAAATASIGVATAQLFPQFSL
FT                   TGTVGQQSMFSSKWFTPGSNYFSIGPSVSWAIFDAGRIRWNIKVQDARQEQAFHTYEKT
FT                   ILVALKDVEDALIAYSKEQDTRESLKLAVDSNRRAYDISYELYAKGLVDFLNVLDAQRN
FT                   LFVTQDQYAQSTLRVSADLVALYKALGGGWDVPPEAAARPVARNAPENPVGQGQ"
FT   gene            539971..540933
FT                   /locus_tag="Sfum_0448"
FT   CDS_pept        539971..540933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0448"
FT                   /product="Pyruvate dehydrogenase (acetyl-transferring)"
FT                   /EC_number="1.2.4.1"
FT                   /note="PFAM: dehydrogenase, E1 component; KEGG: tte:TTE0186
FT                   Thiamine pyrophosphate-dependent dehydrogenases, E1
FT                   component alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16148"
FT                   /db_xref="GOA:A0LFE6"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE6"
FT                   /protein_id="ABK16148.1"
FT                   /translation="MPPTKEKLLEMLRSMLLTRRFEEKLTELCQIEGKVPGMMILCTGQ
FT                   EAVAAGVCAALEPQDVIVPNHRSHGHLLARGADPNALMAECFGKRTGFNKGKSGTLHVA
FT                   VPEVNALCTTTVVGGGIPIAAGVAFAQKYRKQKNVTVCFFGDGAADEGSFHEALNLAAL
FT                   WDLPVLFVCENNLYAGAQRYEEHTKIRDMADRAVAYGIPGIVVDGNDARVVYAAAERAR
FT                   ARAVAGEGPSLIECKTYRCRGHGESDHQLYQPPEEIASWKERCPLPRLRDEVLAQELLD
FT                   EKALKSMEDEISRIVEDAVRFAEESPWPDPEDALSDVYV"
FT   gene            540969..541946
FT                   /locus_tag="Sfum_0449"
FT   CDS_pept        540969..541946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0449"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase, central region; Transketolase
FT                   domain protein; KEGG: bha:BH0777 acetoin dehydrogenase
FT                   (TPP-dependent) beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16149"
FT                   /db_xref="GOA:A0LFE7"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE7"
FT                   /protein_id="ABK16149.1"
FT                   /translation="MQQLTMGQAVNQALREEMLRDPNVFIAGEGVGVSIHAAPVLPTFG
FT                   LLEEFGPDRVKDTPVSEAAIAGLAVGASVMGLRPVVEIMFNPFVTLASDMIVNHAAKLR
FT                   YLSGGKSTFPMVVRIKSGAGFKAGCQHSHNLEAWLAHCPGIRVVMPSTPADAKGLLKSA
FT                   IRDDNPVVFIEDMLLYFVPGPVPEEEYLVPIGKADVKRQGSDVTIVTWSKMLGAAMKGA
FT                   ALLEQKGVSAEVIDLRTLAPLDKDAILDSVRKTGRLVVLHEATRTGGFAGEICALVAEE
FT                   ALGSLKAPFRRVTGPDIPVPFSPPLEAFYIPDEHDLVKAVESIV"
FT   gene            542359..543582
FT                   /locus_tag="Sfum_0450"
FT   CDS_pept        542359..543582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0450"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   gme:Gmet_1651 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16150"
FT                   /db_xref="GOA:A0LFE8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE8"
FT                   /protein_id="ABK16150.1"
FT                   /translation="MVDFVRRGIEVLERMRSLKSTMAMWSKRFLWTVGILWVSLSVSAC
FT                   SENISGQGRGGGAKRAVVVPVTVSAAVEKTVPVQLKAIGKVQAYNTVAIRAQVTGELVG
FT                   VHFTEGREVKKGDPLFTIDPRPFEAEVKKAEANLAKNRAQLENARRQTRRYGEVAHKGY
FT                   VSQELHDQVLTNATALEAAVRADEAALESARLMLRYCHISSPIDGVTGETKVDLGNLVK
FT                   DNDDANPMVVINQISPIYASFAVPEQNLPEVKKHMAAGKLEVLATVSGNERDVVKGELS
FT                   FIDNTVDPATGTIQLKATFANKDKFLWPGQYVNVVLTLTTRSGAIVVPSHAVQTGQEGQ
FT                   YTFVVKPDATVEYRRVTVGRDVDGELVIEKGIAVGEKVVTDGQLRLAQGSQVRVVEEGD
FT                   AGTGEKAR"
FT   gene            543579..546746
FT                   /locus_tag="Sfum_0451"
FT   CDS_pept        543579..546746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0451"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   dvu:DVU0438 AcrB/AcrD/AcrF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16151"
FT                   /db_xref="GOA:A0LFE9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFE9"
FT                   /protein_id="ABK16151.1"
FT                   /translation="MNITELFIRRPVATTLVMLAILLFGLMGYRSLPVSELPNVDYPTI
FT                   EVSSNLPGSNPETMAASVATPLEREFSTIAGLDSMTSVNALGITRITLQFSLDRDIDAA
FT                   AQDVQTAIAKSQRLLPPELPTPPWFRKVNPADQPILYLALASPILPLSTVDEYAQTLVA
FT                   QRISMLGGVAQVLVFGSQKYAVRVQVNPNALTSLGIGIDEVEQAIAKSNVNLPTGTLYG
FT                   QNRAFTVQATGQLVNAASYKPVIVAYRNGSPVRLQDLGKVIDGVENDKVAGWFNSGGNT
FT                   SRAIILAIQRQPGTNTVQVADRIKGLLPMFRMQIPESVKLDILYDRSESISHSIEDVKF
FT                   TLYLSMCLVVLVIFLFLRNVSATIIPSLALPLSIVGTFAVMYMLGYSLDNLSLMALTLS
FT                   VGFVVDDAIVMLENIVRHLEMGKSKLQAALDGSREIGFTILSMTLSLAAVFIPLLFMGG
FT                   ILGRLFHEFAVTIGAAILVSGVVSLTLSPMLCSRFLKAPGAERHGAFYNTAERFFQGML
FT                   GAYDWSLKLVLRHKASMMLLSAVLLIATGYLFWAIPKDFIPSQDTGQVQGFTEARQGIS
FT                   FAAMVERQKAVAAIINKDPDVAGFMSGAGATGGTPTGNSGRLFMRLKPRSERESNVTEV
FT                   IARLRGEVAAVPGINVYFQNPPAIQIGGRATKSQYQYTLQGPDTKELYQWAPALEEKFR
FT                   ELPGLQDVVSDLQITNPQVVVDIDRDKAQSLGVSAEQIENALYSAYGARQVSTIYTPIN
FT                   QYQVILEVDPKYQEDPSALSLLYVRSSSGRLVPTEAVAKIRQNVGPMTVNHTGQFASVT
FT                   VSFNLKPGVALGDAVDQIEKAVRELRLPATLSSSFQGTAQQFQQSMKGMWVLLIVAIMV
FT                   IYMVLGILYESFIHPVTILSGLPSAGVGALLTLMIFRVDLSIYAFVGIIMLVGIVKKNA
FT                   IMMIDFALSAQREYGKSPAEAIYEGCILRFRPIMMTTMAALMGTLPIALGIGAGAEARQ
FT                   PLGLAVVGGLVLSQLLTLYITPVVYLYMESFQEMLRRVFKPAARKATPEAVGSEVMERP
FT                   RRKTSAL"
FT   gene            546877..547611
FT                   /locus_tag="Sfum_0452"
FT   CDS_pept        546877..547611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0452"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: dvu:DVU2209
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16152"
FT                   /db_xref="GOA:A0LFF0"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFF0"
FT                   /protein_id="ABK16152.1"
FT                   /translation="MDELDTLMDLIRQKYEVEVVPLKIGDRTLRLLQLTDFEAYIERLV
FT                   DSGGVGIMDLPFWAKVWDSSFLLAWFLGKQPVVPGRRLLEIGAGMGVVGLYAALCGHRV
FT                   TLSDINEDALLFARANARLNGLTEMKILKLDWNDPSPFEPYDIVFGSEVIYDRKSYPLL
FT                   VRFLRRAVAPDGMIFLAKNQGLHAPRFFEELTRYFEFKEKVQEVRSCGEAEKICLYAIR
FT                   RKRSVPEESGVDSAACADGGGT"
FT   gene            547611..548330
FT                   /locus_tag="Sfum_0453"
FT   CDS_pept        547611..548330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE1809 hydrolases of the alpha/beta
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16153"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFF1"
FT                   /protein_id="ABK16153.1"
FT                   /translation="MSPVSRVMIPVGAGALACEIHLPDKLPSPAVVCCHGLLSSKDSTK
FT                   YLSIAEELRAVGIAAVRFDFSGAGECTAPLGPNLLESWLRDLDAVLGYVRARTWMAGPL
FT                   GLLGSSMGGYVSLLMRDSGRHPVNALVCWSTPFRLERIRAALEDGDELAHVFPAGFKLG
FT                   HPQTLASLGPIPGILVIHGQEDDLVHWEQATDIYRRLGEPRNLVLLRTAEHRILDPEWR
FT                   RLALRLSVDWFRERFST"
FT   gene            548430..549071
FT                   /locus_tag="Sfum_0454"
FT   CDS_pept        548430..549071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mfa:Mfla_1749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16154"
FT                   /db_xref="GOA:A0LFF2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFF2"
FT                   /protein_id="ABK16154.1"
FT                   /translation="MLTEMVSNFAIRCLETTGYLGAAFLMALESMIAPIPSEAVMPFVG
FT                   FLVADGKWNLWIAVLATSAGSIIGSLASYLMGYHGGKPLVLKVGKYLLLDAHDLERTES
FT                   FFNRRSGTLTIFVSRFVPVVRHLISIPAGTGKMPLGRFLIATLIGATLWNSFLLGCGMV
FT                   LREHWSVVQTYSHQVDIVVVLALLAGAAWFVRARIGARSRKAMASSSEGE"
FT   gene            complement(549179..549583)
FT                   /locus_tag="Sfum_0455"
FT   CDS_pept        complement(549179..549583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0455"
FT                   /product="methylmalonyl-CoA epimerase"
FT                   /EC_number="5.1.99.1"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: tte:TTE1219 lactoylglutathione
FT                   lyase and related lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16155"
FT                   /db_xref="GOA:A0LFF3"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFF3"
FT                   /protein_id="ABK16155.1"
FT                   /translation="MKVLKLDHIGIAVNSIEECKKLYADILGLLHAGSETVAEQKVTTA
FT                   FFPVGDTEIELLESTAPDGPIAKYLEKKGEGVQHLAFRVDNIEAALAELKAKGIKLIDE
FT                   VPRRGAGGAKIAFLHPKSTFGVLVEISQRD"
FT   gene            complement(549580..550557)
FT                   /locus_tag="Sfum_0456"
FT   CDS_pept        complement(549580..550557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0456"
FT                   /product="LAO/AO transport system ATPase"
FT                   /note="KEGG: tko:TK0329 lysine/arginine/ornithine transport
FT                   system kinase; TIGRFAM: LAO/AO transport system ATPase;
FT                   PFAM: ArgK protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16156"
FT                   /db_xref="GOA:A0LFF4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFF4"
FT                   /protein_id="ABK16156.1"
FT                   /translation="MATDYVKEILEGTHRYAARLITWLEDEDPRGHEVMERLYPHTGKA
FT                   YVIGITGSPGAGKSTLTDKLTRVIRQEGLTVGIVAVDPSSPFTGGAILGDRVRMSELSE
FT                   DSGVYIRSMATRGFLGGMAKATGDVVKVLDAFGQDIIIIETVGVGQDEVDVIGIADTTC
FT                   LILVPGLGDAIQSMKAGIMEIADVFVVNKADRPGADQLAAEVCHRVEQDAHIKPTDWNP
FT                   PVTRTVAVNDEGTTELWQSIQRHRQFLHESGKFIEKRRQHTCDETLRMIHNELFRIVRS
FT                   QLETSGQLDHLVEDILDRKRDPYSIMRQIVNKWLSIPQKHKEAS"
FT   gene            complement(550963..551364)
FT                   /locus_tag="Sfum_0457"
FT   CDS_pept        complement(550963..551364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0457"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; KEGG:
FT                   aba:Acid345_1432 methylmalonyl-CoA mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16157"
FT                   /db_xref="GOA:A0LFF5"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFF5"
FT                   /protein_id="ABK16157.1"
FT                   /translation="MASKIKIIVAKPGLDGHDRGAKLLARIFAEAGMEVVYTGLRQTPE
FT                   MIVNAALQEDADVVGLSSLSGVHNYFFPRVVQLMREKGLKDVLIVGGGIIPQEDYEPLK
FT                   KAGVQGVFGPGTPTTEIVKFIQDNVRAKK"
FT   gene            complement(551416..553095)
FT                   /locus_tag="Sfum_0458"
FT   CDS_pept        complement(551416..553095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0458"
FT                   /product="methylmalonyl-CoA mutase"
FT                   /EC_number="5.4.99.2"
FT                   /note="KEGG: tte:TTE1217 Methylmalonyl-CoA mutase,
FT                   N-terminal domain/subunit; TIGRFAM: methylmalonyl-CoA
FT                   mutase, large subunit; PFAM: methylmalonyl-CoA mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16158"
FT                   /db_xref="GOA:A0LFF6"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFF6"
FT                   /protein_id="ABK16158.1"
FT                   /translation="MFDEKALQKIKAGKDKWEQGTVAKTLAKSPESKKEFTTISGAPVE
FT                   RLYTPADVAGIDYEKHIGFPGEFPFTRGVQPTMYRGRYWTMRQYAGFGSAKDTNARYRY
FT                   LLQQGQTGLSVAFHLPTQAGYDSDHPLSMGEVGKVGVAIDSIEDLKVLFNGIPLDKVTT
FT                   SMTINAAATVLLGMYLAIAEEQGVPYDKVGGTVQNDVLKEIICRGQYIYPPKPTMRLTV
FT                   DLIEFAQKFVPRWNSISISGYHIRESGSTAAQEIAFTLADGIAYAQACMDRGIPVDAFA
FT                   GRLSFFFNAFTNVLEEVAKFRAARRCWAKIMKERFGAKDPRSMMLRYHVQTGGVTLTAQ
FT                   QPLNNIVRVGLQTYATALGGAQSLHTNSYDEALCLPTQQAVTVALRTQQIVAEESGATD
FT                   TIDPLAGCYYVEAMTDKIEAEVHEYIKKIDAIGGTLSAIEQGYIQKEIQNSSYRFQKEI
FT                   ENNERVYVGINKYTMEEPPPEGLLKVDMSVGEVEAAKLKKLRATRDQAKWKAALDKLKK
FT                   VSQTDENVMPTVIEAVKAKATVGEICDVWREVFGEYRPKEFV"
FT   gene            553492..553860
FT                   /locus_tag="Sfum_0459"
FT   CDS_pept        553492..553860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0459"
FT                   /product="molybdopterin biosynthesis MoaE"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE; KEGG:
FT                   sat:SYN_01004 protein involved in biosynthesis of
FT                   molybdopterin"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16159"
FT                   /db_xref="GOA:A0LFF7"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFF7"
FT                   /protein_id="ABK16159.1"
FT                   /translation="MTDLNALVAKIKKETDPDKVGMIVCHNGVVRGTTRAGEKAEFLEI
FT                   DADWNAWREIIAEMRQAPGISAVEAHLFTGRRQVGDDVMLVAVAGDIRENVFPVFETTV
FT                   NRLKKEAVRKKEGLSPVR"
FT   gene            complement(554375..555364)
FT                   /locus_tag="Sfum_0460"
FT   CDS_pept        complement(554375..555364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0460"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /note="TIGRFAM: malate dehydrogenase; PFAM: Lactate/malate
FT                   dehydrogenase; KEGG: aci:ACIAD3155 malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16160"
FT                   /db_xref="GOA:A0LFF8"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LFF8"
FT                   /protein_id="ABK16160.1"
FT                   /translation="MAKKPVRVTVTGAAGQIGYALLFRVASGQMLGPDQPIILQMLELP
FT                   IDKVQAALKGVMMELEDCAFPLLADMIGTGDPKVAFKDSDYALLVGARPRGPGMERKDL
FT                   LLENAKIFIEQGKAMNAVASRDIRVIVVGNPANTNAWIAMKSAPDLPKGNFTAMLRLDH
FT                   NRAKSQLATRTGKPVASVEKMIVWGNHSPTMYPDIRFCTVDGQPAVKLVNDEAWYRNEY
FT                   IPKVGKRGAAIIEARGLSSAASAANAAIDHMHDWALGTNGKWVTMGLPSDGSYGIPEGT
FT                   MYGVPVTCTPGKYERVKGLEIDAFSREKMDFTLKELTEEQAGVKEMVK"
FT   gene            complement(555407..557392)
FT                   /locus_tag="Sfum_0461"
FT   CDS_pept        complement(555407..557392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0461"
FT                   /product="pyruvate carboxylase subunit B"
FT                   /EC_number="6.4.1.1"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; pyruvate carboxyltransferase; Conserved
FT                   carboxylase region; KEGG: mja:MJ1231 pyruvate carboxylase
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16161"
FT                   /db_xref="GOA:A0LFF9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFF9"
FT                   /protein_id="ABK16161.1"
FT                   /translation="MENKHLHGTSLIAKLQDDPKVKVDNPIKIGDLTFRDGHQSLFATR
FT                   GRTEDLLPIAEEMNKIGYWSMEVWGGATFDTMHRFLNEDPWERPRQLKKYLKDTPMMML
FT                   LRGQNLVGYRNYADDMAEAFVDRACINGIDIFRTFDAVNDFRNFETVIKPIKKHKKHFQ
FT                   GTICYSLTEPRMGGPVYNLDYYVKKAKQLENMGADTVCIKDMAGLIAPYDAYYLVKALK
FT                   ENVKVPIHLHSHFTSGMADLALLKAIEAGVDIVDTCLAPWAYRSSHPAIEPLVMTLRHT
FT                   SRDTGFDLHQLAKCSTHFEKVSPKYRHLLDDRMATIDIGVLLHQTPGGMLSNLINQLRD
FT                   MGASDKLDAVFKALPQVRKEMGQVPLVTPTSQIVGIQAVNNVLFDTPQERYKMISAQSK
FT                   DLFYGLYGETPVPVDPEIQKKALKGYPRGETPTTARPADVLEPEMEKNWKDMEGLAKDI
FT                   DDVLIYGMYPMTGKRFLNWKYGKEPVPKEVMPKTLEDCAKEADLVKKAKAGLLVEKPTK
FT                   VAPEKGPGLRTFSVFVDEEFFEVGVEQIGGAPAITSITPMVAPVAAPAAAPAAAPKPAA
FT                   APAAAPKPAAAPVEGGTKLEAPMPGMVIRYEVKEGDSVKEGDVVMILEAMKMENSITAP
FT                   AAGVIKQICCKDGQSVQKGDVLAVIG"
FT   gene            complement(557623..557904)
FT                   /locus_tag="Sfum_0462"
FT   CDS_pept        complement(557623..557904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16162"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFG0"
FT                   /protein_id="ABK16162.1"
FT                   /translation="MTIFSGGLLEWKRREKRKRWHLMRREYMQEKKKVVAAIATALAYY
FT                   MQAEEQAMLALQQQRAAQGPRQLFNPYALAGRTAAMDVRWTWQMRLAR"
FT   gene            complement(558071..558400)
FT                   /locus_tag="Sfum_0463"
FT   CDS_pept        complement(558071..558400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16163"
FT                   /db_xref="GOA:A0LFG1"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFG1"
FT                   /protein_id="ABK16163.1"
FT                   /translation="MGKQKDKTTKEKPLDKMTAKELRELAMTLEGIVGVHAMNKNELIA
FT                   AIREAKGIVDDKSKKSSVDVRGIKVKIRELKERREKAKEEGNRKLADAFRRRIGNLKKR
FT                   SRRAA"
FT   gene            complement(558393..559178)
FT                   /locus_tag="Sfum_0464"
FT   CDS_pept        complement(558393..559178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0464"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="PFAM: band 7 protein; KEGG: sat:SYN_02180 membrane
FT                   protease subunit, stomatin/prohibitin -like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16164"
FT                   /db_xref="GOA:A0LFG2"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFG2"
FT                   /protein_id="ABK16164.1"
FT                   /translation="MPIGVYIVVVLAVLFLATAIRVLNEYERGVIFRLGRVIRAKGPGL
FT                   IILIPMVDRMQKVSLRLVAADVPAQDVITRDNVSVKVSAVIYFRVVDPVKAVISAENYL
FT                   YATSQLAQTTLRSVCGQGELDDLLAERDKINSHIQEILDRHTEPWGVKVSVVELKHIDL
FT                   PQEMQRAMAKQAEAERERRAKIIGAEGEFQAASRLSEAAKIIQEHPVAIQLRYLQTLRE
FT                   ISSENNSTTIFPIPIDLFRPFIRLAELYDRKQEKEQPIG"
FT   gene            complement(559234..560589)
FT                   /locus_tag="Sfum_0465"
FT   CDS_pept        complement(559234..560589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0465"
FT                   /product="Nodulation efficiency protein NfeD"
FT                   /note="PFAM: peptidase S14, ClpP; protein of unknown
FT                   function DUF107; KEGG: sat:SYN_02179 membrane-bound serine
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16165"
FT                   /db_xref="GOA:A0LFG3"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFG3"
FT                   /protein_id="ABK16165.1"
FT                   /translation="MSLSRHPRGGFEMLKSLYARIPFHAAWFLVVGALVLFPFNGCIAG
FT                   SDHVNIVEIQDTINPGVEDFIRYAVATSEEDGAQFLVILLDTPGGLLTSTRGIAQAILN
FT                   AKVPIVVYVYPSGAQAASAGVFITAAADIAAMAPGTNIGAAHPVMGGGENVPSTMDEKV
FT                   LNDTLAFSRSIAAQRGRNAEWLEQSIRRSVSATAEEAFKENVIDLVADDLPALMKKLDG
FT                   WNLSKGGKSVVLQTRAVEQRTLTPSWQHRVLRGIANPNLAYILLMIGLAGLYFELSQPG
FT                   AIFPGVIGGVSLILALYSLQTLSVNYAGFLIILLAVIFFILEIKVASHGMLSIAGVLCL
FT                   VLGSLMLFRAPGSTTALAMSVFIPTVLTVSAFFVTVASLAFRAQISRPQIGVEAFEGLI
FT                   GEAHTDLRPAGKVFVNGELWNAEADEEILMGEQVQVVSMHNLKLKVRKISGR"
FT   gene            complement(560901..561695)
FT                   /locus_tag="Sfum_0466"
FT   CDS_pept        complement(560901..561695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0466"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   ade:Adeh_2370 phage SPO1 DNA polymerase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16166"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFG4"
FT                   /protein_id="ABK16166.1"
FT                   /translation="MTPSGKTERDIAETLRQLRLVMTGLQVAGIEDWAAAWSDPAVGLP
FT                   EPEKAIEQEPDPAGGLTVIAGELEGCRRCRLHSERTRIVFGEGSAHAPLVFVGEGPGLE
FT                   EDRQGRPFVGRAGRLLDQMIKALGFHREAVYICNVVKCRPPKNRTPESEEIARCGPFLI
FT                   RQIEAIRPRVICALGACAAQTLVGTGSSISRLRGSVHYWRGIPLICTFHPAYLLRTPAQ
FT                   KAAAWEDLILVRDLLKTGCVQDGGIGREGIKPSPASDRHIGP"
FT   gene            complement(561673..562947)
FT                   /locus_tag="Sfum_0467"
FT   CDS_pept        complement(561673..562947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0467"
FT                   /product="Phosphopantothenate-cysteine ligase /
FT                   Phosphopantothenoylcysteine decarboxylase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="KEGG: sat:SYN_02177 phosphopantothenoylcysteine
FT                   decarboxylase / phosphopantothenate--cysteine ligase;
FT                   TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16167"
FT                   /db_xref="GOA:A0LFG5"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFG5"
FT                   /protein_id="ABK16167.1"
FT                   /translation="MGNGPIRWDTGRDCMLKDKSILLGVSGGIAAYKAAEIVRCFVKAQ
FT                   AAVQVVMTANAREFITPLTLQALSGRPVLTNLFDLEHESRIGHIEAARRADLVVLAPAT
FT                   ANLMAKMASGIADDYLTTILLATTAPVLVCPAMNVKMFEHPATQRNLSTLRELGCHVLP
FT                   PAVGSLACREEGTGRLADIPDILEASRRLLTAPSLAGRRILVSAGPTWEPFDPVRFISN
FT                   PSTGKMGYALATVAARRSGEVHLVSGPSTLAAPQGVRLSKVVTAREMQESVLALAPGMD
FT                   AIVMAAAVSDFRPTEEAPQKIKKIAGEEAVRLTRNPDILAALGRSRPGGRHQVLVGFAA
FT                   ETENLIENAREKLIEKNLDFIVANNLTQSGSGFGSDTNQVKILDRDGTITELPCLTKEE
FT                   VAEMVMDRVEQQLGKGEHDDAVRED"
FT   gene            complement(563268..563657)
FT                   /locus_tag="Sfum_0468"
FT   CDS_pept        complement(563268..563657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0468"
FT                   /product="lipoprotein, putative"
FT                   /note="KEGG: dvu:DVU3352 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16168"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFG6"
FT                   /protein_id="ABK16168.1"
FT                   /translation="MASAPPAAAPPSPPPPTPTPTAPRPQFYDFQDIPIPSELDLVSKD
FT                   SYVFQAGALKAGLLTLRGRVDVNSLINFFQMALPREHWKLKGGFRYKRSVLIFDKPDRT
FT                   CIINLYEKMFYTYVEILVAPAGSQV"
FT   gene            complement(564110..564757)
FT                   /locus_tag="Sfum_0469"
FT   CDS_pept        complement(564110..564757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0469"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   aba:Acid345_1901 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16169"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFG7"
FT                   /protein_id="ABK16169.1"
FT                   /translation="MPSQDLRIVLEHIPVGMFRTNCYVLGETRSHRAVVIDPGAEGERI
FT                   AGRIGALGLQPVAILITHAHIDHVMGAWSLKEELGGEIFLHPKDQPLLDDHMIGLDDLA
FT                   CAHVPRFAADRTLEEGDVLDFGPIRLSVIETPGHTPGHVSVYFPEAKSIFVGDTIFAGS
FT                   IGRTDFPGGSHDRLIRSVKEKIFTLPGDTLVYPGHGPGTTVEREMRTNPFFR"
FT   gene            complement(564764..565288)
FT                   /locus_tag="Sfum_0470"
FT   CDS_pept        complement(564764..565288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0470"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: gme:Gmet_1074
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16170"
FT                   /db_xref="GOA:A0LFG8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFG8"
FT                   /protein_id="ABK16170.1"
FT                   /translation="MSGVTTETDTIRTILARRSVRQFTDAAVDRRLIVEALRAASWAPS
FT                   GLNNQPWRFALVWEPVLKDKIGALTRYATVLRSSAVLIPVFMDKESSYDYVKDCQAVGA
FT                   CIQNLLLALHSLELGAVWIGEILKNKEKILEVLELPERLELMAVVAVGVPAHRNQTSHR
FT                   RPLEELILLER"
FT   gene            565616..565978
FT                   /locus_tag="Sfum_0471"
FT   CDS_pept        565616..565978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0471"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   mag:amb0333 anti-anti-sigma regulatory factor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16171"
FT                   /db_xref="GOA:A0LFG9"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFG9"
FT                   /protein_id="ABK16171.1"
FT                   /translation="MSLEVYWEEHRPVVELGGVLDRESVPGIRKVLLRLVKAKGIKDLR
FT                   IDLAEVERMDTSGVAMLVEVLRVLSARKGKVHLTNPSEPATRMIRLARLNGVFEQGASG
FT                   PLAASGAGPQRRDSRG"
FT   gene            566024..566905
FT                   /locus_tag="Sfum_0472"
FT   CDS_pept        566024..566905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0472"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dde:Dde_0022 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16172"
FT                   /db_xref="GOA:A0LFH0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFH0"
FT                   /protein_id="ABK16172.1"
FT                   /translation="MATAQLTAVRGDREKGFDKTFQTGRWARELEMDSSDMIVVDRLNS
FT                   RYRGHQVLYDVSLTIPGSQVTVIMGVSGCGKTTLLRHLVGLKRTDPGRIFIEGEDLGSF
FT                   DGRQLEDYRRRVGILFQSGALFNSMTVAENIAVPLKVHTRLADETIRLMALIKLNMVGL
FT                   SDFCDFMPSQLSGGMKKRAGMARALAMDPEILFVDEPSSGLDPITAAGLDRLILDLREA
FT                   LGMTIVVVTHELESAFQIADQIIVMDQGRLLASGTPEAIRANTDERVVQFLQRRADSGQ
FT                   TGIENYLSSLLG"
FT   gene            567041..567817
FT                   /locus_tag="Sfum_0473"
FT   CDS_pept        567041..567817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0473"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   pca:Pcar_0447 putative ABC transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16173"
FT                   /db_xref="GOA:A0LFH1"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFH1"
FT                   /protein_id="ABK16173.1"
FT                   /translation="MIRSLGAYTVVQVGFLGRLGLFLGRMLAGITRPPGKFLSVVKQIQ
FT                   FIGTKSFLVIGFTAIFTGMVLALQGYYALASVGSEGWLGKAVSLSLIRELGPVLTALMV
FT                   TGRAGSAMCAEIGIMRIDEQIDAIECMAIDPHSYLITPRLLAALIALPLLTAFCDVVGI
FT                   VGGYLVGVNLLGVNAGAYLDSMESSVVWKDVYMGIVKSICFGVLIIWICTYKGYYAGVD
FT                   ENNFGPEQVSRATTNAVVLSSISILVCDYVVTSVLL"
FT   gene            567833..568327
FT                   /locus_tag="Sfum_0474"
FT   CDS_pept        567833..568327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0474"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: sat:SYN_01264 ABC-type transport system involved in
FT                   resistance to organic solvents, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16174"
FT                   /db_xref="GOA:A0LFH2"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFH2"
FT                   /protein_id="ABK16174.1"
FT                   /translation="MERRGLEFGVGLFLLIGLACLGYLSFKLGHLNLWGGSDYPVTAKF
FT                   STVAGLKDKAKVFMAGVAIGEVQSIGLKDGEAVVTLSINKDVKLEDDVIASIKTSGLIG
FT                   DKYVSVTAGASDQYIKPGGAIRDTQPPLDIENLLGRFVFGSVEQPKGQGGEGKQDDGAL
FT                   R"
FT   gene            complement(568437..568760)
FT                   /locus_tag="Sfum_0475"
FT   CDS_pept        complement(568437..568760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16175"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFH3"
FT                   /protein_id="ABK16175.1"
FT                   /translation="MVQRRGGSVFGFDWFLKEERVMKRIMAVLFVVALAFTMISGCCAT
FT                   TDCKKCADLCQAALDKAQAIEQSCTASARAAEAAAQKAEAAARRAEAAADKCEQMLMRK
FT                   MKK"
FT   gene            complement(568960..569925)
FT                   /locus_tag="Sfum_0476"
FT   CDS_pept        complement(568960..569925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0476"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   noc:Noc_0717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16176"
FT                   /db_xref="GOA:A0LFH4"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFH4"
FT                   /protein_id="ABK16176.1"
FT                   /translation="MKNRALLLLQLLIAISLFVSPPAYADEEEDEVFTATLTRYNYRIP
FT                   DLTVVGEPSWCTVKPKDTLLDIARRYGLGYNEVDLLFPRMDAWIPPAGKRIAVPTFWVL
FT                   PPTQHRQLVINVPELRIYFFDKSGNAVQTYPIGIGDEGWESPIGTFSITEKRPNPTWYI
FT                   PASLQEKYGMAQMPPGPENPLGEFMMKFSAGAYGVHGTAMPWGVGRLVSHGCIRCYPEH
FT                   IRILYPQVPVGYKLEMIYEPIKFGQKNGQVFVEAHPDVYRKIPDYIQYGFDKLAQYPLE
FT                   KQVDRKKFTMALTLQNGVPTNVTRLSPDDNSLKLVEFSQE"
FT   sig_peptide     complement(569848..569925)
FT                   /locus_tag="Sfum_0476"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(570049..570765)
FT                   /locus_tag="Sfum_0477"
FT   CDS_pept        complement(570049..570765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0477"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase-like"
FT                   /note="KEGG: mmu:234814 methenyltetrahydrofolate synthetase
FT                   domain containing"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16177"
FT                   /db_xref="GOA:A0LFH5"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFH5"
FT                   /protein_id="ABK16177.1"
FT                   /translation="MHPLDIADIVSRKDQLRTSFLSAGGRSPALPPEGAQGKAAERLRH
FT                   LPRYREAQSVMISPVSSLYQVRLNALTDRKRLVMPTPGLHKGFVVVEPGFIPPRQRHSA
FT                   VQPGPENPFATRMPYREPPGFLIDLIVTEGLMVGRDGGRLGDGSGHLDLQCAILSSLGW
FT                   LHPAFEVVGLVEDCRVVPSVPMKPGDVEIHWIVTPSRMERTPATAQARIGIQWDRLSLK
FT                   QIKRNDALFFLYRARS"
FT   gene            complement(571023..573344)
FT                   /locus_tag="Sfum_0478"
FT   CDS_pept        complement(571023..573344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0478"
FT                   /product="cysteine synthases"
FT                   /note="TIGRFAM: cysteine synthases; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   cysteinyl-tRNA synthetase, class Ia; KEGG: sat:SYN_00075
FT                   cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16178"
FT                   /db_xref="GOA:A0LFH6"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005858"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFH6"
FT                   /protein_id="ABK16178.1"
FT                   /translation="MKTVFSNVLESIGNTPLIRINRLNPNPAVTLYAKLEAKNPGGSIK
FT                   DRTALFMIESAERDGLLTHEKIIIEATSGNTGIGLAIVAAVKGYRLMLAMPETASLERQ
FT                   KILKALGAEILLTPGNLGTDGAIEKVYSLVRENPDRYYMPDQFNNPANPAAHHFGTGPE
FT                   IFEQTEGKVNTVVVTLGTTGTAMGILQAMKERDPAIRVVGVEPYPGHRVQGLKNMKESY
FT                   VPGIFDRHALDQIIHIKDEDAFEMARRLAREEGIFTGMSSGAAMAIAVRVAEEMREGIV
FT                   VAVLPDGGDRYLSTNLFTTLLEPDFHFFNFLERKKVDFKPVVEGKVRICVTGPPLDNPL
FT                   TLGESRRFLLADFLARFLTAKSFSVEQVVQVPDLDSRTIGGSLASRMPLSAYTRQQLDL
FT                   ILEDLDRLAVKRAYRYPRSSEHINAITEDTKTLVNKGLAYDKLRSVYFNLSGSKDYGAL
FT                   SRVNLKKIRIGTTVDLDAYEKLNPRDFALLKRATLAELKRGVCLKTDWGNVIPTWHIAA
FT                   ASVALRELGAPIDIQVSSVDFLFPHLENVREIGHALTGKPFANVWMLSERMWSGADVKR
FT                   EDGLSEETPIRELNKLGYSPIEVRYWLLSNHYRKPIHVTPENIDNARRGYHRLREFIHR
FT                   VQHARTASQDHKLLPEMIYALEQGFFDALADDLNVPRAFACLFRFIRQFNPILDREEFS
FT                   EAQRRQITDVFYKINGIMGIFDLELQPLSEDDQELIHRREKARGSGEWDTADRIRETLL
FT                   QRGLKVIDTPLGTRWERVEH"
FT   gene            573770..576496
FT                   /locus_tag="Sfum_0479"
FT   CDS_pept        573770..576496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0479"
FT                   /product="ATP-dependent nuclease subunit B-like"
FT                   /note="KEGG: pca:Pcar_1709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16179"
FT                   /db_xref="GOA:A0LFH7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFH7"
FT                   /protein_id="ABK16179.1"
FT                   /translation="MTNLEYQEKLLDLITDGHTVLSETERFANQLRLRARGRYRRQGAP
FT                   GWDGVAVGTFNAWAMDCWEDSWPNEWPASDFTRWRLIREILRHNPPPEPLLPDLPLVVA
FT                   VDESFAGCLRYGIDPGEGDPANRLVEWRRGVWKEYRDALRALLLFHPASLPERLGSFLS
FT                   LNPDAVPSKTVIAGFEFAGYWEKKLFSRLADTHGALALPLPQVKAKPRAVVYADREQEV
FT                   FGLLGDLIRGAGEGRLHELAVVLLDRGTYAPILSQHLKDLLGAQLEGENAAYNLLAGDV
FT                   LTSQSLWRAALLPLDFCLGGESGTQLFSLLRSPYYGYFGARGRALAQWDRVWREQGIEK
FT                   GLTALLGSLGGREDVLPRRGAELTEGLGALTDRGTRAASEWSAGLRSFWKQMEFPVIAN
FT                   ERDRIAWQRLTGLLDGFDAELGDSSMRAAEFAAWLTAAGEKAPVQPSGFEDAGIQVIGE
FT                   LELRGLAFKRLFVPGFLSGVIPQPARSLPFLSVRERRLVLGGTAESQFEFAAHLFGQVQ
FT                   AAARETVVSRPLLGEGGEPCLPSPFWPASEETMAPVIPWRHDLPVMQRARWVRDGIEGI
FT                   AAAMERKEPAGKTHAGGESAPDLYRAERLRFPSEVSVSELELLLACAGRFFLRVILGLE
FT                   ALPVPTRGLDAAVRGRKIHALLAGFGRRLRGIPGGHEREPEALCRLLDEMVRKDIEEQA
FT                   RVAHWRVELARLLGGAEGAPGLLKEWLALECSRFGEGWRWTAFEPSFDNLKLRDCPVGI
FT                   KGRLDRLDLHSELGCICWDYKTGAAPGMKEVLEDFKAPQLPVYLLAVRKGLVPAIGDRR
FT                   VTLAAGYIALQSVRKLNHCLVIGADERMESFLSQWESVLAEKIDAARRGQLAPLWVLQP
FT                   CEERCDYECLCGELLFAGPEAASGCAAPGNPVERGRG"
FT   gene            576595..577149
FT                   /locus_tag="Sfum_0480"
FT   CDS_pept        576595..577149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0480"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: hch:HCH_10012
FT                   ADP-ribose pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16180"
FT                   /db_xref="GOA:A0LFH8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR029401"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFH8"
FT                   /protein_id="ABK16180.1"
FT                   /translation="MSCRETEKECGAALKGKHWEPRYCAYCGKVLGIRLEGAHPRLHCS
FT                   SCNVIHYRNPTVGVAVILVEEGRLLLVKRSGTYEGMWCIPCGHVEWHEDVRRAAEREFF
FT                   EETGLRVKAGKVFEVHSNFHDPRHHTVGVWFLGTRCEGTLRPGSDASDARFFALDELPE
FT                   DLAFPTDRLVCEKLRELHGAP"
FT   gene            577760..579112
FT                   /locus_tag="Sfum_0481"
FT   CDS_pept        577760..579112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0481"
FT                   /product="phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase C
FT                   terminal; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III; KEGG: sat:SYN_00938
FT                   phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16181"
FT                   /db_xref="GOA:A0LFH9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFH9"
FT                   /protein_id="ABK16181.1"
FT                   /translation="MDPNVFREYDIRGIVGSEIRDRDVYLLGKTFGTYMVRQGKSRVVV
FT                   GRDCRLSSDRFRDLLVEGMLETELDIVDLGVCPTPLLYFALHHLKREGGVMITASHNPP
FT                   EYNGFKICNGVDTISGAEIQRIRELMESRDFAGGRGEIRQFAIQEPYIDYVLQSVRPKR
FT                   SLRIGLDAGNATGGPVALPLLRDLGCRVYPLYCEMDGTFPNHEPDPTVMENMRDIQELV
FT                   VKENLDVGIALDGDCDRLGVIDHRGEVVFGDKLMILFAREILSRRPGSLFISEVKCSKT
FT                   LYDDIERNGGRAIMWKAGHSLIKAKMREVDAVLAGEMSGHVFFKDRYFGFDDGIYSACR
FT                   LIEILAATGKTIPELLEGVPPTFSTPEIRIPCPDDIKFEVVEQARRSFAEKQFRIIDVD
FT                   GARIVFPDGWGLVRASNTQPVLVLRYEADSPERLDAIRNLVEGTLHAIMNR"
FT   gene            579415..579723
FT                   /locus_tag="Sfum_0482"
FT   CDS_pept        579415..579723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_2360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16182"
FT                   /db_xref="GOA:A0LFI0"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFI0"
FT                   /protein_id="ABK16182.1"
FT                   /translation="MPDFGTAFSGLALEKRKLTHEELIRAIRFMVAAEYEAVQLYVQLA
FT                   ESIDNELAATVLRDIAEEEIVHAGEFLRLLKELAPEEEGFYKKGAEEVEEMIRELKK"
FT   gene            complement(579917..580696)
FT                   /locus_tag="Sfum_0483"
FT   CDS_pept        complement(579917..580696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0483"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /EC_number="4.1.3.-"
FT                   /note="TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit; PFAM: histidine biosynthesis; KEGG:
FT                   sat:SYN_01684 imidazole glycerol phosphate synthase,
FT                   cyclase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16183"
FT                   /db_xref="GOA:A0LFI1"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LFI1"
FT                   /protein_id="ABK16183.1"
FT                   /translation="MLSKRIIPCLDVRDGRTTKGIKFRNNVDIGDPVDMGRFYYEEGAD
FT                   EIVFYDITASSDRRGIMLDVVKRVAETIFIPFSVGGGIRTLEDMRDVLLAGAEKVSVNS
FT                   AAVLNPDIISQGAEAFGSQCIVLGMDVKHVAPSTRIPSGYEIVINGGRTTTGFDALWWA
FT                   LEAERLGAGEICLNSIDADGTRDGYELRLTRLISTSVRIPVIASGGAGTPNHLADVLKQ
FT                   GRADAALIASMVHYGTYSIRRIKQFLDDNGIRVRKTW"
FT   gene            complement(580709..581347)
FT                   /locus_tag="Sfum_0484"
FT   CDS_pept        complement(580709..581347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0484"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisH"
FT                   /EC_number="2.4.2.-"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: sat:SYN_01683 imidazole
FT                   glycerol phosphate synthase, glutamine amidotransferase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16184"
FT                   /db_xref="GOA:A0LFI2"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFI2"
FT                   /protein_id="ABK16184.1"
FT                   /translation="MIAILDYRAGNLTSVERALNFLGFPCRITHSHDEIRDADRIIFPG
FT                   VGAAGKSMADLRELGLDELLRERRSSGIPILGICVGMQVLFDHSEENDTVCLGILPGAV
FT                   RRFPNDLTDTKGERLKIPHMGWNSVAFDKAHPVFADVREGNEFYFVHAYFPDPRDSDHI
FT                   VGRTLYGIRFASAVAHDSLVAVQFHPEKSGPPGLRILANFCRWDGRVSR"
FT   gene            581592..584186
FT                   /locus_tag="Sfum_0485"
FT   CDS_pept        581592..584186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0485"
FT                   /product="metal dependent phosphohydrolase"
FT                   /EC_number="2.7.7.59"
FT                   /note="PFAM: amino acid-binding ACT domain protein;
FT                   metal-dependent phosphohydrolase, HD sub domain; GlnD
FT                   PII-uridylyltransferase; KEGG: pca:Pcar_1512 protein-P-II
FT                   uridylyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16185"
FT                   /db_xref="GOA:A0LFI3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFI3"
FT                   /protein_id="ABK16185.1"
FT                   /translation="MHSISESLRKQREQVLSDSSEDALIRHTSLLEIAIISLYNRLVNR
FT                   LSQDTEHFRSSAAVIGLDGFARGVIGPGQPVRILFLMTDSALWNASWLDEITVPLTEAG
FT                   WTVDLRRETIDSLMIALEGDFEAFLELLEMRYVSGNRQLLEQAEKGIEGFIEARREELL
FT                   SRLYGTVKAREGRLQKPESWLEPDLQDNPGALSDIVAIRLACRIASNIRSLDDAIFMGY
FT                   LVRREVDFIRHAEKSYMRLLGLLRSLSDKSSGVLHFDEQGLLADKLGYAERAGYLPVES
FT                   LMQEVFQLFHGVGVVSAEFWERLRESRENLPAAGEMRGEPLEEGLFVLNGKIHIQTDRY
FT                   PATPGHLVHLFRLAAEGGLGFANVTRQWVHHHRNALNSSSGDPLVKEELFALIRADSED
FT                   LPAFRRFCDNGLFTALIPELAAVYGLAQHDAFHLYPIHEHHLRTLSELKKIRAGFYSAA
FT                   EPELTQIARGIEDPVWLYLAGLLHDIGKSSGRGHAAKGGEMIPAIARRLGLEPEETSKV
FT                   RFLVAQHLLLMDSASLRDLADQEMLAGCAAAVGSSELLDLLVLLSYADMLSTGPKARQK
FT                   WRDTPVLALYNSIRHLLEKGEPSARAITERIERLRNQVRNEVLDLVDEAQLDSYFSQLV
FT                   PRYLLSMQPKAVARHLRMWRHLQSSDTPFVWEVESSGDTAEITIVSWEKPGLLSRCAGL
FT                   LTLHSMNILGAQVFTMHNGLILLIFQCRLPGGAGGGMDWNAVRLDVERLLLGKMALDYR
FT                   IAEHARRRPASQVPMRTAPSQVLVDNQSSAMYTILEVYTVDRVGLLYTIGRTLFELQIR
FT                   ISVAKITTKIDQVADVFYVRTHQGEKVSDPEQIDELKRALLFWLDGPAEMPA"
FT   gene            complement(584459..585718)
FT                   /locus_tag="Sfum_0486"
FT   CDS_pept        complement(584459..585718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0486"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Peptidoglycan-binding LysM; Lytic
FT                   transglycosylase, catalytic; KEGG: bth:BT4487 putative
FT                   membrane-bound lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16186"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFI4"
FT                   /protein_id="ABK16186.1"
FT                   /translation="MLNRIGFRGVAPAVLGILLSIVCSGCTTTPQPSPSVSPQPQPPAA
FT                   REPVHVAPQAAPVSCAATFPYYPPPDRLDLCGEPVPLQHDSVRERFDREFTTVVYNHAQ
FT                   VYLWLKRMDRYFPQIEERLKSMGLPDDLKYVAIVESDLVPNVVSPKGAAGPWQFMPATG
FT                   SAYGLHQQGSIDKRYDFERSTISAFRYLSDLNRKYNNWALAIAAYNCGEKRILDESRAQ
FT                   GTRDYYHLKLPTETERYVMRILAVKAVLGNPTRYGYCLPKGMGYGELKVDRVTMNLSCS
FT                   TPIQTVAACAGTTYREFKRLNPEFRAEVIPSGCHEVKFPAGCGPAFEQNFSASRASMSS
FT                   SVPEPSSDEAPREPAQVRQPKPSPLKAKSRQPAETFHTVRKGDTLFSIARHYRVNAQDI
FT                   KKANRLRGNDIVPGQKLKIP"
FT   sig_peptide     complement(585641..585718)
FT                   /locus_tag="Sfum_0486"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.784) with cleavage site probability 0.543 at
FT                   residue 26"
FT   gene            586346..586741
FT                   /locus_tag="Sfum_0487"
FT   CDS_pept        586346..586741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0487"
FT                   /product="membrane protein of unknown function"
FT                   /note="PFAM: membrane protein of unknown function; KEGG:
FT                   sat:SYN_01406 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16187"
FT                   /db_xref="GOA:A0LFI5"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFI5"
FT                   /protein_id="ABK16187.1"
FT                   /translation="MRGLVLRWLVVTFAIVCASYLIEGIRVSGFFSALFAAATLGVLNV
FT                   FLRPLILILTLPINVLTFGLFTFVINALMLKMASSVIPGFHVEGFWAAVFGALVISVVG
FT                   WVLSAFIDDRESGGIIDLKKKDGNRWG"
FT   gene            586778..587743
FT                   /locus_tag="Sfum_0488"
FT   CDS_pept        586778..587743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0488"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: dps:DP0453
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16188"
FT                   /db_xref="GOA:A0LFI6"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFI6"
FT                   /protein_id="ABK16188.1"
FT                   /translation="MPLIDPSSYVPPALFSNGHIQTIFPALLRKVDGVFYHRERIATPD
FT                   EDFLDLDWSRMGARRLGVVCHGLEGDSTRAYVMGMVRALNGAGWDALAWNYRGCSGEIN
FT                   RRLRFYHSGETGDLGTVIAHAVASGVYEKVALIGFSAGGNIVLKYLGEKGESLAMPVCG
FT                   AAAFSVPCDLGASARRLADPGNRFYLRRFLKLLHEKIRRKMELMPGEIDDRDYDRIKTF
FT                   KEFDDRYTARLFGFKDAEDYWRRASCKPYLERIRVPALLVNALDDPFLTPECRPVEQAR
FT                   RSPFFFLELPGSGGHVGFVSFARDGRYWSERRAVEFLDAM"
FT   gene            587952..588851
FT                   /locus_tag="Sfum_0489"
FT   CDS_pept        587952..588851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0489"
FT                   /product="N-acetylglucosamine kinase"
FT                   /EC_number="2.7.1.59"
FT                   /note="PFAM: ROK family protein; KEGG: mca:MCA0661 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16189"
FT                   /db_xref="GOA:A0LFI7"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFI7"
FT                   /protein_id="ABK16189.1"
FT                   /translation="MLRLGVDLGGTKIEIIALDDGGNELARFREATPRGDYRSTLEAVA
FT                   RLVSKVEAELGGERGSVGIGTPGAVSRATGLLRNSNSVCLNGKPIARDLEAVLGRPVRI
FT                   ANDANCFALSEYRDGAARGARVVFGAIVGTGTGAGIVVGGEVLEGVNAIAGEWGHNPLP
FT                   WPKDDERPGPRCYCGRYGCIETFLSGPGMAALHALSTGDRLPPEEIVARADEGDPSCEH
FT                   TLLRYEDRMARSLAHVINILDPDVIVLGGGMSNIRRLYRNVPRLWGAYVFSDRVDTRLV
FT                   PPRFGDSSGVRGAAWLWG"
FT   gene            588908..589438
FT                   /locus_tag="Sfum_0490"
FT   CDS_pept        588908..589438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0490"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: helix-turn-helix domain protein; bacteriophage
FT                   CI repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16190"
FT                   /db_xref="GOA:A0LFI8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFI8"
FT                   /protein_id="ABK16190.1"
FT                   /translation="MSGLRDFRRKGIGCGSVSFDPRGAHPSVHICLSGRNESCIFSHFC
FT                   NDRPAVTPSEGTYQENDVKAYGWFKEMRDEARDSFEFKLAALKIEVTERILEAMERRSM
FT                   NRKQLADSLGVSKASVSRLLNNGSNATLKTLLQIAEALDCDLSIGIRRRAAARDSGKTE
FT                   EEDPEKMKKAAAR"
FT   gene            589779..590630
FT                   /locus_tag="Sfum_0491"
FT   CDS_pept        589779..590630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0491"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; PFAM: Gram-negative
FT                   tonB protein; KEGG: pca:Pcar_0453 periplasmic protein TonB
FT                   links inner and outer membranes-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16191"
FT                   /db_xref="GOA:A0LFI9"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFI9"
FT                   /protein_id="ABK16191.1"
FT                   /translation="MRLWQNLTISILGHLGVACVLWATPLAIYRPPPWMEVRLISPADF
FT                   HGRAEIPCDGNGAGEGGPAADDNIHAAPKEVCAVKQLPPPEQRPEEPKLEPPVRNRSVK
FT                   KEKPPAKPKGASRVVPLAAIRADAQRPADPAESSAGEGAAAAGSHASIGPGTFASGTPS
FT                   GGSVDAGAGAGSLSPGGPGEGVVDARFGAANGPRFHRLVKPRYPSVARQLGKEGTVVLR
FT                   VTIDEKGRAIHVEVLTRAGSGFEEEAILAVRESTFTPARLNGHAVKSRAVLPIRFALTN
FT                   SG"
FT   gene            591607..593895
FT                   /locus_tag="Sfum_0492"
FT   CDS_pept        591607..593895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0492"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug; KEGG: dar:Daro_4029 TonB-dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16192"
FT                   /db_xref="GOA:A0LFJ0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFJ0"
FT                   /protein_id="ABK16192.1"
FT                   /translation="MFLLLLPGLLLPAVAVAADAAEKVAPAESRTGSSEIGYTAAEGAP
FT                   APGHADETAKKDHPLDPIVVTATRTEKSIVDVPAATSVVTREDIESRNIQKVDEAMNLV
FT                   PGLFDKRAKGLDTTGRVTLRGLPDQKRTLVLLDGQPLNNGYTGHVDWNSINPEDVQQIE
FT                   VARGPFSSLYGGNAMGGVVNIITRMPEKREFTVKGGYGSDNYWSTYGSYGDKLFDRLRL
FT                   LASFGYKSSDGYPSGLVVKKPSGSGGTPARGAVPTTDTYGNPAFIIGDTGDNSWWTQSG
FT                   GLKLSYDVCEEAKVFFSYRNNQYGYGYDNPNSYLTNAMGDTIWSGPVNFRGNTLSFTEG
FT                   SFLSGGGGILQNLYNGGLETRLFGDSVLKLSGGLIDMPTNWYVTPSSSTATRSGGPGTI
FT                   SETPTRAYHADAQLSIPVLEKHMLIVGTAFRHDEANNQEHALTDWTDTGSKADLTYEAK
FT                   GADNIFSFYSQAEIALFRDVTLYAGLRGDYWETFDGMADQVGVAGYPQYYDSKGEFSVN
FT                   PKGSVVYKPLDGTTFRASVGTAFRPPNVYELYRTWVTSYGTVYQGNPKLDPESSFSWDI
FT                   GVEQKIGQSTVLKLTYFNNTIDDFIYFRTVTPTLLVQTNAGKAETDGFELEAETRPWEC
FT                   LKLFTSFTYTHSEMLDNPANPLTEGKQLPGVPRYMFSAGGEVKYRRLSFTAIGRYVSKQ
FT                   YSSDQNLDTVSGVYGSYDAYFVGEFAARYKLTDWATIDFAVNNIFDNNYYSYYKAPGRQ
FT                   FFGGVTARF"
FT   sig_peptide     591607..591669
FT                   /locus_tag="Sfum_0492"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.588 at
FT                   residue 21"
FT   gene            593895..594866
FT                   /locus_tag="Sfum_0493"
FT   CDS_pept        593895..594866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0493"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   hac:Hac_1669 iron(III) ABC transporter, periplasmic
FT                   iron-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16193"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFJ1"
FT                   /protein_id="ABK16193.1"
FT                   /translation="MAAILVWFQLVLFVAAGAAPALAHALTLKDAAGKDVEIALPVRRV
FT                   VFLSLYDLIPVFGIWDRAAGINRWAFDSAVLKGFPELKACTSVGTGDSVNVETLLSLHP
FT                   DLVITWSYKPEVTAFLVERGLKVISVWPESLRELYQVIDLYGRIFQKEDRAREVRSLME
FT                   NSLAATASKVSKVAPEKRPKVLWVWTKPTTVSGGIGLQQDLIRLIGAVNPAEHIPSKQA
FT                   DVSLEWIVAWDPDVIFIWGSARYGPGDLASNRQWKSVKAVRNGRVYKAPALSTWSPAVS
FT                   TLALWMAYKAHPGCFDSREALEAIREFHMKCFGVPLEGLALD"
FT   sig_peptide     593895..593966
FT                   /locus_tag="Sfum_0493"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.694 at
FT                   residue 24"
FT   gene            594872..595882
FT                   /locus_tag="Sfum_0494"
FT   CDS_pept        594872..595882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0494"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; KEGG: mac:MA4605 iron(III) ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16194"
FT                   /db_xref="GOA:A0LFJ2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFJ2"
FT                   /protein_id="ABK16194.1"
FT                   /translation="MGFVNRKWLKFSLGISPLLFGGLSLFWGAYGISPLLTAKILLSKV
FT                   FFFDATPAPELSIVWEIRLPRVVLSGVVGAALSGAGVTLQGIFRNPLVDPFILGLSSGA
FT                   AFGCALSVAVFPQFPIQVAAFLFSLVASFSTYMLARTQGEVSRLHLVLSGIVVSAFFSA
FT                   LVSILKFLVDPHKLVSIVYWLLGSFSLADWRAVGVVSLSMLAVSFPLILMRWRLNALSM
FT                   GEDEARALGIPVERDRLLFIGAASLAVGSAVSVSGIIGWVGLMVPHLTRMLVGPDHRVL
FT                   VPFSLAVGAAFMIFADTLARNLTAFDLPVGIITTLSGTPFFVYLMKRGAKESWGK"
FT   sig_peptide     594872..594988
FT                   /locus_tag="Sfum_0494"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.865) with cleavage site probability 0.575 at
FT                   residue 39"
FT   gene            595879..596649
FT                   /locus_tag="Sfum_0495"
FT   CDS_pept        595879..596649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0495"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cac:CAC1989 ABC-type iron (III) transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16195"
FT                   /db_xref="GOA:A0LFJ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFJ3"
FT                   /protein_id="ABK16195.1"
FT                   /translation="MIEVRGVTFSHNGSRETVLREIDFLARGGEITAVLGPNGSGKTTL
FT                   FQCLLGIWKFQKGDVLFEGESMKHLKRVEIARRISSVPQEHEPPFPYTCFDIVLMGRTA
FT                   HVDVFSSPGEKDSDLAHEAMEALGIRHLASRPYTRVSGGERQMVLVARCLAQNAPVMLL
FT                   DEPSAHLDFRNQNLILAKVKQIVRERGLTVIMNLHDPNMALMFSDQVLLLKQGRLIAHG
FT                   TPDDAITRKNLWDVYGLEVEFLTGSGLRMICPRI"
FT   gene            596686..600498
FT                   /locus_tag="Sfum_0496"
FT   CDS_pept        596686..600498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0496"
FT                   /product="hydrogenobyrinic acid a,c-diamide
FT                   cobaltochelatase"
FT                   /EC_number="6.6.1.2"
FT                   /note="PFAM: CobN/magnesium chelatase; KEGG: mac:MA0872
FT                   cobN/magnesium chelatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16196"
FT                   /db_xref="GOA:A0LFJ4"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFJ4"
FT                   /protein_id="ABK16196.1"
FT                   /translation="MKLLSIMWSNYVPLLKQAAAETGTFDLRAYSNKQLNLDPLKLREC
FT                   RKEVKSADLILFYRTTESFWDELEDELKDCRGRIPVVTVGPDIASWKLSNVNPEIVANV
FT                   YRYLLFNGGDNFREMLKYLAAAVFSIEIPYDPPKETAWEGIFHPQWGGPFDTTREYLEI
FT                   YPHKDRPLVGVLFSRSNWVSGNLEVESRTIAAIEEQGLGVLPVFFYSVKDTNLGNLGGE
FT                   DVVRGFLLAEDGSPLVEAVVKLTVFFLGQKKGNSSESQAESGVGLLKALNVPLVNPVIS
FT                   YYKDRTQWLDDPAGLGQQVAWSIALPEFEGVVEPLVVGASKGVSNPEEEMYEAIPDRID
FT                   RLARRISRWVRLRRTPNRLKKIAFILHNNPCASVEATVGGGAHLDTLESVARVLRRMKD
FT                   EGYAVTPPENGKALIDEILERKAISEFRWTTTGEIAARGGCLAQLDVAGYSRWFDELPE
FT                   ATRNRMIEAWGRPPGEEKDGVPAAMVHEGKILVTGVRYGNAVVCVQPKRGCAGARCDGQ
FT                   VCRILHDPNVPPPHQYVATYKWLSRDFGADAIVHVGTHGNLEFLPGKGTGLSSGCFPDI
FT                   GIDEMPNLYIYNADNPPEGTTAKRRSCAVLVDHMQAVMVRGELYGDLDELERLMSEYDK
FT                   IKLVEPGKAHTLRHMIEARLEAGNLLQGMKIDHDAPFDEVLKAAHEALSLLKNTYIPKG
FT                   MHVFGSIPEGERLSEFIYAVVRYENTPESLRGVVKSLMERDEGFRALDETAGKNLVDEK
FT                   AQAICTAYLEGEAPLAHIMQSHFDDISRFESAIACVQEKIDDVRKRVALTDEMSALLNG
FT                   AAGGYVPPGPSGIVTRGRPDILPTGRNFYSLDPHKVPSRAGWEVGVQLAGLTIEKFLNE
FT                   EGKYPENIAFYWQCTDIMWSDGEGMAQMMYLLGVRPVWQANGKVSGFEIIPLEELKRPR
FT                   IDITVRVSGITRDNFASVIELIDEAVQAVAALDEPPDRNFVRRHLLAHMEESGAAEDEA
FT                   EAFRKGTFRLFSSMPGVYQAGTQLAVYASAWKDEKDLCDVFLYWNGYAYGKGVFGEPAH
FT                   RHLSRSLETVELTFAKTVTDEYDLLGCCCHFGTHGGLINAAKVVSGRDIKTYYGDTREM
FT                   GEVRVRDLADEIRRIVRTKLLNPKWIEGMKEHGYKGAGEIGKRVGRVYGWEATSREVDD
FT                   WIFDDIARTFLMDEGNRKFFEENNPYALEETARRLIEAAERGLWAPSADVRDALKEIYV
FT                   EIEGWIEEKTGEMEGDFQGGSIDIITSREVESWKGKMDETLGRKG"
FT   gene            600502..601542
FT                   /locus_tag="Sfum_0497"
FT   CDS_pept        600502..601542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0497"
FT                   /product="protoporphyrin IX magnesium-chelatase"
FT                   /EC_number="6.6.1.1"
FT                   /note="SMART: AAA ATPase; KEGG: mja:MJ0911
FT                   magnesium-chelatase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16197"
FT                   /db_xref="GOA:A0LFJ5"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFJ5"
FT                   /protein_id="ABK16197.1"
FT                   /translation="MIFPFTAIVGQDQMKLGLILNVIDPTIGGLLIMGEKGTGKSTAVR
FT                   ALADLLPEIAVSRGCAFNCDPDGKNLCTSCVEKASPGRPLESETRKMKVIELPLGITED
FT                   RLVGTLDIEHALKHGAKRFEPGILADANRNFLYVDEVNLLEDHIIDLLLDSAAMGRNFV
FT                   EREGVSFTHPARFILVGTMNPEEGDLRPQLLDRFGLCVYVRSIREREPRMEILRRRFEF
FT                   DADPAAFLEKIEPDQRSLSERIVRARRNLQDIKMPDEILEKVVGVTSAVHVDGHRSDIV
FT                   ILRGARALAALKGRERIEMEDIKDIVRPALNHRLKRAPFEEIGSGASKMEAVIEQLGRS
FT                   DGAAIS"
FT   gene            601631..603469
FT                   /locus_tag="Sfum_0498"
FT   CDS_pept        601631..603469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0498"
FT                   /product="protoporphyrin IX magnesium-chelatase"
FT                   /EC_number="6.6.1.1"
FT                   /note="KEGG: cte:CT0420 magnesium-chelatase, subunit D/I
FT                   family; PFAM: ATPase associated with various cellular
FT                   activities, AAA_5; SMART: von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16198"
FT                   /db_xref="GOA:A0LFJ6"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFJ6"
FT                   /protein_id="ABK16198.1"
FT                   /translation="MMSFARIVSHARAKLALILNLIDPGIGGVLFLGHKGTGKSTLARS
FT                   ARNLLPEGAPFVEVPLNVTEDALLGGIDLEEAVRTGERSMRAGLLQRSLGGVLHIDDVN
FT                   LLNQDLLSLILNNREGDGIVGAIEEGSISRRLCLFAGMNPEEGAVSAATIDHFGLCAVF
FT                   ETPEKQGTKTRALAHNCPDEALDLRLRRIEAKVKKRIERARGLLERVAVPSQMRALAVE
FT                   ACIEAGIEGHRGDIALLRAARAYAAFCGARALSAKHVKRVVPLALIHRRRSAAPPREEE
FT                   MREQQSQIPRAEEREQAGDSSRGGAEAREAPADGDGSQAHSSPKSREGHSREEVFPVGD
FT                   SFKVKRMRFAKDRIERNASGRRTNTRFSGKAGRYVGSILRAKKLDVAVDATLRAAAPWQ
FT                   ILRGRTGNLIVSREDLRFKRREKKMGHLVVFAVDCSGSMGARRRMIETKGAVLSMLTDC
FT                   YHKRDKVSLIAFRKDGAEVVLPPTSSVELASRRLAEIPVGGKTPLPAALVAIYNLIRRV
FT                   LIKEPALRIVAAVVSDGRANQGITGIPVPEEVERCAGLLKGMKNTDFIVVDTEDKSGIM
FT                   RLDLAQRLAVSLDADYFTCDTLKAEILAELVSRRKN"
FT   gene            603884..604267
FT                   /locus_tag="Sfum_0499"
FT   CDS_pept        603884..604267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16199"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFJ7"
FT                   /protein_id="ABK16199.1"
FT                   /translation="MPTIVQPGIPAPGRNRSVAMARFWAHLKRHNPAMRIKSRQNPALS
FT                   GHKVWRDSREDANRLGKSKDRAHAKSSLTQRRDDGRRSAHTFAKRKGAGDSGACPLPFR
FT                   TCMKTPDKGVTPTSGLQLEIDPA"
FT   gene            complement(604271..605011)
FT                   /locus_tag="Sfum_0500"
FT   CDS_pept        complement(604271..605011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0500"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="PFAM: nucleoside diphosphate kinase; KEGG:
FT                   tko:TK1307 nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16200"
FT                   /db_xref="GOA:A0LFJ8"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFJ8"
FT                   /protein_id="ABK16200.1"
FT                   /translation="MRDDLQQTLVLIKPDALKNSLTGYVLSQFSEFHTGLTFAGTKVVH
FT                   VTRMLAEEHYAEHRGKVFFPALIEMITGHLHYPGEPDKQRVIAIVYKGPDVIRKVREIC
FT                   GPTNPHVARDEKPGCVRSLGTVVALKDAQGNIVGDRMDNLIHASATPEEAEREIKLWFR
FT                   PDDIPPAIRAFPTVHSEACFYYKDGRLFENYEPGTVCVLAPGDVAWESDLNTLKAFAEG
FT                   IPTDSSLQGVVAKYLLNRKVSLSW"
FT   gene            complement(605387..606016)
FT                   /locus_tag="Sfum_0501"
FT   CDS_pept        complement(605387..606016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0501"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: sma:SAV3523 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16201"
FT                   /db_xref="GOA:A0LFJ9"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFJ9"
FT                   /protein_id="ABK16201.1"
FT                   /translation="MSLVLFLGIVALAWTRQWRTASIWSDYPVNADNVFVGLYILWLLV
FT                   ETPVAGRDADSEGKKTSDSATCLVYGTAQALTFLSALWFPSVWHSPNIAHFFGMGLFAA
FT                   GGCCRLWAIRTLGKFYSHLVRTIPRHTIVDSGPYRFVRHPAYAGMLIANAGICIAFLNA
FT                   VTLCIFLFALVPAILLRIRIEERVLFAIEGYSHFAQNRKRLFPGIW"
FT   gene            complement(606249..608111)
FT                   /locus_tag="Sfum_0502"
FT   CDS_pept        complement(606249..608111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0502"
FT                   /product="ATP-dependent DNA helicase, Rep family"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: tte:TTE0604
FT                   Superfamily I DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16202"
FT                   /db_xref="GOA:A0LFK0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFK0"
FT                   /protein_id="ABK16202.1"
FT                   /translation="MSMQSLSPVQMEAVSHVETPAIVTAGAGSGKTRTLTNKIAYLVNN
FT                   LHYDPERILAITFTNKAADEMKSRLEKITGRSAGDFPWVRTFHSACFKILKVHCELLGY
FT                   RKPLLIHDASQQKAHLKKVLAELNLDRHYLFAAASLISKAKNSADPVLYLASNGRVPRR
FT                   KEAYRIYNEMLAQSNSVDFDDILLLTRDLLQKYPEIRKAYRNRFDYILVDEFQDSNEIQ
FT                   NQIIDLLLKDGRLTVVGDDYQSIYQFRGANPFHFINFPQKYAKARVFRLEENFRSTRQI
FT                   VTASDRLIAHNLQRIEKQCFSRRDGQPVTVETFYNEQMEAEWVADRCRELLNDENIPYR
FT                   EIAILYRTKFTSLPFERALRSAGVPYTMVGAQGFFQRREVQDINAYLICAVNPSDDISF
FT                   ERIVNVPRRGIGPGALKKIFGCKERNMSLRDAARKAIDGRLIPKKAAAELDKLLSLLES
FT                   IAEEKPDAAMHRVMKETDYFAHLSTLSDDGDDLETRLENIKSMIYDAAGKASIPEYLED
FT                   AALIRDDQDETDNGNGVRLSTIHAAKGLEFKAVFVVAVEEGILPHRKSIETESEIELER
FT                   GMEEERRLMYVAMTRASELLSLSAAATRRGELARPSPFLAETGL"
FT   gene            608391..609416
FT                   /locus_tag="Sfum_0503"
FT   CDS_pept        608391..609416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0503"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddi:DDB0188529 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16203"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFK1"
FT                   /protein_id="ABK16203.1"
FT                   /translation="MKKTLFALVALAVIVVGCGEPALAKGGGKGGGKGAGGAAAPRAAK
FT                   YRPPQPAVSLGSAGFASQYGPVTSYYGSLASQYGSLLSQYGPSIGQTGSSPLQGTSTTG
FT                   TGQGTPIFGQSDVFASTTPGAIPGAPDILSGLSMGLDSGLADLILSGLQGTATAGRPSS
FT                   SRFQLPTAVQILPPTTPGSAAVGQYTYDLSLALAAPQLTSISAFPGQYGTLPLQTGMAA
FT                   LSYGPQAGAYGFVPVTGALGGTAGQYGYFAGQYDMTSSLQDQSTQVALSSAAVTAILDA
FT                   LSSRLRTSSGLPGSTLTGTGIGRFSGSIPGMAAPVGGMPSTLSQFQAAPGMGSPLRMGP
FT                   P"
FT   sig_peptide     608391..608465
FT                   /locus_tag="Sfum_0503"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 25"
FT   gene            complement(609455..610006)
FT                   /locus_tag="Sfum_0504"
FT   CDS_pept        complement(609455..610006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0504"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="KEGG: pca:Pcar_2317 transcriptional regulator, MucR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16204"
FT                   /db_xref="GOA:A0LFK2"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFK2"
FT                   /protein_id="ABK16204.1"
FT                   /translation="MTKKLLDIAAEIIQAQASVGQMTPTQIEEALIKTFSTLQKMQKAE
FT                   EKGLFLDVAAIGEGVALEGGASLKQDPKSSIQDDKITCLECGTQMRQLTARHLSAHGLT
FT                   PREYKKKWGFSFKQPLSAKSLTKARSKAAKKRGLPENLVKFLEQKKQEKAMAEQASATT
FT                   ESGTGSSPKPMTKRRPAKQV"
FT   gene            complement(611359..611754)
FT                   /locus_tag="Sfum_0505"
FT   CDS_pept        complement(611359..611754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16205"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFK3"
FT                   /protein_id="ABK16205.1"
FT                   /translation="MNYNRQVIKLIKAMGMWTVPTIKSERRGMKRLIAAVFIPVLLAVG
FT                   CAPVEWVKPGATHAEFERDRIACERESGLTSSGAFRPLEEPRNTGMSMKHIGLNEQKFE
FT                   MCMKARGWRKSADRIPETLKLESAARQ"
FT   gene            complement(611847..612143)
FT                   /locus_tag="Sfum_0506"
FT   CDS_pept        complement(611847..612143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0506"
FT                   /product="putative protein-S-isoprenylcysteine
FT                   methyltransferase-like"
FT                   /note="KEGG: bur:Bcep18194_B2540 putative
FT                   protein-S-isoprenylcysteine methyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16206"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFK4"
FT                   /protein_id="ABK16206.1"
FT                   /translation="MLLFARLSLGRSIGFVPAQRVIVTGGAYRIVRHPIYTGIFLSFIA
FT                   WTLRDYSPRVLAISVIGCGLFVLKSFIEERFLREDPEYRDYLTRVRWRWFPGI"
FT   gene            613025..613288
FT                   /locus_tag="Sfum_0507"
FT   CDS_pept        613025..613288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16207"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFK5"
FT                   /protein_id="ABK16207.1"
FT                   /translation="MKRILLVLAVLAGVMGCATMPDQNWLYGDPYSGLLQVEPRAEVQF
FT                   LFSNPNYGTSLFALDVDEKFQLGRIGRNSINGGIGMMGIYRF"
FT   sig_peptide     613025..613084
FT                   /locus_tag="Sfum_0507"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.975) with cleavage site probability 0.294 at
FT                   residue 20"
FT   gene            complement(613722..613985)
FT                   /locus_tag="Sfum_0508"
FT   CDS_pept        complement(613722..613985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16208"
FT                   /db_xref="InterPro:IPR011467"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFK6"
FT                   /protein_id="ABK16208.1"
FT                   /translation="MIRSFGMKPWLIAVLLAAFLNGSGLCAVENPGPALLLCSEPQAGP
FT                   CAELLETTHDFGKITLGDVLEHEFKVGNPGNDTLVIENVRVG"
FT   sig_peptide     complement(613902..613985)
FT                   /locus_tag="Sfum_0508"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.944 at
FT                   residue 28"
FT   gene            complement(614093..614797)
FT                   /locus_tag="Sfum_0509"
FT   CDS_pept        complement(614093..614797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0509"
FT                   /product="vanX D-Ala-D-Ala dipeptidase. Metallo peptidase.
FT                   MEROPS family M15D"
FT                   /note="PFAM: peptidase M15D, vanX D-ala-D-ala dipeptidase;
FT                   peptidase M15B and M15C, D,D-carboxypeptidase
FT                   VanY/endolysins; KEGG: stt:t1508 D-alanyl-D-alanine
FT                   dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16209"
FT                   /db_xref="GOA:A0LFK7"
FT                   /db_xref="InterPro:IPR000755"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFK7"
FT                   /protein_id="ABK16209.1"
FT                   /translation="MFERNSRFLLLLCLFVPFFVPLAVAQEAGLPDGFVYVDEVVPGVN
FT                   VELRYHTEHNFVGTPIDGYRGARCILTREAAEALKGVQEDLKPFGLGLKIYDGYRPQRA
FT                   VNHFVRWAQDLSDTRMKQEFYPGVDKADLFKEGYIAEKSSHSRGSTVDLTIVPLEAAES
FT                   EAELDMGGAFDFFGPESRPDWPLLTPSRRAHRMLLQTLMRNHGFQPYPKEWWHYTLKNE
FT                   PYPDTVFDFPVQ"
FT   sig_peptide     complement(614720..614797)
FT                   /locus_tag="Sfum_0509"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 26"
FT   gene            complement(614941..615771)
FT                   /locus_tag="Sfum_0510"
FT   CDS_pept        complement(614941..615771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0510"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mac:MA2730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16210"
FT                   /db_xref="GOA:A0LFK8"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFK8"
FT                   /protein_id="ABK16210.1"
FT                   /translation="MMFTNPEVILVEAYVHGYSETEAGRLQDQASTLVELLHPSVSFPA
FT                   GSRILEPGCGVGAQTLYLAGKNPASRITAFDISPDSVRRAREKVARAGLSNVAVEVADI
FT                   FNLPYGAGTFDHLFVCFLLEHLQDPAAALLRLKDMLRENGSVSVIEGDHGSYYCHPRSE
FT                   RADLVVRCLVEVQARKRGNSLIGRELYPLLDRAGFREVQVSPRMVYVDRTRPQLVEGFT
FT                   RKTFIAMIEGVREEALSLELTDEETWDGGIADLYRTTREDGTFCYTFFTAVAFK"
FT   gene            complement(617105..619048)
FT                   /locus_tag="Sfum_0511"
FT   CDS_pept        complement(617105..619048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0511"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; protein of unknown
FT                   function DUF395, YeeE/YedE; KEGG: ade:Adeh_2629
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16211"
FT                   /db_xref="GOA:A0LFK9"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFK9"
FT                   /protein_id="ABK16211.1"
FT                   /translation="MAVSLLVGFGFGFALERAGFGSSRKLGGIFYFRDMTVLRVMFTAM
FT                   ITAMLGLHLALSLGIVASDQIYFLPTVYGAQIVGGVLFGIGFGLACWCPGTAAVGVASG
FT                   RLDALIYLFGAVLGSILFNEIYGLLEPLYTWGESGVKFVWEALGVSAPFFALVFSGLGV
FT                   AAFWFAEWIERRTAGTGPYFGSPFLKAFSVAVLAAAFGVAVLPSAGIDRAAVSRLGPPP
FT                   ETAILQTMQAGEDHVEPEALADRLMTGDPSLLLVDIRTPGEYSAFHIKGALNVAPADLP
FT                   ETLAPRRDRGTIVLYSNGMTHPAQARDALARMGFNNVTILTDGLQGFMHRVLKPVSLRE
FT                   APLTAEMAAQVEAWRGFFLGTATARADDSQGSTGGMPGLVETAWLNEHLGRGDVRIIET
FT                   RSQPAYNGGHLPGSVRMDPEHFRGVVGGVSSMVLPVDMIVRHLELLGIRPETTIVVVPS
FT                   EKIMDATLIGTALERAGHRRYAILNGGWEKWLAERRPVDTLLPAITETAYPAPREADRF
FT                   TVDYRTVLEHVHRRSAVLLDVRPADYFSGAKSDEARAGHIPGAVNRPFADDLATIDGIT
FT                   SFKPRAELEEAYARLIPSKDTTVVVSCRTGHQASQTRFVLQNILGYRKVFWYDGGWAEW
FT                   SSRPELPVETSP"
FT   gene            complement(619093..619623)
FT                   /locus_tag="Sfum_0512"
FT   CDS_pept        complement(619093..619623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0512"
FT                   /product="protein of unknown function DUF395, YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395, YeeE/YedE;
FT                   KEGG: ade:Adeh_2630 protein of unknown function DUF395,
FT                   YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16212"
FT                   /db_xref="GOA:A0LFL0"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFL0"
FT                   /protein_id="ABK16212.1"
FT                   /translation="MNPDQSIHSNGPRPYMNPYLAGLILGAVLLAAFLVLGTGLGASGG
FT                   IARVGAAAQGALMPQHVAGSPYFGAWGSNPLSYYLVFMFAGTLLGGLVSAVAARRVQPQ
FT                   LERGPTASPRRRILMALSGGVLAGFASRLASGCTSGQALTGGAMLATGSLLFLVSLFAA
FT                   GYAAAWFARRQWS"
FT   gene            complement(619802..621655)
FT                   /locus_tag="Sfum_0513"
FT   CDS_pept        complement(619802..621655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0513"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; Rhodanese
FT                   domain protein; KEGG: rha:RHA1_ro08897 possible hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16213"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFL1"
FT                   /protein_id="ABK16213.1"
FT                   /translation="MQFNLPVLSHYSYLLISGKEALLVDPDRDITAYLDHAKKHGLTIK
FT                   GVFLTHSHADFVAGHLELVRALNVPVYQNAASGAKYKIEPLKEGSTFKVGAAMVKAVET
FT                   PGHTPDGMCGLVFSEGDDQPKMIFTGDTLFVGSVGRPDLLEGKMTAATLASMSYDTWHN
FT                   VLSKLPDTVAVLPAHGAGSLCGAHLSDDPSSTIGRERSSNPYIRHKGRSEFISAVLEGL
FT                   PEAPQYFKHNAAMNREGPPLVSWDAAPVQAKVDESITRVEDLWLVDLRDPKPYSEGHVP
FT                   GSVNIGLRGRLETWVGTIVPWKAPMVLIGSSAEIKEAVLRLHRVGYTGSVLPFEAWTRA
FT                   GLSLARSGTVKPGELYAQMQDGSAPIIVDVRLPNEWMALRIGTVVNLPLNHLGELSRKL
FT                   DPALPVVAVCNSAYRSSLAVGILQRKGFKQVSSLEGGSAAWIEAGYPVFGSEKQAAGSS
FT                   APRRHVHLAERISPADLNRLLKDLPGTFDLVDIRPPEAFRDYSLPGSTNADPADVLSNA
FT                   GYLTGAGPLIIVDRDGSLAMMIAGILSQKTKRPIKALHGGLDAFWEETELKAAVRAVPL
FT                   PGGGPKFQGPAAPAPAPVPQPATSAPAPSTPGTPKKKSAGC"
FT   gene            complement(621967..623163)
FT                   /locus_tag="Sfum_0514"
FT   CDS_pept        complement(621967..623163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0514"
FT                   /product="outer membrane protein"
FT                   /note="KEGG: sat:SYN_00874 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16214"
FT                   /db_xref="GOA:A0LFL2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFL2"
FT                   /protein_id="ABK16214.1"
FT                   /translation="MAFAGRRNRKDPLNPVLEEYGETGMIPVSGSGLMRKSIILFLVVV
FT                   LGTALFFSCMHNPAPFDEAKWRRQVDAQSVEQLYAPHFNDGRYFNPWAPMEHGGFWRLV
FT                   KWKMSSKAHYSEEEKNHRPKFIPELKARIQGMPEGDFIAWIGHSTFLLRIGGDYWITDP
FT                   IFSERAFLPRRITPPAITGEELKALAPSLNVLISHNHYDHLDEESVRSLPRASRFYVPL
FT                   GLGNHVASLHEGAVQELDWWREIDLGGGNKLVCLPAQHWSRRFGQGFNETLWAGFLLIT
FT                   PEISVYYGADSGYFIGYREIGRRYPNIHYALLSTTAYHPRWFMHYAHKSIPEALDAFHD
FT                   LGARYFIPTQWGTFPLGDEPPGYPALDLMRTIQERKLDPSRFLVLDIGEIRPLRGARE"
FT   gene            complement(623865..625082)
FT                   /locus_tag="Sfum_0515"
FT   CDS_pept        complement(623865..625082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_2862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16215"
FT                   /db_xref="GOA:A0LFL3"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFL3"
FT                   /protein_id="ABK16215.1"
FT                   /translation="MKKKWAFALLAVTALILLSLLTFMISHILALSEILGRIHPALGLV
FT                   SNCLLLGLLALCLFWLIGAHVFRQKPLTMLSNPSAAQKELYLAKLSKRLESNKYIIAGG
FT                   LRASSVDRLPELTAYLDDLAVQEIKLVGKRVFVATAISQNGRLDSLIVFFQVASLVWKI
FT                   SRIYNQSPHPMELWKIYTNVLTVSLVSYGLDEADLANQIGSIISPIIPHAVFDKVPFVA
FT                   TIARTFSHSIFTGAANASLACRVGVVTKNYIGLKTCPDSSVKQRPSLEALQILNEIVAE
FT                   SLPKVLGALGGSIKSISARGMRKASGAVADTATGFAGGLGNACQAVGRKSSDAYNSTKH
FT                   GARKVAGAVRSVYDAVGDKAGDVFEATAGGVKKVSSTAAGVAGKAVAGLKKPVRRISSF
FT                   LFRNSE"
FT   sig_peptide     complement(624990..625082)
FT                   /locus_tag="Sfum_0515"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.531 at
FT                   residue 31"
FT   gene            625102..625488
FT                   /locus_tag="Sfum_0516"
FT   CDS_pept        625102..625488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16216"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFL4"
FT                   /protein_id="ABK16216.1"
FT                   /translation="MASRSGNGAFDESPLRDKTLERADFRRKASGRQLSINSSIAAKLC
FT                   PWTRMGDVDTNGWRREPKGSPQVFRTGRDEQTSEQIGTVKAAGAERFASGVHTARKAPR
FT                   YPLTIPGRGVIRGLRSGWVHRAGA"
FT   gene            complement(625627..626643)
FT                   /locus_tag="Sfum_0517"
FT   CDS_pept        complement(625627..626643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0517"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: sco:SCO5895 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16217"
FT                   /db_xref="GOA:A0LFL5"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFL5"
FT                   /protein_id="ABK16217.1"
FT                   /translation="MNPRYLIAFLRILKVPGLFPLMKDWQALVRMHFLHAAYESGLLKA
FT                   LAVPCEKQVLIDKLQVKRPELFDALLDVGLATKELGMKNRLFSIKGKRSKAVVGARGDM
FT                   LAAMVQANITYYSDAYRHAARRLRGDDLGDDLHRMGDLVARFSKLAEPIMKDFIVGLVS
FT                   GRNPMRILDVGCGSGVFLHAAHSANRNATGAGLDIDEAAVRQATNNIAQWGLEDRFRIF
FT                   HGDTRHPPGGLEGPFDLITLFNILYYFNEEDRIELVHNLRAMLAPQGVLAIATTCHSMG
FT                   MDVAAAHLNMVNCSLKGLTRLPRLEDILSLLHRCGFRRIDTHRFIPGGTLYGIVAGN"
FT   gene            627279..629387
FT                   /locus_tag="Sfum_0518"
FT   CDS_pept        627279..629387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV2604 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16218"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFL6"
FT                   /protein_id="ABK16218.1"
FT                   /translation="MNSMKRTIAVSVIALAIALGTSWAGAATLEVIDGEYKLPARIHAS
FT                   VASDVKTELWAHVWRPRPRGSYPLVVFLHGNHPTCGRYDSELGVRIDDRVDYTTTGECP
FT                   SGYVVTPNHLGYAYLAGTLASYGYVVVSINANRGVNGAKPETDDYGLNLRRGRLVLRHL
FT                   QELAKWNTEGGAPASLGFQLKGFIDFTQVGLMGHSRGGEGMRAAVAQLNDPDSLWPKRI
FT                   PGLKFRSLFEIGPVDGQTSRTLNPVGVVWNVLLPGCDGDVADLEGMKPFDRMLQDAAEA
FT                   DSLSKSTFQVFGANHNFYNTQWQISDSMGCIGQTAIFPQLKGSASQRRTALRSLVPFFR
FT                   SNLGPAPVEGLARRFDPSFPIPSGLASETSYARGFTRSPRRCENFVIDNFNRRTGLSSR
FT                   NVANESSGLSGYEHGTAGKNQDPTQRAAAIDWRRAGGFFQVNAAAAGEGLDVGNYHALE
FT                   FRVMLRCFDKLCCSPGDPTGDVDFSIAIANADAVLSNPVSLKSVAVVRRPGGSFQGSWV
FT                   NYNELFQTVRIPLSDFTGADLSNFRGVRFTFDRSPKSFIYLANVRLTKARAGNGALASD
FT                   AQTQVGSETVVQTRARDEAQADRNEIVAIRLPGGAAAGVSEKARVPAVEIEVASSRSFP
FT                   VGGALPTLVVGDKTFALSHYPSGATDRLVFTLEAGQFEAIEQGAEVGVRIGGARPWHFG
FT                   LLDKSLAR"
FT   sig_peptide     627279..627353
FT                   /locus_tag="Sfum_0518"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.832 at
FT                   residue 25"
FT   gene            629406..630530
FT                   /locus_tag="Sfum_0519"
FT   CDS_pept        629406..630530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0519"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase;
FT                   3-dehydroquinate synthase; KEGG: stm:STM4108 glycerol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16219"
FT                   /db_xref="GOA:A0LFL7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFL7"
FT                   /protein_id="ABK16219.1"
FT                   /translation="MFSVFSSPARYTQGLDATAILGAEMAGLGIEGPALIVAGGSALAQ
FT                   LSGTWRQTLGEVGCSYGIHRFGGECSLAEILRIRHAAEALPARVVIGAGGGKALDAARA
FT                   SAAELGLPFVSCPTLASTDAPCSAVSVVYGESGAVEEVRILPRNPVLVLVDTRVIVQAP
FT                   PRLLISGMGDALATWFEARACAASGARNLRGGRSTRSALALAELCYRTLLEDGVEAVEA
FT                   AGTQTVTPAFERIVEANTLLSGLGFESSGLAAAHSVHNGLTAAPQTRAFTHGEKVAFGT
FT                   LVQLVLEKSDRSAIDEVMGFCAQVGLPVTLAQIGLRELSGEMLERIALRATRTGESIHN
FT                   EPFEVSANRVADAILKADALGRALPGNGKLPSPE"
FT   gene            complement(630710..631516)
FT                   /locus_tag="Sfum_0520"
FT   CDS_pept        complement(630710..631516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0520"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: noc:Noc_1902
FT                   putative cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16220"
FT                   /db_xref="GOA:A0LFL8"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFL8"
FT                   /protein_id="ABK16220.1"
FT                   /translation="MQLDTRFSFFAAAIVSLILLAAPTTSSAASEEKLVDMTFPFSEES
FT                   IYWPTDKPFTPTVVFKGITDGGWWYASNQYAASEHGGTHVDAPIHFHEHGRTIGQVPLQ
FT                   EWIGPAVKIDVTGKSLANRDYQLSVEDLLAWEKKHGPIPQGAWVIMYSGIDDRFYPNRK
FT                   EVLGTDKTGMDAVAELHFPGFSPEAVDFLLANRAITGIAVDTPSIDPGSSKDFKAHRAL
FT                   CKAQKLALENIANLDKIPESGAMLYVIPMFIQNGTGAPARVFAKLP"
FT   sig_peptide     complement(631430..631516)
FT                   /locus_tag="Sfum_0520"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.802 at
FT                   residue 29"
FT   gene            631597..631875
FT                   /locus_tag="Sfum_0521"
FT   CDS_pept        631597..631875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16221"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFL9"
FT                   /protein_id="ABK16221.1"
FT                   /translation="MPAISPVMADRSCPADRPVVAKDCCFTLHGRHTVAPSRRVSRIPG
FT                   IGAFFTSFLCMHLSVFPGGVLQQYAIVAHSARLMFDGDQRVIACEPE"
FT   gene            632094..632930
FT                   /locus_tag="Sfum_0522"
FT   CDS_pept        632094..632930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0522"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mhu:Mhun_2368 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16222"
FT                   /db_xref="GOA:A0LFM0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFM0"
FT                   /protein_id="ABK16222.1"
FT                   /translation="MSEPFKGKVCIITGSSSGIGLGLAKELLGRGAVVHMSGWRETNRE
FT                   NLRTTADLLERYPGKAFSRELDVRDARAVAEYIADIAAGGPVDYMFSNAGVGLEMPFIG
FT                   VDLAVWDKILGVDLYGVIHCVQAVVPLMLEQGHGHIVNTASVAGIVPLPYQAVYCAAKY
FT                   AVVGFSESLRYELEPYNIKVTAVCPGAVATQIFQRGLDYTVHEELPMPEEAIGIDHAAL
FT                   EILEGVEAGRGILPVTDFARAMYENIRTDPARNDVVMRSIARDRRQRFIDRGLLDR"
FT   gene            633701..634444
FT                   /locus_tag="Sfum_0523"
FT   CDS_pept        633701..634444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0523"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bba:Bd0529 murein transglycosylase D"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16223"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFM1"
FT                   /protein_id="ABK16223.1"
FT                   /translation="MQDCSKPRRLVYLVAALFMAAGVIGCATAETSAPAGPPVQAAVQA
FT                   ERTAAPVQVQRPAHQSPGMVAYYPPPGRMDFCGEHVPLENQEVMERFDKEFTLVVYNHA
FT                   QIYRWLKRRDGYFQWMEERLRRLNLPEDLKYVALAESEPPLSTADRKRWAEMRNDFERS
FT                   PESALQYLGDLHRSFRSWSLALAAYCCGEKRIMDESRAQGQSDFYKMMLPQETERYVFK
FT                   VLAIKAVLSDPARYGYELPKGARQR"
FT   sig_peptide     633701..633790
FT                   /locus_tag="Sfum_0523"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.902 at
FT                   residue 30"
FT   gene            complement(635136..638542)
FT                   /pseudo
FT                   /locus_tag="Sfum_0524"
FT   gene            640255..640746
FT                   /locus_tag="Sfum_0525"
FT   CDS_pept        640255..640746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0525"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dvu:DVU2197 site-specific recombinase, phage
FT                   integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16224"
FT                   /db_xref="GOA:A0LFM2"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFM2"
FT                   /protein_id="ABK16224.1"
FT                   /translation="MVDNLTMARKVEGAIKGDLARVEYDIADHKAAEKVTLNVSFDNHF
FT                   LPWTKEHKRTWRNDRYLYDCHLKPRFVGKALEEINAFEINKMKLAMKKAKNKQGRPCTP
FT                   ATIKHVVVLLKRLFNLATRWRIHKGANPCAGVELPKLDNKVTEFLSDEKTERLLKVLDA
FT                   "
FT   gene            640819..641388
FT                   /locus_tag="Sfum_0526"
FT   CDS_pept        640819..641388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0526"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   lip:LI0173 prophage DLP12 integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16225"
FT                   /db_xref="GOA:A0LFM3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFM3"
FT                   /protein_id="ABK16225.1"
FT                   /translation="MKWGDVDVERKILTLRAPKGGKTEIIPLSDTTLSAIEDLARKSEY
FT                   VFPGREGAMLTGFKGPWEMVRKEAKLPASFHFHGIRHSFASNLVSSGVDFYTVGGLRTH
FT                   KQAVTTQRYAHLSDEAMRRAVEKSAEVITPKEKKEEAVENDIESAQRAYYGQQKTLLLF
FT                   IENLMADLMRKQFQEKLEKIKKYATI"
FT   gene            641687..642571
FT                   /locus_tag="Sfum_0527"
FT   CDS_pept        641687..642571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0527"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; KEGG:
FT                   ana:all5131 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16226"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFM4"
FT                   /protein_id="ABK16226.1"
FT                   /translation="MQGREVTEARFLQRCNQYAWLEEAVGVTRLARFPSLEVDPERVNL
FT                   SDATRLADEVRRQFDLGNRPAAVLEKTLEDVYGVKIWYDKLEEGSAASVWGKFGPAILM
FT                   NSREAPWRRNYNFAHEVFHLITWNSLPPGLLSEQSDLRSKVESIANAFASQLLLPADPV
FT                   RMVFYARVTESKIAYSDLVDLARSFDVSTEALLYRLLNLNCFPRAAVTKMLRDPAFREL
FT                   DRCSMSECWHSPPEIPERFVRLAFLAHQKGKLSRSKFASLLGASIADLNDVLRKYGFGD
FT                   EKDNAGKTKVRVA"
FT   gene            642606..643082
FT                   /locus_tag="Sfum_0528"
FT   CDS_pept        642606..643082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16227"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFM5"
FT                   /protein_id="ABK16227.1"
FT                   /translation="MWESLIERAEVLVSSIVAHEETLFHVKGQLPEPINMKRLIAEGKV
FT                   QEFAATASQMAGLRLCFDRRFVEGLHEGELEALALIHENLVGEALYSSGDANAIRALAM
FT                   LGHSDRGISMERLLKTTGLQKTVAPQFGDSLFRRCIGEGKQSRITGEGLNKSIV"
FT   gene            643230..643544
FT                   /locus_tag="Sfum_0529"
FT   CDS_pept        643230..643544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16228"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFM6"
FT                   /protein_id="ABK16228.1"
FT                   /translation="MRTFRDHLQEKLQDKRFGELFDEEKELVRIGIEVAEARAKLGMSQ
FT                   ADLQMHREIRPPAGSESFLYMPASIKKENGPKTVLEKATASDVPSEVLARFQKSPSKAS
FT                   "
FT   gene            complement(643671..643745)
FT                   /locus_tag="Sfum_R0009"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(643671..643745)
FT                   /locus_tag="Sfum_R0009"
FT                   /product="tRNA-Thr"
FT   gene            644554..647721
FT                   /locus_tag="Sfum_0530"
FT   CDS_pept        644554..647721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0530"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; KEGG:
FT                   gsu:GSU1842 polysaccharide biosynthesis/export domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16229"
FT                   /db_xref="GOA:A0LFM7"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFM7"
FT                   /protein_id="ABK16229.1"
FT                   /translation="MRSKRKMFCATLLSFLLCWNSVCAQQLQQIPSPLAPPFATTSTPV
FT                   SATTGSSPTTTTIPGIPGLPSLTLPQAMMPVPCETLLPGQLPPVGTPPVIPGLPSTAGQ
FT                   VPYLQPCGPGQIPYQPPGVATQVPYQAPGIPSQVPYQPPQGTAAQGPYQPAPGVAGQAL
FT                   VTQPGVGTSQVPYQQPGVPVQGAPVTQPGVAGQVPYQPSAIPGQVPSLQPGVSLQMPVQ
FT                   QPMVPGQPGYPQPTPPTSRGYQAGQVPYQQPAELAVPPILPVEPLSPFEEFVAGKSTST
FT                   PASISFDIKQFGYDLFINSGSPLITGSPISGTAVPGTTGVPGMLGGTSVQTIPGMPGIP
FT                   GTTGHTGPMSTQFGLPILNVPVSPSYVIGPGDEIRIAVWGSVEGTWDVIVDRDGTISLP
FT                   KIGIIGVTNMTFQEVKDTLKNEFSKYYQDFQMNVSMGSLKTIRVYVVGNARNPGAYLVT
FT                   SMSSIVNGLLAAGGPSKAGSMRNIELKRNGDTIAVFDLYELLLKGDKTKDRQLMAEDVL
FT                   YIPPIGSMVGVAGNVERPAIFEMKGKTKLSEAIKMAGGPTADAYLQRIQVERVSQRKAK
FT                   IFLDVDMQGIKGKQDIVLQDGDIVKVFPISMFVTNRIILKGNVRRPGEYEWKHGMRVKD
FT                   IIRNFDALLPDAMLEYALVERLVAPDNHQEYRTFNLREAISGTDRSQNILLEPYDTITV
FT                   YSKWEMQERERVRVSGAVNRPGDFEFRENMKLSDLLKLSGGLKKTAAADNAEITRVVPT
FT                   EAGPRTEQIQVNPTLALAGDPDFDILLHRDDYLTVKSVPDWQLYRKVSIYGEVKYPGDY
FT                   ALQKGERLSSLLERAGGFTDRAYKRGSSLFRESVRQLQQRQMGELIDMLGRQVLANSAA
FT                   NLMGEMTPGEAEFQATQAKQQKLFLDTLRTLQAKGRVVVQLDEPRKLKGTAFDIEVEEG
FT                   DQIYIPINPRVVQVIGAVYNQTAFVYEPGRNYSYYIDQAGGYSPTADKGNVFILKADGS
FT                   AVQPGRGIFWCVATARWQTGANGRLEPGDTVIVPDKLDKVAWMRNFKDLTTVLYQIAVG
FT                   TGVLLRL"
FT   sig_peptide     644554..644628
FT                   /locus_tag="Sfum_0530"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.974 at
FT                   residue 25"
FT   gene            647801..648775
FT                   /locus_tag="Sfum_0531"
FT   CDS_pept        647801..648775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0531"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: dps:DP2941
FT                   similar to mannose-1-phosphate guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16230"
FT                   /db_xref="GOA:A0LFM8"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFM8"
FT                   /protein_id="ABK16230.1"
FT                   /translation="MKAMILAAGLGTRLRPLTLARPKVLVPLMGTTVLDFWMWRLRDAG
FT                   ACAAVVNAHHLGEKLVSTVAENTWPIPLESRFEPVLLGTGGGLRNALDFLGTEPALVIN
FT                   GDIVCDVPLRELPRKHSEHGGPVSLLLHDCPRFNNVAVDENDRILGFGSEASELKRSLP
FT                   NVRLLAFTGIHCIDPSILSVLPPDRFSDILALYRELIRAGRHPRAIRRPRVFWREMGSI
FT                   RAYRDLTVELAGMPEDFLPPLHCGSRVRIDPRAFVDPRAELRGVVTVGKGCVVMEGAVL
FT                   EDVILWDNVTVEPGSRLRGCIATDGSVVGGIHEDEIFTGPRQG"
FT   gene            648779..649861
FT                   /locus_tag="Sfum_0532"
FT   CDS_pept        648779..649861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0532"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   dps:DP2940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16231"
FT                   /db_xref="GOA:A0LFM9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFM9"
FT                   /protein_id="ABK16231.1"
FT                   /translation="MPTIMLPELRPMLHHAAGALRLPLDSADVTPLAGDGSDRRFFRVR
FT                   RGADHYVALISPRKNHQGLDENDSYLKIGEHLHRRGVPVPRIFWADAARGWFLLEDFGD
FT                   RHLQAQVLRGRSSVTAVYRKALEVLVRLHREGRDGFRADYCFDGAFYDPAFVYERELEY
FT                   FRSAFLVSLMRLQIDREDLRSDFERIAEAAGTGSDRFVFHRDFQSRNLMVCKGKLGLVD
FT                   FQGMRFGPPAYDLASLLIDPYVALPARLQEVLCRLYWDDARKFLGGSIDAFLKHYRWVR
FT                   LCRNLQILGAFGYLGTSKGKTRFLAYVPGAWAELTRLLREHFAGCFPRLEECVETVARE
FT                   AAFTFPTGGAQVFRDFAAAN"
FT   gene            complement(650093..651862)
FT                   /locus_tag="Sfum_0533"
FT   CDS_pept        complement(650093..651862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0533"
FT                   /product="oligoendopeptidase, pepF/M3 family"
FT                   /note="TIGRFAM: oligoendopeptidase, pepF/M3 family; PFAM:
FT                   peptidase M3A and M3B, thimet/oligopeptidase F;
FT                   Oligopeptidase F; KEGG: dps:DP1442 related to
FT                   oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16232"
FT                   /db_xref="GOA:A0LFN0"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR011977"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFN0"
FT                   /protein_id="ABK16232.1"
FT                   /translation="MNDPAEHVVWNLNDLYSGPDAPAMEQDRQSANDLAVQFAARYRGK
FT                   VAALSPEEASAAIREYEALQEILQKLDAYAALHFATRTRDPSTGALLQAIREFRSQVHR
FT                   DTLFFELEWAQIDDEAFAAALRHSALGPYRHYLELSRRYRPHLLTEPEEKILAEKEPVA
FT                   NDSWTTLFDKVLGHLRFGPGERTESEVLSDLYAGDRTVRQQAARELTQGLTEMLPVLTH
FT                   IFNTILLDKAVTDRLRRYPHWLRARNLANEAEDVMVEALVEAVSSRYDVVRRYYRLKRT
FT                   LLGYEELFDYDRYAPIPGLPKKAFSWEEAKHLVLSGFEAFSPEFAEIASDFFRHNWIHA
FT                   PVLPGKRSGAFSHPTVPSCHPYVLVNFTGTSRDVATLAHELGHGVHQVLARKQGLLNAD
FT                   TPLTLAETASVFGEMIVFRHLLERVESRKERAALLCSKLEDSFATVFRQVSMNRFESAV
FT                   HNQRRSGGELDPERISQFWLDSQKQMFGDSVTLTGDYRIWWSYIPHFIHSPGYVYAYAF
FT                   GELLVLSLYRQYRQTGASFVPLFRDLLEAGGKASPNELLSPFGIDLSDPSFWKRGLEVI
FT                   EGMLDEAEQYARS"
FT   gene            complement(651975..653369)
FT                   /locus_tag="Sfum_0534"
FT   CDS_pept        complement(651975..653369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0534"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   gsu:GSU3296 glycolate oxidase subunit GlcD, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16233"
FT                   /db_xref="GOA:A0LFN1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFN1"
FT                   /protein_id="ABK16233.1"
FT                   /translation="MTIPITEITRIVGKDHVLTAPEELHCYGYDASKMKARPECVVFPG
FT                   SAAETAELLVLANRDRFPVYPRGAGTGMVGAAIPSGGGLVVALNRLNRILEIDAENMTA
FT                   IVEPAVVTGDFQKRVLECGLFYPPDPASLQFSTLGGNVAMCAGGPRAVKYGVTRDYVLG
FT                   LEVVLPTGSIIRTGTRTMKGVVGYDLTRLMVGSEGTLGIFTKIILRLIPAPEGVRTMMA
FT                   VFPRLDDAANAVCDIIKHRIVPSTLEFMDQPTIGVVENYLHAGLPTEAEAILLIEADGR
FT                   EALLDEDASQIERLCREAGADAFKTGRSPAEREQLWKARRAISPALGQIRPGKINEDVT
FT                   VPRTLIPSLIRFIQGLASRHRLTIVCFGHLGDGNIHTNIMLDRKDADERKRAERAVEEL
FT                   FRKVLELGGTLSGEHGIGIAKSPFLELEVGRDGLAAMLRIKQALDPLNILNPGKMFVPN
FT                   RAFFGE"
FT   gene            653891..655063
FT                   /locus_tag="Sfum_0535"
FT   CDS_pept        653891..655063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0535"
FT                   /product="Uncharacterised conserved protein UCP016719"
FT                   /note="PFAM: Uncharacterised conserved protein UCP016719;
FT                   KEGG: dps:DP2946 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16234"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFN2"
FT                   /protein_id="ABK16234.1"
FT                   /translation="MGKVILGCEVLASSPPGWFRSGRLGLLVNQASVTQSFEHVRDLLR
FT                   RTGGRLTCLLSPQHGFHSEKQANMIESDDSWDEDSSLPVVSLYGKVRQPSRETLDGIDV
FT                   LVIDLQDVGTRVYTYGVTMGLCLEAAARSGTKVVVLDRPNPIGGISIEGNILDDGYRSF
FT                   VGRYPIPMRHGLTMGELARFICKECSVDCDLQVIPMKGWRRRDYFPDTGLPWFFPSPNM
FT                   PTWETALLYPGMVLLEGTNVSEGRGTTLPFHVFGAPFVNRRRLGDYLAGAGLEGVVFRP
FT                   VSFEPMFDKWRGRLCHGFQIHVTDRVSFSPYRLGLTLIRGLRLLNPDEFKWLEPPYEYE
FT                   TEKLPIDILLGDGKLREKLDNGADPGGVARGWANPLAAYWAKCAGLFLYA"
FT   gene            complement(655346..656011)
FT                   /locus_tag="Sfum_0536"
FT   CDS_pept        complement(655346..656011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0536"
FT                   /product="signal peptidase I. Serine peptidase. MEROPS
FT                   family S26A"
FT                   /EC_number="3.4.21.89"
FT                   /note="KEGG: sat:SYN_01527 signal peptidase I; TIGRFAM:
FT                   signal peptidase I; PFAM: peptidase S24, S26A and S26B"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16235"
FT                   /db_xref="GOA:A0LFN3"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFN3"
FT                   /protein_id="ABK16235.1"
FT                   /translation="MRNPPEKNTGSKRTKSLLREYTEAIGIAILLALFIRAFVVQAFKI
FT                   PSGSMKTTLLIGDHILVNKFVYGIRLPILNKEILHFSNPKRRDIIVFQYPVDPSKDFIK
FT                   RVIGEPGDTVKIIDKKVYVNDQPLDEPYTVFTDPKIQPAGVSPRDNMGPVAVPPDSLFV
FT                   MGDNRDESYDSRFWKFVKLDALRGEAFIIYCSWNQDGELSLSSSESYIRWNRIGKLLH"
FT   sig_peptide     complement(655883..656011)
FT                   /locus_tag="Sfum_0536"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.762) with cleavage site probability 0.724 at
FT                   residue 43"
FT   gene            656161..657213
FT                   /locus_tag="Sfum_0537"
FT   CDS_pept        656161..657213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0537"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="TIGRFAM: type IV pilus assembly protein PilM; KEGG:
FT                   ade:Adeh_0641 type IV pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16236"
FT                   /db_xref="GOA:A0LFN4"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFN4"
FT                   /protein_id="ABK16236.1"
FT                   /translation="MFAKKENLLGLDIGSHSVKLTQLKAKEGRLTLANVGLVPVPREAF
FT                   NEGRVNKPDLVSNCIKHLTSHLKVKERTVATAVSGYEVMIKKIELPTMTEEELDSRMHA
FT                   ELGQYIPYNIEEVDVDYQVLDVAKDRPNYMGVLLVAAKKESIGDCVGIVRAAGLDTDVV
FT                   DVDFFALSNAFEATYGSFEGNIALIDIGSAKAIMNIASNGVPVFTRGISIGGSQITESI
FT                   RDYFKVSYEEAERLKLGEISVNFPVKEIEGLFVSTVRNWVSECKRAIDFYYSNYPDKTI
FT                   QRIFLSGGSCRIPGLDRVFQENMGVAVEIFNPFKRVDCDPKLFDPEYIEFIGPQMAISL
FT                   GLALRKTKEK"
FT   gene            657210..657797
FT                   /locus_tag="Sfum_0538"
FT   CDS_pept        657210..657797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0538"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   dps:DP0109 related to fimbrial assembly protein PilN"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16237"
FT                   /db_xref="GOA:A0LFN5"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFN5"
FT                   /protein_id="ABK16237.1"
FT                   /translation="MIQINLLPVRAKKKRETARQFVSIYFLSIILMAIALGAAWFLKDR
FT                   EIQDKKAELSRLQQEVAKYAKFEEMLKDLTKKKELVDKKRTIIRDLQQDRDTIVRVLAL
FT                   LSVQLPPERMWFDRLSQVGTTITLDGTAMSNEALVEFMRNLESSPYIEKGSVNLIHSRQ
FT                   TVIAQKKLREFQLSYRFFPFSEVKKRLATKPS"
FT   sig_peptide     657210..657326
FT                   /locus_tag="Sfum_0538"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.804) with cleavage site probability 0.526 at
FT                   residue 39"
FT   gene            657794..658423
FT                   /locus_tag="Sfum_0539"
FT   CDS_pept        657794..658423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0539"
FT                   /product="Pilus assembly protein, PilO"
FT                   /note="PFAM: Pilus assembly protein, PilO; KEGG:
FT                   gsu:GSU2030 type IV pilus biogenesis protein PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16238"
FT                   /db_xref="GOA:A0LFN6"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFN6"
FT                   /protein_id="ABK16238.1"
FT                   /translation="MKKSLIPTGAFTEKLAGLPLAQKALLFLITLAILGAGFYYLVYED
FT                   QEKELAKVTASVAEQQKKLASLKEAAARVDKLQKELAASEADFNSLLALLPDQKEIPGL
FT                   LESVSQLGAKVGLENVLFQPQPEQPKEFYSVIPIRLDLLGSFNDLEVFLDNVSKLNRIL
FT                   KVETLTLNRVKDKGSGSGLQVGCTIVTYRFVDRPVQKDAKKDQKKK"
FT   gene            658509..660419
FT                   /locus_tag="Sfum_0540"
FT   CDS_pept        658509..660419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0540"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; Secretin/TonB, short
FT                   N-terminal domain; KEGG: ade:Adeh_0645 type II and III
FT                   secretion system protein, secretin"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16239"
FT                   /db_xref="GOA:A0LFN7"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFN7"
FT                   /protein_id="ABK16239.1"
FT                   /translation="MHYVGFRKMSCFAFVLVFALCWACAIPGSVEGGSSPKAGVASPSP
FT                   AAATPTAESATAGKGAKLLSVAMDESGLETVLRIAGSGPLKDYQFRRLGEDRFVLEIGD
FT                   VTARAAKPALPGKSSRVKLNYARAKAGVRIVGNVRQPISDYTVDSVDNDIVVNLRFAEK
FT                   KQVAAAGAAAEKPATAEKTRPGKAAARRGAGDAGEEVQGADQQFPEYSATRPGGGAPEL
FT                   RHARKQYTGKPISLDLLDADLRNVLRLLADLTGTNIVIEPDVTGKVTLKVEQVPWDQVL
FT                   DMIISMNDLGQEQVGSVIRIARRSKLKSEWAQQAEAIRAKQEYLLTSKDLGEINTAYLT
FT                   VNYAQVTDVASKINEAKSDKGKVSVDERTSLIIYSDYPGRINNARMLLNRLDRPTSQVL
FT                   IEARIITLTSEVKRSLGMNLGFGGDTPNHSATVPFTDFLINSPPANLFALNLAQMVGTT
FT                   LLKVDLTISALETADEIRIMAAPRVLTMNNVKAVISQGVQIPYLKVGDTASNITGTDFK
FT                   DAVLELAVTPHITPDHKVRMTIEAKQDEPSSTVTGAQGQPGIDTRKISTELLVDDGNII
FT                   VIGGIIRNRDEAKKTATPGLSDVPILGRLFKSNEVDAQRNEILIFICPKIVDVTKPSDR
FT                   T"
FT   sig_peptide     658509..658607
FT                   /locus_tag="Sfum_0540"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.984) with cleavage site probability 0.601 at
FT                   residue 33"
FT   gene            660589..661164
FT                   /locus_tag="Sfum_0541"
FT   CDS_pept        660589..661164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1201 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16240"
FT                   /db_xref="GOA:A0LFN8"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFN8"
FT                   /protein_id="ABK16240.1"
FT                   /translation="MESAHAEGTWDGDSSVIERAGHEKAALRVDYLTPASAIKSPEIFV
FT                   YKEKRRLYVIQSNVLVRDYPIGLGPHPSGDKDRDGDGRTPEGDFFIIVKGSSERLKKSL
FT                   AISYPGRGHAEKAYFSGVITPLEFRDILRAADNRSAPPSGTVLGGKIFIHAGGAHKDWT
FT                   DGSIALYDSDMEELFTVASVGTPVSIRP"
FT   gene            complement(661376..661807)
FT                   /locus_tag="Sfum_0542"
FT   CDS_pept        complement(661376..661807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0542"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_01357 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16241"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFN9"
FT                   /protein_id="ABK16241.1"
FT                   /translation="MDGKRAPIPEMLLDNGLTLHFEDRSRPIPGGRSQVVLCISIPFRV
FT                   REFVAEDPEITPEQAAQVLGDTVTYSVEKVRNFVPQESVEQNLQQMREEFIRSNLAYLL
FT                   NPSFPRRFLIKKVREALEARRLEEAHSRALHDSAPEHDD"
FT   gene            662072..662665
FT                   /locus_tag="Sfum_0543"
FT   CDS_pept        662072..662665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0543"
FT                   /product="pyruvate ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="KEGG: pho:PH0678 pyruvate ferredoxin oxidoreductase,
FT                   gamma subunit; TIGRFAM: pyruvate/ketoisovalerate
FT                   oxidoreductase, gamma subunit; PFAM: pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16242"
FT                   /db_xref="GOA:A0LFP0"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFP0"
FT                   /protein_id="ABK16242.1"
FT                   /translation="MTKKCIEMRWHGRGGQGAVTAAMIMAEAAYYEGYRGVTAAPFFGA
FT                   ERRGAPIIATTRFGREPIRTFSLVEQPDIVVVLDETLLRVVDVSAGVGPEGIVIINSAK
FT                   EPGAIRLKNAVNVATTNATEWAKEAGLIISGAVIFNTAILGGVARATGLISLESIEKAL
FT                   RNHFPGKAGERNVEGARAAYAGTSILQECKLACA"
FT   gene            662714..663010
FT                   /locus_tag="Sfum_0544"
FT   CDS_pept        662714..663010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0544"
FT                   /product="ketoisovalerate ferredoxin oxidoreductase, delta
FT                   subunit"
FT                   /EC_number="1.2.7.7"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, delta subunit; PFAM: 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein; KEGG: pho:PH0679
FT                   pyruvate ferredoxin oxidoreductase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16243"
FT                   /db_xref="GOA:A0LFP1"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFP1"
FT                   /protein_id="ABK16243.1"
FT                   /translation="MNKAREDKFTQARSALCKGEAGRTGDWRSVRPRIDHAKCIPSKNR
FT                   RPSCFICWLYCPEGVVKRSIPVEIDLDYCKGCGICAEECPGKAIEMVEEHEEA"
FT   gene            complement(663044..663607)
FT                   /locus_tag="Sfum_0545"
FT   CDS_pept        complement(663044..663607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0545"
FT                   /product="protein of unknown function DUF208"
FT                   /note="PFAM: protein of unknown function DUF208; KEGG:
FT                   sat:SYN_02970 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16244"
FT                   /db_xref="GOA:A0LFP2"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFP2"
FT                   /protein_id="ABK16244.1"
FT                   /translation="MTTRRLLLHMCCGPCAIYPLRTLRADGWSVHGFFYNPNIQPCREF
FT                   ERRLEAARTVSEREELPLIVRDDYDPVEFLRNVVFREQQRCVYCYSVRIEAAARIARKS
FT                   GFDAFSTTLLYSKLQKHELIEEIARDTSRRIGVPFIYRDFRQGWREGHEAAKMMGIYRQ
FT                   QYCGCIYSEAERYHRGGKKDRPPK"
FT   gene            complement(663604..665037)
FT                   /locus_tag="Sfum_0546"
FT   CDS_pept        complement(663604..665037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0546"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="PFAM: cytoplasmic peptidoglycan synthetase domain
FT                   protein; cytoplasmic peptidoglycan synthetases domain
FT                   protein; Mur ligase, middle domain protein; KEGG:
FT                   dps:DP2930 probable
FT                   UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-
FT                   diamino pimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16245"
FT                   /db_xref="GOA:A0LFP3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFP3"
FT                   /protein_id="ABK16245.1"
FT                   /translation="MRRKNSKTIYLLGIGGIAMGTLATMLTEKGFNVTGSDLNLYPPMS
FT                   THLETLGIPVCQGYDAANPEKCAPDLVIIGNAIRRTNPEAEYVLSHGLPYLSMPQAIAE
FT                   FFLCAHKSMVVAGTHGKSTTSSLLSWVLSRGGLDPSVFVGAFIKNWNSSYRIGRGPFMV
FT                   IEGDEYDTAFFDKGPKFLHYSPWIGIVTSVEFDHADIFTDFEAVRRAFRSFARLIQPDG
FT                   HLILNADDANCLALAKESRGRVTTYGWSRTADWRIVDMIHTDGRIRFTYENPLSRGTES
FT                   ILTRMPGRHNVSNSMAVMAAASLAGLDRNAVQDGLLTFEGVKRRQDILGEIGGILVMDD
FT                   FAHHPTAVRETIQALKDFYPRRRIFCAFEPRTNSSRRSVFQQAYTTAFDDAFCICIKHP
FT                   PGMDAIPREERLDVQKLVADIAERGKECHGFASAEDLIGFLVDHCASGDLVVCMSNGSF
FT                   DGLPHGLCTALAQKHAGAS"
FT   sig_peptide     complement(664966..665037)
FT                   /locus_tag="Sfum_0546"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.973) with cleavage site probability 0.691 at
FT                   residue 24"
FT   gene            complement(665018..666145)
FT                   /locus_tag="Sfum_0547"
FT   CDS_pept        complement(665018..666145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0547"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: dps:DP0647 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16246"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFP4"
FT                   /protein_id="ABK16246.1"
FT                   /translation="MIAQIEQLFEDGLREGIFSGASLLAAARGTILFERQWGHTLSGGS
FT                   PISTETRFDLASLTKILVTTPLAVCAASRGALRLDHTLDAFFAPDVLPADKRDISIRHL
FT                   LNHCSGLPAYHPFYRDLISLPPPSRRPALLDAILRTPLAAPPGTVACYSDLGFLLLGMI
FT                   LEKLFDGRLDQVARKMVFDPFRIDSLHFRSMEVPTGPEIIPSLSPADGLSFAATEHCPW
FT                   RKRLLVGEVHDENCYCLGGVAGHAGLFGTARGIFTLLSRFLDIARGDSGEPAWSSDILT
FT                   EFWSRQGIVADSTWALGFDTPSASNSSAGRFFSPRSVGHLGFSGTSAWMDLERSVIIIL
FT                   LTNRIYPTRCNEKLKAFRPLAHDLTMELLHATQEF"
FT   gene            complement(666150..667043)
FT                   /locus_tag="Sfum_0548"
FT   CDS_pept        complement(666150..667043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0548"
FT                   /product="peptidase U61, LD-carboxypeptidase A"
FT                   /note="PFAM: peptidase U61, LD-carboxypeptidase A; KEGG:
FT                   sth:STH2808 putative muramoyltetrapeptide carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16247"
FT                   /db_xref="GOA:A0LFP5"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFP5"
FT                   /protein_id="ABK16247.1"
FT                   /translation="MKLRPLKPGDRIGLAAPSSPFDREAFERGTAVLEADGYRPVPGRH
FT                   IFKRNHYLAGTDAERAEDLMQLLANPEISAVVCIRGGYGSGRLLSRLPFSSLRDHRKLF
FT                   LGHSDITFLHLAFASQMGWITFLGPNLTGIGQFESQWEYTRRVLAGETECSWRFTSGQV
FT                   LREGTAVGKVLGGNLTCLVHLVSTPFLPELEKVMLLVEDRGEAPYRLDRLFTQLKLSGR
FT                   LERLAALLLGEFHECGDRALIHEMILEQVRDYSFPVVADLPFGHGSVNEAIPLNVEFSL
FT                   NTYEGSLRAVQSPFCG"
FT   gene            complement(667040..667816)
FT                   /locus_tag="Sfum_0549"
FT   CDS_pept        complement(667040..667816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0549"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="TIGRFAM: putative transcriptional activator, Baf
FT                   family; PFAM: Bordetella pertussis Bvg accessory factor;
FT                   KEGG: sat:SYN_02883 bvg accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16248"
FT                   /db_xref="GOA:A0LFP6"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LFP6"
FT                   /protein_id="ABK16248.1"
FT                   /translation="MLLAMDIGNTNTVLGLFNEQRLVHDWRIRTEVNTTVDEYGIAIRS
FT                   LFDAHGFFVADVGSVIISCVVPPVLNSIERFCRKYFNIQPIIVGPGIRTGMPIFYDNPK
FT                   EVGADRIVNAVAAYDYYRCATIVVDFGTATTFDYISDKGEYMGGVISPGIMISCEALFF
FT                   KTSKLPRVEIFARPPSVLAKNTIASMNAGIVYGYAGLVEGIITRMRNEIGTNLKVVATG
FT                   GLAALIASECSLIDDVDDYLTLKGLRIIFERNKKNP"
FT   gene            complement(668133..668993)
FT                   /locus_tag="Sfum_0550"
FT   CDS_pept        complement(668133..668993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0550"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: chy:CHY_2383 dihydropteroate synthase;
FT                   TIGRFAM: dihydropteroate synthase; PFAM: dihydropteroate
FT                   synthase, DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16249"
FT                   /db_xref="GOA:A0LFP7"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFP7"
FT                   /protein_id="ABK16249.1"
FT                   /translation="MSISERKDYILRLKSGCLSLGRRTLVMGILNVTPDSFSEAGKFFS
FT                   FDSAVEQASALISAGADILDIGGESTRPFSDPVPLESELERVLPVIEAVRAVGNVPISI
FT                   DTTKAEVAKRAIEAGADIINDVSAMRFDENMVKVASDSGAPVILMHMQGNPKNMQQEPR
FT                   YASLLSEIVAFLEDRIQFAVQNGVDRSQIIVDPGIGFGKTVEHNLSLIRNLPAFGCLDR
FT                   PVLLGASRKRFIGSILGRSPDDREVGTAAVNAVAIASGVHILRVHDVGFHLQVARMGDA
FT                   IRSAG"
FT   gene            complement(669250..671208)
FT                   /locus_tag="Sfum_0551"
FT   CDS_pept        complement(669250..671208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0551"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /note="KEGG: gsu:GSU1809 cell division protein FtsH;
FT                   TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase, central domain protein;
FT                   peptidase M41, FtsH extracellular; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16250"
FT                   /db_xref="GOA:A0LFP8"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFP8"
FT                   /protein_id="ABK16250.1"
FT                   /translation="MSPFYKNLALWLVISLMVILLFNMLQKPQSSSIETTYSQLMASVQ
FT                   KGEVAKVTIQGDRILGTYNDGKLFRTHVPRDPDMIKMLRDHGVDIQAKPEEENPWYVSV
FT                   LVNWFLPMLLLVGMLIFFMRQMQVGGGKAMSFGKSRARLLNENSKKVLFNDVAGIDEAK
FT                   EELQEIVEFLKDPRKFTRLGGRIPKGVLLVGAPGTGKTLLAKAIAGEAGVPFFTISGSD
FT                   FVEMFVGVGASRVRDLFMQGKKNAPCIIFIDEIDAVGRHRGAGLGGGHDEREQTLNQLL
FT                   VEMDGFESNEGVILIAATNRPDVLDPALLRPGRFDRQVVVPVPDIRGREGILHVHLRAK
FT                   PLAPDVDPKVLAKGTPGFSGADLENLVNEAALLAARKNKDLIDMADFESAKDKVMMGLE
FT                   RKSMILTEEEKRNTAYHEAGHALVARLLPGADPLHKVTIIPRGRALGLTQQLPEDDRHT
FT                   YSRDYLLDSIAILMGGRVAEELAFNQRTTGASNDIKRATQLARRMVCEWGMSEDMGPVS
FT                   FGRQEEQVFLGRDIAQHRDFSEQTAIFIDKEVRRIVDENYLRARQMLSDRFTLLEKIAE
FT                   GLLERETLDLRDIDRIILEVDPGLYDEIKRREPPRPPELEIAVDGVGTQEAVAEQPEGG
FT                   TASPDSTSASEQKNQGT"
FT   gene            complement(671325..672548)
FT                   /locus_tag="Sfum_0552"
FT   CDS_pept        complement(671325..672548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0552"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   gsu:GSU0773 multidrug resistance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16251"
FT                   /db_xref="GOA:A0LFP9"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFP9"
FT                   /protein_id="ABK16251.1"
FT                   /translation="MNPDDPSLKSTVAFVRLLFLCCIVCFFCYVGAYMRVPVVPLFALS
FT                   LGADAFEVGLINSSFLFMAALLSLPLGIVSDRLGRKSLILGGILLTSLSSFLLCLCRNP
FT                   MQMVLVYLLFGVGLAAFAPTLMSYVADFAPATHLGRSYGYYTMALYGGMSLGPALGGAL
FT                   AEVTGYPAVFAISGGFGFLMFCLVLVLLPRTPRTAAHSSRKLDSMAVAGTFLTNRPLLG
FT                   CWMGTLGGCFGLGMFVTFVPLHAAEQGISVASIGLIFASQSLFNAVARIPFGHFTDRVK
FT                   DRGAVVVFGLIGFSIAVSGIAFSTGIFHFIGFSIALGITMSLTFTALGALISEVVPHDS
FT                   RGLAMGGYSTCIYLGMMLSAVSMGALARDLGFKSAFLVTAGVIALTGVVFRAFVTRIPP
FT                   SPSAGNLL"
FT   gene            complement(673208..673657)
FT                   /locus_tag="Sfum_0553"
FT   CDS_pept        complement(673208..673657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16252"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFQ0"
FT                   /protein_id="ABK16252.1"
FT                   /translation="MRSVHAGCNAAKILIIVLAALITASCGMATKEEKQHEQFVAAIDG
FT                   YNAAFRWQDYKTASGFVDPANQEAFWKEADAFLKEVRIMDYEIRNVSFEANGLRGTVFI
FT                   NCRFYLTREPSLQSKMIRQTWQFLEKPKTWQVTNSGYQAILAQTQ"
FT   sig_peptide     complement(673562..673657)
FT                   /locus_tag="Sfum_0553"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.818) with cleavage site probability 0.657 at
FT                   residue 32"
FT   gene            complement(673761..674336)
FT                   /locus_tag="Sfum_0554"
FT   CDS_pept        complement(673761..674336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16253"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFQ1"
FT                   /protein_id="ABK16253.1"
FT                   /translation="MATASARNGTEERRTPFERLSRRNARPVFFTSSTHAAGVLFMTPP
FT                   APLSRKDRRGPFFSVGSVSAPSGEGAILPPLPAATARFPGCAIPRGRVAPRGVNLRAAH
FT                   ADYEKKEPTGKPAGEKTFVKRPSDARECFESSGFRILRGTNAGNHVQHAPWEDATTVGS
FT                   GSGRSSSLPQKPGESAAAAGAGNDLQLS"
FT   gene            674588..675100
FT                   /locus_tag="Sfum_0555"
FT   CDS_pept        674588..675100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16254"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFQ2"
FT                   /protein_id="ABK16254.1"
FT                   /translation="MCRDDCYAFRRNRGDDDGMLEKLIRSGKIKEHFFMKRKDTPRNEL
FT                   ESPESAIPSSGSAAVPEREDNGLFLLEDGKLRPFSLEEYTAATLYEVVESFGVECKLVR
FT                   PEDPGNVLFEGKRPSRKTVPIFIKKDGDCALVASWETVEANPEQLAEVREVLGAIPVRQ
FT                   AFVLRRK"
FT   gene            675489..677153
FT                   /locus_tag="Sfum_0556"
FT   CDS_pept        675489..677153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0556"
FT                   /product="peptidase C14, caspase catalytic subunit p20"
FT                   /note="PFAM: protein of unknown function DUF323; peptidase
FT                   C14, caspase catalytic subunit p20; SMART: peptidase C14,
FT                   caspase precursor p45; KEGG: dps:DP2442 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16255"
FT                   /db_xref="GOA:A0LFQ3"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR015917"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFQ3"
FT                   /protein_id="ABK16255.1"
FT                   /translation="MLGLSTKTFLLMMATVLLAASGPVDRVWGADAAPPVENASQAEQR
FT                   TALVIGNGAYASAPLRNAVNDARTMGETLKGLGFDVVEHENLNQKEMKKEIQAFGQRLL
FT                   KGGVGLFYYAGHGMQVNGRNYLIPVGAAIEHEKQVEYEAVDVGAVLTEMDYARNRLNIV
FT                   ILDACRDNPFARSFRSSMQGLASMNAPTGTIVAYATAPGAVANDGPGDHGVYTGELVKA
FT                   MEAPGLRIEDVFKQVRSSVRETTQGKQVPWESSSLEGDFYFKFPTAATPPVPVPDKPVP
FT                   VPQTVTARGEKPARTLKTWKEPITGMEFVWVPGGCFLMGSPQTEKDREADEGPVHEVCV
FT                   DGFWMARTEVTNGQFRKFRADHNSRDYSGVSLNGDNQPVVYVTWNDANDFAQWLKGQNG
FT                   GQYKFRLPTEAEWEYASRAGKESSRYWGDDPNKACTHENVADLTAKRQWKWEESHDCDD
FT                   GYAAIAPVGTFQANDFGIYDMLGNVWEWCEDIYGVDAYTRHDRMNPSFTDRTAGTGRVV
FT                   RGGYWHSQPGGARCADRGSGLPEAMNDDLGFRLVREP"
FT   sig_peptide     675489..675548
FT                   /locus_tag="Sfum_0556"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.971) with cleavage site probability 0.628 at
FT                   residue 20"
FT   gene            677187..677927
FT                   /locus_tag="Sfum_0557"
FT   CDS_pept        677187..677927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16256"
FT                   /db_xref="InterPro:IPR025493"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFQ4"
FT                   /protein_id="ABK16256.1"
FT                   /translation="MRLRGEGEMFIFRNRMEWSVPARMVMSVLAICACLLLSNVCFTGA
FT                   AETPAVEFKWAFGALTEEDGQSRIVPVGRDAALKTGDRLKLMIEMKRKSFIYVFHHNER
FT                   DGLTLLFPYSFEQFTADYRPAVKYYIPRGEAWFELDKQPGTEKFYLLASAERLLGLEAL
FT                   YTSYRAGDAQTKHQLSNKILDKIRTLKRQGRDLAAPAERPVAIGGAVRGVPKQAGPALP
FT                   DVATLAEEIASSGVVSRTYNVEHK"
FT   sig_peptide     677187..677324
FT                   /locus_tag="Sfum_0557"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.606) with cleavage site probability 0.311 at
FT                   residue 46"
FT   gene            677914..679911
FT                   /locus_tag="Sfum_0558"
FT   CDS_pept        677914..679911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0558"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   CHASE2 domain protein; KEGG: sat:SYN_01481 adenylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16257"
FT                   /db_xref="GOA:A0LFQ5"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFQ5"
FT                   /protein_id="ABK16257.1"
FT                   /translation="MSTSRRGNVRATTALVVASFAVVALCFRLLPWVFEPWNSQLVDKL
FT                   FVLRSSVSWLRPVYDPTVVHVDITNSTLHRLDDFYLKRVQFARVVRNLAAMRTAAQAYD
FT                   FIFGTKPDDRDDPALIAAAREAGNAYFGLALALSPQRAARETKVDEEALRTLASTKWVL
FT                   NVEGDVTGFHRGSAPLATFPALAAVSKGLGHISIKIDADGIVRRVPLLVRYEDGFYPSL
FT                   PFRVICDYLGVPPQHIRVVPAEAVVLQQARRPGAPPRDIRIPIDRAGSMIVSFIGPWET
FT                   MKHYNFADVYIASDSRDELEVWRDELEGKIVVVSDVSTGSTDLRPVPTDTEYPLSGMHA
FT                   NAIHTILTEDFFRESTAAEAFLVELSLMACLIVLARSFSSVAFTASAAGMVALCAGGAL
FT                   VSFFSLHAIPQVVRPVLSIGLAVFLVLAYRYINEEKQKEVYRRSFEAYFPPAVVKKIMA
FT                   HPESMAMSAQRKELTVLFSDIASFTTYSSALAPDRIRGFLNEYFDAMVEIVFNHGGTVD
FT                   KYIGDGLMVFFGDPEPQEDHATRCVQAAIDMQRRVRELQNAWRNAGGFPLAVRIGINTG
FT                   EVVVGNMGSRRQFSYTVLGSPVNLAQRLESNAPVGGILISERTRQLIGDGFQTKALGEI
FT                   KVKGIAEPVAVHEVTVSQGEVQDSNSAGNV"
FT   sig_peptide     677914..678015
FT                   /locus_tag="Sfum_0558"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.769) with cleavage site probability 0.293 at
FT                   residue 34"
FT   gene            complement(679995..681566)
FT                   /locus_tag="Sfum_0559"
FT   CDS_pept        complement(679995..681566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0559"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: Forkhead-associated protein; adenylyl cyclase
FT                   class-3/4/guanylyl cyclase; GAF domain protein; KEGG:
FT                   mxa:MXAN_3956 putative adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16258"
FT                   /db_xref="GOA:A0LFQ6"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFQ6"
FT                   /protein_id="ABK16258.1"
FT                   /translation="MARLIIHDTEGVQEIDLVDRNSIGRLSRNRIRIADDLVSKEHCLI
FT                   YLDPRGGYGIKDLGSQNGTFVNGHRIVRETPLSDRDVVTIGRTSCIFLAGDLPHGTSDG
FT                   MEATIQFMDADRSWSQIAQDRFLPEEEIWDEKVLRADYEKLRIAHELQREIGLELNLDR
FT                   IFNRILDRTFQLLNCDRAVILMVGENGGMEVRASKTRHSGEDLVVSSTLVNFVREHKVG
FT                   LICGDALADERFSCAESICNRNIRSSMAVPIVYEQELLGVMIIDSSASVRAYAEKDLLL
FT                   FNNIAHQTSQFTMMAKMAKRIEEEALTRERFQRLMSPDLAEMVVSGSIKVEKGGQNRVA
FT                   TILFADIRGFTSMCENMRAAEVLIMLNEFFELMVDVGFRHEGTVANFIGDMIMLVWGAP
FT                   VFHPDDPVRAVQAAVEMQEVLAEYNRGRREKGLPEIGVGIGINTGDLMAGYLGSTRTMT
FT                   YSVIGDPVNVASRLCALARQNQILISEHSRLSVDNHFETAEISTVKVKGRKAPIRIYEV
FT                   VGRKRN"
FT   gene            complement(681773..682558)
FT                   /locus_tag="Sfum_0560"
FT   CDS_pept        complement(681773..682558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0560"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   mxa:MXAN_3502 adventurous gliding motility protein AgmI"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16259"
FT                   /db_xref="GOA:A0LFQ7"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFQ7"
FT                   /protein_id="ABK16259.1"
FT                   /translation="MGTPPKISARNLEQQQAARNQKRFVFSLGPRQIVLCAAGLLLAMC
FT                   WMFIFGILVGRGLPMISSEDVSVRAEFMRFLGLDRPPPSTVEKAAETWQAPEKMLESLK
FT                   YYEELTRKEVFTQAKTAVPPGAPSTSPAAKDAAADTRNKPTKSLPVPLSTPDKPESSDS
FT                   EKTGSGAGGQEPVAANNASEHFTLLVASLKDADNAQKLVEQLRAKGYAPRLHTLDLNGG
FT                   GRWNRVLVGSFRNRESALKFAADFNKKERMEGLVIRESN"
FT   gene            complement(682590..684269)
FT                   /locus_tag="Sfum_0561"
FT   CDS_pept        complement(682590..684269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0561"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: sat:SYN_00994 arginyl-tRNA synthetase;
FT                   TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16260"
FT                   /db_xref="GOA:A0LFQ8"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFQ8"
FT                   /protein_id="ABK16260.1"
FT                   /translation="MSTVRNVLIGMLSDSLSRLLPEASEHLDPTCIELDIPKLPEHGDY
FT                   ATNVALALTRRLKRNPREIAGKIVGGLNDPDNLLQKVEIAGPGFINFFFHPRAWHGILT
FT                   DILADPRNYGRLDLGEGHRVQVEFVSANPTGPLHIGHGRGAATGDALANILEACGYAVE
FT                   REYYINDAGNQMDTLGRSLYFRYQEALGEPVEFPDAHYRGEYMKDLARDFLRDNGDRYL
FT                   RAPLDEVLPLFTRFAADRILEGIKDDLGEFGVSFDQWFSERSLHAEDAIRRTVEDLNRR
FT                   GFIYESEGAVWFKSTAFGDEKDRVVIRANGVSTYFAADLAYHRNKYDRGYDKVVDIWGA
FT                   DHHGYVERMLAGVEALGRNREDLRIVLVQLVNLLRAGKPVAMSTRAGEFVTLREVVDEV
FT                   GKDAARFIFLTRRSDSPLDFDLDVAKARTNDNPVFYVQYAHARLCSIFQVAAERGLVCD
FT                   WANGKDIPDLGLLTLAQELQIIKFLGEYPAILANCSRSMEPHFIPYYLHELVSLFHSYY
FT                   NQNRVIGDDPELTRARLFMAAAIREVIRNALELLGVSAPEKM"
FT   gene            complement(684478..685605)
FT                   /locus_tag="Sfum_0562"
FT   CDS_pept        complement(684478..685605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0562"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: mta:Moth_2167 alanine racemase; TIGRFAM:
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16261"
FT                   /db_xref="GOA:A0LFQ9"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LFQ9"
FT                   /protein_id="ABK16261.1"
FT                   /translation="MAHSWVEIDLAALRHNYSRAKERLAPGSRILGVVKSDAYGHGMIP
FT                   VARELVACGASFLAVSKHWEAVDLRAAGIRLPILCLLGVEPSEMAEAIRNEIRPVIYRI
FT                   DHARRLSDTARSLNATATVHVKLDTGMGRLGIPCRHLEAFLNELLTLPAIRLEGVLSHF
FT                   ASADEADKTSSTLQLTRFREAMALLSARGLSVLGHIANSAGLLDLPQAHFDLARPGIML
FT                   YGSPPSLELHKPADLRPVMTFKSKIIQLKDVQAGQPIGYGGTFVTAAPGRIATIPVGYD
FT                   DGYPRLLSNRGRVLVRGMSAPVVGRVSMNMITADVTHIPSAREDDEVVLLGAQGTERVT
FT                   AEEIAQLCGTISYEIYCSIGRNRFKSFHNGIANSN"
FT   gene            686122..686325
FT                   /locus_tag="Sfum_0563"
FT   CDS_pept        686122..686325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP2542 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16262"
FT                   /db_xref="GOA:A0LFR0"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFR0"
FT                   /protein_id="ABK16262.1"
FT                   /translation="MHAGYLLTVLGLICFLEGLPYLASPDYLKKWLIEVVIPAPSRYLR
FT                   LFGGVLMVLGLLFVYWGRRHGG"
FT   gene            686315..687388
FT                   /locus_tag="Sfum_0564"
FT   CDS_pept        686315..687388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0564"
FT                   /product="Queuosine biosynthesis protein"
FT                   /note="PFAM: Queuosine biosynthesis protein; KEGG:
FT                   hch:HCH_04470 S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16263"
FT                   /db_xref="GOA:A0LFR1"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFR1"
FT                   /protein_id="ABK16263.1"
FT                   /translation="MADERISYRLREYDYDLPPSLIAQSPLSRREESRLLVLDRGRGAM
FT                   DHVRFRDLPDHLHAEDLLVVNDTRVVPARLIGFKDSGGRIELLVTEPYKSEAEGRRDGY
FT                   WCLAAAAKRTRPGCLISLPDGTVAEVLEAGDGGRIRVRFPDDRPLMTILSEIGAVPLPP
FT                   YINRSGTGDFPGDAEAYQTVYARNPGAVAAPTAGLHFSSALLEAVARAGVEVVRITLHV
FT                   GYGTFAPIRVDDIRDHEMHPEYVRVDEDSTERIRSAIDRKRRIVAVGTTVVRSLEWIAH
FT                   RRGEIMPAAGACAHYIYPGYRFKVVDAMITNFHLPRSSLLLLVSAFAGRRRILEAYREA
FT                   IRREYRFFSYGDAMLIL"
FT   gene            687464..688585
FT                   /locus_tag="Sfum_0565"
FT   CDS_pept        687464..688585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0565"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="KEGG: gsu:GSU2619 queuine tRNA-ribosyltransferase;
FT                   TIGRFAM: tRNA-guanine transglycosylases, various
FT                   specificities; queuine tRNA-ribosyltransferase; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16264"
FT                   /db_xref="GOA:A0LFR2"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LFR2"
FT                   /protein_id="ABK16264.1"
FT                   /translation="MDFRIIARDASCHARRGRLRTAHGTFDTPVFMPVGTQASVKSLSP
FT                   DELEDLGAHIILGNTYHLLLRPGAERVARLGGLHRFMHWNRSILTDSGGFQVFSLARIN
FT                   RIEEDGVVFQSHIDGARHAITPETSMECQMQLGSDIAMCFDECTAYPVTYEYARESMLR
FT                   TVRWAARSKEAHTLPEQSLFGIVQGGVFCDLRRDCLERLVETGFDGYALGSLSVGESKE
FT                   EMLSVLEAVAPGLPAASPRYVMGVGTPEDLVEGVRCGVDMFDCVMPTRNARNGMLFTVR
FT                   GGIQIKNSRYADDDRPIEEGCSCYTCRRFSRAYLRHLFLARELLAYRLNTLHNLHYYLG
FT                   LMAAMREAIEANAFDRWRRSFYLDRENREPAEE"
FT   gene            complement(689051..689791)
FT                   /locus_tag="Sfum_0566"
FT   CDS_pept        complement(689051..689791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mth:MTH145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16265"
FT                   /db_xref="GOA:A0LFR3"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFR3"
FT                   /protein_id="ABK16265.1"
FT                   /translation="MVRLSWKVCVGLILVASSLLLGIIHVVLFKDPQTLLFYLVLDIVF
FT                   VPVQVLLVTIIIERLLNEREKQSMLNKLNMVIGAFFTETGTTLIKQMGHTCMDLHELEQ
FT                   HLAVSDDWDNTRYVIAMRHIEDFTCRFGLPIEQLERLKAFLLSKKGFLLGLLQNPNLLE
FT                   HDSFTDLLWAVCHLSEELEARGDLSGLPPSDLRHIENDIRRAFGILVREWLVYLHHLRS
FT                   HYPHIHSLHVRTNPFNPQASPVVQ"
FT   sig_peptide     complement(689699..689791)
FT                   /locus_tag="Sfum_0566"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.647) with cleavage site probability 0.433 at
FT                   residue 31"
FT   gene            complement(690219..690422)
FT                   /locus_tag="Sfum_0567"
FT   CDS_pept        complement(690219..690422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0567"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; SMART: Cold
FT                   shock protein; KEGG: sat:SYN_02175 cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16266"
FT                   /db_xref="GOA:A0LFR4"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFR4"
FT                   /protein_id="ABK16266.1"
FT                   /translation="MAEGRVKWFNEKKGYGFIETDGQGDVFVHYSAIEGAGFRSLNEGE
FT                   QVRFEVEQGSKGPQAVRVQRVQ"
FT   gene            690939..692000
FT                   /locus_tag="Sfum_0568"
FT   CDS_pept        690939..692000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0568"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: gsu:GSU2429 PPIC-type PPIASE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16267"
FT                   /db_xref="GOA:A0LFR5"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFR5"
FT                   /protein_id="ABK16267.1"
FT                   /translation="MMRKGSRWIPAILASFFVVVFLSPVGAAEKAAKKDAKPTAASNET
FT                   AAKSGASKEPAKGEKVAVVNGTVITRAEYESETKRFERQMAMSGQAPDGAQVAEMKKKV
FT                   LDGLVGREVLKQQAAKLGVKVDPAEVDKEIATLKQRFPNEDEFKKALKNLNLTEESLKA
FT                   QFTQDLGIRKMIDEQVASKITITPEETKKFYDGNPELFKTPEMVRASHVLIKVDPKAGD
FT                   ADKAKAKERITAAQKKVQAGEDFAKVAKEVSECPSAAKGGDLDFFQRGQMVGPFEQAAF
FT                   ALKVGSVSDIVETQFGYHVIKVTDKKEAGVMKYDEIKDRIAQHLKQDRVNQQLAKYIEE
FT                   LKAQAKIEIFPVN"
FT   sig_peptide     690939..691022
FT                   /locus_tag="Sfum_0568"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.978 at
FT                   residue 28"
FT   gene            692193..693770
FT                   /locus_tag="Sfum_0569"
FT   CDS_pept        692193..693770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0569"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sat:SYN_01420 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16268"
FT                   /db_xref="InterPro:IPR025393"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFR6"
FT                   /protein_id="ABK16268.1"
FT                   /translation="MERVLFSDADRRQIESHGLTVDRVLAQIEIFRKSSSLITLDRPCT
FT                   VEDGVHKILTSEIERFLRYHESAAQAERFMKFIPASGAATRMFQSLLQIYYMPQFLDVE
FT                   ELHRRVGQGVAVACDFMTFLEGLYLFPFVGDLEKVLQADGFSLAMLIRHCEYRTILEYL
FT                   LTERGINYGNLPKCLLKFHRYPDETRTAFEEHLTESAFYMGKRSGRCRVHFTVSIDHEE
FT                   RFKRLMEKVRVAYEERYGTTYEIGYSFQKRSTDTIAVDMENRPFRDRYGRLHFRPGGHG
FT                   ALIENLNDLKGDIVYIKNVDNLIPDRHKDHIVFWKKVLAGCLAEIQDTVHGYLRRLVEE
FT                   PSPELIEEMESYARGKLLIRFPDDFAARSLEERGRVLMNRLNRPIRVCGVVPNSGEPGG
FT                   APFWVAHDNGDVSIQIVEKAQVDFDSARQRETWMSSTHFNPVDLVCGLRDFAGNNFDLR
FT                   RFIDDDAVFITRKSKDGKDLKALELPGLWNGSMAGWITHIVEVPKITFNPVKSVFDLLR
FT                   PEHQPEEY"
FT   gene            694344..695870
FT                   /locus_tag="Sfum_0570"
FT   CDS_pept        694344..695870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0570"
FT                   /product="transcriptional regulator, NifA subfamily, Fis
FT                   Family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; GAF domain protein;
FT                   SMART: AAA ATPase; KEGG: sat:SYN_01633 nif-specific
FT                   regulatory protein with sigma 54 interaction domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16269"
FT                   /db_xref="GOA:A0LFR7"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFR7"
FT                   /protein_id="ABK16269.1"
FT                   /translation="MSENYNLEELRTLHEIARVVSRSAELKDQLQQTLDILSSRLGMER
FT                   GMVSVLDLQTGEAWLDVARGVDVERGTIRYRPGEGITGKVAQSGRPMGIANLGDEALFL
FT                   DRTGARRSLNREELAFLCVPIFYQGRSVGVLSADKLARRVEDLDKEVEILSAVAELLGK
FT                   VVHFRAVEEENSRLRRMLAEARRPTTNIIGRSKVIQEVLRAIDQVADTNTTVLISGETG
FT                   TGKELVARAIHDNSRRAKGPLVQVNCAAMPDTLLESELFGHEKGAFTGAVTRRRGRFEE
FT                   AQGGTIFLDEVGELSPIAQAKLLRVLQEREFQPLGSSRTVKVDVRVITASNKDLEKEVA
FT                   LGTFRSDLYYRLNVFPIFLPPLRERGPDILLLADYFVLKYARELDKDVKRITTSAIDML
FT                   MCYHWPGNVRELENCIERAVLLAGGNAVDSWHLPPTLQMKPVGMQNVSRGKLEALVSAF
FT                   ERDLITDALKDVRGNQSQAARLLGTTKRIVQYKVEKYGIDPRRFRVKAPA"
FT   gene            695908..696186
FT                   /locus_tag="Sfum_0571"
FT   CDS_pept        695908..696186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16270"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFR8"
FT                   /protein_id="ABK16270.1"
FT                   /translation="MGPPRSRTPGGRAIAVKRSKAIPGDSERQGIMARFLPLEAAAGGQ
FT                   ARFPADNPAVCAAGLKAPDFPEPSPSPGRPSSAVHGEPESDRIRECE"
FT   gene            696177..697835
FT                   /locus_tag="Sfum_0572"
FT   CDS_pept        696177..697835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0572"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /note="KEGG: aba:Acid345_2524 NAD+ synthetase; TIGRFAM:
FT                   NAD+ synthetase; PFAM: Nitrilase/cyanide hydratase and
FT                   apolipoprotein N-acyltransferase; NAD+ synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16271"
FT                   /db_xref="GOA:A0LFR9"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFR9"
FT                   /protein_id="ABK16271.1"
FT                   /translation="MRIAIGQIDPFIGDFKGNAAKICDGVDRARREGCDLVVFPEMALI
FT                   GYPPRDLLDKPSFVRTSREHWEAIREASRGIGVIFGAVDENPNGTGKPYHNAAVFFDDG
FT                   KPAAIAHKMLLPSYDVFDEERYFEPGKHATWVDFRGERLGITICEDVWNVPRFLPRRLY
FT                   HCDPIRELEQASVSVIVNISASPYHVGKASYVGELLRSHAQRSGTQVIYVNQVGGNDEL
FT                   IFHGHSMVWDEAGKLVASAADFREDFVVYDTRTHAGKLHAVGGDQAEEVIEALVLGLRD
FT                   YVRKNRFGKAVVGLSGGVDSALTVCLAVLALGAENVLGVGMPGPFNAPESLEDAKELAR
FT                   RLGIAFETVPIGDLFDAALRTLAPPFHGQPRDVTEENLQARIRGMILMAISNKFNRILL
FT                   STGNKSEIAVGYCTLYGDMNGGLSVLGDVPKTMVYELARKLNAQHDWIPERTLVRAPSA
FT                   ELRPDQTDQDTLPPYEVLDAILADYVEKRLPAEEIASHGWDAALVKWVTDRVDCNEYKR
FT                   WQAPPILRVTTKAFGMGRRNPIAHGYREGGARQCS"
FT   gene            697884..698222
FT                   /locus_tag="Sfum_0573"
FT   CDS_pept        697884..698222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0573"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   ade:Adeh_4248 nitrogen regulatory protein P-II (GlnB,
FT                   GlnK)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16272"
FT                   /db_xref="GOA:A0LFS0"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFS0"
FT                   /protein_id="ABK16272.1"
FT                   /translation="MKKIEAIVKPFKLDDVKEKLTALGIKGMTVTEVRGFGRQKGHTEI
FT                   YRGAEYVVDFLPKIKIEVAVADVQVVEVVQAIRSAANTGKIGDGKIFVIPLEECIRIRT
FT                   GETGEEAL"
FT   gene            698236..700830
FT                   /locus_tag="Sfum_0574"
FT   CDS_pept        698236..700830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0574"
FT                   /product="UTP-GlnB uridylyltransferase, GlnD"
FT                   /EC_number="2.7.7.59"
FT                   /note="KEGG: gsu:GSU1820 protein-P-II uridylyltransferase,
FT                   putative; TIGRFAM: protein-P-II uridylyltransferase; PFAM:
FT                   amino acid-binding ACT domain protein; metal-dependent
FT                   phosphohydrolase, HD sub domain; GlnD
FT                   PII-uridylyltransferase; SMART: metal-dependent
FT                   phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16273"
FT                   /db_xref="GOA:A0LFS1"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFS1"
FT                   /protein_id="ABK16273.1"
FT                   /translation="MHLRPQLSRKLKDLRETFQQMCREDVPGVLAARTYAHQFHESLRK
FT                   AFPETVVPEDGWGLLAVGGFGRGELGFASDIDLLLLYRNRLVKSHEALFKELVYCLWDS
FT                   GFEVGHATASLSSMKRMAQDDFTVLTNILEARLIAGDPKLFSEWRESFFNGFGRQSRKK
FT                   FLQNLVGYREERQQQYGGSSYLQEPHVKEGVGAMRDVHILRWAGHVFLRDPSFAAMVRK
FT                   ELMTNQEKLWLEQAYDFLWRVRLQLHRLTGRRQDQLLFMEQEQIAERFGCMAGQQGSAV
FT                   EVFMRLYYRHTSRIRRTASFFLERVGETQKSFPGLRPRRRILPGPFLLEGKHLNFMEPE
FT                   WIKKDPRLLMRFFWQAALSDAHFHHQAGQIIRENLAVFTDEARRDPEVVKQFFDILLDS
FT                   EHAFSVVNVMLETGFLEVFIPEFAAVRYRVQNDVYHLYTVDEHLLRTVWQMHQMERGDD
FT                   EVAGELNPSDIFVHVKSRRVLYLAALVHDIGKGDGRNHAVRGGAMAGPIAERLGLDTHE
FT                   TGLLRFLVEHHLILAETALKRDLMDEKPIAQCAIQIKDRERLQMLYLLTIADSRATGPG
FT                   AWSTWKASLVRELFVKVDRVLARGDLQGQDLEQRSGEVQENVLDLVSDPAERERVRHWL
FT                   ERVSYRYLLSQAPTAIVEHHRMERALGNKPLVLASSPAEGEMWQLTVVTADRPGLFALI
FT                   TGVLWARGLNILSADIFTWESGVALDVLIVERLPDPLHPRELWERVEADLGRALEHRGY
FT                   LDELLSNKRKPSILQQKNLPRKDDIVLVDEEASDFYTIIEVYTWDRPGVLHCITDTLYH
FT                   LDVSIQLAKISTPGAQVADVFYVTDLSGNKLMDYEMHEKIRVSLLDSLTRVG"
FT   gene            701056..701313
FT                   /locus_tag="Sfum_0575"
FT   CDS_pept        701056..701313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16274"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFS2"
FT                   /protein_id="ABK16274.1"
FT                   /translation="MHSMEGFHSGFRMLGADRAEKSRRGENFFHWGRRSSPRTRQPMLR
FT                   RSSRGVFSPPGEGEMYTGRPGIKKVARHGFRTGFGKLFAY"
FT   gene            701361..702773
FT                   /locus_tag="Sfum_0576"
FT   CDS_pept        701361..702773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0576"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="KEGG: gsu:GSU1835 glutamine synthetase, type I;
FT                   TIGRFAM: glutamine synthetase, type I; PFAM: glutamine
FT                   synthetase, catalytic region; glutamine synthetase,
FT                   beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16275"
FT                   /db_xref="GOA:A0LFS3"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFS3"
FT                   /protein_id="ABK16275.1"
FT                   /translation="MTPKEVLAYAKQNGAKMVDFKFMDFVGTWQHFTNPIDELGESDFE
FT                   NGYGFDGSSIRGWQPIHASDMLIIPDPTTAKMDPFMAVPTLTMICDVVDPVTKERYTRD
FT                   PRYIAHKAEEYLKFTGIGDAAWFGPEAEFFIFDDIRFDDGCQFGYYHIDSVEGIWNSGR
FT                   VENPNLGYKPRHKEGYFPVPPVDSQQDLRTEMVLKMMEVGIPVECQHHEVATAGQAEID
FT                   MKASTLVKMADNLQWYKYVVKNVARRFGKTVTFMPKPLYGDNGSGMHIHMSIWKEGKPM
FT                   FAGDKYAGLSEMALFAAGGVLKHAAAICAITNPTTNSYKRLVPGYEAPVNLAYSSRNRS
FT                   ASVRIPMYSASPKLKRMEVRFPDPSCNGYLAFSALLMAALDGIENRIDPGEPLDRDIYS
FT                   MTPEELADVPSTPGSLDAALNALESDHEFLLKGDVFTEDVIEKWIEYKRLNEVDPIRMR
FT                   PHPHEFKLYFDV"
FT   gene            703428..704192
FT                   /locus_tag="Sfum_0577"
FT   CDS_pept        703428..704192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0577"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sat:SYN_01193 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16276"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFS4"
FT                   /protein_id="ABK16276.1"
FT                   /translation="MSEDAKPKCIAELSQGQLVRWVIEGLRCTMIHYGYWFREVESRLG
FT                   FERAAEAEATAGDRVLGIVMRRLGAAMGFEVDDRGYPAALTAMSREELLNLIDAVCANW
FT                   LANDGVWFREVEKPFGMVSAKHANDMCWGRFSLYEAFRIKRFLELPKLPGLDGLKTALA
FT                   FRMYSRINKQSIEDVDEHSFIFRMEECRVQMARKRKGLPDYPCKSAGMIEYPYFASAID
FT                   PGIETECIGCPPDRHPEGWFCAWKFMLKPRGR"
FT   gene            704438..704767
FT                   /locus_tag="Sfum_0578"
FT   CDS_pept        704438..704767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0578"
FT                   /product="phosphoribosylaminoimidazole carboxylase ATPase
FT                   subunit"
FT                   /note="KEGG: sat:SYN_01067 phosphoribosylaminoimidazole
FT                   carboxylase ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16277"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFS5"
FT                   /protein_id="ABK16277.1"
FT                   /translation="MKLRLPENIFQSIPDEIPEEVCEAIVRTDTIVIERIVSHGQASHE
FT                   GFWYDQEKSEWVMVLQGRAGLLFEGWEEPVVLQTGDWINIPAHAKHRVEWTDPNEKTIW
FT                   LAVYY"
FT   gene            complement(705058..705483)
FT                   /locus_tag="Sfum_0579"
FT   CDS_pept        complement(705058..705483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0579"
FT                   /product="nitrogen-fixing NifU domain protein"
FT                   /note="PFAM: nitrogen-fixing NifU domain protein; KEGG:
FT                   dps:DP0957 similar to nitrogen fixation protein (NifU)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16278"
FT                   /db_xref="GOA:A0LFS6"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFS6"
FT                   /protein_id="ABK16278.1"
FT                   /translation="MDDKTLDFWRNHSVRFLEMALTDHYREVPANPDGYARVVRECGDT
FT                   VEMFLMVRDGKIRTASFETNGCIYSVACANTAVHMASGLTPEEARRITPDQIVEFLETL
FT                   PPEEEHCAEQAVKALRLALADARDGERQPWKKYYQRR"
FT   gene            705847..706170
FT                   /locus_tag="Sfum_0580"
FT   CDS_pept        705847..706170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16279"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFS7"
FT                   /protein_id="ABK16279.1"
FT                   /translation="MEGRCKRHTHYTTDVFYRPLQASSPAAGGLGAYSVTYAYDQRANG
FT                   KGHLTTVTDPSGSTLSNHDARSRLWEKKSTVSGFEFTFSRAFSPAGRLRRVEVGPVSGS
FT                   SRG"
FT   gene            706395..708641
FT                   /locus_tag="Sfum_0581"
FT   CDS_pept        706395..708641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0581"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: bja:bll1715 two component regulator; TIGRFAM:
FT                   PAS sensor protein; PFAM: ATP-binding region, ATPase domain
FT                   protein domain protein; histidine kinase A domain protein
FT                   domain protein; PAS fold-3 domain protein; SMART: PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16280"
FT                   /db_xref="GOA:A0LFS8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFS8"
FT                   /protein_id="ABK16280.1"
FT                   /translation="MRSMEHAGKAAAFLFLGLLFLAVSHGSSASVPVKRILLLFPFESS
FT                   VPGFISYDNSLRSTLTASKDYQFEFYVECMDLTRFTSKDYRDKLVGLYREKYSGIEIDL
FT                   VVALLRPSLDFVAEHSPETFQNVPVIVVEQDPRLLGDLPSTSLAAVVTGKLDMEGTLAL
FT                   ALRLHPDARKVFVVSGVSRYDELVHGLAREGFRGFENQVDLQYLSGLPMDELIDRVAKV
FT                   PEHSLVFYLTVTRDGSGKTFRSPEALALLSRQANAPIYSISETYIDYGIVGGHLVSQSV
FT                   LGVRTAQAVLRTLGGERPGDRESSEGGANRYIFDARELKRWGVGEENLPQGSILRHRDF
FT                   SLWREYRWQIVGVFLIVFIQAFLISALFVSRGKQLRADRALRNAESKYRTVADYTYDWE
FT                   DWSAPDGSLNYVSPSCKRITGYSPQEFIENPSLRHEIIIPEDRHIWDRHKAGIGPESES
FT                   REIQFRILTRAGETRWIDHTCRSVTDQNGDFLGIRASNRDVTERRMAEARVQRHRDELS
FT                   HISRVAALGELAGSLAHELNQPLAAILNYANAARRFLAAAEPNLSKVSEALQGIIRDEK
FT                   RAAQVIREVRALIRKQEPHYRALSINKVIRKSVDLFRGDSILTGLSIVTELAPGLPAVR
FT                   GDGVQLQQVLINLTLNAVAAMSGVLPDSPRLVFRTEAWEDQGVKVSIRDFGAGIDEDHK
FT                   DRLFEPFYTTRPEGLGMGLAICRNIIDAHGGTMGAENNPDGGATFYFTLQAAAR"
FT   sig_peptide     706395..706484
FT                   /locus_tag="Sfum_0581"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.948 at
FT                   residue 30"
FT   gene            708638..709258
FT                   /locus_tag="Sfum_0582"
FT   CDS_pept        708638..709258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0582"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; Sigma-70, region 4 type 2; KEGG: aba:Acid345_3713
FT                   two component transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16281"
FT                   /db_xref="GOA:A0LFS9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFS9"
FT                   /protein_id="ABK16281.1"
FT                   /translation="MNPTTIFIVDDDASHRDSLQFLLESAGLEVRSFSSARDFLDGADP
FT                   ETPGCLLLDVLMPGMSGLDLQNELLNAKISLPIIFITGHGTIPMSVRAVKSGAVDFLQK
FT                   PCDEQDLLRAIHRAIEQDRRTRREKEKLREIHKLIDSLSPREHEVFTHLVSGMLNKQVA
FT                   YRLGTTERTIKAHRRRIMEKMKADSMADLVRYAEKLGLGKPQD"
FT   gene            709512..709883
FT                   /locus_tag="Sfum_0583"
FT   CDS_pept        709512..709883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0583"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   aba:Acid345_3714 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16282"
FT                   /db_xref="GOA:A0LFT0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFT0"
FT                   /protein_id="ABK16282.1"
FT                   /translation="MTWKQCTVFVADDDKSVLESLALLLESAGYQSRGFGSAEELLASG
FT                   SVQNACCLILDIKLPGMSGLQLLQVLAASHTPIPVVFITGHDCPGIEAQALGLGAVAYL
FT                   RKPFDEQMLLDAIHPYCVN"
FT   gene            709946..710824
FT                   /locus_tag="Sfum_0584"
FT   CDS_pept        709946..710824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0584"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mca:MCA1015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16283"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFT1"
FT                   /protein_id="ABK16283.1"
FT                   /translation="MRPDTFMKVFASMVLSIMLGGCVQSMRSPALKHAEASGTTETAPV
FT                   VKKNPAEVAASPSGYPFDSAEARRKVNQYETELQRNGGRRDIALVELARLCFTLGELGE
FT                   KSESELHFNKGRYYAECLSKEQPARVEGHYWLAMNLAGLARAGGAGRSLRLLSVIVDEL
FT                   KVALGIDETYDKGGPHRVLGRIRCKAPVWPLSEGNMDQSLEHLRAAVVIAPENSTNHLF
FT                   LAETLYQLGKTEEAVQELERVVSSSCRAAYSAGARDDCQEALALLKKCREEQNCEPAGK
FT                   SVNVASPGKAR"
FT   sig_peptide     709946..710044
FT                   /locus_tag="Sfum_0584"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.716) with cleavage site probability 0.402 at
FT                   residue 33"
FT   gene            711087..711902
FT                   /locus_tag="Sfum_0585"
FT   CDS_pept        711087..711902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA0408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16284"
FT                   /db_xref="InterPro:IPR019207"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFT2"
FT                   /protein_id="ABK16284.1"
FT                   /translation="MILRKLLIAVICLLSACLVAAPGSAAQGQAAVPSGSQADGMAILM
FT                   RTANFLAQAGQFSFRLSAGYDVLQETGQKIEFGEVRQVTLVRPDRMRVDTERSDGEKAQ
FT                   AIFNGQEIIVYSPGDKVYATAGKPGDLDSALRYLVNDLQLRLPLSLMYVRDFPAELERR
FT                   MLSVDVVEKVAAMDVPCIHLAGRTDTVDFQFWIPTEGDPLPRRVVMTYKLAEGQPQFWA
FT                   NFTEWNLSPNPPQGFFSFTPPEGVQRIAFLAELEVAKPDVKKVKKGGKK"
FT   sig_peptide     711087..711167
FT                   /locus_tag="Sfum_0585"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.389 at
FT                   residue 27"
FT   gene            711899..712810
FT                   /locus_tag="Sfum_0586"
FT   CDS_pept        711899..712810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0586"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syn:slr1774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16285"
FT                   /db_xref="GOA:A0LFT3"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFT3"
FT                   /protein_id="ABK16285.1"
FT                   /translation="MRYGSFQKILSIVTILVFAMFLIALDAEARGGGGRGGGGRGGGGR
FT                   SMSRGGGGGFNRSGPASGGGFSSRSSMGGGGRSYSGGGRSYSGGGRSYSGSRGGQGYGG
FT                   SGRSYSGGRGGQSYGAQGRQAGMGGQRSEMRGQRQGQRTDRAQGRQDTRQGRQEARTQR
FT                   SGDRSDVRSGRQDSRTERQGTRQENRTDRQGTRQEQRTDRQGQRQDAVGDAYDHGYGHY
FT                   DDHWDGGYWGPGYWGAAAVGAAAAYAVGTAISATAYSSLPCTSTTVVVGGVSYRQCGGT
FT                   WYQPAYSGDGVTYVVVNPPPGY"
FT   sig_peptide     711899..711973
FT                   /locus_tag="Sfum_0586"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.949) with cleavage site probability 0.572 at
FT                   residue 25"
FT   gene            713299..713817
FT                   /locus_tag="Sfum_0587"
FT   CDS_pept        713299..713817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP0354 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16286"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFT4"
FT                   /protein_id="ABK16286.1"
FT                   /translation="MGNRTKRLCILLALSLWCLAASQSTVSQVLAAEEGTFTGTWVANG
FT                   SKEVLAFGNGREAALFKLSGHVRLIKKIGKESDFWAECIGLADSETGSDMRCVWRSLDG
FT                   EEIHLILKGTRMEQGSSITGTIIGGTGPAKGITGTIRFTWSMMSFKQATSEAGIGGFAK
FT                   DLSGTYKLP"
FT   sig_peptide     713299..713394
FT                   /locus_tag="Sfum_0587"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.895 at
FT                   residue 32"
FT   gene            713860..715167
FT                   /locus_tag="Sfum_0588"
FT   CDS_pept        713860..715167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0588"
FT                   /product="anaerobic c4-dicarboxylate antiporter, Dcu
FT                   family"
FT                   /note="TIGRFAM: anaerobic c4-dicarboxylate antiporter, Dcu
FT                   family; PFAM: anaerobic c4-dicarboxylate membrane
FT                   transporter; C4-dicarboxylate anaerobic carrier; Citrate
FT                   transporter; KEGG: dps:DP0353 probable anaerobic
FT                   C4-dicarboxylate transporter (DcuA)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16287"
FT                   /db_xref="GOA:A0LFT5"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFT5"
FT                   /protein_id="ABK16287.1"
FT                   /translation="MWIVELLVVLFFIWLGARLGSIGIGYAGGFGVLVLSLGFGLKPGD
FT                   IPFDVILIIMGVIAAIAAMQEAGGLEYLVQVAARVLKKNPKYITFLAPAVTYFMTLFAG
FT                   TGHTAFLALPVIAEVAKKEGIRPSRPLAIGTVASQIAITASPISAAVVFVASALEPVGV
FT                   DYVKLLLITIPSTFIACMLGAIITNFMGKELKDDPVYQDRLAKGLVKDPSESVEEKVLP
FT                   PGAKLSVLIFGLAIVCVVFYATAISPTVGLIKKPILARDHAIISFMLAAASLIALLCKV
FT                   KTNNIVNAATFKSGMSACICVLGVAWLGTTFVSAHLKEINILAGDLLASKPWMLAVVLF
FT                   FAAMLLYSQAATAKALMPVALALGVSPVAAVAAFPSVSALFVLPTYPTLLAAVEFDDTG
FT                   STRIGKYVFDHPFLIPGVLTITFAIVLGYVFGRLIL"
FT   gene            715306..716709
FT                   /locus_tag="Sfum_0589"
FT   CDS_pept        715306..716709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0589"
FT                   /product="fumarate lyase"
FT                   /note="PFAM: fumarate lyase; KEGG: rfr:Rfer_3846 fumarate
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16288"
FT                   /db_xref="GOA:A0LFT6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFT6"
FT                   /protein_id="ABK16288.1"
FT                   /translation="MGYRIEKDFLGEKQIPDDVYYGVQTLRGKENFLITNMPVSKEPNF
FT                   VKAFGYVKKAAAMANRDLGVLDPKIAEAIISACDRIIAGEMLDQFVTDFIQGGAGTSVN
FT                   MNANEVIANLALESLGHKKGEYQYVNPNDHVNFGQSTNDVYPTAFHLGLILRLESYMES
FT                   LGRLRDAFFAKAKEFENVLKMGRTHLQDAVPMSLGQEFHGWGTTVGEEVHRIAEVRQML
FT                   QGVNLGATAIGTTVTAAPGYPELAVKYLSELTGIEFTLAEDLIEATSDTGDYVLLSGVI
FT                   KHTSVKLTKICNDIRMLASGPRCGFGEINLPQLQPGSSIMPGKVNPVIPEVVNQTGFLV
FT                   IGLDLTVSLAASAGQLQLNVMEPVITFALFASIMTMQRAVESLRVNCIEGITANADRTR
FT                   DMVLNSLGIVTVLKPSLGYKQCAEIAREGFLTEKSLHEIVVNERKLLTQEKWDEVFSFD
FT                   NLISPKFEQ"
FT   gene            716855..717346
FT                   /locus_tag="Sfum_0590"
FT   CDS_pept        716855..717346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0590"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA2574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16289"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFT7"
FT                   /protein_id="ABK16289.1"
FT                   /translation="MMKKHKVVLTVFLIAAVVLAAAPVPAQEKAADNMQIVLEKARADK
FT                   KLLVAGNMQLTEAEGKVFWPVYERYQDELFLLRARTLKLLDDYADSYEKLTNEMAKKLL
FT                   DEYMTIETLRLKLHQAYLPKFRKALPDKKVARYYQIENKVQAALMYEFARKIPLAKTDG
FT                   "
FT   sig_peptide     716855..716920
FT                   /locus_tag="Sfum_0590"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.382 at
FT                   residue 22"
FT   gene            717469..718026
FT                   /locus_tag="Sfum_0591"
FT   CDS_pept        717469..718026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0591"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /note="KEGG: dar:Daro_2057 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16290"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFT8"
FT                   /protein_id="ABK16290.1"
FT                   /translation="MRYFHLMLALLTFLFVGSALITPNSASGASAAEINRDVGKALQQL
FT                   YAQSPSAAALGKKARAILVFPSIVKGGFIVGGQYGEGALLMNRKIVGYYNTVQASYGLQ
FT                   AGVQKYGYALFLMTDSALNWVNRSNGWEFGTGPSIVIVDVGKAGSMTTTTLQSDVYAFF
FT                   FSQRGLMGGLGLQGTKVTRISK"
FT   sig_peptide     717469..717564
FT                   /locus_tag="Sfum_0591"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.750 at
FT                   residue 32"
FT   gene            718069..718344
FT                   /locus_tag="Sfum_0592"
FT   CDS_pept        718069..718344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0592"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lip:LI0059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16291"
FT                   /db_xref="InterPro:IPR009200"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFT9"
FT                   /protein_id="ABK16291.1"
FT                   /translation="MIFLNPLLGMAAGATAGTVGGALADVGINGKFMKELAAQLHPNSS
FT                   ALFVLARKATPDKVLDEIKGTGGKILQTSLSHENEAKLAAVLADNQ"
FT   sig_peptide     718069..718143
FT                   /locus_tag="Sfum_0592"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.985 at
FT                   residue 25"
FT   gene            719119..720249
FT                   /locus_tag="Sfum_0593"
FT   CDS_pept        719119..720249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0593"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   mca:MCA0120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16292"
FT                   /db_xref="GOA:A0LFU0"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFU0"
FT                   /protein_id="ABK16292.1"
FT                   /translation="MNIPSQSDYEFEQRVASRFMDILIRAGLILVLAMLCYQVLSPFLT
FT                   LMVWALILAVTIFPLHQFLAGRIGGRQGLAAALLVIVGLMLIVVPTAMLMSSLGDSVHQ
FT                   LVNDVQNNSLKIPAPRPGVEGWPVVGKKVHDIWSRAYADLPALVQSMQPKIGELAKTAL
FT                   GFVAGIAGGLLQFIASFIVAGIIMAFGQSGGRGSLAIFERIVGRERGGEFARLSTSTIR
FT                   AVSQGVIGVAFIQAIIVGLALLVSGVPWAGALALIVLVLGIAQIPALIVTLPAIVYIWM
FT                   SGHYGNAAAVAYTVVLILSGMTDNVLKPLMLGRGVDAPMPVILLGALGGMGTAGILGMF
FT                   VGATLLTLGYQVFMGWVAANPDAGQAQAESESQQAG"
FT   gene            complement(720629..720904)
FT                   /locus_tag="Sfum_0594"
FT   CDS_pept        complement(720629..720904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0594"
FT                   /product="putative regulatory protein, FmdB family"
FT                   /note="TIGRFAM: putative regulatory protein, FmdB family;
FT                   KEGG: dde:Dde_1512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16293"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFU1"
FT                   /protein_id="ABK16293.1"
FT                   /translation="MTAKDITMPLFDFLCLECGKTSEVLVTSSNASPACSECGSVKLKK
FT                   LLSAPSSLSGAPRHGLPGAGDTACCGSSPAQAHCAGPGSCCGRNSG"
FT   gene            complement(720901..721335)
FT                   /locus_tag="Sfum_0595"
FT   CDS_pept        complement(720901..721335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0595"
FT                   /product="nitrogen-fixing NifU domain protein"
FT                   /note="PFAM: nitrogen-fixing NifU domain protein; KEGG:
FT                   mhu:Mhun_2214 nitrogen-fixing NifU-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16294"
FT                   /db_xref="GOA:A0LFU2"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFU2"
FT                   /protein_id="ABK16294.1"
FT                   /translation="MDNQRPGTSQADVEHLQKMLAESGYSRKAIRLFIEKPHMGTIPDA
FT                   DHVSEMTGTCGDTMSVCLKVQDGVIRDLKYQVLGCPGAVASAMAAVELIKGKTIEEARS
FT                   LNDGDIFRLLEEIPAQKHHCIQLAVKTLKKALDEYARKSD"
FT   gene            complement(721874..722575)
FT                   /locus_tag="Sfum_0596"
FT   CDS_pept        complement(721874..722575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0596"
FT                   /product="glutamine amidotransferase class-I"
FT                   /note="PFAM: glutamine amidotransferase class-I; KEGG:
FT                   noc:Noc_2237 glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16295"
FT                   /db_xref="GOA:A0LFU3"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFU3"
FT                   /protein_id="ABK16295.1"
FT                   /translation="MKLHTLQHVPFEGLANLEKWAVKAGFSISCTGLYADAALPRVADI
FT                   DWLVVMGGPMNIYEEDRYPWLVEEKKFIAEAIEKNKIVLGICLGAQLISDVLGGKVYRN
FT                   GEKEIGWFPVSLTPEAAESVVFSALPPRFTAFHWHGDTFHLAPGATRTARSDACAVQAF
FT                   EANGGRVVGLQFHLESSAESIRLLIDNCGDELAPAPYIQRKHEIVSQEHYLGEISTTMT
FT                   TLLDAVKRNFA"
FT   gene            722596..722946
FT                   /locus_tag="Sfum_0597"
FT   CDS_pept        722596..722946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16296"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFU4"
FT                   /protein_id="ABK16296.1"
FT                   /translation="MKGVAGIEPEAPGMPLPRRENREPESLQKPGCAHHVPAVRRVRPA
FT                   GVASARVCRTSSSCTARRAGPFLFPHDSVPRHNLSSSFGGIRLRQRFLTVQSSYRPLPI
FT                   LSPCSDGHRSQS"
FT   gene            complement(723187..723831)
FT                   /locus_tag="Sfum_0598"
FT   CDS_pept        complement(723187..723831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0598"
FT                   /product="signal peptidase I. Serine peptidase. MEROPS
FT                   family S26A"
FT                   /EC_number="3.4.21.89"
FT                   /note="KEGG: gsu:GSU1267 signal peptidase I; TIGRFAM:
FT                   signal peptidase I; PFAM: peptidase S24, S26A and S26B"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16297"
FT                   /db_xref="GOA:A0LFU5"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFU5"
FT                   /protein_id="ABK16297.1"
FT                   /translation="MTKTPIPTDRKPRPRQAVIWEYTRSILLGVVLALLIRTFIVQAYE
FT                   IPSGSMEDTLAINDHILVNKFIYGTKIPFTDLRILEWREPARGDVVVFEYPLDPSKDYI
FT                   KRIIGLPGDRIRIADRQVYINGQLYENPHAIHKGREIVPKLASPRDNTDPIVVPPNSYF
FT                   VLGDNRDNSYDSRFWGFVRKDRIKGLAFIKYWAWDSERHSVRWRSIGDVID"
FT   sig_peptide     complement(723700..723831)
FT                   /locus_tag="Sfum_0598"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.925) with cleavage site probability 0.924 at
FT                   residue 44"
FT   gene            complement(724110..724682)
FT                   /locus_tag="Sfum_0599"
FT   CDS_pept        complement(724110..724682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0599"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   bte:BTH_I1723 RNA polymerase sigma-H factor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16298"
FT                   /db_xref="GOA:A0LFU6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFU6"
FT                   /protein_id="ABK16298.1"
FT                   /translation="MEEDRAVIARIKNGDTGAFAVLVQKYQGRLLTFIHRMVRDGKIVE
FT                   DIGQEVFLDVYKSLRNFDETRGTPFSAWLFIAARNRCVNELRKRTGEHCVHIDAVDAAD
FT                   LGVDLRTAEHLLLEHERRSALRDSLAKISEPLRKPIFMWLNGGSLAEIAEACGVSPGTV
FT                   KSRLFRAREKVRVCVQHQAGGKNHDGV"
FT   gene            complement(724768..725277)
FT                   /locus_tag="Sfum_0600"
FT   CDS_pept        complement(724768..725277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0600"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mag:amb3944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16299"
FT                   /db_xref="GOA:A0LFU7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFU7"
FT                   /protein_id="ABK16299.1"
FT                   /translation="MPTTESPFAGRSFALGACLLERLEEADARPLAKILLSNEPWLTLH
FT                   STLDGIQRYFLRRDPGLWRFTARFDGAPGGVVCVRHPWLFGPYLELIALDRPYQGQGVG
FT                   RDIVRWMERQAKPVSANIWTLVSAFNEPAQRFYAGLGFEEIVPIRDLVIAGHVEILMRK
FT                   TLEEPR"
FT   gene            complement(725264..726301)
FT                   /locus_tag="Sfum_0601"
FT   CDS_pept        complement(725264..726301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0601"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: lip:LI0141
FT                   predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16300"
FT                   /db_xref="GOA:A0LFU8"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFU8"
FT                   /protein_id="ABK16300.1"
FT                   /translation="MPSPENGKKAGGSGGSASGDEHPAHPQSPREPLAFGSRAILDACW
FT                   SGEELEADAPRLERRGPTAVPENLRTAVDFRIARPPLPQSLRNSIRRVRPVGSGKPVAL
FT                   TFDLCETAGGVSGYDAGIVNWLRANRVRATFFAGGKWMQTHPEQTLQLMADPLFEIGNH
FT                   SWTHANFRELGRSRMEEQVLRTQDQYRLLRGLLESRECARRAGARAMDDIPREPVLFRF
FT                   PYGTCNAEALGFLASRGLAAIQWDVVTGDASTSQTAGGIARIVLSRVKPGSIIVCHANR
FT                   RGHGTAAALPLFVPRLREMGYDFVTVSELLASGTAETSPDCYEERPGDNRKYDKITGVG
FT                   KHADH"
FT   gene            complement(726572..726946)
FT                   /locus_tag="Sfum_0602"
FT   CDS_pept        complement(726572..726946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0602"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rba:RB8370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16301"
FT                   /db_xref="GOA:A0LFU9"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFU9"
FT                   /protein_id="ABK16301.1"
FT                   /translation="MPVFVRIVLLGSAVL