(data stored in ACNUC7421 zone)

EMBL: CP000479

ID   CP000479; SV 1; circular; genomic DNA; STD; PRO; 5475491 BP.
XX
AC   CP000479;
XX
PR   Project:PRJNA88;
XX
DT   21-NOV-2006 (Rel. 89, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Mycobacterium avium 104, complete genome.
XX
KW   .
XX
OS   Mycobacterium avium 104
OC   Bacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae;
OC   Mycobacterium; Mycobacterium avium complex (MAC).
XX
RN   [1]
RP   1-5475491
RA   Fleischmann R.D., Dodson R.J., Haft D.H., Merkel J.S., Nelson W.C.,
RA   Fraser C.M.;
RT   ;
RL   Submitted (19-OCT-2006) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
DR   MD5; f1b47f838ef43a43d6484956d9c06b29.
DR   BioSample; SAMN02603981.
DR   EnsemblGenomes-Gn; EBG00001235292.
DR   EnsemblGenomes-Gn; EBG00001235293.
DR   EnsemblGenomes-Gn; EBG00001235294.
DR   EnsemblGenomes-Gn; EBG00001235295.
DR   EnsemblGenomes-Gn; EBG00001235296.
DR   EnsemblGenomes-Gn; EBG00001235297.
DR   EnsemblGenomes-Gn; EBG00001235298.
DR   EnsemblGenomes-Gn; EBG00001235299.
DR   EnsemblGenomes-Gn; EBG00001235300.
DR   EnsemblGenomes-Gn; EBG00001235301.
DR   EnsemblGenomes-Gn; EBG00001235302.
DR   EnsemblGenomes-Gn; EBG00001235303.
DR   EnsemblGenomes-Gn; EBG00001235304.
DR   EnsemblGenomes-Gn; EBG00001235305.
DR   EnsemblGenomes-Gn; EBG00001235306.
DR   EnsemblGenomes-Gn; EBG00001235307.
DR   EnsemblGenomes-Gn; EBG00001235308.
DR   EnsemblGenomes-Gn; EBG00001235309.
DR   EnsemblGenomes-Gn; EBG00001235310.
DR   EnsemblGenomes-Gn; EBG00001235311.
DR   EnsemblGenomes-Gn; EBG00001235312.
DR   EnsemblGenomes-Gn; EBG00001235313.
DR   EnsemblGenomes-Gn; EBG00001235314.
DR   EnsemblGenomes-Gn; EBG00001235315.
DR   EnsemblGenomes-Gn; EBG00001235316.
DR   EnsemblGenomes-Gn; EBG00001235317.
DR   EnsemblGenomes-Gn; EBG00001235318.
DR   EnsemblGenomes-Gn; EBG00001235319.
DR   EnsemblGenomes-Gn; EBG00001235320.
DR   EnsemblGenomes-Gn; EBG00001235321.
DR   EnsemblGenomes-Gn; EBG00001235322.
DR   EnsemblGenomes-Gn; EBG00001235323.
DR   EnsemblGenomes-Gn; EBG00001235324.
DR   EnsemblGenomes-Gn; EBG00001235325.
DR   EnsemblGenomes-Gn; EBG00001235326.
DR   EnsemblGenomes-Gn; EBG00001235327.
DR   EnsemblGenomes-Gn; EBG00001235328.
DR   EnsemblGenomes-Gn; EBG00001235329.
DR   EnsemblGenomes-Gn; EBG00001235330.
DR   EnsemblGenomes-Gn; EBG00001235331.
DR   EnsemblGenomes-Gn; EBG00001235332.
DR   EnsemblGenomes-Gn; EBG00001235333.
DR   EnsemblGenomes-Gn; EBG00001235334.
DR   EnsemblGenomes-Gn; EBG00001235335.
DR   EnsemblGenomes-Gn; EBG00001235336.
DR   EnsemblGenomes-Gn; EBG00001235337.
DR   EnsemblGenomes-Gn; EBG00001235338.
DR   EnsemblGenomes-Gn; EBG00001235339.
DR   EnsemblGenomes-Gn; EBG00001235340.
DR   EnsemblGenomes-Gn; EBG00001235341.
DR   EnsemblGenomes-Gn; EBG00001235342.
DR   EnsemblGenomes-Gn; EBG00001235343.
DR   EnsemblGenomes-Gn; EBG00001235344.
DR   EnsemblGenomes-Gn; EBG00001235345.
DR   EnsemblGenomes-Gn; EBG00001235346.
DR   EnsemblGenomes-Gn; EBG00001235347.
DR   EnsemblGenomes-Gn; EBG00001235348.
DR   EnsemblGenomes-Gn; EBG00001235349.
DR   EnsemblGenomes-Gn; EBG00001235350.
DR   EnsemblGenomes-Gn; EBG00001235351.
DR   EnsemblGenomes-Gn; EBG00001235352.
DR   EnsemblGenomes-Gn; EBG00001235353.
DR   EnsemblGenomes-Gn; EBG00001235354.
DR   EnsemblGenomes-Gn; EBG00001235355.
DR   EnsemblGenomes-Gn; EBG00001235356.
DR   EnsemblGenomes-Gn; EBG00001235357.
DR   EnsemblGenomes-Gn; EBG00001235358.
DR   EnsemblGenomes-Gn; EBG00001235359.
DR   EnsemblGenomes-Gn; EBG00001235360.
DR   EnsemblGenomes-Gn; EBG00001235361.
DR   EnsemblGenomes-Gn; EBG00001235362.
DR   EnsemblGenomes-Gn; EBG00001235363.
DR   EnsemblGenomes-Gn; EBG00001235364.
DR   EnsemblGenomes-Gn; EBG00001235365.
DR   EnsemblGenomes-Gn; MAV_0008.
DR   EnsemblGenomes-Gn; MAV_0010.
DR   EnsemblGenomes-Gn; MAV_0025.
DR   EnsemblGenomes-Gn; MAV_0243.
DR   EnsemblGenomes-Gn; MAV_0251.
DR   EnsemblGenomes-Gn; MAV_0252.
DR   EnsemblGenomes-Gn; MAV_0325.
DR   EnsemblGenomes-Gn; MAV_0380.
DR   EnsemblGenomes-Gn; MAV_0419.
DR   EnsemblGenomes-Gn; MAV_0443.
DR   EnsemblGenomes-Gn; MAV_0521.
DR   EnsemblGenomes-Gn; MAV_0699.
DR   EnsemblGenomes-Gn; MAV_0842.
DR   EnsemblGenomes-Gn; MAV_0843.
DR   EnsemblGenomes-Gn; MAV_0844.
DR   EnsemblGenomes-Gn; MAV_0845.
DR   EnsemblGenomes-Gn; MAV_1041.
DR   EnsemblGenomes-Gn; MAV_1106.
DR   EnsemblGenomes-Gn; MAV_1158.
DR   EnsemblGenomes-Gn; MAV_1180.
DR   EnsemblGenomes-Gn; MAV_1506.
DR   EnsemblGenomes-Gn; MAV_1532.
DR   EnsemblGenomes-Gn; MAV_1533.
DR   EnsemblGenomes-Gn; MAV_1534.
DR   EnsemblGenomes-Gn; MAV_1561.
DR   EnsemblGenomes-Gn; MAV_1657.
DR   EnsemblGenomes-Gn; MAV_1663.
DR   EnsemblGenomes-Gn; MAV_1684.
DR   EnsemblGenomes-Gn; MAV_1710.
DR   EnsemblGenomes-Gn; MAV_1711.
DR   EnsemblGenomes-Gn; MAV_2046.
DR   EnsemblGenomes-Gn; MAV_2096.
DR   EnsemblGenomes-Gn; MAV_2201.
DR   EnsemblGenomes-Gn; MAV_2349.
DR   EnsemblGenomes-Gn; MAV_3062.
DR   EnsemblGenomes-Gn; MAV_3160.
DR   EnsemblGenomes-Gn; MAV_3527.
DR   EnsemblGenomes-Gn; MAV_3528.
DR   EnsemblGenomes-Gn; MAV_3529.
DR   EnsemblGenomes-Gn; MAV_3530.
DR   EnsemblGenomes-Gn; MAV_3841.
DR   EnsemblGenomes-Gn; MAV_3842.
DR   EnsemblGenomes-Gn; MAV_3973.
DR   EnsemblGenomes-Gn; MAV_4136.
DR   EnsemblGenomes-Gn; MAV_4524.
DR   EnsemblGenomes-Gn; MAV_4529.
DR   EnsemblGenomes-Gn; MAV_4530.
DR   EnsemblGenomes-Gn; MAV_4574.
DR   EnsemblGenomes-Gn; MAV_4830.
DR   EnsemblGenomes-Tr; EBT00001581269.
DR   EnsemblGenomes-Tr; EBT00001581270.
DR   EnsemblGenomes-Tr; EBT00001581271.
DR   EnsemblGenomes-Tr; EBT00001581272.
DR   EnsemblGenomes-Tr; EBT00001581273.
DR   EnsemblGenomes-Tr; EBT00001581274.
DR   EnsemblGenomes-Tr; EBT00001581275.
DR   EnsemblGenomes-Tr; EBT00001581276.
DR   EnsemblGenomes-Tr; EBT00001581277.
DR   EnsemblGenomes-Tr; EBT00001581278.
DR   EnsemblGenomes-Tr; EBT00001581279.
DR   EnsemblGenomes-Tr; EBT00001581280.
DR   EnsemblGenomes-Tr; EBT00001581281.
DR   EnsemblGenomes-Tr; EBT00001581282.
DR   EnsemblGenomes-Tr; EBT00001581283.
DR   EnsemblGenomes-Tr; EBT00001581284.
DR   EnsemblGenomes-Tr; EBT00001581285.
DR   EnsemblGenomes-Tr; EBT00001581286.
DR   EnsemblGenomes-Tr; EBT00001581287.
DR   EnsemblGenomes-Tr; EBT00001581288.
DR   EnsemblGenomes-Tr; EBT00001581289.
DR   EnsemblGenomes-Tr; EBT00001581290.
DR   EnsemblGenomes-Tr; EBT00001581291.
DR   EnsemblGenomes-Tr; EBT00001581292.
DR   EnsemblGenomes-Tr; EBT00001581293.
DR   EnsemblGenomes-Tr; EBT00001581294.
DR   EnsemblGenomes-Tr; EBT00001581295.
DR   EnsemblGenomes-Tr; EBT00001581296.
DR   EnsemblGenomes-Tr; EBT00001581297.
DR   EnsemblGenomes-Tr; EBT00001581298.
DR   EnsemblGenomes-Tr; EBT00001581299.
DR   EnsemblGenomes-Tr; EBT00001581300.
DR   EnsemblGenomes-Tr; EBT00001581301.
DR   EnsemblGenomes-Tr; EBT00001581302.
DR   EnsemblGenomes-Tr; EBT00001581303.
DR   EnsemblGenomes-Tr; EBT00001581304.
DR   EnsemblGenomes-Tr; EBT00001581305.
DR   EnsemblGenomes-Tr; EBT00001581306.
DR   EnsemblGenomes-Tr; EBT00001581307.
DR   EnsemblGenomes-Tr; EBT00001581308.
DR   EnsemblGenomes-Tr; EBT00001581309.
DR   EnsemblGenomes-Tr; EBT00001581310.
DR   EnsemblGenomes-Tr; EBT00001581311.
DR   EnsemblGenomes-Tr; EBT00001581312.
DR   EnsemblGenomes-Tr; EBT00001581313.
DR   EnsemblGenomes-Tr; EBT00001581314.
DR   EnsemblGenomes-Tr; EBT00001581315.
DR   EnsemblGenomes-Tr; EBT00001581316.
DR   EnsemblGenomes-Tr; EBT00001581317.
DR   EnsemblGenomes-Tr; EBT00001581318.
DR   EnsemblGenomes-Tr; EBT00001581319.
DR   EnsemblGenomes-Tr; EBT00001581320.
DR   EnsemblGenomes-Tr; EBT00001581321.
DR   EnsemblGenomes-Tr; EBT00001581322.
DR   EnsemblGenomes-Tr; EBT00001581323.
DR   EnsemblGenomes-Tr; EBT00001581324.
DR   EnsemblGenomes-Tr; EBT00001581325.
DR   EnsemblGenomes-Tr; EBT00001581326.
DR   EnsemblGenomes-Tr; EBT00001581327.
DR   EnsemblGenomes-Tr; EBT00001581328.
DR   EnsemblGenomes-Tr; EBT00001581329.
DR   EnsemblGenomes-Tr; EBT00001581330.
DR   EnsemblGenomes-Tr; EBT00001581331.
DR   EnsemblGenomes-Tr; EBT00001581332.
DR   EnsemblGenomes-Tr; EBT00001581333.
DR   EnsemblGenomes-Tr; EBT00001581334.
DR   EnsemblGenomes-Tr; EBT00001581335.
DR   EnsemblGenomes-Tr; EBT00001581336.
DR   EnsemblGenomes-Tr; EBT00001581337.
DR   EnsemblGenomes-Tr; EBT00001581338.
DR   EnsemblGenomes-Tr; EBT00001581339.
DR   EnsemblGenomes-Tr; EBT00001581340.
DR   EnsemblGenomes-Tr; EBT00001581341.
DR   EnsemblGenomes-Tr; EBT00001581342.
DR   EnsemblGenomes-Tr; MAV_0008-1.
DR   EnsemblGenomes-Tr; MAV_0010-1.
DR   EnsemblGenomes-Tr; MAV_0025-1.
DR   EnsemblGenomes-Tr; MAV_0243-1.
DR   EnsemblGenomes-Tr; MAV_0251-1.
DR   EnsemblGenomes-Tr; MAV_0252-1.
DR   EnsemblGenomes-Tr; MAV_0325-1.
DR   EnsemblGenomes-Tr; MAV_0380-1.
DR   EnsemblGenomes-Tr; MAV_0419-1.
DR   EnsemblGenomes-Tr; MAV_0443-1.
DR   EnsemblGenomes-Tr; MAV_0521-1.
DR   EnsemblGenomes-Tr; MAV_0699-1.
DR   EnsemblGenomes-Tr; MAV_0842-1.
DR   EnsemblGenomes-Tr; MAV_0843-1.
DR   EnsemblGenomes-Tr; MAV_0844-1.
DR   EnsemblGenomes-Tr; MAV_0845-1.
DR   EnsemblGenomes-Tr; MAV_1041-1.
DR   EnsemblGenomes-Tr; MAV_1106-1.
DR   EnsemblGenomes-Tr; MAV_1158-1.
DR   EnsemblGenomes-Tr; MAV_1180-1.
DR   EnsemblGenomes-Tr; MAV_1506-1.
DR   EnsemblGenomes-Tr; MAV_1532-1.
DR   EnsemblGenomes-Tr; MAV_1533-1.
DR   EnsemblGenomes-Tr; MAV_1534-1.
DR   EnsemblGenomes-Tr; MAV_1561-1.
DR   EnsemblGenomes-Tr; MAV_1657-1.
DR   EnsemblGenomes-Tr; MAV_1663-1.
DR   EnsemblGenomes-Tr; MAV_1684-1.
DR   EnsemblGenomes-Tr; MAV_1710-1.
DR   EnsemblGenomes-Tr; MAV_1711-1.
DR   EnsemblGenomes-Tr; MAV_2046-1.
DR   EnsemblGenomes-Tr; MAV_2096-1.
DR   EnsemblGenomes-Tr; MAV_2201-1.
DR   EnsemblGenomes-Tr; MAV_2349-1.
DR   EnsemblGenomes-Tr; MAV_3062-1.
DR   EnsemblGenomes-Tr; MAV_3160-1.
DR   EnsemblGenomes-Tr; MAV_3527-1.
DR   EnsemblGenomes-Tr; MAV_3528-1.
DR   EnsemblGenomes-Tr; MAV_3529-1.
DR   EnsemblGenomes-Tr; MAV_3530-1.
DR   EnsemblGenomes-Tr; MAV_3841-1.
DR   EnsemblGenomes-Tr; MAV_3842-1.
DR   EnsemblGenomes-Tr; MAV_3973-1.
DR   EnsemblGenomes-Tr; MAV_4136-1.
DR   EnsemblGenomes-Tr; MAV_4524-1.
DR   EnsemblGenomes-Tr; MAV_4529-1.
DR   EnsemblGenomes-Tr; MAV_4530-1.
DR   EnsemblGenomes-Tr; MAV_4574-1.
DR   EnsemblGenomes-Tr; MAV_4830-1.
DR   EuropePMC; PMC1865596; 17428883.
DR   EuropePMC; PMC2228276; 18081934.
DR   EuropePMC; PMC2292972; 18272714.
DR   EuropePMC; PMC2395067; 18305134.
DR   EuropePMC; PMC2845136; 20219093.
DR   EuropePMC; PMC3416486; 22763637.
DR   EuropePMC; PMC3599157; 23339684.
DR   EuropePMC; PMC3716041; 23554206.
DR   EuropePMC; PMC3746425; 23991261.
DR   EuropePMC; PMC3774663; 24066122.
DR   EuropePMC; PMC4058006; 24885784.
DR   EuropePMC; PMC4191392; 25217589.
DR   EuropePMC; PMC4219376; 24299240.
DR   EuropePMC; PMC4300377; 25649944.
DR   EuropePMC; PMC4747469; 26859598.
DR   EuropePMC; PMC4809946; 26739155.
DR   EuropePMC; PMC5399256; 28428297.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000479.
DR   SILVA-SSU; CP000479.
XX
CC   Source DNA/bacteria is available from Dr. William Bishai, Johns
CC   Hopkins School of Medicine, email: wbishai1@jhmi.edu.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5475491
FT                   /organism="Mycobacterium avium 104"
FT                   /strain="104"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:243243"
FT   gene            33..1529
FT                   /gene="dnaA"
FT                   /locus_tag="MAV_0001"
FT   CDS_pept        33..1529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="MAV_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68742"
FT                   /db_xref="GOA:A0A0H3A2F6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2F6"
FT                   /protein_id="ABK68742.1"
FT                   /translation="MWNAVVSELNGEPVADGGAANRTTLVTPLTPQQRAWLNLVRPLTI
FT                   VEGFALLSVPSSFVQNEIERHLRAPITDALSRRLGQQIQLGVRIAPPPDDVEDALIPPA
FT                   EPFPDTDAALSADDGADGEPVENGEPVTDTQPGWPNYFTERPHAIDPAVAAGTSLNRRY
FT                   TFDTFVIGASNRFAHAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPG
FT                   MRVKYVSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEGIQEEFFHTF
FT                   NTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQME
FT                   RLAVPDDVLELIASSIERNIRELEGALIRVTAFASLNKTPIDKSLAEIVLRDLIADAST
FT                   MQISAATIMAATAEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELTDLSLPKIGQAFG
FT                   RDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRSKR"
FT   gene            2150..3298
FT                   /gene="dnaN"
FT                   /locus_tag="MAV_0002"
FT   CDS_pept        2150..3298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="MAV_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68049"
FT                   /db_xref="GOA:A0A0H3A0Q1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0Q1"
FT                   /protein_id="ABK68049.1"
FT                   /translation="MRESFADAVSWVAKSLPSRPAVPVLSGVLLSGTDEGLTISGFDYE
FT                   VSAEAQVAAEIASPGSVLVSGRLLSDIVRALPNKPIDFYVDGNRVALNCGSARFSLPTM
FT                   AVEDYPTLPTLPEETGTLPADLFAEAIGQVAIAAGRDDTLPMLTGIRVEISGDTVVLAA
FT                   TDRFRLAVRELTWSAASPDIEAAVLVPAKTLAEAARTGIDGSDVRLSLGAGAGVGKDGL
FT                   LGISGNGKRSTTRLLDAEFPKFRQLLPAEHTAVATINVAELTEAIKLVALVADRGAQVR
FT                   MEFSEGSLRLSAGADDVGRAEEDLAVDFAGEPLTIAFNPTYLTDGLGSVRSERVSFGFT
FT                   TPGKPALLRPASDDDSPPSGSGPFSALPTDYVYLLMPVRLPG"
FT   gene            3299..4456
FT                   /locus_tag="MAV_0003"
FT   CDS_pept        3299..4456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67353"
FT                   /db_xref="GOA:A0Q8R8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0Q8R8"
FT                   /protein_id="ABK67353.1"
FT                   /translation="MYVRHLGLRDFRSWAHADLELQPGRTVFIGSNGFGKTNLLEALWY
FT                   SSTLGSHRVGTDAPLIRAGADRTVVSTIVVNDGRECAVDLEIAAGRANKARLNRSPVRS
FT                   TREVLGVLRAVLFAPEDLALVRGDPSERRRYLDDLATLRRPAIAAVRADYDKVLRQRTA
FT                   LLKSLSGARHRGDRGALDTLDVWDSRLAEYGAQLMAARIDLVNQLAPEVEKAYQLLAPG
FT                   SRAASIGYRSSLGAAAAAEVNAGDRDYLEAALLAGLAARRYAELERGVCLVGPHRDDLE
FT                   LWLGEQVAKGFASHGESWSLALSLRLAAYELLRADESDPVLLLDDVFAELDAARRRALA
FT                   AVAESAEQVLVTAAVLEDIPAGWQARRLFVELRDTDAGRVSELRP"
FT   gene            4453..4998
FT                   /locus_tag="MAV_0004"
FT   CDS_pept        4453..4998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05258"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66373"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR023007"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZV51"
FT                   /protein_id="ABK66373.1"
FT                   /translation="MSDDQSPSPSGEPTAMDLVRRTLEEARAAARAQGKDAGRGRAAAP
FT                   TPRRVAGQRRSWSGPGPDARDPQPLGRLARDLARKRGWSAQVAEGTVLGNWTAVVGHQI
FT                   ADHAVPTGLRDGVLSVSAESTAWATQLRMMQAQLLAKIAAAVGNGVVTSLKITGPAAPS
FT                   WRKGPRHIAGRGPRDTYG"
FT   gene            5257..7290
FT                   /gene="gyrB"
FT                   /locus_tag="MAV_0005"
FT   CDS_pept        5257..7290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="MAV_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65962"
FT                   /db_xref="GOA:A0A0H2ZUC5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUC5"
FT                   /protein_id="ABK65962.1"
FT                   /translation="MAAQKKKAQDEYGASAITVLEGLEAVRKRPGMYIGSTGERGLHHL
FT                   IWEVVDNSVDEAMAGYADRVDVRILDDGSVEVADNGRGIPVAMHATGAPTVDVVMTQLH
FT                   AGGKFGGENSGYNVSGGLHGVGVSVVNALSTRLEVNIARDGYEWSQYYDHAVPGTLKQG
FT                   EATKRTGTTIRFWADPDIFETTEYDFETVARRLQEMAFLNKGLTINLTDERVTNEEVVD
FT                   EVVSDTADAPKSAQEKAAESAAPHKVKHRTFHYPGGLVDFVKHINRTKNPIHQSIIDFG
FT                   GKGPGHEVEIAMQWNGGYSESVHTFANTINTHEGGTHEEGFRSALTSVVNKYAKDKKLL
FT                   KDKDPNLTGDDIREGLAAVISVKVSEPQFEGQTKTKLGNTEVKSFVQKVCNEQLTHWFE
FT                   ANPADAKVIVNKAVSSAQARIAARKARELVRRKSATDLGGLPGKLADCRSTDPRKSELY
FT                   VVEGDSAGGSAKSGRDSMFQAILPLRGKIINVEKARIDRVLKNTEVQAIITALGTGIHD
FT                   EFDITKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIEHGHVFLAQPPLYKLKWQ
FT                   RSDPEFAYSDRERDGLLEAGLKAGKKINKDDGIQRYKGLGEMDAKELWETTMDPTVRVL
FT                   RQVTLDDAAAADELFSILMGEDVDARRSFITRNAKDVRFLDV"
FT   gene            7302..9821
FT                   /gene="gyrA"
FT                   /locus_tag="MAV_0006"
FT   CDS_pept        7302..9821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="MAV_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989; match to protein
FT                   family HMM TIGR01063"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64957"
FT                   /db_xref="GOA:A0A0H2ZT47"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZT47"
FT                   /protein_id="ABK64957.1"
FT                   /translation="MTDTTLPPGGDAADRVEPVDIQQEMQRSYIDYAMSVIVGRALPEV
FT                   RDGLKPVHRRVLYAMYDSGFRPDRSHAKSARSVAETMGNYHPHGDASIYDTLVRMAQPW
FT                   SLRYPLVDGQGNFGSPGNDPPAAMRYTEARLTPLAMEMLREIDEETVDFIPNYDGRVQE
FT                   PTVLPSRFPNLLANGSGGIAVGMATNIPPHNLGELAEAVFWALDNYEADEEATLAAVME
FT                   RVKGPDFPTSGLIVGTQGIADAYKTGRGSIRMRGVVEVEEDSRGRTSLVITELPYQVNH
FT                   DNFITSIAEQVRDGKLAGISNIEDQSSDRVGLRIVIELKRDAVAKVVLNNLYKHTQLQT
FT                   SFGANMLAIVDGVPRTLRLDQLIRHYVDHQLDVIVRRTTYRLRKANERAHILRGLVKAL
FT                   DALDEVIALIRASETVDIARQGLIELLDIDEIQAQAILDMQLRRLAALERQRIIDDLAK
FT                   IEAEIADLEDILAKPERQRGIVRDELAEIVEKHGDARRTRIVAADGDVSDEDLIAREDV
FT                   VVTITETGYAKRTKTDLYRSQKRGGKGVQGAGLKQDDIVRHFFVCSTHDWILFFTTQGR
FT                   VYRAKAYELPEASRTARGQHVANLLAFQPEERIAQVIQIRSYEDAPYLVLATRNGLVKK
FT                   TKLTDFDSNRSGGIVAINLRDNDELVGAVLCSAEDDLLLVSANGQSIRFSATDEALRPM
FT                   GRATSGVQGMRFNADDYLLSLNVVREGTYLLVATSGGYAKRTAIEEYPVQGRGGKGVLT
FT                   VMYDRRRGRLVGALIVDEDSELYAITSGGGVIRTAAGQVRKAGRQTKGVRLMNLGEGDT
FT                   LLAIARNAEEAADEAVEESDGAAGSDG"
FT   gene            9924..10787
FT                   /locus_tag="MAV_0007"
FT   CDS_pept        9924..10787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64556"
FT                   /db_xref="GOA:A0A0H2ZS96"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZS96"
FT                   /protein_id="ABK64556.1"
FT                   /translation="MSSPNEPGAPKKGETPNGDGSAERAGVRRATPPAPGGRAPEAGDG
FT                   PPWQRGSTRPQQPPPRQNEPPTEKRPGGGAEARLNRFISGTAAPGTASHAKEPERGEGP
FT                   PAEAYASELPDLSGPVPRGPHRKPAAERGAETTGGQGGGRPVSGESREGRDNRDRVQVS
FT                   RRTRGPVRASMQIRRIDPWSTLKVSLLLSVALFFVWMIAVAFLYLVLGGMGVWSKLNSN
FT                   VGDLLNNTSGSSGELVSSGTIFGGAVLIGLVNIVLLTAMATIAAFIYNLATDLIGGIEV
FT                   TLADRD"
FT   gene            10858..10934
FT                   /locus_tag="MAV_0008"
FT   tRNA            10858..10934
FT                   /locus_tag="MAV_0008"
FT                   /product="tRNA-Ile"
FT   gene            11094..11169
FT                   /locus_tag="MAV_0010"
FT   tRNA            11094..11169
FT                   /locus_tag="MAV_0010"
FT                   /product="tRNA-Ala"
FT   gene            complement(11157..11735)
FT                   /locus_tag="MAV_0009"
FT   CDS_pept        complement(11157..11735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0009"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68688"
FT                   /db_xref="GOA:A0A0H3A3C1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3C1"
FT                   /protein_id="ABK68688.1"
FT                   /translation="MARDDWLVGRDRRSAAAERIYAAAADLIARRGYDGFTIEALAARV
FT                   HCSPATIYRHAGGKATIRDAVVGIQAARIVDTTREAIKDLRGPERVVTATIMALERLRS
FT                   DPLAQLMRSIHAAPVSDWVINSPTVTALAAEMLGPGHDNPLAAQWLIRVFLALWGWPLK
FT                   DPAAERALVHRFLGASYRPGGERDSICGA"
FT   gene            11932..13146
FT                   /locus_tag="MAV_0011"
FT   CDS_pept        11932..13146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0011"
FT                   /product="cytochrome P450"
FT                   /note="identified by match to protein family HMM PF00067"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67991"
FT                   /db_xref="GOA:A0A0H3A068"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A068"
FT                   /protein_id="ABK67991.1"
FT                   /translation="MAVLDSATRFFGSEAIQDPYPLYERMHAEAPVHRIGDSVFYAVCG
FT                   WDAVHEAIERVEDFSSNLTATMVFHEDGTVTPFDMGAPGAPMHALATADDPVHAVHRKI
FT                   LLPHLSAKRIRIIEEFATQTADRLWDENLSDGRIEWMSAIANRLPMMVVCRLLGLPDDD
FT                   VDKLIRLGYATTTLLDGIVAPEQLEQAGMAAIELSGYVLEHFEKASEKPESSLMADLAA
FT                   RCAAGELEQLPALGIMLTLFSAAGESTASLLGSAAWILADRPAIQRQLRENPELLSTFI
FT                   EETLRFEAPFRGHYRHVWRDTTLGGIELPEGAHLLLMWGAANRDPTHFKDPNEFRLDRA
FT                   AAKSHLSFGKGVHFCVGAALARLEAHIVLRRLLERTSWIDATDVGDWLPSILVRRRERL
FT                   GLAVR"
FT   gene            complement(13148..13582)
FT                   /locus_tag="MAV_0012"
FT   CDS_pept        complement(13148..13582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67414"
FT                   /db_xref="GOA:A0A0H3A0C0"
FT                   /db_xref="InterPro:IPR024245"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0C0"
FT                   /protein_id="ABK67414.1"
FT                   /translation="MRAKAEDRLTPRERLARGLTYSTLGPLDLTRGVAGLSGQSARSTA
FT                   EQLRRRYREGRLARDLAAAQETLAQELAAAQEVVTGLPQALQDARRAQRRGKRPWIIAG
FT                   VAVAVLAGGAAAFSIVRRSVREKPQEPQSRPPSVDVQPRP"
FT   gene            13691..14221
FT                   /locus_tag="MAV_0013"
FT   CDS_pept        13691..14221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0013"
FT                   /product="peptidyl-prolyl cis-trans isomerase B"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00160"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66705"
FT                   /db_xref="GOA:A0A0H2ZWD6"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWD6"
FT                   /protein_id="ABK66705.1"
FT                   /translation="MTNSPFQTATATLHTNRGDIKVALFGNHAPKTVANFVGLAQGTKE
FT                   YSTQNASGGSSGPFYDGAVFHRVIRGFMIQGGDPTGTGRGGPGYKFADEFHPELQFDRP
FT                   YLLAMANAGPGTNGSQFFITVDKTPHLNRRHTIFGEVVDPESQKVVDAISTTSTDGNDR
FT                   PSEPVVIESITIS"
FT   gene            complement(14233..14514)
FT                   /locus_tag="MAV_0014"
FT   CDS_pept        complement(14233..14514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67893"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1K8"
FT                   /protein_id="ABK67893.1"
FT                   /translation="MFAGMSWRARPKLAITPDGLAVRGWYRTQVLPRPDIKIIRIIEFR
FT                   RYGRTVRLLEVESADGDPVVLSRWDLGADPLQVLDALTAAGYAGPRQR"
FT   gene            complement(14814..15095)
FT                   /locus_tag="MAV_0015"
FT   CDS_pept        complement(14814..15095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0015"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF06781"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67171"
FT                   /db_xref="GOA:A0Q8S8"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0Q8S8"
FT                   /protein_id="ABK67171.1"
FT                   /translation="MPKSKVRKKNDFTVSAVSRTPVKVKVGPSSVWFVALFIGLMLIGL
FT                   VWLMVFQLAAVGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH"
FT   gene            15226..15969
FT                   /locus_tag="MAV_0016"
FT   CDS_pept        15226..15969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05949"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64421"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZQG6"
FT                   /protein_id="ABK64421.1"
FT                   /translation="MVQTRQSPWRFGVPLVCLLAGLLLAATHGVSGGAEIRRSDAPRLV
FT                   DLVRETQASVNRLSAQREQLAAKIDAAHGRSSDAALAAMLRRSAQLAGEAGMSPVHGPG
FT                   LVVTLQDAQRDANGRFPRDASPDDLVVHQQDIQAVLNALWSAGAEAIQMQDQRIIATSV
FT                   PRCVGNTLLLNGRTYSPPYTITAIGNAAAMQAALAAAPLVTLYKQYAVRFGLGYQEEVR
FT                   SDVQVVGHFEPDRLHFAQPNGPIGY"
FT   gene            16018..16704
FT                   /locus_tag="MAV_0018"
FT   CDS_pept        16018..16704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0018"
FT                   /product="anthranilate synthase component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM TIGR00566"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66238"
FT                   /db_xref="GOA:A0A0H2ZUS9"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUS9"
FT                   /protein_id="ABK66238.1"
FT                   /translation="MRILVVDNYDSFVFNLVQYLGQLGVDADVWRNDDSRLADHNAVAR
FT                   RFDGVLLSPGPGTPERAGASIAVVRACAAEHTPLLGVCLGHQAIGVAFGATVDRAPELL
FT                   HGKTSSVHHTNAGVLQGLPNPFTATRYHSLTILPESLPPVLEVTAHTDSGVIMGVRHTQ
FT                   LPIHGVQFHPESILTEGGHRMLANWLTECGWVRDDTLVRRLENDVHAAVRPYLPADPAA
FT                   TDRTSA"
FT   gene            complement(16682..18562)
FT                   /locus_tag="MAV_0017"
FT   CDS_pept        complement(16682..18562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0017"
FT                   /product="serine/threonine protein kinase"
FT                   /note="identified by match to protein family HMM PF00069;
FT                   match to protein family HMM PF03793"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69121"
FT                   /db_xref="GOA:A0A0H3A3I3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3I3"
FT                   /protein_id="ABK69121.1"
FT                   /translation="MTTPQHLSDRYELGEILGFGGMSEVHLARDVRLHRDVAVKVLRAD
FT                   LARDPSFYLRFRREAQNAAALNHPSIVAVYDTGEAETPSGPLPYIVMEYVDGVTLRDIV
FT                   HTDGPLPPRRAIEIIADACQALNFSHQNGIIHRDVKPANIMISTTNAVKVMDFGIARAI
FT                   ADSGNSVTQTAAVIGTAQYLSPEQARGDAVDARSDVYSLGCVLYEILTGEPPFTGDSPV
FT                   AVAYQHVREDPVPPSQRHEGISADLDAVVLKALAKNPDNRYQTAAEMRADLVRVHNGEK
FT                   PEAPKVLTDAERSSLLSSGAGAAGPSRTDPLPRQVLADSGEDRTVGSVGRWIVAVAALA
FT                   VLTIIVVIAFNTFGGGARDVQVPDVRGQVSADAIAALQNRGFKTRTLQKPDSAIPPDHV
FT                   IGTDPGANASVSAGDEITINVSTGPEQREVPDVSSLSYSDAVTKLKAAGFSKFKQANSP
FT                   STPELLGKVIGTNPPANQTSAITNVITLIVGSGPETKQVPDIAGQTVDIAQKNLTVYGF
FT                   TKITQVQVDSPRPAGEVIGTNPPKGQTVPVDSVIELQVSKGNQFIMPDLSGMFWTDAEP
FT                   RLRALGWTGILDKGPDVDAGGAQSHRVVYQNPPAGAGVNRDGIITLKFGQ"
FT   gene            complement(18559..19824)
FT                   /locus_tag="MAV_0019"
FT   CDS_pept        complement(18559..19824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0019"
FT                   /product="serine/threonine protein kinases Drp72"
FT                   /EC_number="2.7.11.1"
FT                   /note="identified by match to protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65135"
FT                   /db_xref="GOA:A0A0H2ZS26"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZS26"
FT                   /protein_id="ABK65135.1"
FT                   /translation="MTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLKQEFSQD
FT                   PEFIERFRAEARTTAMLNHPGIAAVHDYGESQLDGEGRTAYLVMELVNGEPLNSVLKRT
FT                   GRLSLRHALDMLEQTGRALQVAHAAGLVHRDVKPGNILITPTGQVKITDFGIAKAVDAA
FT                   PVTQTGMVMGTAQYIAPEQALGHDATPASDVYSLGVVGYEVVSGKRPFSGDGALTVAMK
FT                   HIKEPPPPLPAELPPNVRELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPPRPSQSP
FT                   PPGRASPAAIPSSPTTRAAAVSSGRTAAPRRTRPATGGHRPPPARRTFSSGQRALLWAA
FT                   GVLGALAIIIAVLIVINSRADQQQQPPTVTDTGTPPASAPPPTKTPSGSGAHPGLRLDW
FT                   PDDGTIGASGFRDGPARHWTSQ"
FT   gene            complement(19839..21317)
FT                   /locus_tag="MAV_0020"
FT   CDS_pept        complement(19839..21317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0020"
FT                   /product="PbpA protein"
FT                   /note="identified by match to protein family HMM PF00905"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67970"
FT                   /db_xref="GOA:A0A0H3A1S7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1S7"
FT                   /protein_id="ABK67970.1"
FT                   /translation="MNASLRRISVTVMALIVLLLLNATMTQVFAADSLRADPRNQRVLL
FT                   DEYSRQRGQIVAGGQLLAYSVATDNRFRFLRVYPNPAQYAPVTGFYSLRYSSTGLERAE
FT                   DPLLNGSDERLFGRRLADFFTGRDPRGANVDTTIRPRVQQAAWDGMQQGCGGPPCKGAV
FT                   VALEPSTGKILAMVSSPSYDPNLLSSHDPEVQAQAWQRLRDDPDNPMTNRAISETYPPG
FT                   STFKVITTAAALQAGASDTEQLTAAPSIPLPNSTATLENYGGQACGNDPTVSLQQAFAL
FT                   SCNTAFVQLGILTGADALRSMARSFGLDSTPSVIPLQVAESTIGIIPDAAALGMSSIGQ
FT                   KDVALTPLQNAEIAATIANGGVTMQPYLVDSLKGPDLTTISTTTPYEQRRAVSPQVAAK
FT                   LTELMVGAEKVAQQKGAIPGVQIASKTGTAEHGSDPRHTPPHAWYIAFAPAQTPKVAVA
FT                   VLVENGADRLSATGGALAAPIGRAVIEAALQGGP"
FT   gene            complement(21314..22723)
FT                   /locus_tag="MAV_0021"
FT   CDS_pept        complement(21314..22723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0021"
FT                   /product="cell cycle protein, FtsW/RodA/SpoVE family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01098"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67416"
FT                   /db_xref="GOA:A0A0H2ZYE1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYE1"
FT                   /protein_id="ABK67416.1"
FT                   /translation="MTTQLQPPVAVTPPLPTRRNAELLLLGFAATITVAALLIVEANQQ
FT                   HDLRWNAVSYGLVFLVVFGSAHVAIRRFAPYTDPLLLPIVALLNGLGLVMIHRLDLVTN
FT                   QLSGRHHPSATQQMLWTLIGVVTFALVVTFLKDHRQLARYGYICGLVGLVFLVIPALLP
FT                   ASLSEQNGAKIWIRFPGFSIQPAEFSKILLLIFFSAVLIAKRGLFTSVGKHFMGLTLPR
FT                   PRDLAPLLAAWVISVGVMAFEKDLGTSLLLYTSFLVVVYLATQRFSWVAIGLVLFVAGS
FT                   VVAYYIFAHVRVRVQMWWDPFSDPDGSGYQIVQSLFSFATGGIFGTGLGNGQPDTVPAA
FT                   STDFIIAAFGEELGLVGLAAILMLYTIVIVRGLRTAIATRDSFGKLLAAGLASTLAIQL
FT                   FIVVGGVTQLIPLTGLTTPWMSYGGSSLLANYVLLAILARISHSARRPLRTRARTEPSI
FT                   AAASTEVIEKV"
FT   gene            complement(22720..24219)
FT                   /locus_tag="MAV_0022"
FT   CDS_pept        complement(22720..24219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0022"
FT                   /product="protein phosphatase 2C"
FT                   /note="identified by match to protein family HMM PF00481"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68569"
FT                   /db_xref="GOA:A0A0H3A0I7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0I7"
FT                   /protein_id="ABK68569.1"
FT                   /translation="MTLVLRYAARSDRGLVRSNNEDSVYAGARLLALADGMGGHAAGEV
FT                   ASQLVIAALAHLDDDEPGGDLLAKLDEAVRAGNAAIAAQVEAEPELEGMGTTLTAILFA
FT                   GDRIGLVHIGDSRGYLLRDGELTQITKDDTFVQTLVDEGRITREEAHSHPQRSLIMRAL
FT                   TGHEVEPTLTMREARAGDRYLLCSDGLSDPVSDETILEALQIPDVAEAAYRLIELALRG
FT                   GGPDNVTVVVADVVDYDYGQTQPILAGAVSGDEDQLTLPNTSAGRASAIRPRDESAKRV
FT                   APQPETPSRPRWSRRRLFIVIALAVMLVLAGLTVGWWVIQRNYYVAEYNGRISIVRGIQ
FT                   GSLLGVPLQQPYLVGCLNARNELSLISYGQSGGSNCQLMTLQDLRRPGQVQVQTGLPGG
FT                   SLDQAESQLRQLLAEYLLPLCPPPRATSPPGAQATRSPVPETGGPASPAPPTTSASPTP
FT                   STNATPGPASSSPAGPTTTSQTLTALPGPPLQPGIDCRTVA"
FT   gene            complement(24284..24682)
FT                   /locus_tag="MAV_0023"
FT   CDS_pept        complement(24284..24682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0023"
FT                   /product="FHA domain protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69113"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A389"
FT                   /protein_id="ABK69113.1"
FT                   /translation="MLRILRTDIYAPTGAVMVRRGLALRSTLLPSRQRRHAARYLVVTE
FT                   GALAGGRITLSGQPVLIGRADDSTLVLTDDYASARHARLTQRGSEWYVEDLGSTNGTYL
FT                   DRAKVTTAVRVPIGTPIRIGKTAIELRP"
FT   gene            complement(24876..26513)
FT                   /locus_tag="MAV_0024"
FT   CDS_pept        complement(24876..26513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0024"
FT                   /product="xyppx repeat family protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67403"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0B1"
FT                   /protein_id="ABK67403.1"
FT                   /translation="MSSQRGLVARIERKLEATVDNAFARVFGGPIVPQEVEALLCREAR
FT                   DGVQKLHGNRLLAPNEYIITLGMHDFEKVSADPDLTSSAFARYLADYIHEQGWQTYGEV
FT                   VVRFEQSSSLRTGQYRACGAVNPDVQPRPTVDDPVRPQSNNAFGEERGVAPMTDNSSYR
FT                   GAQGPGRPGDEYYDERYGRPQDDARGGSEPQGAPDQRGGYPPEQGGYPPQQGYPPPRHP
FT                   EQGGYPEQGGYPPPQSYQEHGGYPDQRGGYPEPGQAGYPPQQHGYPDLRGYPEPAQGGY
FT                   PQSYEQRPPAPPGYSGQGYDQGYRPPGGGYPPPGGQPAGGPQGYGGYGDYGRGPARPDE
FT                   GGYAPPEQRPAYPEQGGGYDQGYPQGGGYGRQDYGSAEYTQYAEHAQGATYAPPGGGYP
FT                   EAPGSEYEYGQPADYGQQPEYAQPAEYGQPADYGQQAGGYGGYGQGGYGSTGTTVTLQL
FT                   DDGSGRTYQLREGSNIIGRGQDAQFRLPDTGVSRRHLEIRWDGQVALLSDLNSTNGTTV
FT                   NNAPVQEWQLADGDVIRLGHSEIIVRIH"
FT   gene            26767..26849
FT                   /locus_tag="MAV_0025"
FT   tRNA            26767..26849
FT                   /locus_tag="MAV_0025"
FT                   /product="tRNA-Leu"
FT   gene            27020..27457
FT                   /locus_tag="MAV_0026"
FT   CDS_pept        27020..27457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0026"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68000"
FT                   /db_xref="InterPro:IPR028952"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1W3"
FT                   /protein_id="ABK68000.1"
FT                   /translation="MVDGKTAHLQAEVDRIAARLNVPPIKVGVVLKNDDRNIYIDDDGR
FT                   YHYDYWERGRQRFDRVGDIDEALYGFATDAAFDIGYSYSARFSPPDQDRRILLWAKQYE
FT                   LLNQLNPGWAKRCVRERADQLRGWGLHEAVELLPDIPERDG"
FT   gene            complement(27478..27849)
FT                   /locus_tag="MAV_0027"
FT   CDS_pept        complement(27478..27849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66307"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVB3"
FT                   /protein_id="ABK66307.1"
FT                   /translation="MPTMDVDAVAFSERWVRNWNAHDVDAVLDDFRDDVVFTSPGAAQL
FT                   LPETQGIIRGKAALRQYWTAALASIPDLRFSVEGVYQGIDTVVIAYRNQNGNLVNEVLT
FT                   FRDGAIIEGHGTYLTEGAD"
FT   gene            complement(27880..28383)
FT                   /locus_tag="MAV_0028"
FT   CDS_pept        complement(27880..28383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0028"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65796"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTL5"
FT                   /protein_id="ABK65796.1"
FT                   /translation="MLVTDPCRECGFAYDLRQAATAGDDVRARVAEVVTILCDNTIDVR
FT                   SRPRNGVWSPLEYGCHLRDVLLVQRERVLAARRTGGADCASMGREERAEHDGYNEQDPR
FT                   EVARQLADAATLFGNVLARLSDEDWDRTLVYHYPETRERSLRWVAVHTAHELHHHLLDI
FT                   RGQL"
FT   gene            28598..28861
FT                   /locus_tag="MAV_0029"
FT   CDS_pept        28598..28861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0029"
FT                   /product="acyl carrier protein"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66343"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZX11"
FT                   /protein_id="ABK66343.1"
FT                   /translation="MTSSNPPLPRAVDDRLVSILRDDLDLKFESLSPTTRLIDDLGMDS
FT                   VAFAVSLVAIEERFGTQLSEEDLLYCTTVGDLQSAIAAGVNA"
FT   gene            28858..30414
FT                   /locus_tag="MAV_0030"
FT   CDS_pept        28858..30414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0030"
FT                   /product="acyl-CoA synthase"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64714"
FT                   /db_xref="GOA:A0A0H2ZSP1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSP1"
FT                   /protein_id="ABK64714.1"
FT                   /translation="MNVLAAAMRDAMTRSPHDLVVLDKDSDTWRSCPWPEVHGMAESIA
FT                   VRLLQRDRLGAVGLVGEPTVELIAAIQGAWLAGVAVSLLPRPRRGADPSEWAHSTLQRF
FT                   GGIGVDTVLSHGGVLRTLAAADSAVSVCDLAQAARTPTSTGLEYQDDSGVAILQGTAGS
FT                   TGNPRTAVLSPAAVLSNMRGLIERLRLDGASDRACSWLPLYHDMGLAFLLTSVLSGMPL
FT                   WQAPTGAFSAAPLRWAEWLSDSQATFTAGPNFGYSMIGRYAGRVRDVDLGALRIAINGG
FT                   EPVDCEGFQRFAMAMAPFGFRASAATPAYGMAEATCAVTMPSCGEGLQIDERTESGVPQ
FT                   RYALLGRPIAGMQLRIAATDEPSGEGVGEVEIHGSSMMTGYLGDTTGRSDGDWFPTGDI
FT                   GYLVDGALVICGRSKEVITVAGRNIFPTEIEQVAAQVDGVRHGGVVAVGSKSGAAQSRL
FT                   LIAAEFVGADRDVTRSAVIKRVISVCGVTPADVVLMPPGSLPRTSSGKLRRLEVRRQLL
FT                   G"
FT   gene            30569..32470
FT                   /locus_tag="MAV_0031"
FT   CDS_pept        30569..32470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65265"
FT                   /db_xref="InterPro:IPR025331"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSF5"
FT                   /protein_id="ABK65265.1"
FT                   /translation="MGLPYIDKQALIAEAGGDPWAINASLQAGSPSQISNLAGAFHRAG
FT                   RCTQEADNAFQQARSRFDAAWNHQDGDHPINDSEEVQRVTKALGAQSLQLPKIGADLEG
FT                   IAAALAEAQKAGAARIATLDAQLKNISDLVVEAVALLNDKSLSPPDRDALHALINTCEN
FT                   DALRDTKAALADLQAIRNGYADGLQKSLNSLHAEGYDGAPLHGVDADGVAPASPAQQAA
FT                   LDDIRRATNQAVLDQMAKVRAAQRALDKAMADVYAHGPGSPEGEAASAQLPKLKADLAH
FT                   ALDDLGKIPDYTGIDPASVNVTPDGHFMFTYNVNGQPVQVVGQLQNGTGEFFDQATGTY
FT                   YTFNGGKLTGMRTPDPGKVEATSEPLWTAITTAVGGYGLKVGGTAAWQGLKTLFSREML
FT                   DGLTSENVMSRAMTGAEVRAALAEAEYPRGIGGEPVPSTHPLEPPPVEHTPPPADAPVE
FT                   HAPGGPHVAVPDSPPPLPPEQPPPPPLASDHPLFEGYHPIDPGPEFTNADGSLRYPDDT
FT                   LPTKPYAVPGTVVPDAQLSAGTVLSRFGFPGGGYLAPEGTPFAELALPPGSAGKPYFQY
FT                   VVDDPTRLPPGWHIEQSEVAPWFHQPGGGQQYRIINEEGATGDVAELVRWGYLRRIN"
FT   gene            32692..32946
FT                   /locus_tag="MAV_0032"
FT   CDS_pept        32692..32946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0032"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68649"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A263"
FT                   /protein_id="ABK68649.1"
FT                   /translation="MAEKYLIWDWATTARSDLASGRLGADLAKQGFAPKIEVSKIDTKY
FT                   KICSGNDCAILSEVNATIFSHLIDKSADQIERLITGEPS"
FT   gene            33419..34693
FT                   /locus_tag="MAV_0033"
FT   CDS_pept        33419..34693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0033"
FT                   /product="transposase, Mutator family protein"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68692"
FT                   /db_xref="GOA:A0A0H3A2B3"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2B3"
FT                   /protein_id="ABK68692.1"
FT                   /translation="MVKRPRITTERNIAMALDQSALLEVLDALRTADAGERITQAAETI
FT                   YQALIDAELTAFIGASPHERTETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSFFPAL
FT                   LERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEVSRICKDLDTEVAA
FT                   FRDRPLGDQRFPYVFLDATYCKARVNHRVVSQAVVIATGVAADGRREVLGFEVGDSEDG
FT                   AFWTAFLRSLKSRGLAGVQLVISDAHAGLRSAIDAVLIGAAWQRCRVHFLRNVLAQVPK
FT                   GSAEMVAAAIRTVFAQPDAEHVREQLDTIAGMLGRQFPKVETMLREAAADITAFADFPV
FT                   AHWKKIWSTNPLERLNKEIKRRTDVVGVFPNPAALLRPAGSVLVEAHDEWQVADKRYLS
FT                   ETSLALLDVSDQSAETIAPTAALTA"
FT   gene            complement(34806..36131)
FT                   /locus_tag="MAV_0034"
FT   CDS_pept        complement(34806..36131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0034"
FT                   /product="transposase, Mutator family protein"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65386"
FT                   /db_xref="GOA:A0A0H2ZVE3"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVE3"
FT                   /protein_id="ABK65386.1"
FT                   /translation="MSVMDVKRPPRDPSSQPSTESSRSPTMTAPHIVDPAGLLGEALAE
FT                   ASPDLMRSLLQTVINALLSADADAVVGAEWGQPTPGRRAQRNGYRHRGLDTRVGTIDVA
FT                   VPKLRKGTYFPDWLLERRKRAESALITVVADCYLAGVSTRRMDKLVKTLGIDSLSKSQV
FT                   SRMATDLDEHVEAFRHRPLDSAGPFTFVAADALTMKVREGGRVVNGVVLLATGVNGDGH
FT                   REVLGMRVVTSETGPAWNEFFADLVARGLAGVRLVTSDAHAGLREAIAANLPGAAWQRC
FT                   RTHYAANLMSICPKSMWPAVKAMLHSVYDQPDAPAVAAQFDRLIDYVTDKLPAVADHLA
FT                   TAREDILAFTAFPKDVWSQIWSNNPAERLNKEIRRRTDAVGIFPNRDAIVRLVGAVLAE
FT                   QNDEWAEGRRYLGLDILTRCRLTTITDDNPDIGANDMPALTA"
FT   gene            complement(36248..37522)
FT                   /locus_tag="MAV_0035"
FT   CDS_pept        complement(36248..37522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0035"
FT                   /product="transposase, Mutator family protein"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66274"
FT                   /db_xref="GOA:A0A0H3A1M9"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1M9"
FT                   /protein_id="ABK66274.1"
FT                   /translation="MVKRPRITTERNIAMALDQSALLEVLDALRTADAGERITQAAETI
FT                   YQALIDAELTAFIGASPHERTETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSFFPAL
FT                   LERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEVSRICKDLDTEVAA
FT                   FRDRPLGDQRFPYVFLDATYCKARVNHRVVSQAVVIATGVAADGRREVLGFEVGDSEDG
FT                   AFWTAFLRSLKSRGLAGVQLVISDAHAGLRSAIDAVLIGAAWQRCRVHFLRNVLAQVPK
FT                   GSAEMVAAAIRTVFAQPDAEHVREQLDTIAGMLGRQFPKVETMLREAAADITAFADFPV
FT                   AHWKKIWSTNPLERLNKEIKRRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVADKRYLS
FT                   ETSLALLDVSDQSAETIAPTAALTA"
FT   gene            complement(37715..38959)
FT                   /locus_tag="MAV_0036"
FT   CDS_pept        complement(37715..38959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01844;
FT                   match to protein family HMM PF02720"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66849"
FT                   /db_xref="GOA:A0A0H2ZYS5"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYS5"
FT                   /protein_id="ABK66849.1"
FT                   /translation="MSSSVLAAEVEVRPYDRLAVLFDELAELTGQRNAIDGRIVEIVAQ
FT                   IEREQLWGATGARSLGALVAWKTGCSPGNAETIATVARRLDSFPRCAAGLREGRFSLDQ
FT                   LGVIAQRAGEGSDEHYAQLAGVATVNQLRTAVKLEPRPQPEAKPAPQPGLTKTSDEELS
FT                   CWRITLDRLDAATFDAALAAHREALIAEWKRDHNHRAGESVPPLPGTLEAFIRLIETGW
FT                   DAEAHRRPHGHHTTVVVHLDAAQRVAGLHLGPLLSDAERRYLTCDATCEVWVERDGQPI
FT                   GAGRSTRVINRRLRRALEHRHRGCAIPGCGATRGLHAHHLRHWEDGGPTELSNLVLVCP
FT                   YHHRAHHRGEITITGPADTLLVTDSSGRHLKPGSLARKPTRPPPAVPPCPGPLGQRADW
FT                   WWYDPFQPQPPPTTN"
FT   gene            complement(39014..39343)
FT                   /locus_tag="MAV_0037"
FT   CDS_pept        complement(39014..39343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0037"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67870"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZW0"
FT                   /protein_id="ABK67870.1"
FT                   /translation="MTTDKTGAQTTVSLQDGKYTIAVEGKPVGLADFKDRGDQRVFYHT
FT                   EIDPAYGGRGLATILVEEALNEARNEGKRIVPVCSMIGTVLKKHPEFDDITDPVTPEIT
FT                   QWVHS"
FT   gene            complement(39330..40322)
FT                   /locus_tag="MAV_0038"
FT   CDS_pept        complement(39330..40322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02678;
FT                   match to protein family HMM PF05726"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68259"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0W5"
FT                   /protein_id="ABK68259.1"
FT                   /translation="MSNLEVAPAEVACAASRDRDASPAVQILRPREVPLGGPRALRVQR
FT                   TLPQRERSLIGAWCFIDHYGPAHTRMDVPPHPHTGLQTVSWLFSGEVEHRDSAGVHAAV
FT                   RPGELNLMTAGAGICHSEVSVGSGALHGVQLWVVLPDSDRDTARDFAHYAPAPISLPGA
FT                   QARVFLGELHGSRSPVRTFTPLVGAQIDLGAGAQLDLDLDPDFEHGLLCDAGAVHVDEK
FT                   PLSVAELAYLGPGRAAVQLRNAGDTPGRVLLLGGTPFSEQLVMWWNFVGRSHEDIVGYR
FT                   RLWEDGDERFGAVRGYRGALSRLPAPPLPTARLRPRPIPERKGSTNDNR"
FT   gene            complement(40327..41709)
FT                   /locus_tag="MAV_0039"
FT   CDS_pept        complement(40327..41709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0039"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69032"
FT                   /db_xref="GOA:A0A0H3A375"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A375"
FT                   /protein_id="ABK69032.1"
FT                   /translation="MTFDLTPTAAQHDLARRTHEFAESVIRPVALEYDQRQEFPWPVLE
FT                   EAARRGFYSPLFYRDLIGDPTGISLPMFMEELFWGCAGIGLAIVMPALALSAIGQAASP
FT                   EQMLEWAPECFGTPGDLKLAALAISEPEGGSDVRNLRTRARRDGDDWIIDGHKMWIGNG
FT                   GIANVHVVNAVVDEELGHRGQALFVVPGGTPGLKMVRKLDKLGCRASHTAELLFEGVRV
FT                   PAANLLGGQEKLEHKLAKAREVVAGGKRSGSATLGTFEQTRPMVAAQAIGIARAALEYA
FT                   TSYATEREAFGAPIIDNQGIAFPLAELATQIDAARLLTWRASWMAANNVPFERGEGSMS
FT                   KMAASEVAVKATERAVQTLGGWGYITDHPVEKWYRDAKLYTIFEGTSEIQRMVVSNALG
FT                   AAVGTPPLHVVLEPSGGALNRVFGRGTPLRSRAAEAALSMQDRIPEPVMRLAMKVLRPP
FT                   GR"
FT   gene            complement(41803..42219)
FT                   /locus_tag="MAV_0040"
FT   CDS_pept        complement(41803..42219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0040"
FT                   /product="transcription factor WhiB family protein"
FT                   /note="identified by match to protein family HMM PF02467"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64946"
FT                   /db_xref="GOA:A0A0H2ZTB7"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTB7"
FT                   /protein_id="ABK64946.1"
FT                   /translation="MGHPCAANPELWFGYPDDDGGDGAAKARAYERSATEARIQCLRRC
FT                   PLAQQRRCAQHAVAHREEYGVWAGVKLPGGQYRKREQLAHAHEVLRRIASGEINSRQLP
FT                   ENAALLARHEHETVAAPAVVLHLPLAKVGPRSAA"
FT   gene            42362..43150
FT                   /locus_tag="MAV_0041"
FT   CDS_pept        42362..43150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0041"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65665"
FT                   /db_xref="GOA:A0A0H2ZVF6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVF6"
FT                   /protein_id="ABK65665.1"
FT                   /translation="MSRESAGAAIRALRESRDWSLADLAAATGVSIMGLSYLERGARKP
FT                   HKSTVQKIENGLGLPPGTYSRLLVAADPEAELARLMAAQPVAEMPARRTGPVVVDRHSD
FT                   TEVLEGYAEAQLDALKSVIDRLPATTSNEYETYILSVIAQCVKAELLAASSWRVAVNAG
FT                   ADSTGRLMEHLQALEATRVALLKRMPTSLSARFDRACAQSSLPETIIAALVGVDVDEMW
FT                   DIRNRGVISPSALPRVRAFTDAVESASRDEASQGDDEEGS"
FT   gene            43147..43974
FT                   /locus_tag="MAV_0042"
FT   CDS_pept        43147..43974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0042"
FT                   /product="NLP/P60 family protein"
FT                   /note="identified by match to protein family HMM PF00877"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66104"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUR6"
FT                   /protein_id="ABK66104.1"
FT                   /translation="MSHSELEALSRAHQLFAGGTRPASLDTGSGHYRDLLGRAARLSDG
FT                   FAHGGYRLAVQHSRQRLASTSDTDAAVTDLLAGAHRDRAQARELTGAVLDAGRADAAAN
FT                   PTTPLAQREAMRRRVMRLRTQHAHVVSAAARARHHHARLLALRYRLRHGVGLAGLRGPG
FT                   SDRAALAVRAALSRLGRPYVWGATGPDQFDCSGLVQWSYAQAGIHLDRTTYQQINEGIP
FT                   VPRSQVRPGDLVFPHAGHVQLAIGNNLVVEAPYSGASVRISRLGNNVAIRRPI"
FT   gene            44023..44385
FT                   /locus_tag="MAV_0043"
FT   CDS_pept        44023..44385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67190"
FT                   /db_xref="InterPro:IPR019710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYS2"
FT                   /protein_id="ABK67190.1"
FT                   /translation="MPEQPGFSLEAVEARRSALADQHGAASESDRVLAEVLASAHAAAQ
FT                   ESARRLDAIAEQIDRAVAHQADLAVDTPLGAREFHKFLLAKQHEIASVITEAQELSRAK
FT                   RVVLENLRAQYSAGNR"
FT   gene            44501..45952
FT                   /locus_tag="MAV_0044"
FT   CDS_pept        44501..45952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64897"
FT                   /db_xref="InterPro:IPR019710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTA5"
FT                   /protein_id="ABK64897.1"
FT                   /translation="MSAYDDLLAAVKDVRDRTGDPNAWQTGLAPAEVSAVITPSTRPEQ
FT                   LQAILAKIRRQHAEVFGAAPTGVARPPADAGPAPDRESGAAADAIASAEAALAQQNSVS
FT                   SQLDMQVVTAILNAHLKAVDGREALTKLQQETEAAVRTRSDLDTPAGARDFQRFLIGKL
FT                   RDIRAVVLNASLDDTSKSALMAAWTSLYDAAKNDRPGDHASSAGAAADAAAAGTSDQPD
FT                   EDLDDEWDPLLDSLLADDDGSPIDPAAALDPLGGNTIPPAPPPAMAPALPSFGGGSLPG
FT                   LGATPASMSGWETPGGLPLSGLQAGDASDPALQDLADEDLPEDQGQQHDSPADGSAEQA
FT                   DDENASADEPPAGPTSVTLPDGETVTAASPQLAAAIKAAVAGTPIAEAFQQQGMTLPAP
FT                   GTAVANPVDVVRVSPGDIGMFTDRHALALGPGKALLDGQIQHIATVSGPSFLGWEHPPA
FT                   AAASVTAPAKPDPPTPTRPASSSTT"
FT   gene            46003..46320
FT                   /locus_tag="MAV_0045"
FT   CDS_pept        46003..46320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0045"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66778"
FT                   /db_xref="GOA:A0A0H2ZW47"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW47"
FT                   /protein_id="ABK66778.1"
FT                   /translation="MADSIHVVPAHLRQAAAHHQDTSEYLRTVPSSHAAIQESLDSLGP
FT                   IFSELRDAGRELLELRRQCYEQQAADHADLADQLTVSAAMWEQHEQEAADKFGSIVDRG
FT                   R"
FT   gene            46395..46628
FT                   /locus_tag="MAV_0046"
FT   CDS_pept        46395..46628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66015"
FT                   /db_xref="InterPro:IPR024426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWI0"
FT                   /protein_id="ABK66015.1"
FT                   /translation="MHSVALSEEAMETDAETLAQGILLTADVSCLKALLEIRDEIVAAG
FT                   HTPSAEVPTPRDLDAAIEKLLAHKLRRRTHAK"
FT   gene            complement(46662..46805)
FT                   /locus_tag="MAV_0047"
FT   CDS_pept        complement(46662..46805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67764"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A176"
FT                   /protein_id="ABK67764.1"
FT                   /translation="MADSALQQQLDEVRTLLARARELFGPNPVEPPTGIAPDPSAAKPW
FT                   LR"
FT   gene            46888..48576
FT                   /locus_tag="MAV_0048"
FT   CDS_pept        46888..48576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69306"
FT                   /db_xref="InterPro:IPR040604"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2M7"
FT                   /protein_id="ABK69306.1"
FT                   /translation="MAIFGRMTARQRLRRATRESLSIPAFSSPVDCTPWVTGGLWPAEL
FT                   STVTPETATLAEYLKADLQRIADGANDELRKLKRAGMTDTARQAAEARVIEQARTRAVR
FT                   RVESTIRYLHAVQSGARPPAPPRPTLDAPGADLERTQVLPAVGDAEHTAGPPAQQTPEA
FT                   RPRPTRRRAAEDEPAQLEETRVLPAIRDDAAAADASVPETPASETPVPEAPAAEAPVPE
FT                   APAPEAPAAEVPEAPAPEAPAAEVPEPLGEPTTRGRHHAPVPEPVAERVEPDIAAPAEA
FT                   ADLEQTQVIPVVRRDEPVPEPPVVAPPEPAEEPADSGRHHAPADRDEPATEGRTAVADT
FT                   DTAQPRVEKPAPTTVFDNNRLNRLLEFVVRQEPRLNWAIGDRADGTTILVTDLAHGWIP
FT                   SGIALPAGVRLLEPERRSGDVVALIGETVRRVTYTPGDTLRRSADFAATQSSSQPRELP
FT                   PIDDLATAISRAIRGRAGLPKIVPRLADAAAAGAVIVDQEVDVLRVHLDTARYQLLVQY
FT                   PNVNPALLLKCLLMATTEGIASGDPVSANYHLAWYRTLAAPSPGG"
FT   gene            48627..48950
FT                   /locus_tag="MAV_0049"
FT   CDS_pept        48627..48950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69042"
FT                   /db_xref="InterPro:IPR024296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A540"
FT                   /protein_id="ABK69042.1"
FT                   /translation="MQVSDSGSRANLSDKDLVESVLRELSEAADKWEALVAQAEAVTYS
FT                   VDLGDIYAVANSDGRLLKLTLHPGVMTGYGHGELADRLNLAITALREEAEAENRASYGG
FT                   PLH"
FT   gene            complement(49093..49866)
FT                   /locus_tag="MAV_0050"
FT   CDS_pept        complement(49093..49866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR03083;
FT                   match to protein family HMM TIGR03084"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68521"
FT                   /db_xref="GOA:A0A0H3A2Z2"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017518"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2Z2"
FT                   /protein_id="ABK68521.1"
FT                   /translation="MTGPAPIVADLRAESDALDALVAPLPPGRWADPTPAAGWTIAHQI
FT                   GHLLWTDRVALIAVTDEPGFAEVLAGAAADPAGFVDKGAEELAAVAPAELLADWRATRD
FT                   RLHRALLGVPAGRKLPWFGPPMSAASMATARLMETWAHGLDVADALGVTRPATDRLRSI
FT                   AHLGVRTRDYAFAVNNLTPPAEPFLVELRGPRGDTWSWGPPEAAQRVTGSAEDFCFLVT
FT                   QRRPLSALDITADGADAQRWLEIAQAFAGPPGPGR"
FT   gene            complement(49924..51210)
FT                   /locus_tag="MAV_0051"
FT   CDS_pept        complement(49924..51210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0051"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66498"
FT                   /db_xref="GOA:A0A0H2ZVU7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVU7"
FT                   /protein_id="ABK66498.1"
FT                   /translation="MIPTRMQSSAPVEIWRSVRALPDFWRLLQVRVASQFGDGLFQAAL
FT                   AGALLFNPDRAADPLAIARAFTVLFLPYSLLGPFAGALMDRWDRRLVLVGANVGRLVLI
FT                   AAIGTILAVRAGDLSLLLGALFANGLARFVGSGLSASLPHVVPREQVVTMNAVATAAGA
FT                   VAAFLGANFMLVPRFLFGAGDRGAAAIVFLTVVPVSIALLLSWRFAPRALGPDDTWRAI
FT                   HGPVLYAVITGWLHGARTVAQRPTVAATLSGLAAHRMVVGINSLLVLLLVHHLPGLEGG
FT                   GFGTALLFFGAAGLGAFLANVLTPPAIRRWGRYATANGALAASAIIEVAGAELLLPVMV
FT                   VCGFLLGVTGQMVKLCADSAMQMDVDDALRGHVFAVQDALFWVAFIVAITVAGMVIPDD
FT                   GHAPVFALFGSVLYLVGLAVHGIVGRRGE"
FT   gene            51341..51946
FT                   /locus_tag="MAV_0052"
FT   CDS_pept        51341..51946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02622"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66131"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0Q8W4"
FT                   /protein_id="ABK66131.1"
FT                   /translation="MPPPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEH
FT                   NDGGTLGVVLNRPSDTAVYNVLPQWTTLAAKPKTMFIGGPVKRDAALCLATLRVGADPQ
FT                   GAPGLRHVDGRVVMVDLDADPDAIAPLVEGVRIFAGYSGWTIGQLEGEIERDDWIVLSA
FT                   LPSDVLVGPRSDLWGQVLRRQPLPLSLLATHPIDISRN"
FT   gene            complement(51962..52303)
FT                   /locus_tag="MAV_0053"
FT   CDS_pept        complement(51962..52303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64684"
FT                   /db_xref="GOA:A0A0H2ZSA3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSA3"
FT                   /protein_id="ABK64684.1"
FT                   /translation="MLIAGVLCICAAVASAGFGTWSLAHNRNYGATALALRAMAPTQLA
FT                   AAVMLAAGGTVALAAVPHTALVVLIVCVAGALGTLAAGSWQSARFAVRQQSAAPACAGS
FT                   CTGCTQSCA"
FT   gene            complement(52359..53459)
FT                   /locus_tag="MAV_0054"
FT   CDS_pept        complement(52359..53459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0054"
FT                   /product="proline-rich 28 kDa antigen"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64724"
FT                   /db_xref="InterPro:IPR019674"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSP9"
FT                   /protein_id="ABK64724.1"
FT                   /translation="MIEIVPGHRAVLGGMVAGLIGLAVAAGGTASADPLPPAPAPVPAP
FT                   APANLGPELVPPSRYLAAPQATTAATQITPATPGTPGPAPAPAPAQAPAPAPAPAPATS
FT                   GTIREFLQSKGVKFEAQKPQGFKALDITLPMPARWTQVPDPNVPDAFAVIADRHGSSIY
FT                   SSNAQVVVYKLVGNFDPREAITHGYVDSQKLPAWQPTNASMADFGGFPSSIVEGTYRDG
FT                   DLTLNTSRRHVIATSGPDKYLVSLAVTTDRAVAVADAPATDAIVNGFRVTVPGASAPAP
FT                   TAAPVALPAQAPAVAPVAPAPAPVAPAAPTAPAPAAAPLVPLAQTAPAAPAGLPAQPLP
FT                   NQQHTPSLLAMVPGLPPLPNFSFLQH"
FT   gene            53575..56553
FT                   /gene="leuS"
FT                   /locus_tag="MAV_0055"
FT   CDS_pept        53575..56553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="MAV_0055"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="identified by match to protein family HMM TIGR00396"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69297"
FT                   /db_xref="GOA:A0Q8W7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0Q8W7"
FT                   /protein_id="ABK69297.1"
FT                   /translation="MRNATETNLWPAKPPRRPLYPVQVTESPTTSPATGSGAAAPDSDA
FT                   PPYRYTAALAGRIEGSWQDTWAKLGTFNVPNPVGSLAPTDGTPVPEDKLFVQDMFPYPS
FT                   GEGLHVGHPLGYIATDVYARYFRMTGRNVLHALGFDAFGLPAEQYAVQTGTHPRTRTEA
FT                   NVVNFRRQLGRLGLGHDSRRSFSTTDVEFYKWTQWIFLQIYNAWFDPAANKARPIAELV
FT                   AEFDSGARSLDDGRNWSELSAGERADVIDSHRLVYRADSMVNWCPGLGTVLANEEVTAD
FT                   GRSDRGNFPVFRKRLRQWMMRITAYSDRLLDDLDLLDWPEPVKTMQRNWIGRSTGAKAL
FT                   FAATGADGAALDIEVFTTRPDTLFGATYMVLAPEHELVDELVAPAWPDGTDPRWTYGAA
FT                   TPGEAVAAYRRAIASKSDLERQESKAKTGVFLGSYATNPTNGKPVPIFIADYVLAGYGT
FT                   GAIMAVPGHDQRDWDFAHEFGLPIVEVIAGGDISEGAYAGDGLLVNSGYLDGLDVAAAK
FT                   EAITARLEAEGRGCARVEFKLRDWLFARQRYWGEPFPIVYDSDGRPHALDEAALPVELP
FT                   DVPDYSPVLFDPDDADSEPSPPLAKATDWVHVELDLGDGLKPYSRDTNVMPQWAGSSWY
FT                   ELRYTDPHNSERFCAKENEAYWMGPRPAEHGPQDPGGVDLYVGGAEHAVLHLLYARFWH
FT                   KVLYDLGHVSSREPYRRLVNQGYIQAFAYTDSRGSYVPAEEVVERDGRFFYRGPDGEIE
FT                   VFQEFGKIGKSLKNSISPDEICDDYGADTLRVYEMSMGPLEASRPWATKDVVGAHRFLQ
FT                   RVWRLVVDEQTGETRVVDGAGRDLPTGTLRLLHRTIAGVSEDYAGLRNNTAVAKLIEYT
FT                   NHLTKEHRDAVPRAAVEPLVLMLAPLAPHMAEELWLRLGHTTSLAHGPFPVADPAYLVE
FT                   DTVEYPVQVNGKVRGRVTVAADADRDTLEAAALADEKVLAFLAGAQPRKVIVVPGRLVN
FT                   LVV"
FT   gene            complement(56560..57231)
FT                   /locus_tag="MAV_0056"
FT   CDS_pept        complement(56560..57231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0056"
FT                   /product="short chain dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68752"
FT                   /db_xref="GOA:A0A0H3A2B5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2B5"
FT                   /protein_id="ABK68752.1"
FT                   /translation="MPNALITGAGGGIGSAIATALAPTHTLLLAGRPSDRLDAVAQRLG
FT                   ATTFPLDLTDGGDIEAACEVVDELDVLVHNAGLSIPGNVADSNVDEWRATFAVNVFGPV
FT                   ELTLALLPALRRARGQVVFINSGAGRNVSPGMASYSASKFALRAFADSLRNDEPELRVT
FT                   TVYPGRTDTGMQRELIAFEGGSYDPDRFLKPETVAAAVANVVATPPDGHVHEVVLRPAR
FT                   R"
FT   gene            complement(57290..57793)
FT                   /locus_tag="MAV_0057"
FT   CDS_pept        complement(57290..57793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0057"
FT                   /product="transcriptional regulator, MarR family protein"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68198"
FT                   /db_xref="GOA:A0A0H2ZZI3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZI3"
FT                   /protein_id="ABK68198.1"
FT                   /translation="MADSESNAAEVAELAEGLHRALSKLFAMLRRGDPSGAAAGDLTLA
FT                   QLSILVTLLDQGPIRMTDLAAHERVRTPTTTVAIRRLEKVGLVKRSRDPSDLRAVLVDI
FT                   TPRGRAVHGESLANRRAALAAMLSQLPASDLDTLMKALAPLERLASGDPTSGPAGVPPA
FT                   RKEA"
FT   gene            complement(57860..58606)
FT                   /locus_tag="MAV_0058"
FT   CDS_pept        complement(57860..58606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0058"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67296"
FT                   /db_xref="GOA:A0A0H2ZXC8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXC8"
FT                   /protein_id="ABK67296.1"
FT                   /translation="MSNPASRASVSLACKDIHQTLNGNAVLRGVDLDTPAGSTVAVIGP
FT                   SGSGKSTLLRTLNRLYEPDRGDILLDGRSVLHDDPDQLRQRIGMVFQHFNLFPHRTVLD
FT                   NVALAPRKLRRLPAEAARELALTQLDRVGLKHKAGARPATLSGGQQQRVAIARALAMSP
FT                   QVMFFDEATSALDPEMVKGILQLIADLGAEGMTMVVVTHEMGFARSASDAVIFMDHGKV
FT                   VESGPPEQIFEAAETERLQRFLSQVL"
FT   gene            complement(58603..60399)
FT                   /locus_tag="MAV_0059"
FT   CDS_pept        complement(58603..60399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0059"
FT                   /product="amino acid ABC transporter, permease protein,
FT                   His/Glu/Gln/Arg/opine family protein"
FT                   /note="identified by match to protein family HMM PF00497;
FT                   match to protein family HMM PF00528; match to protein
FT                   family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66421"
FT                   /db_xref="GOA:A0A0H2ZVL5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVL5"
FT                   /protein_id="ABK66421.1"
FT                   /translation="MGRRGTRRGKLLALTATVLMVCGSSALLAPPAAADRNQCAPAGPK
FT                   SAAVLPENLTRGGSMSQPDEHTTPTVEPLSSVRIDTLGLGTPGVLTVGTLSGAPPNVCI
FT                   TPTGQYSGFDNQLLRAIAGKLGLQVRFVGTDFAGLLAQVASRRFDVGSSSIKATDERRQ
FT                   TVAFTNGYDFGYYALVVPPGSAIKEFTDLAAGQRIGVVQGTVEESYVVDTLHLQPVKYP
FT                   DFATVYASLKTRQIDAWVAPAGQAATTIQPGDPAVVVANTISPGNFVAYAVAKDNKPLV
FT                   DALNSGLDAVIADGTWSNLYSQWVPRTLPPGWKPGSQAVAPPKLPDFAAIAASQHHKAV
FT                   GPAAPKSTLAQLRDSFFDWDMYRQAIPTLLRTGLPNTLILTFSASVIGLVLGMVLAVAG
FT                   ISHARWLRWPARVYTDVFRGLPEVVIILLIGLGIGPIVGGLTNNNPYPLGIAALGMMAA
FT                   AYIGEILRSGIQSVDPGQLEASRALGFSYATAMRLVVVPQGVRRVLPALVNQFIALLKA
FT                   SALVYFLGLVADQRELFQVGRDLNAETGNLSPLVAAGACYLILTVPLTHLVNMIDARLR
FT                   RGRAAVDPEEPAEMLTFGQEIT"
FT   gene            complement(60462..61202)
FT                   /locus_tag="MAV_0060"
FT   CDS_pept        complement(60462..61202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0060"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66819"
FT                   /db_xref="GOA:A0A0H2ZW86"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW86"
FT                   /protein_id="ABK66819.1"
FT                   /translation="MPKKYGVKEKDLVVSHILHLLLTGKLRTGDRVDRNEIAVGLGVSR
FT                   VPIQEALVQLEHDGIVSTRYHRGAFVERFDEATVLEHHELDGLLNGIASARAATSPTPR
FT                   ILGELDTLLRSLRTAKDSRAFTDIAAQYRRTVNDEYAGPRLHATIRASQNLIPRLFWTT
FT                   YQGGRDDLLPFYEDETSAIHRRDPEAARAACVERSYRMAQTMLGELFRRRVFTPPDDAG
FT                   RVVAGPLPVLADADTICGGASLAL"
FT   gene            complement(61321..62100)
FT                   /locus_tag="MAV_0061"
FT   CDS_pept        complement(61321..62100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0061"
FT                   /product="MmcI protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65273"
FT                   /db_xref="GOA:A0A0H2ZU50"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022480"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZU50"
FT                   /protein_id="ABK65273.1"
FT                   /translation="MTHPIRIGVQLQPQHAPQYNQIRDAVRRCEDIGVDIAFNWDHFFP
FT                   LYGDPDGAHFECWTMLGAWAEQTSRIQIGALVTCNSYRNPELLADMARTVDHISEGRLI
FT                   LGIGSGWKQKDYDEYGYEFGTAGSRLDDLAGALPRIEARLAKLNPAPTRDIPVLIGGGG
FT                   ERKTLRLVAQHADIWHSFTSAEEYPAKSEVLARHCADVGRDPDRIERSAAVKGGAELLA
FT                   NAEALVGLGVTLLTVGCDGPDYDLRDAQALCKWRDGR"
FT   gene            complement(62117..63031)
FT                   /locus_tag="MAV_0062"
FT   CDS_pept        complement(62117..63031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0062"
FT                   /product="hydrolase, alpha/beta fold family protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65554"
FT                   /db_xref="GOA:A0A0H2ZT10"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZT10"
FT                   /protein_id="ABK65554.1"
FT                   /translation="MTDVSEDELAGLSEFALLHENAEQAGVSGPLPEVARVESGSGDAK
FT                   VSALRWGSTDARIVFVHGGGQNAHTWDTVIVGVGEPALAVDLPGHGHSAWRADGDYSPQ
FT                   LNADALLPMLREHAAGADLVVGMSLGGLTAIRLGAVAPDLVKELVLIDVTPSALQRHSE
FT                   MTKEQQGTVALMHGEREFDSFQAMLDLTIAAAPHREVKALRRGVFHNSRKLDNGKWTWR
FT                   YDAIRKFPDFDGLWADVDALSAPVTLVRGGSSGFVSDEDAAELSRRAKHFRTAHVVANS
FT                   GHSVQSDQPRALIHILRGVLDAR"
FT   gene            complement(63055..64269)
FT                   /locus_tag="MAV_0063"
FT   CDS_pept        complement(63055..64269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0063"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68669"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A295"
FT                   /protein_id="ABK68669.1"
FT                   /translation="MNMAFGDGPHDAALRAAWTEFCARLQRAGERAFKDHNPASGPHRV
FT                   DAFRFLTQNLGQAFDLALETRDANYPVLHSFCGPTRKLGGDCADFTYQQAWIDGRSTYR
FT                   ITGTRGTSRFFNVTVQGRRTPGEGVLHEPFGDTPQANLFGQQLRVGADGRFELYVGGPE
FT                   RGHNWLPTTPESRKLFIRQGFDSWDEAPAQLRIERVDMTVPKPLPTPGEMVEAMRWAGD
FT                   FVTGLMSDWPEYPFRHGGVDAENPNTFPRAAATDADGKRGRAAANMYWELAPDEALIVE
FT                   FDAHPGLWMFTNMGVFFNSMDYLYRPVSYTPSRTTVDGDGRIRLVMAHRDPGVHNWLDT
FT                   QGFERGNLTYRHMLEGEPAVLDTRVVEHDELLDALPKDTVMVTPSQRADAMWKRFRGIR
FT                   RRYVL"
FT   gene            complement(64266..65069)
FT                   /locus_tag="MAV_0064"
FT   CDS_pept        complement(64266..65069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0064"
FT                   /product="AP endonuclease, family protein 2"
FT                   /note="identified by match to protein family HMM PF01261"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69517"
FT                   /db_xref="GOA:A0A0H3A6C7"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A6C7"
FT                   /protein_id="ABK69517.1"
FT                   /translation="MTGAHKRLSVHNVTFYGAPPAALQAHWAALGVSRLSILDNQLLDP
FT                   QLPMLLGRNDYTVEAVYHLFAGGRLTSDPGAAREALIAVIDAAASVGAHTVYLLTGGRA
FT                   GLTWPQAAERFAAMVAPCAARAKAAGVVLAIENASSLYADIHIAHTLRDTVALAEMSDL
FT                   GICIDLFHCWAEGDFEAQLPRALPRTALIQLSDYVLGDRALPGRAVPGDGAIPIEAFVA
FT                   QALAVGYAHGFDLELIGPRIEREGRLESARRACDVVGAMLDKLGG"
FT   gene            complement(65071..66240)
FT                   /locus_tag="MAV_0065"
FT   CDS_pept        complement(65071..66240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67534"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZH8"
FT                   /protein_id="ABK67534.1"
FT                   /translation="MTTLLDAAEMLAAAEAETGLHDYGDPTLPQRFTVAVEHLNALGLD
FT                   ADGRFEAAQVCRWLLTSRLELIEDRNRYPIGAEVIDAPMFVTGEPRSGTTLMHALMSVD
FT                   PHARALRFWEVMYPSPPPGLAGPDDDRRARADADWREINAKMPKWLHSHPYNDMLGDGL
FT                   PEDERTWAFDFRVMTPTAWWRVPMQSLVAGLPTDPAAQYRLHKAMLQQLQYNRPRKYWV
FT                   LKGFHGFRLKELFDTYPDARMVWLHRDPVQVAASRTMMMADIAEGMVGPVDLHAEAKKH
FT                   LEMTRASIANTMTNPLVDDPRILHLSYTDFIADHVGAVRRYYAFCGRELTAEAESAMRA
FT                   YLADNPGDRYGKFRYSTQLLTDIGEDLDALHAEFRPFRERFGVPIENRG"
FT   gene            complement(66237..67364)
FT                   /locus_tag="MAV_0066"
FT   CDS_pept        complement(66237..67364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65885"
FT                   /db_xref="GOA:A0A0H2ZVL2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVL2"
FT                   /protein_id="ABK65885.1"
FT                   /translation="MTVQPAAFLRTTLPLDLSRLDEFDSGRYHSVWLPDHMVSFWPDSI
FT                   WAPEFTDLATASASPHRHLDGLAVAAAAAVLTERVPLVSAVVDTVRRHPALLAQTALTL
FT                   DHLSKGRFILGLGSGESENTVPYGFDFARPVSRFEEALRVIRLLWDTDGPVDFNGEFYS
FT                   LHQARLDTEPYHDRLPPIWIGASGPRMLDIAGRYADGWWPAGAWTPEHYAEMLGAVRVS
FT                   AERAGRDPMAITPCFIQVCLIGEDDDALAEILRAPLVKAFLLQVSAKTLGEFGFEHPMG
FT                   DGWRGFQDIDPAALGRDRIVEFLHRVRPEMVLAVVPHGTPKQVAKIVKSYVDAGLRVPK
FT                   ILDYGAMAGLSHAQSSAANVRATEDELMRLCGDGS"
FT   gene            complement(67496..68602)
FT                   /locus_tag="MAV_0067"
FT   CDS_pept        complement(67496..68602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0067"
FT                   /product="myo-inositol-1-phosphate synthase"
FT                   /note="identified by match to protein family HMM PF01658;
FT                   match to protein family HMM PF07994"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64417"
FT                   /db_xref="GOA:A0A0H2ZRL8"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR017815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZRL8"
FT                   /protein_id="ABK64417.1"
FT                   /translation="MSDHQPPQAEDAQSEVRVAIVGVGNCASSLVQGVQYYFDADENST
FT                   VPGLMHVKFGQYHVRDVKFVAAFDVDAKKVGFDLSEAIFASENNTIKIADVPPTNVTVQ
FT                   RGPTLDGIGKYYADTIEVSDAEPVDVVQVLKEAKVDVLVSYLPVGSEEADKFYAQCAID
FT                   AGVAFVNALPVFIASDPVWAKKFTDAGVPIVGDDIKSQIGATITHRVMAKLFEDRGVQL
FT                   DRTMQLNVGGNMDFLNMLERERLESKKISKTQAVTSNLQREFKTKDVHIGPSDHVSWLD
FT                   DRKWAYVRLEGRAFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVIPA
FT                   SAYLMKSPPQQLPDDVARTQLEEFIIGG"
FT   gene            complement(68662..69204)
FT                   /locus_tag="MAV_0068"
FT   CDS_pept        complement(68662..69204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0068"
FT                   /product="transcriptional regulator, PadR family protein"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65104"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZRZ7"
FT                   /protein_id="ABK65104.1"
FT                   /translation="MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRR
FT                   MQAEGLIAEDAAPAGTPVRRARRVYQLTDEGRRRFGELVADTGPHNYTDDGFGVHLAFF
FT                   NRTPAEARMRILEGRRRQVEERREGLREAVARASSSFDRYTRQLHQLGLESSEREVKWL
FT                   NELIAAERAMPGLSEQT"
FT   gene            complement(69351..70235)
FT                   /locus_tag="MAV_0069"
FT   CDS_pept        complement(69351..70235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0069"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF08044"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68396"
FT                   /db_xref="GOA:A0A0H3A324"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A324"
FT                   /protein_id="ABK68396.1"
FT                   /translation="MAKWLGTPPAGTAPPSGRASTRAKDSDRQSTCTILDNALNDGELS
FT                   AEEHRERVSAATRAVTLGDLQTLVCDLQTGPQPPALDPSPPSGRVRGWGTLAAAFVVSV
FT                   LLGIGIGWGLYGNTSSPLDFTSDPGAKPDGVNAVVLTPPTQLHSVGGLTGLLEQMRKRF
FT                   GSTLGYRLVIYPTYAALDRPDPSDDRRVLAYTYRGGWGDPTSSAKSSSDGPVLVDLSKF
FT                   DVTAAVGIMRGAPETLRMKPSDVKTSYLIVEPATDPTTPGALSLSVYVSSDYGGGYIAF
FT                   TGDGTVKQMNLPT"
FT   gene            70351..70794
FT                   /locus_tag="MAV_0070"
FT   CDS_pept        70351..70794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65676"
FT                   /db_xref="InterPro:IPR035169"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTJ9"
FT                   /protein_id="ABK65676.1"
FT                   /translation="MGVRLQRQVVDYALRRRSLLAEVYSGRTGVSEVCDANPYLLRAAK
FT                   FHGKPSQIMCPICRKEQLTLVSWVFGEHLGPVSGSARTAEELVMLATRFEEFAVHVVEV
FT                   CRTCSWNHLVKSYVLGAARPAPPPRGTRTTTRTARNGARTATE"
FT   gene            70791..73424
FT                   /locus_tag="MAV_0071"
FT   CDS_pept        70791..73424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0071"
FT                   /product="Transglycosylase"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF00912"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69494"
FT                   /db_xref="GOA:A0A0H3A402"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A402"
FT                   /protein_id="ABK69494.1"
FT                   /translation="MSSNNEGRHSQSSGDQRGPAAEQGAGERRETARPDADPQRRNGPS
FT                   TSSRRRQAPPDDRLTTILPPVDDDRAPRRSDPIEEVKAALAGPPSTPLRRDALDEVKAA
FT                   LDSRGPASGRQQRAGLGGRPPVGPPPPPPRRGWSGGPGGPGGRGSGPWRDWSWTQQINW
FT                   LWVRRAAYLCAAVLVLLPIVTFAMAYFIVDIPKPGDLRTNQVSTILASDGSEIAKIIPP
FT                   EGNRVDVNLNQVPVHVRQAVIAAEDRNFYSNPGFDFSGFARAVNNNLFGNGDLQGGSTI
FT                   TQQYVKNALVGSAQHGVSGLMRKAKELVIATKMSGEWSKDEVLQSYLNIIYFGRGAYGI
FT                   SAAAKAYFDKPVEQLTVSEGALLAALIRRPSTLDPAVDPKGALARWNWVLDGMVETKAL
FT                   PAKDRAAQVFPQTVPPDQARAQNQTTGPNGLIERQVTKELMELFNIDERTLNTQGLQVT
FT                   TTIDPKAQQAAEKAVSKYLDGQDPDMRAAVVSVDPHDGAIRAYYGGSDANGFDFAQAGL
FT                   QTGSSFKVFCLIAALEQGIGLGYQVDSSPLTVDGIKITNVEGESCGTCNIAQALKMSLN
FT                   TSYYRLMLKLKGGPQAVADAAHQAGVATSFPGVDHTLSEDGKGGPPNNGIVLGQYQTRV
FT                   IDMASAYATLAASGVYHRPHFVQKVVNSDGQVLFDAGKSDNNGEQRIPKAVADNVTAAM
FT                   EPIAGYSRGHALAGGRPSAAKTGTTQLGDTTSNKDAWMVGYTPSLSTAVWLGTAKGDQP
FT                   LVTASGGPVYGSGLPSDIWKATMDGALKGTPNESFPKPAEVGGYAGVPAPPPPPKAPPS
FT                   ETVIQPTIEVAPGITIPVGPPTTVTLAPAPPAGGPPGGPEPGGGVPPGPGGGVPPGGPQ
FT                   APPPPP"
FT   gene            73421..75058
FT                   /locus_tag="MAV_0072"
FT   CDS_pept        73421..75058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69463"
FT                   /db_xref="GOA:A0A0H3A347"
FT                   /db_xref="InterPro:IPR016570"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A347"
FT                   /protein_id="ABK69463.1"
FT                   /translation="MTGAAEPSTTISPGPLAADRRSADNRDCPSRNDFLGAAFAEVIGG
FT                   PVGRHALIGRARIMTPLRVMFLIALVFLALGWSTKAACLQSTGTGTGDQRVANWDNQRA
FT                   YYELCYSDTVPLYGAELLSQGKFPYKSSWIETDSTGAQQIRYDGQPAVRYMEYPVLTGM
FT                   YQYVSMALAKTYTALSKLAPLPVVAEVVMFFNIAAFGLALAWLATVWASAGLAGRRIWD
FT                   AALVAGSPLLIFQIFTNFDALATAFAMAGLLAWARRRPVLAGVLIGLGAAAKLYPLLFL
FT                   GPMLVLGIRTGRLGAWARTAVVAVATWLLVNLPVLVFFPRGWSEFFRLNTRRAEDMDSL
FT                   YNVVKSFTGWRGFDPKLGFWQPPTVLNTVVAVLFVTCCAAIAFIALTAPRRPRAAQLVF
FT                   LVVAAFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTVDALVWVPRMYYLYGNPNR
FT                   SLPEQVFTTTVLLRDIAVITLCALVIRQIYRPDEDLVRWGGRVDDPAGGPFNRAPDAPP
FT                   GWLPDWLRPAGSRRGQAAEPEPALAGAT"
FT   gene            75055..75696
FT                   /locus_tag="MAV_0073"
FT   CDS_pept        75055..75696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0073"
FT                   /product="DJ-1/PfpI family protein"
FT                   /note="identified by match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67336"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZZ0"
FT                   /protein_id="ABK67336.1"
FT                   /translation="MTLIAIPLFPRVTALDAVGPYEVLQRIPSVQVVFIGQRRGEVRTE
FT                   NGMLGLACDATFDEVSAPDVVVFPGGIGTRQLIHDEAVRAWLQAVHPHTRFTTSVCTGA
FT                   LLLAAAGLLDGLTATTHWRAADLLKGLGARYVEQRVVEHLPQRIITAAGVSSGIDMALR
FT                   LVELLVDRQAAQAAQLLIEYDPQPPFDSGALGKADAATVARAEEYLTGRR"
FT   gene            75831..76121
FT                   /gene="rpsF"
FT                   /locus_tag="MAV_0074"
FT   CDS_pept        75831..76121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="MAV_0074"
FT                   /product="ribosomal protein S6"
FT                   /note="identified by match to protein family HMM PF01250;
FT                   match to protein family HMM TIGR00166"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67398"
FT                   /db_xref="GOA:A0A0H3A051"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A051"
FT                   /protein_id="ABK67398.1"
FT                   /translation="MRPYEIMVILDPTLDERTVAPSLETFLNVVRKDGGSVEKVDIWGR
FT                   RRLAYEIAKHAEGIYVVIDLKAEPATVSELDRQLSLNESVLRTKVMRTDKH"
FT   gene            76239..76746
FT                   /pseudo
FT                   /locus_tag="MAV_0075"
FT                   /note="single-strand DNA-binding protein; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by match to protein family
FT                   protein HMM PF00436; match to protein family protein HMM
FT                   PF01336; match to protein family protein HMM TIGR00621"
FT   gene            76788..77042
FT                   /gene="rpsR"
FT                   /locus_tag="MAV_0076"
FT   CDS_pept        76788..77042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="MAV_0076"
FT                   /product="ribosomal protein S18"
FT                   /note="identified by match to protein family HMM PF01084;
FT                   match to protein family HMM TIGR00165"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68861"
FT                   /db_xref="GOA:A0Q8Y7"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0Q8Y7"
FT                   /protein_id="ABK68861.1"
FT                   /translation="MAKSNKRRPAPEKPVKARKCVFCAKKDQAIDYKDTALLRTYISER
FT                   GKIRARRVTGNCVQHQRDIAIAVKNAREVALLPFTSSAR"
FT   gene            77073..77531
FT                   /gene="rplI"
FT                   /locus_tag="MAV_0077"
FT   CDS_pept        77073..77531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="MAV_0077"
FT                   /product="ribosomal protein L9"
FT                   /note="identified by match to protein family HMM PF01281;
FT                   match to protein family HMM PF03948; match to protein
FT                   family HMM TIGR00158"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65373"
FT                   /db_xref="GOA:A0Q8Y8"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0Q8Y8"
FT                   /protein_id="ABK65373.1"
FT                   /translation="MKLILTADVDHLGAVGDTVEVKDGYGRNFLLPRGLAIVASRGAQK
FT                   QADDIRRARETKAVRDLDHANELKTAIEALGPVTLPVKTAGDSGKLFGSVTAGDVVAAI
FT                   KKAGGPNLDKRIVRLPKAHIKALGTHPVAVHLHPEVDVEVALEVVPQS"
FT   gene            complement(77682..78008)
FT                   /locus_tag="MAV_0078"
FT   CDS_pept        complement(77682..78008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0078"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A081"
FT                   /protein_id="ABK68006.1"
FT                   /translation="MSVGQGADILAVSHPLARRRDDVRRCWLVGEGGAVHEAVHGVCIS
FT                   VDTCVERGVENLWINAKGKDIGADTGHTTPRNPCGQESLRRVGPGYRPGRVGFPPYFRC
FT                   VTAR"
FT   gene            78063..80450
FT                   /locus_tag="MAV_0079"
FT   CDS_pept        78063..80450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0079"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF00772;
FT                   match to protein family HMM PF03796; match to protein
FT                   family HMM TIGR01443"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66051"
FT                   /db_xref="GOA:A0A0H2ZW51"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW51"
FT                   /protein_id="ABK66051.1"
FT                   /translation="MAVVDDLTSGMDSSSPSEDFGRQPPQDLAAEQAVLGGMLLSKDAI
FT                   ADVLERLRPGDFYRPAHQNVYDAILDLYGRGEPADAVTVAAELDRRNLLRRIGGAPYLH
FT                   TLISTVPTAANAGYYATIVAEKALLRRLVEAGTRVVQYGYAGAEGADVAEVVDRAQAEI
FT                   YEVAERRTTEDFVPLEDLLQPTMDEIDAIASNGGVARGVPTGFTELDEVTNGLHAGQMI
FT                   IVAARPGVGKALALDTPLPTPTGWTTMGDVAVGDELLGDDGRPTRVVAATDVMLGRPCY
FT                   EVEFSDGTVIVADAAHQWLTETRVSRKSAQAAAVGYNRYKNQRTFAAVRTTAEIAETLR
FT                   CPAQDRRLNHSVVNARALELPDREFLVPPYTLGAWLGDGTSAAAQITAADPEIIMRIEA
FT                   EDSGAGVGTLQARLRTIGVLGNKHIPTEYLRGSEAQRRALLAGLLDTDGTVTVGGAVQF
FT                   SVTNQRLARDVNELIVSLGYRCQTSTKRVQGRSETSSIAYTLTFSTADKVFALERKAIA
FT                   HKERRAVTGTSRGGSRFIVDVRPIEPVAVRCVEVDNDSHMYLASRAMVPTHNSTLGLDF
FT                   LRSCSIKHRMASVIFSLEMSKSEIVMRLLSAEAKIKLSDMRSGRMSDEDWTRLARRMSE
FT                   ISEAPLYIDDSPNLTMMEIRAKARRLRQKADLRLVVVDYLQLMSSGKKVESRQLEVSEF
FT                   SRQLKLLAKELEVPVVAISQLNRGPEQRTDKKPMLSDLRESGSLEQDADMVILLNRPDA
FT                   FERDDPRGGEADFILAKHRNGPTKTVTVAHQLHLSRFANMAR"
FT   gene            complement(80591..81478)
FT                   /locus_tag="MAV_0080"
FT   CDS_pept        complement(80591..81478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0080"
FT                   /product="acyltransferase domain protein"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68204"
FT                   /db_xref="GOA:A0A0H2ZZI6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016676"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZI6"
FT                   /protein_id="ABK68204.1"
FT                   /translation="MNSPARQLLSATADDQRARRQAAIERALFGLARQWDRVRPVYKPY
FT                   VDGLENLPSDGRFLLVANHSYTPSSEILLLLYEVQRHLGRRVRALMDRRFGRFAGLAAD
FT                   VLAAGGGIVGTREGTAELMRANEPILVFPGGAREIGKGKDQLNTLQWGDRAGFARLAIE
FT                   HNYPIVTAAVVGGDDMYKILTTSDGTWAQLNKKVSIWLGSDADLLLPLSRGIGPTLLPR
FT                   PQRLYARFSRPIDTTRPKGTPHDEWLTKVRETAKTDLESNLAALLAIRATDPFRNLAPW
FT                   AWRKAVMPHPAQDR"
FT   gene            complement(81564..82373)
FT                   /locus_tag="MAV_0081"
FT   CDS_pept        complement(81564..82373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67500"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYP7"
FT                   /protein_id="ABK67500.1"
FT                   /translation="MSEALTVDPAIASMPRGGPDASWLDRRLQTEKLEYTDRYDIPDEV
FT                   KQTVVAALDRMGTRAGYHERNARTALDIVADIANPRILELGAGHGKLSAEILTSHPTAT
FT                   VTVSDLDPTSVANIAAGPLGADPRARTQVVDATAIDAPDDSYDLVVFAQAFHHLPPATA
FT                   VRAIAEATRVGKRFLVIDLPRPRSVQLLLTPLILAPFAAALALVRPSLKHVMHDAYISA
FT                   LRAYSRSAFIALGKAADPRMGVEFLPLSACRLRPGHVGIVFTRPRAS"
FT   gene            82456..83025
FT                   /locus_tag="MAV_0082"
FT   CDS_pept        82456..83025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0082"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67078"
FT                   /db_xref="GOA:A0A0H2ZZC5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZC5"
FT                   /protein_id="ABK67078.1"
FT                   /translation="MRTATELRGEILQAAGAEFAQYGLAGARIDRIARVAQASKERLYA
FT                   HFRDKETLFREVVAAGNREFFSAVTLRPDAVPDFVGGIYDLAREHPEHHRMISWAQLEG
FT                   IALDEPHAEGQPAFAQHVAAIEAAQADGHVDGAWQPDDLLIVLFGIALAWANSPHPDAA
FT                   TNDPDANARRRAAAVEAARRIIAPSK"
FT   gene            84512..84933
FT                   /pseudo
FT                   /locus_tag="MAV_0083"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which is not the result of sequencing error"
FT   gene            84930..87863
FT                   /locus_tag="MAV_0084"
FT   CDS_pept        84930..87863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0084"
FT                   /product="putative transport protein MmpL4"
FT                   /note="identified by match to protein family HMM PF03176;
FT                   match to protein family HMM TIGR00833"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67817"
FT                   /db_xref="GOA:A0A0H3A1D0"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1D0"
FT                   /protein_id="ABK67817.1"
FT                   /translation="MSDDMSDTDEIPVAHRTHVEHKPRLARTIRVLALPIVLGWLVLAV
FT                   GVNVFVPQLEKVAEEVSVPLSPSDAPSVTGMKHIGEKFKEYDSDNLVLVTLVGDKPLGE
FT                   DAHRFYDGLVEKLKQDPHVEHALNFWGQRFTSSGVESYDHRSAYVQVNLRGDQGGAVGD
FT                   KSVAAIRKIVADSKPPAGVKAYVAGQGALTADTIVVGDASLAKMTIITIIIIAIMLMFV
FT                   YRSIGTVLLTMVILFVGLATGRGVVALLGETGIMGLSTFAVNLLTALAIAAGTDYAIFM
FT                   VGRYQEGRERGLDREAAYYDTFAGVTKVVLGSGLTIVGALACLKFTRLPYFSSLAFPCA
FT                   VGLLVVVAAGVTLTPALIALASGFGLFDPKRKFNYTRWRRLATAIVRWPAPILATSVIL
FT                   AIVGAIGLMGFTPRYNDLYYLPQSASSVQAYNAADRHFTQARLNPDLLMIESDHDLRNP
FT                   RDMLVLDKVAGAIFRVPGIERVQSITRPLGPPIQDGSVPFQLSVQSAPIRSNLDYLKAR
FT                   VGDIKKITGFLDTQIALLERQYAVTQKLANAADDSSKTTGETAAITDQIRDHIADFDDF
FT                   WRPIRSYFYWEKHCYDIPICWSLRSLFDALDGFDQLAEKFHALTSDLTDTAKATRELLA
FT                   IIPENIAVSKSIRDTTLTIYSSFDSLIAQFDRLTDTNAVMGKSFNDSQVESLFYLPPEI
FT                   FQNPDFQLGLSLMVSPDGKAARFIITHATDPATVKGIASVDQERQAAKEALKLTSLENA
FT                   DIYLGGTAATFYDIANGAKYDLMIAAVASIVLIFIIMVIVTRALVAAGVIVGTIVLSLG
FT                   AAFGFSTLIWQHLADFQLHWVATEFALIVLLAVGSDYNLMLVSRIEEEIGAGLKTGLIR
FT                   GMGVTGPVVTAAGVVFAVTMGAMITSDLRAIGQFGTTIGIGLLFDTFVVRSLITPSIMT
FT                   AMGRWFWWPKRVRVRPASQMLRSVGPRPLVRALLHQPRHAVPPPPTT"
FT   gene            88122..89186
FT                   /locus_tag="MAV_0085"
FT   CDS_pept        88122..89186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67275"
FT                   /db_xref="GOA:A0A0H2ZXA8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXA8"
FT                   /protein_id="ABK67275.1"
FT                   /translation="MSIDNESTASRQFVASAAAFSSKWTKGIRYWQAGYTAVFIAFVVF
FT                   IAVKMLGTLKMVNLRTPHIGAAAVYALPIGLVVVGAAIGSYLWWRSRRTYLLTVAGDSL
FT                   TIGRRRPEVYPLADAQLGLWVDNGVALHLHSGRRRFVLGGRDRRIGPGTPLAAPPVPLV
FT                   DASLGAADFDELLALGGWSAARGPATGEPIRCLLFPNPLETQRMGSFALRKKQRLIRSL
FT                   SQPQLLIDLDADSIRVIDPNNDAVMAMTWVARVTATPATYRLSAGHAVPSAQHIASDAV
FT                   GQYFSTMPALRIDIAGMPPLTVGCRAFDGLKQRCSWSPDVPTTHEPPTYAVSAADWQSL
FT                   VEKMGLAARLADTA"
FT   gene            89269..89544
FT                   /locus_tag="MAV_0086"
FT   CDS_pept        89269..89544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0086"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68942"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2V9"
FT                   /protein_id="ABK68942.1"
FT                   /translation="MTVIAAIGALATAAFLGYHVGRRAGSPRPTWAKRTSRPALGRLAI
FT                   TLIAMIAARRIQQRLRAERGRAATHASRLVAPLGILRAGVTRIRCY"
FT   gene            89564..90304
FT                   /locus_tag="MAV_0087"
FT   CDS_pept        89564..90304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0087"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family protein"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65164"
FT                   /db_xref="GOA:A0A0H2ZTM9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTM9"
FT                   /protein_id="ABK65164.1"
FT                   /translation="MAALQDKVALVTGASSGLGAETAKLFSSRGATVFGIGRDTARLAE
FT                   VFAGIERGGFASVDIASPQACTEAVAQCVRDFGGLDVLVNVAGIHRMRRTESMTDEDWE
FT                   HDLAVNLNGPFFLCRAALPQLLERGGNIVNVSSIAGVEGQAYSAGYCAAKHGLIGLTRA
FT                   LAVEYTADRLRVNAVCPGGMLTPQIERFSAPDDPNYDLILRTAAPRGMMRPLDVANVIA
FT                   FLASDAAAAVHGAVYRVDNGKGAG"
FT   gene            complement(90333..90968)
FT                   /locus_tag="MAV_0088"
FT   CDS_pept        complement(90333..90968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67399"
FT                   /db_xref="GOA:A0A0H2ZYC6"
FT                   /db_xref="InterPro:IPR033458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYC6"
FT                   /protein_id="ABK67399.1"
FT                   /translation="MIGELTVRWAVTALFGASLAAYAYLAVSQRGRWSCAVNHLLHLAM
FT                   SAAMILMVWRVGLGLPAVAPTLFFLLAGAWFVFLAVRASAESRERLKTCYYAAMMAAMA
FT                   WMYALMSSGTTGAHAHGHSASDSVGANMPGMRLPEHPASPGAGGFSWVAAANWLGALGF
FT                   AALAVYWLYRFVGQRRLARVPARLARMEPLYQAFTAAGTALMFDTLLR"
FT   gene            91195..92631
FT                   /locus_tag="MAV_0089"
FT   CDS_pept        91195..92631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0089"
FT                   /product="FAD binding domain protein"
FT                   /note="identified by match to protein family HMM PF01565"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64471"
FT                   /db_xref="GOA:A0A0H2ZS20"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZS20"
FT                   /protein_id="ABK64471.1"
FT                   /translation="MAREISRQTFLRGAVGALAAGAMLGAPRVGADPRPSGWEGLSTAL
FT                   GGKVLLPDSPQFAGAKQVFNTNYNGSTPAAVVTPTSAADVQKAMAFAAAHNLKVAPRSG
FT                   GHSYTGASTANGTMVLDLRQLPGDANYDAATGQVTVTPATSLYTMHRTLAAVGRGVPTG
FT                   TCPSVGAAGHALGGGMGAQSRHAGLLCDQLTSASVVLPSGQAVTASTASNPDLFWALRG
FT                   GGGGNFGVTTSLTFATFPTKDVDAVNLNFPPQSFAQVLVGWQNWLRTADPNSWALADAT
FT                   VDAMGVHCRILATCPAGSGNSAAAAITQAVGIQPSGVETHTFNYMDLVNYLAVGNLNPQ
FT                   PLGYVGGSDVFPTVNAAVAQGIAAAVNAFPRNAGRMLAIMHALDGALATVAPAATAFPW
FT                   RRQSALVQWYVETSGDPAAATNWLASAHQAVQQYSVGGYVNYLEANQSPARYFGPNLSR
FT                   LSAVRQKYDPGRVMFSGLNY"
FT   gene            92758..92877
FT                   /locus_tag="MAV_0090"
FT   CDS_pept        92758..92877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0090"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66575"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVP8"
FT                   /protein_id="ABK66575.1"
FT                   /translation="MAWAQYRFLERDDSKLEYQVSCDECGNHYSEVTATTPAA"
FT   gene            93019..93696
FT                   /locus_tag="MAV_0092"
FT   CDS_pept        93019..93696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0092"
FT                   /product="transcriptional regulator, Crp/Fnr family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00027;
FT                   match to protein family HMM PF00325"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66659"
FT                   /db_xref="GOA:A0A0H2ZY06"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZY06"
FT                   /protein_id="ABK66659.1"
FT                   /translation="MDDILAQATIFQGIDPEAVAALSRHLQHVSFPRRRTVFVEGEPGD
FT                   DLYVIVSGAVKIRHQTADGRETVFAVLGPGDVFGELALFDPGPRTSTVITLTEVEALRM
FT                   DRNALRTWIIERPEIAEQLLRVLARRLRHTNNTLCDLIFTDVPARVAKQILDLAMRFGT
FT                   DSGGPVRVEHHLTQKELAQLVGSSRETVNKALADFAQRGWIRQQGKALIIDQPAKLARR
FT                   ARA"
FT   gene            complement(93693..94136)
FT                   /locus_tag="MAV_0091"
FT   CDS_pept        complement(93693..94136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0091"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68042"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0P6"
FT                   /protein_id="ABK68042.1"
FT                   /translation="MVEPSTGAWPAQLPAVQVRFARPTAQLDRIVEFYRDVLHLPQLHS
FT                   AGDDEWSVVMFGLPGDQYHLEFVARRDGIDGAAPTRENLLVFYFESAAQQQSVAARCRE
FT                   AGAEEVVLDNPWWRRNGADAFLDPDGWTIVLMPRPVPLPAPTA"
FT   gene            complement(94157..95089)
FT                   /locus_tag="MAV_0093"
FT   CDS_pept        complement(94157..95089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0093"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69470"
FT                   /db_xref="GOA:A0A0H3A353"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A353"
FT                   /protein_id="ABK69470.1"
FT                   /translation="MLSCMANREGQKLFSRSRQMPATPSWFTAALDQKPERCDVEVDGC
FT                   RIRMRVWGAADQPPVVLVHGGGAHSGWWDHIAPFFSHTHRVIAPDLSGHGDSDPRDSYD
FT                   LRIWAGEVMAAAAAAGPAGRPTIVGHSMGGWVVSTAAMHYSSKINSMLVIDSPLWERAP
FT                   EEGRLRRRKHTEYRTRDEILARFTAVPSQELILPYVREHIAAESIRKTSAGWVWKFDPA
FT                   IFGGEFLQPTPADEESLESMLTAMRCRVGYLRCEAGLVPPAMAERIRSLLQLRGPFVEL
FT                   AQAGHHPMLDQPLPLVATLRTLLEFWSIT"
FT   gene            complement(95180..96031)
FT                   /locus_tag="MAV_0094"
FT   CDS_pept        complement(95180..96031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0094"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68798"
FT                   /db_xref="GOA:A0A0H3A3H8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3H8"
FT                   /protein_id="ABK68798.1"
FT                   /translation="MGQVLDIAPLRSLVAVADCGGFHRAAAALHLSQSAVSQHLRRIEA
FT                   VVGEPIVQRSGRGVVFTEVGQKALRHARTILAAHDTALDDLGATENKVLTIGATEHGAD
FT                   VMLAGLSGALRDRLPDLRVRFRLDRNVSLADSIDRGLVDVAIMLDGAGLDRANASGLVR
FT                   LQWVSARTLTIAPKDPLPLVIFSEPCTLREPAFAILDSHRIDYEIAAECGDLSGLYAAV
FT                   RSGLGVALLPMIGKFPDGLGPAEGLPPANNASILVRGRTGIDPALLSTVDTAVRDLLAT
FT                   AT"
FT   gene            96201..97118
FT                   /locus_tag="MAV_0095"
FT   CDS_pept        96201..97118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0095"
FT                   /product="integral membrane protein DUF6"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68010"
FT                   /db_xref="GOA:A0A0H3A1X3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1X3"
FT                   /protein_id="ABK68010.1"
FT                   /translation="MPLTTASAVTFFYALGYPIGTLAVVAMTPMAALVLRFGLAAMVLA
FT                   VWTAIAKAGWPRGARLGHVIVAGLLIQGVQFCCLYEAVQLGAPAVLCAVMIAMNPVATA
FT                   ILAATFLREPLGVQRTVALVLGVLAVLAACSQRLMSTHGVDPVIVLLFVALLGLSAGGV
FT                   YQQRFCGGVDFRAMSALQNGVALLPAAGLAMLTPFGVHDGRKALVAVAAMVLLNATLAV
FT                   SLYVRAINAHGAAAVAMLFAVIPAVAAVLSWIILGQRPDQGVAAGLVLGGLACWVNTRA
FT                   ASRPRTQRDGVPAAAPAELQSVSR"
FT   gene            97404..97879
FT                   /pseudo
FT                   /locus_tag="MAV_0096"
FT                   /note="conserved hypothetical protein, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by match to
FT                   protein family protein HMM TIGR02246"
FT   gene            97888..98454
FT                   /locus_tag="MAV_0097"
FT   CDS_pept        97888..98454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0097"
FT                   /product="phosphinothricin N-acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66397"
FT                   /db_xref="GOA:A0A0H2ZXK8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXK8"
FT                   /protein_id="ABK66397.1"
FT                   /translation="MATSDDAAAVAAVYLPYVRDTAISFETQQPSVEEMRSRLTTTLAT
FT                   LPWLVITDGPRVKGYAYASPHRAREAYRWSVDVSLYLDASIHRQGQGRRLYTALLNLLG
FT                   AQGYINAYAAITLPNAASVGLHEALAFRRVGVFPRVGFKQQRWWDVGWWHRRLADPPAV
FT                   PEEPRPWTRLPAPTINSALAVHPAQ"
FT   gene            complement(98467..99156)
FT                   /locus_tag="MAV_0098"
FT   CDS_pept        complement(98467..99156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0098"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64678"
FT                   /db_xref="GOA:A0A0H2ZSK7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSK7"
FT                   /protein_id="ABK64678.1"
FT                   /translation="MQLMNDRKPLQTVGNRGTWLVRRFRVAAEGIADDEVAPADEPDVA
FT                   EASPNQSEQTDKAAEGEGEPPRPRKRRRIKLVRAIAAGILAAVLATAGYEGWLLFEQHQ
FT                   KDVAAAQALDAAKKYILALTSVDTNAIDKNFAEVLDGSTGEFKDMYTKSSAQLRQTLID
FT                   NKAAAHGNVVDAAVRSATEDKVEVVLFVDQSVSNGAAPAPQLDRSRVKMTMEKVDGRWL
FT                   ASKVELP"
FT   gene            complement(99147..99749)
FT                   /locus_tag="MAV_0099"
FT   CDS_pept        complement(99147..99749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0099"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64564"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSF4"
FT                   /protein_id="ABK64564.1"
FT                   /translation="MFLTRLRRAGSGLAGAALAAAVVLSGHAHADPGQPPPPLPLFTPS
FT                   PSDWSPNFDIWPYNTFTSRVTPEMISGMSDSCQWFKSQFDPLMGQINDFNTYLGDQHDD
FT                   YAAAAVQRNADAVVGNIDRSTAFLTPRVKPLIITNQPDNFGPYSPVYGGESMTHLAFQL
FT                   SRISDSIKRKDPSGVTHANIVSATGWANALRDSGACN"
FT   gene            100083..100940
FT                   /pseudo
FT                   /locus_tag="MAV_0100"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which is not the result of sequencing error;
FT                   identified by match to protein family protein HMM PF02405"
FT   gene            100937..101794
FT                   /locus_tag="MAV_0101"
FT   CDS_pept        100937..101794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0101"
FT                   /product="ABC-transporter integral membrane protein"
FT                   /note="identified by match to protein family HMM PF02405"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69510"
FT                   /db_xref="GOA:A0A0H3A410"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A410"
FT                   /protein_id="ABK69510.1"
FT                   /translation="MTASTYIPGLARPFVGAYRVAAAPTMRLGHMLVFFVRAVLAVPTV
FT                   LRQYRTEFLRLLSNIAWGNGSIVVGGGTAGVAVVLGFTAGALVAVEGYNFLNLLGLGPA
FT                   TGIISSLVNTRELAPIMASLAFAMQAGCRFTAQLGAMRIAEEIDALESLAIRPIPFLVT
FT                   TRLMASVIAVIPLYIACLAVTYLTCQVVANIISGGSIGPYLHYFTMMLSAKDIAYSVLK
FT                   CVVFVWLSSTVQCYYGFYAAGGPEGVGVAAGHAMRASITVVIMVNMLLTMALWSIDAGA
FT                   RFGG"
FT   gene            101795..103351
FT                   /locus_tag="MAV_0102"
FT   CDS_pept        101795..103351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0102"
FT                   /product="mce related protein"
FT                   /note="identified by match to protein family HMM PF02470"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67553"
FT                   /db_xref="GOA:A0A0H2ZY03"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZY03"
FT                   /protein_id="ABK67553.1"
FT                   /translation="MANSLDFDGRGPTDHQLLALGATVLLIAGLITGGLLLKSTGRLND
FT                   YIRVVAELTNVGDGLPARSDVKYHGLLVGAVDNVIPAAYGKPNYVHINLKPEYAQDIPS
FT                   AVTARVVPSNVFAVSSVQLVDGAPGPSIRNGARIPEDLQLSTVIFQTTISKLRDILAAT
FT                   GRGREDHSVGILAAVAAATNNRRGPLLTAGAQLTRVLDELNAIVATDPGPSTVSALLDA
FT                   TRGLQSTAPDLVDVLHDAVRPMQTLVEKREQFRSLVTGSYHTFSVNRQAFDNHTDQLIE
FT                   MTQNLTPVLGVFAMNSDKFVPIFTRLNRLSDKFFQEVWDPELDTGNMRVNLALTPTYTY
FT                   TRADCPRYGQLQGPSCFTAPTIAVRPDLPEVLLPQNYHPPTDLAPPPGTQIGPDGNLVA
FT                   TGPPLYNPDPSLADPNPPLPWWPWQIGPAPRVPGTADPDDAPPPPPPSPPPSPAPPGPV
FT                   APAAYGGNVGPVGSQRERDQLGLITGQGRPASVATQLLLGPVARGSAVSLQPRPAPGGP
FT                   K"
FT   gene            103354..104427
FT                   /locus_tag="MAV_0103"
FT   CDS_pept        103354..104427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0103"
FT                   /product="virulence factor Mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66006"
FT                   /db_xref="GOA:A0A0H2ZU83"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZU83"
FT                   /protein_id="ABK66006.1"
FT                   /translation="MRGPLIGLSLFMAIAIAVTWMVYATLRRDVAGPTTPYAAMFTDVY
FT                   GLRVGDDVRMAGVRVGRVEKVELAGKLAKVSFIVENDQRLYGNTVASVTYQNIIGQRYL
FT                   GLSLGETGSRTTLSAGSVIPVQQTDPSFDVGKLLNGFEPLFTLLNPKDADDLTKGVLQS
FT                   LQGDQASIPLLVEQTSTITKTLSARDQSLGDLISSLTRVTDTVARQNDDLDQALNQTRD
FT                   AVANFDDRRAALQDDVGSIARVTRRLSAIADDVDPSLNELITREPGFSKHLVGIEPQLA
FT                   FTGDNLPLLLKGFARAVSEGSYGNAYACDLNATGFFPGLNDITTFIVNAATPGNAYPIT
FT                   TKNLGWHTPRCRNMANG"
FT   gene            104420..105466
FT                   /locus_tag="MAV_0104"
FT   CDS_pept        104420..105466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0104"
FT                   /product="virulence factor Mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66518"
FT                   /db_xref="GOA:A0A0H2ZY00"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZY00"
FT                   /protein_id="ABK66518.1"
FT                   /translation="MADTRKLRWLRRRPLESYNRTWLGLAGLVVVAVLVAVSLGIKLLG
FT                   VGYTHYTAEFLQAATLRPGNPITVAGIEVGHVTSMKLAGDHVEAGLSVRDNVPLGKDTR
FT                   ALIKVMTILGSRYLELVPDGPGSLPANTIPLAHTEVPYDLQSLLEDATTTFEQVDSDQF
FT                   AQSLAVLGKQLGGVPPLVPQAVANLQTLSTITADRRGQLGALLKSTQRVVNTLRNQQSN
FT                   IGHLMDQGQDLLGHLVARQATFHAMFAALTELVDQLDKIVVNNRPMLDELFANLHQLTN
FT                   MVGQHDDLVRNILQVAPVTLRGLTNATGYGPVVEFNLPNGLAIDSWMCAISGRAKEFNM
FT                   IQYFKDCK"
FT   gene            105463..106578
FT                   /locus_tag="MAV_0105"
FT   CDS_pept        105463..106578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0105"
FT                   /product="virulence factor Mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64937"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZT27"
FT                   /protein_id="ABK64937.1"
FT                   /translation="MTSRRRKLIALAAAAAALAAVAIGVVGHYVKARLDTMTVTAQFDS
FT                   AAGLYEGNVVAVLGMPVGKVSKVTSKGSYVEAELTVDKKVKIPAAVRAVTISTSILTDR
FT                   QVELTPPYRGGPVLKNHDTIGLTRTKTPVAFDRVLDMLDKVSKSLKGDGKGGGPIADVS
FT                   DAAVAITDGNGKKILAALDELSKALRLSSERGVTTREQLTTIITDLSSITEAAARNDAK
FT                   VREFGSTTRQLSQILADEKFGTGATGRTINRILEEVTTLMENNRDNLKQAVRNGDTAAK
FT                   TLVDDQRGVAELLDVLPLTLENLYNTVDQNNGAIRVHGLLDKALTDSQSAKELCNLMHL
FT                   RQLGCSTGTLQDYGPDFGLTYILDGLSAMGQ"
FT   gene            106581..107813
FT                   /locus_tag="MAV_0106"
FT   CDS_pept        106581..107813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0106"
FT                   /product="mce related protein"
FT                   /note="identified by match to protein family HMM PF02470"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66650"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYA8"
FT                   /protein_id="ABK66650.1"
FT                   /translation="MKAGKRKALAVACSAVMASSGCATNGLASLPLPAPGIGSGGYLLN
FT                   AVFSNALNLPAHAKVKLAGADVGQLESMVARNYTAVTTLRIMDGVRVPVGSTAELRSAT
FT                   PLGDVFVAIKPPVPADPSAPLLKAGDTIGLPATRAAATVESVLSSAALLVNGGAVRNFT
FT                   NIVNGAGKATGDQGRAFGDLINRTNSLLTKLNARSDQIDAAVTETAALADRLDAKNQAI
FT                   TDVLRAVGPATDVLSGNADDIADVVDELGATTRQLSKFPSIAGTDKTGRSVIKDANAIA
FT                   AAWNDVVLSPDTSLAGLNRLIPPFVKATPSQAISVRGSFDRLVLGSRPGTGAETGGFKG
FT                   DPAFHGPMRRDWNYLIGSIKYVLWRLQERVVGRGPQTPMGQSPWTPSGPPLPPAPAGQA
FT                   PPDPMVPEPPR"
FT   gene            107810..109060
FT                   /locus_tag="MAV_0107"
FT   CDS_pept        107810..109060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0107"
FT                   /product="mce related protein"
FT                   /note="identified by match to protein family HMM PF02470"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66054"
FT                   /db_xref="GOA:A0A0H2ZUC7"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUC7"
FT                   /protein_id="ABK66054.1"
FT                   /translation="MIDTLGRLVVGVVKAGHRQRTWLSGLALLVTLVVGGAYLALGALR
FT                   VNPLESTYQVTIRLPESGGLLANQDVSVRGIRVGRITSLRPIPSGVEVVANINAHTKIP
FT                   ASSPVRVSGLSPAGEQYIDFEPTSNTGPFLSNGSVIGPQHTTTPIPLSQVLADADGLIA
FT                   QTDPKKLEIVKRELSLSNQGPQKLTDIIDGSTFLLSTMDPVLPQTVSMLKTSRVVLMTL
FT                   SDKNAGLSVAARNVGDLMAGVNKMDRGYRRLVDQTPHALSTVDNLFDDNSDTMVGLLAN
FT                   LVTTARVVYLRVPALNAVFPNYRGSTLEALMTTMHEHGLWATADIYPRYTCDYGTPRRP
FT                   SSSADYPEPFLYTYCRDDDPQVLVRGAKNAPRPGGDDTAGPPPGADLGQTTDPTPKGRF
FT                   TIPTPYGGPVLPIEPPH"
FT   gene            109092..109688
FT                   /locus_tag="MAV_0108"
FT   CDS_pept        109092..109688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67026"
FT                   /db_xref="GOA:A0A0H2ZYD1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYD1"
FT                   /protein_id="ABK67026.1"
FT                   /translation="MTVTADQERATADDVEQPPDDDRKATADRTESQPKTAARQWKRYG
FT                   RAALVVAVYAGAFGLAGGLGWKLWDQRAVAQAGQAAQRTAVDYAQVLTSIDANQVDQNF
FT                   AAVLGGATGEFKDTYTKASVQLRQLLIDNKATAHGTVVDSAIQSQSRNRVVVLLMVDQT
FT                   VSNTVRPDGRVDRSRMKITMENVGGRWLASKVELP"
FT   gene            109702..110487
FT                   /locus_tag="MAV_0109"
FT   CDS_pept        109702..110487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65090"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR021992"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTF9"
FT                   /protein_id="ABK65090.1"
FT                   /translation="MRIFQFSVGAAAVTMAALTAPVASASAQSFCGDLGGDWDGQYCHT
FT                   SVLSERKAVRDIKMAMPGDLIDNPTSGPPIRQYLRTLMTNWRSKGASMVQDSWGEENFQ
FT                   VFGHGPAQSVVFHEDYHADGPAFNNAYRTFTFDMANGRQLQLADITKPGVDPLAAIPPL
FT                   AEPFIQEALDRAAWQHSPGTYPFTVDRWTPDKVFSGGYKAWALTPDELILYLPDYPVGH
FT                   DSPIQYGQSEQWSMDGGTAQPHIPLGVLAPVLRPEFGGA"
FT   gene            110650..111882
FT                   /locus_tag="MAV_0110"
FT   CDS_pept        110650..111882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0110"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66839"
FT                   /db_xref="GOA:A0A0H2ZWS3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWS3"
FT                   /protein_id="ABK66839.1"
FT                   /translation="MKRRPKDRKVQIARAATDAFSELGYHAVSMENIAARVGISAAALY
FT                   RHSQGKYDLFREVFLALGQQLVDATAFADDLPADADPGETLSALTTALIDTTIVNRTAG
FT                   GLYRWEGRYLRGDDQRKLAEQIKVINRRLQRPLIKLRPKLTSRQRWILSAATLSVIGSI
FT                   TDHRSRLGNAEIRATLSDIAAAVLKAELPTQRGRGSEPARAPTLTSAAGSYELLLHESM
FT                   RLFNERGYRETGMEDIAAAVGIPVASIYQYFPGKAAILAVYYRRAADQLSADLSSILAT
FT                   SSDPEQALARLIEAYVTRSFANPELACVYYTERHNLPETDAVLLYNIQRSTVESWARLA
FT                   VAARPELTLGRARYAVHAAFALAVDIGRLVYPNTGAPASTTVRRLMEVTVLGRPAAASR
FT                   DGLRGAGRQRR"
FT   gene            112090..112314
FT                   /locus_tag="MAV_0111"
FT   CDS_pept        112090..112314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66264"
FT                   /db_xref="GOA:A0A0H2ZV69"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZV69"
FT                   /protein_id="ABK66264.1"
FT                   /translation="MLSTIRKVLDYQLTIAELLGLGILLGTPYLIVGVIWSSTHTAHLH
FT                   DMHGVDLVVSFLGSIVSWPVLLFANVCMT"
FT   gene            112326..112670
FT                   /locus_tag="MAV_0112"
FT   CDS_pept        112326..112670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0112"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68504"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1V6"
FT                   /protein_id="ABK68504.1"
FT                   /translation="MHRGPLIVFAAVVCLAGGLLALRFPVFIDAYDQFGLQVKCGSGFT
FT                   TELTQASSAVGPAGTNYVDQCGSALMVRRLWAIPTAVLGGMALTWQAAAALAHDHRRPA
FT                   PSQSAAQSPS"
FT   gene            complement(112726..112893)
FT                   /locus_tag="MAV_0113"
FT   CDS_pept        complement(112726..112893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0113"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A213"
FT                   /protein_id="ABK68056.1"
FT                   /translation="MDQQVSSDPPARPEDAQKATEEQRKLQEQLDHQDEDPDGPGLHQS
FT                   RHDLPDESTR"
FT   gene            complement(113006..113794)
FT                   /locus_tag="MAV_0114"
FT   CDS_pept        complement(113006..113794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64406"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZRW5"
FT                   /protein_id="ABK64406.1"
FT                   /translation="MTGRAALADVDLLIGIDDTDNPYTPGTGRRARALLHELQAAGLGS
FT                   PAGATRHQLLVDDRIPYTSHNSSACLAWRSPDGDPHAARTGIIELAGRFLERVCPPDAD
FT                   PGLAVVVPGELAGAAPRLIEFGRRAKREVLHPNEGRELAAAVGVHLSGHGGTREGMTGA
FT                   LAAVGLHLSGNDGLFITLPGIRELPDRATVETVFATAPIDLARDAMYRQPRSGEVIELG
FT                   DWVRPVLLDGLAVLLLEPPRQQDNGGRTWRTAPRAVVKQY"
FT   gene            complement(113791..114186)
FT                   /locus_tag="MAV_0115"
FT   CDS_pept        complement(113791..114186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0115"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1Z5"
FT                   /protein_id="ABK68082.1"
FT                   /translation="MVAVLVVSAGLVACGGSGGLQLVVQENQHVLQRFTISQLQQLPQV
FT                   EVETPQSHGAQIQKGPSVRSILNAAGATGVVRVRVEGRDPAQSLTAAELDDRTILGFTK
FT                   RDTLKLTGAKLGRDQWVRDVTDLVINP"
FT   gene            114285..114845
FT                   /locus_tag="MAV_0116"
FT   CDS_pept        114285..114845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0116"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65805"
FT                   /db_xref="GOA:A0A0H2ZVU0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVU0"
FT                   /protein_id="ABK65805.1"
FT                   /translation="MTVMQRPAGGLTGVREVAFPLLAVGIIVACTDVRIPLALPGHRGL
FT                   VWLTMLAAVALVTARRETVLAVGAASSIAALPVHGLTDPLWSSRYVAAAVLLYAVASLP
FT                   AVRTRRWILAVAAAPVHLVALASSVLTWQSGANLSAWASHGMLERGGWHLVFGFVAGLL
FT                   AWVVALGLGRPPSVQVGAYGRRY"
FT   gene            114858..115163
FT                   /locus_tag="MAV_0117"
FT   CDS_pept        114858..115163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0117"
FT                   /product="PE family protein"
FT                   /note="identified by match to protein family HMM PF00934"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66372"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVH4"
FT                   /protein_id="ABK66372.1"
FT                   /translation="MTLRVIPEGLAATSAAVDAITAQLAAVHAAAAPVVSVVVPPAADP
FT                   VSLAAAAVFSERGSQHSAAATKGVEVLGRAGLGVSLAGVNYVAGDAASASTYLSAG"
FT   gene            115166..116839
FT                   /locus_tag="MAV_0118"
FT   CDS_pept        115166..116839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0118"
FT                   /product="ppe family protein"
FT                   /note="identified by match to protein family HMM PF00823"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67771"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZL8"
FT                   /protein_id="ABK67771.1"
FT                   /translation="MTAPVWMALPPEVHSTLLSSGPGPGPLLAAAATWTGLSTQYDSAA
FT                   TELTAVLTGSMPVWDGPTADRYVAAHMPYLAWLQLAGALSAEAAAQHQGVATAYTAALA
FT                   AMPTLPELAANHATHAALVATNFFGVNTIPIAVNEADYARMWTQAATTMTTYQATTEAV
FT                   QMTSVAGSGTGGKAGSGSGSGTGAGTGTGTGTGTGTGTGTGTGTGAGSGTGGGTGAGGG
FT                   GGTGSFQLPTPEEIWEMLFGPDGEQIPGQGQPNWSPSEYLQNLGNFFNGNAQAVAWLQQ
FT                   NLSGLLNPSQFPALINYFIAWQTYRIINWTIRTLRFILQELPLLLQVGLSLSITSLGGL
FT                   AGLAGLAGLAGLAAPASAPAPAAMPQPAGMGAQPPVVSAAPAMAPMAPTSPVAPATSAV
FT                   STPAPVASAIAPPATPPVPPAPVTGAEGFGYMVGSFGLGMDSKAQTRARSALAAGRPAA
FT                   SSAGAAAVEQEQGRTRRRPRSVIDPGYRYEFIEGDDEVVAVASAAQDRYRPSDSGGSIQ
FT                   GFAGTLPKSGVRASGLNTLAGNESGDGARIPMLPESWDGP"
FT   gene            complement(116861..117556)
FT                   /locus_tag="MAV_0119"
FT   CDS_pept        complement(116861..117556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0119"
FT                   /product="thiopurine S-methyltransferase (tpmt) superfamily
FT                   protein"
FT                   /note="identified by match to protein family HMM PF05724"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67379"
FT                   /db_xref="GOA:A0A0H3A033"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A033"
FT                   /protein_id="ABK67379.1"
FT                   /translation="MGMSQPTHEMFEAAYRGESPEMGEGARPPWSIGEPQPEIAALIEA
FT                   GKFHGDVLDAGCGEAAVSLYLAERGFTTVGLDQSPTAIKLAREKAARRGLTSASFEVAD
FT                   ISDFTGYDGRFGTIVDSTLFHSMPVELREGYQRSIVQAAAPGASYFVLVFDRNAMPAEG
FT                   PVNAVTEDELREVVGKYWVIDEIRPARIHANVPENFLAAFEAFAGADIRDEDNGRKSVG
FT                   AWLLSAHLG"
FT   gene            117698..118120
FT                   /locus_tag="MAV_0120"
FT   CDS_pept        117698..118120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04075;
FT                   match to protein family HMM TIGR00026"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66360"
FT                   /db_xref="GOA:A0A0H2ZVG5"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVG5"
FT                   /protein_id="ABK66360.1"
FT                   /translation="MADDIELSPTDWVREQTERILRQGTTDGVEVFDRPVVLVTMTGAK
FT                   SGKRRYVPLMRVEHDGRYAVVASKGGAPEHPAWYFNLKAHPEVTLQDGDKVVTLRAREL
FT                   AGAEREQWWRRAVQAYPPYAEYQTKTARQIPVFVLE"
FT   gene            118377..119885
FT                   /locus_tag="MAV_0121"
FT   CDS_pept        118377..119885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0121"
FT                   /product="carbonate dehydratase"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM PF00916"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65956"
FT                   /db_xref="GOA:A0A0H2ZW96"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW96"
FT                   /protein_id="ABK65956.1"
FT                   /translation="MSTSRSERLREVLRYDLPASLVVFLVALPLSLGIAIASDAPVLAG
FT                   LIAAIVGGIVGGWLGGSPLQVSGPAAGLTVVVADVVAEFGWGVTCFITVVAGVLQVLLG
FT                   FSRIARAALAISPVVVHAMLAGIGITIALQQVHVLLGGSSKSSAWSNVTGLPAQILGAH
FT                   RPGLVLGLLVIAILVAWRWVPARLAIVPGPLVAIVVVTIISMVLPFKVSRIELDGSVLD
FT                   AVRLPSLPHGNWGAVAIAVITVTLITSVQSLLTAVSIDRMHTGPRTDFNRELIGQGAAN
FT                   IASGALGGLPIAGVIVRSSANVNAGAKTRASTIMHGFWVLVFAVPFAGLVEKIPTAALA
FT                   GLLIVIGIELLKPAHIETALRNGDLAIYLVTVTSVIFLNLLHGVLIGLLLAVVVTGWRV
FT                   VRARIEAEPVGDGWHVVIEGACTFLALPRLTGVLASIPERTSVTVHLLTNYLDHAAHQA
FT                   IGDWQRRHCATGGTVEVRDTTEPAARRRNSHLSLVEQVSSPGGA"
FT   gene            complement(119919..120776)
FT                   /locus_tag="MAV_0122"
FT   CDS_pept        complement(119919..120776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64919"
FT                   /db_xref="GOA:A0A0H2ZRJ9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019921"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZRJ9"
FT                   /protein_id="ABK64919.1"
FT                   /translation="MRIGVVFPQTEIGSDPAVLRSYAQRVEELGFTHILAYDHVAGADP
FT                   RVHRGWRGPYDIDSTFHEPFVLFGYLAAITSLELVTGVIILPQRQSVLVAKQAAEVDLL
FT                   TGGRFRLGIGLGWNAVEYEALGETFTNRGKRSEEQVELMRRLWTERSVTFDGKYHTVTA
FT                   AGLAPLPVQRPIPVWFGAASDRAFERAGRLGDGWFPMTEPGPGLDHALEQVTRAAEAAG
FT                   RDPTSLGMEGRVSWTDDRDKLAGDIAAWRAAGATHLSVNTMKAGFAGVDEHLAALERVA
FT                   ADLR"
FT   gene            120847..121824
FT                   /locus_tag="MAV_0123"
FT   CDS_pept        120847..121824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0123"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00389;
FT                   match to protein family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64517"
FT                   /db_xref="GOA:A0A0H2ZQN2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZQN2"
FT                   /protein_id="ABK64517.1"
FT                   /translation="MTKLSGVFRVGELEPAFGEELAARYDVPRLPDGAARDRFLAEHAA
FT                   EVRALLTWGRPGVDAALIAALPNLEVIVNNGAGVDLIDTAAADRRGIGVSNTPDVLSDT
FT                   VADTALGLILMTLRRLGAADRYVRAGRWAREGPFPYGRDVSGLQVGILGLGRIGSAIAT
FT                   RLRGFDCAIAYHNRRRIDGSPYRYAASAVELAELVDVLVVATTGDHQAHKLVDRAVLRA
FT                   LGPEGYLINIARGSVVDQEALVEMLAGGELAGAGLDVFADEPHVPAELVGLDNVVLLPH
FT                   VGSATARTRRAMASLALRNLDSYLATGQLVTPVLRPRRRIPDRN"
FT   gene            121922..122347
FT                   /locus_tag="MAV_0124"
FT   CDS_pept        121922..122347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0124"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68641"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A212"
FT                   /protein_id="ABK68641.1"
FT                   /translation="MRLTLAGSARPDTVTAWRRALHRWLQHEVRAPDDVRDDVVLGVNE
FT                   ALANCVEHAYRSHRGTGAMKLQASYDPGAESIRVCVSDRGRWQSPSCRLSSDPRASRGI
FT                   MLMHNLAEHCTIHARPDGTSVYLDYALDPNPVGAQRV"
FT   gene            complement(122354..122461)
FT                   /locus_tag="MAV_0125"
FT   CDS_pept        complement(122354..122461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0125"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66537"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXP7"
FT                   /protein_id="ABK66537.1"
FT                   /translation="MRPGRFPVQHCLPDMALACDDPLPVKFTPSAPVGS"
FT   gene            complement(122484..123839)
FT                   /locus_tag="MAV_0126"
FT   CDS_pept        complement(122484..123839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0126"
FT                   /product="bifunctional wax ester synthase/acyl-CoA
FT                   diacylglycerol acyltransferase"
FT                   /note="identified by match to protein family HMM PF03007;
FT                   match to protein family HMM TIGR02946"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64488"
FT                   /db_xref="GOA:A0A0H2ZQM3"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZQM3"
FT                   /protein_id="ABK64488.1"
FT                   /translation="MEPISPTDALFLIGESREHPMHVGSLQLFEPPPDAGPHFVRESYQ
FT                   AMLECTDVQPTFRKHPAFFGGVTNLAWSIDKEVELDYHLRRSALPEPGRVRDLLELASR
FT                   LHGSLLDRHRPLWEAHLVEGLQDGRYAVYTKYHHSLMDGVSALRLVQRAFTPDPDDDEV
FT                   RVPWSLAPRQRGPRRRPSLLERAGRTAGSALALAPSTLKLARAALLEQQLTLPFQAPRS
FT                   MFNVRIGGARRVAAQSWPLERINAVKAATGATVNDVILAMSSGALRAYLLDQNALPDAP
FT                   LTAMVPVNLRKPDDDRGGNLVGTFLCNLATDLDDPAKRLEIISASIRDTKEVFWQLPPV
FT                   QQLALSAFNIGGLFFGLIPGYLSTASPPFNIVISNVSTGRSERLYWRGARLDGNYPLSI
FT                   PLDGQAVNITVTNNADNLDFGLVGCRRSVPHLQRMLGHLEASLKELELAAGV"
FT   gene            complement(123960..124226)
FT                   /locus_tag="MAV_0127"
FT   CDS_pept        complement(123960..124226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0127"
FT                   /product="PhoY2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64964"
FT                   /db_xref="GOA:A0A0H2ZTJ6"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTJ6"
FT                   /protein_id="ABK64964.1"
FT                   /translation="MGEAAEALAAGAREVLLSQDPRRAAQIRRDDDTMDELHRRLLSVL
FT                   MDPAWTPGVAAAVDATLLGRFYERFADHAVEIARRVIFQATGG"
FT   gene            complement(124653..126162)
FT                   /pseudo
FT                   /locus_tag="MAV_0128"
FT                   /note="integral membrane transport protein; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by match to protein family
FT                   protein HMM PF00083; match to protein family protein HMM
FT                   PF07690"
FT   gene            complement(126283..126858)
FT                   /locus_tag="MAV_0129"
FT   CDS_pept        complement(126283..126858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69364"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3R7"
FT                   /protein_id="ABK69364.1"
FT                   /translation="MADITMLILADHDWFREQFARLDYLQAQAADDRDALQRVWRPLAD
FT                   KLDVHAYIEEKIFYPQLLKRGSADAEGETLDAIGDHNDIRDGVRATNAAQPGTEQWWAA
FT                   VGRTREANDDHMAEEEREGLSDFRRTAPIGLREALGRQYAEFMAEHPTTEGLPIIDRDP
FT                   AGYVEQVQNAQPPKPAEFSLRIGSLKGQ"
FT   gene            127072..127956
FT                   /locus_tag="MAV_0130"
FT   CDS_pept        127072..127956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0130"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase 1"
FT                   /EC_number="2.1.1.79"
FT                   /note="identified by match to protein family HMM PF02353"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67370"
FT                   /db_xref="GOA:A0A0H2ZZ61"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZ61"
FT                   /protein_id="ABK67370.1"
FT                   /translation="MSENTGDAVNLQPHFDDVQAHYDLSDEFFALFLDPTRTYSCAYFE
FT                   RDDMTLEEAQIAKVDLSLGKLGLQPGMTLLDIGCGWGTTIVRALERYDVNVVGLTLSRN
FT                   QQAHVQRPLDNHPSPRSKRVLLQGWEQFDEKVDRIVSIGAFEHFGRDRYDDFFKMAYAA
FT                   LPDDGVMMLHTIIKPSDEEFAERGLPITMTKLRFMKFIMDEIFPGGDLPQAKGVIEHAQ
FT                   RAGFGVQRVQALRPHYARTLDTWAAALRARRDEAIAIQSEEVYDRYMKYLTGCADLFRE
FT                   GYTDVAQFTLTKG"
FT   gene            complement(127981..128124)
FT                   /locus_tag="MAV_0131"
FT   CDS_pept        complement(127981..128124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0131"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64748"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSW8"
FT                   /protein_id="ABK64748.1"
FT                   /translation="METPVAHEDSANRGQAATATTRSLTVKYAAQSGDWGVALELPTGM
FT                   RR"
FT   gene            128159..128512
FT                   /locus_tag="MAV_0132"
FT   CDS_pept        128159..128512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0132"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67938"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A013"
FT                   /protein_id="ABK67938.1"
FT                   /translation="MSEHEAKMIILSTDDLDESIRFYSETLGMPLKFRDGAHFAALDAG
FT                   PVTLALATAVDHPIPGQVVVGIKTADVDGAARAVEASGGGIVKGPYDDAHERRAVVYDN
FT                   KGNGLVFYKPLGR"
FT   gene            complement(128545..128811)
FT                   /locus_tag="MAV_0133"
FT   CDS_pept        complement(128545..128811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0133"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3D8"
FT                   /protein_id="ABK69181.1"
FT                   /translation="MSGRPLPGGVVHKLPADLRESLIGNATALAAWNDITPLARNEFIC
FT                   WVEDAKQQATRERRIRRTVEELEEGKRRPCCWPGCKHRERTGK"
FT   gene            complement(128808..129701)
FT                   /locus_tag="MAV_0134"
FT   CDS_pept        complement(128808..129701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65138"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTK2"
FT                   /protein_id="ABK65138.1"
FT                   /translation="MRRQPLLARRFFDRYEPVHAVTYFAPEARAALDALGYRGFWMGYF
FT                   AARSAPLGAVPREVVAAIFYNFAPERVAKALPAAWEIAGPQAALRARQESAVAALRRYG
FT                   LRPDENVAVAAELAAKAARGAPLDGRPLFAANLALPWPEDPLAALWHATTLLREQRGDA
FT                   HVAVLAAAGISGRESNVLHAAAGNVSRDYIARTRDYDEASWRRHEQRLAERGLLDGDGA
FT                   LTAAGRQCKDHIEATTDALALSALDALTDDEVETLFEALTPITRAVIAGGDIPAATPMT
FT                   LRRDELHDDSAHLVAR"
FT   gene            complement(129710..130324)
FT                   /locus_tag="MAV_0135"
FT   CDS_pept        complement(129710..130324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0135"
FT                   /product="transcriptional regulator, PadR family protein"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65696"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZV31"
FT                   /protein_id="ABK65696.1"
FT                   /translation="MSLRDAVLAALLEGESSGYDLAKDFDASVANFWPATPQQLYRELD
FT                   RLAGQGLIRARVVHQQRRPNKRMFSLTAAGRAAIRRFTATAPRPSVIRDELLIKVQAAD
FT                   AGDMRAVRDAIRERRDWATAKLARYQRLRARLLDGRSEEDYLARAERIGPYLTLIRGIS
FT                   FEEDNIRWAEHALAVIARRLPTTDADSDAGDSRLVGPATNG"
FT   gene            130383..130868
FT                   /locus_tag="MAV_0136"
FT   CDS_pept        130383..130868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0136"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68808"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3I5"
FT                   /protein_id="ABK68808.1"
FT                   /translation="MRPIGLASTPPTQQVDYARSPMHPFRRAVEERDEQAIQALLADTV
FT                   VFTSPVAFKPYVGKPITAAILRGVMRIFEDFRYLREIGDPGGRDHALVFETGIAGAPGI
FT                   RITGCDFLHCDDDGLIDDFMVMVRPLSGATALSEAMGAQFARIQQEAVELANRFGTA"
FT   gene            130874..131917
FT                   /locus_tag="MAV_0137"
FT   CDS_pept        130874..131917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0137"
FT                   /product="oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64576"
FT                   /db_xref="GOA:A0A0H2ZQS4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019951"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZQS4"
FT                   /protein_id="ABK64576.1"
FT                   /translation="MTMRIGLSINYAGGFKDVAAEVADLENAGLDIVFVPEAYSFDAVS
FT                   ALGYLAASTQRVELASGILQLYTRTPTLTAMTAAGLDYVSDGRFTLGLGASGPQVIEGF
FT                   HGVPYDAPIGRTREVIEICRQVWRREPVQHRGKHYTIPLPADRGTGLGKPLKLINSPVR
FT                   ERIPILVAALGPKNVEMAAEIAEGWQPIFYLPEKARDVWGESLAAGRAKRAAELGELEI
FT                   YAGPVLAIGENTEPLREFVKPHLALYIGGMGAKGKNFYHALATKYGYGPQADRIQELYL
FT                   AGDKDGAAKVVPDDLVRDVNLIGSREFVKERVAAFREAGVTTLNVAPMASTPAERVKLI
FT                   EALRQLV"
FT   gene            complement(131951..133168)
FT                   /locus_tag="MAV_0138"
FT   CDS_pept        complement(131951..133168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0138"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67829"
FT                   /db_xref="GOA:A0A0H2ZZS2"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZS2"
FT                   /protein_id="ABK67829.1"
FT                   /translation="MMSSNVRAARNRPGRTDPQPPTGAPLFVGVLGLLLATGWVANHFV
FT                   GLMPAISDRDHLATTTLDGIFGIYALGLLPGLLVGGRTSDALGRRPVALTGSAAALVGT
FT                   VAMLLSQHSPALFAGRLIVGLGVGLAISAGTAWASDLRGPAGAATAGAVLTAGFAVGPF
FT                   AGGVLAWAGPSGVRASFALAAAILALAAFAVVAAPQPSPVTAPADPDGEETADAAPQGI
FT                   SRALSWAMPLAPWVFASATLGFVTIPGRLHTALAAPVAAGTATLIVNGVSGAVQVLARA
FT                   LRWGPQAGTAGAVLAALGYAVAAAAPSTLTPALGVPLFVVLGCASGLCLREGLIDLEAA
FT                   APQRLRGGLTGLFYVVTYIGFGLPLILASVRPGVATAILSGMAVLAVTAAVGRAARLRR
FT                   DDHRQN"
FT   gene            133335..133616
FT                   /locus_tag="MAV_0139"
FT   CDS_pept        133335..133616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0139"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69230"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A4E8"
FT                   /protein_id="ABK69230.1"
FT                   /translation="MMKYIAAAAIALSVLLSSACSASQVINTGGDTKCKDFTTQDEKKQ
FT                   NDEVSKMLKDKSGTDPSNVEISATRLSAMTYCQTVGKPDTKISEAPHG"
FT   gene            133761..134489
FT                   /locus_tag="MAV_0140"
FT   CDS_pept        133761..134489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0140"
FT                   /product="ABC nitrate/sulfonate/bicarbonate transporter,
FT                   ATPase subunit"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66694"
FT                   /db_xref="GOA:A0A0H2ZYE0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYE0"
FT                   /protein_id="ABK66694.1"
FT                   /translation="MLRDVDVEIEPGAVVALLGASGSGKSTLLRLVAGLDRPSGGRIEI
FT                   DGKAVRGIDPRCAVVFQEPRLLPWRSLAANVAFGLPRGTERPERTAAVQRWLDVVGLRE
FT                   FAGHYPRQVSGGMAQRAGLARALARQPSVLLLDEPLAALDALTRLRMQDLLDAVQQRAG
FT                   TTTILVTHDVEEAVLLADRVLILRGEEGGAATVAATHDVAIPKPRDRGDPRIAALREQL
FT                   LEEVGVPRRGYAIEQEAKTS"
FT   gene            134486..135451
FT                   /locus_tag="MAV_0141"
FT   CDS_pept        134486..135451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0141"
FT                   /product="sulfonate binding protein"
FT                   /note="identified by match to protein family HMM TIGR01728"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67554"
FT                   /db_xref="GOA:A0A0H2ZZJ5"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZJ5"
FT                   /protein_id="ABK67554.1"
FT                   /translation="MRPRHLTALAVVAAVTAVSGCGSSSGTTTTKDLHLDYAYYNPLSL
FT                   VIRDQQLLEKKGYHVTWVLSQGSNKANEGLRSKALDFGSTGGSPALLARANGTPIKTVD
FT                   VYARGEWTALVVAKNSPINAVADLKGKKVAVTKGTDPYFFLLQSLATAGLSPADIEIVN
FT                   LQHADGKTALERGDVDAWSGLDPFMAETIQQQGSRIIYRNPDFNSGGVLNAREDFITAH
FT                   PDSVQLVVDTYEEARKWAKTHPAELAALLASQAKVSQSVAQEELGRTALDIDPVPGDWL
FT                   RAVLTRIEPLAVADGDIKSDDAGRNALNTLIEPKYARQAR"
FT   gene            135514..136215
FT                   /locus_tag="MAV_0143"
FT   CDS_pept        135514..136215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0143"
FT                   /product="putative aliphatic sulfonates transport permease
FT                   protein SsuC"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65567"
FT                   /db_xref="GOA:A0A0H2ZV64"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZV64"
FT                   /protein_id="ABK65567.1"
FT                   /translation="MAWQLATAVTGFFAPSQLPPPGDVVAALSDLARHGELWTHLRASG
FT                   WRVLAGYASGAAAGLALGSLVGLSAAARRLLAPTVAAFRTVPSLAWVPLLLLWFGIDET
FT                   PKILMVAVGAFFPVYTTTASALSHIDAHLVEVGRAYGRHGVSLLTAVLLPAAAPELVNG
FT                   LRLGLANAWLFVVAAELIASSKGLGFLLIDSQNSGRTDVMLLAIVLLAGLGKLSDAALG
FT                   AVETRIARRRG"
FT   gene            complement(136212..137165)
FT                   /locus_tag="MAV_0142"
FT   CDS_pept        complement(136212..137165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0142"
FT                   /product="FAD dependent oxidoreductase, putative"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65841"
FT                   /db_xref="GOA:A0A0H2ZVJ7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVJ7"
FT                   /protein_id="ABK65841.1"
FT                   /translation="MIVVIGAGVCGLAAAHELSRRGHDDVVVLEKGQPFGEQSAGLARI
FT                   FRIAHQREALCRLAFAARAGWQRWEAEFGVGRLLGSEGFIAAGAAADGVAQAMKRAGAA
FT                   FSRLDRDGIAERIPFADVPWETGIFDPLGGSLRIRRALTALARRVVIRCGEVVSVADDG
FT                   RTVLADGTVLRADRVLICAGVATPKLFGPLGVGFVPHTRFTYRGADATGAACLSAPEGY
FT                   GLPLGGTGRWAFGQEVADPATVRALFPSLVAVDRVDCVSVRAPWLDSGGDGWTVARRGR
FT                   VLAFVGANLMKFGPLLGELLARAALSDDIPAELLLD"
FT   gene            complement(137165..138382)
FT                   /locus_tag="MAV_0144"
FT   CDS_pept        complement(137165..138382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0144"
FT                   /product="acetyltransferase, gnat family protein"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68372"
FT                   /db_xref="GOA:A0A0H3A007"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022902"
FT                   /db_xref="InterPro:IPR025559"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A007"
FT                   /protein_id="ABK68372.1"
FT                   /translation="MAIEIRVLEDEDDLIAAANVFRTAMVGFAPLAGLAPGQIGTLLEP
FT                   GRTIGAYAGGQLVGTADAVTSRLTLPGGALVGHAAVTHIGVLPSFTRQGIATALVRHQL
FT                   RDFAARNEVVATLRASEATIYGRYGYGVASSSQSVTVHTARAALRRDVGPGGPVRLLDT
FT                   AQAWEVLPRIYAEHRPARPGTIDRPRVWWQGVRLRTESAPGPTYVAVHGAPGSETGFVR
FT                   YRPIDTERWFVSDERTIVVEDFFAPTAEAYLGLLRFLLGLDLVDRVQFWMLPLDDPLPW
FT                   LLADRRAVRVTAVHDETWLRVVDARAALAARGYCSDETVTVAVNDPLLQDNSVCLRIAG
FT                   GGVAVADGPADVDVDVEGLAAVLLGGTTWRDLAVAGLARARDPGALAVADRLFAVPEAP
FT                   HAGFFF"
FT   gene            complement(138439..139650)
FT                   /locus_tag="MAV_0145"
FT   CDS_pept        complement(138439..139650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0145"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68026"
FT                   /db_xref="GOA:A0A0H3A1V1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1V1"
FT                   /protein_id="ABK68026.1"
FT                   /translation="MTFSLQLSDDVIEVRDWVHQFAADVVRPAAAEWDEREETPWPVIQ
FT                   EAAKVGLYSPDLFAQQAAEPTGLGMLTVFEELFWGDAGIALSIMGTGLAAAALAGNGTP
FT                   EQLGRWLPEMFGTADEPKLGAFCSSEPDAGSDVGAIRTRARYDEATGEWVLNGTKTWAT
FT                   NGGIANVHIVVASVYPELGARGQATFVVPAGVKGLAQGQKFKKHGIRASHTAEVVLDDV
FT                   RLPADHILGGREKFEERIARVKSGASARGQAALKTFERTRPTVGAMAVGVARAAYEYAL
FT                   EYACQREQFGRKIGEFQAVAFKLADMKCRIDAARMLVWRAGWMARNNQAFDAAEGSMAK
FT                   LVASETAVYVTDEAIQILGGNGYTRDYPVERMHRDAKIFTIFEGTSEIQRLVISRALTG
FT                   LPIR"
FT   gene            complement(139647..140294)
FT                   /locus_tag="MAV_0146"
FT   CDS_pept        complement(139647..140294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0146"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66633"
FT                   /db_xref="GOA:A0A0H2ZXD6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXD6"
FT                   /protein_id="ABK66633.1"
FT                   /translation="MLSSGRDRLLSAALRLFAAKGYAATSVADIQRESGLAPGSGALYK
FT                   HFGSKRELLEAAVAHRIESIVTAREQYDAGQPGSVEQAVRTAGQLIWNNLKQSEDLLKV
FT                   MLREPDELGDLDEKTWQVITDNAYQRFADELAASNRAGRTSIPDPEAAAAVAIGSLSYA
FT                   ATLQALTGRLPGNTDEDRYFEAWVNQTVSVLAQYTNRRKPLNDNDNDSGAQT"
FT   gene            140441..141769
FT                   /locus_tag="MAV_0147"
FT   CDS_pept        140441..141769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0147"
FT                   /product="sensor-type histidine kinase PrrB"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64475"
FT                   /db_xref="GOA:A0A0H2ZQL6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZQL6"
FT                   /protein_id="ABK64475.1"
FT                   /translation="MRVLSLRTIVIVAAISVMTLVVLLGTWVWVGVTNDQYNQLDRRLD
FT                   SVSSLGDISSLLTNPQHNSPDRATQDGNLVRTARIGGVTVSVPSNIVLPQLPDGYANTT
FT                   INGVQYRVRTFTAGPASIALAAPLAEAQHRINELHLRVLLICASVIGGTVVVGWVISLI
FT                   MVNPFLLLAQQARAINAQSSPDEVQVRGVREAVEIAEAVEGMLARIGKEQQRTKAALES
FT                   ARDFAAVASHELRTPLTAMRTNLEVLSTLDLPHEQRQEVIGDVIRTQSRIEATLTALER
FT                   LAQGELTTVDDFVPFDITELLDRAAHDALRVYPDVEVSLVPSPTVLMIGLPTGLRLVID
FT                   NAIANAVKHGNAGKIQLTVSSSGEGVEIAIDDDGSGIPESERATVFERFARGSTASRSG
FT                   SGLGLALVAQQAELHGGTAELQNSPLGGTRLLLRLAGDGRGPA"
FT   gene            141877..142659
FT                   /locus_tag="MAV_0148"
FT   CDS_pept        141877..142659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0148"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65168"
FT                   /db_xref="GOA:A0A0H2ZTW0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTW0"
FT                   /protein_id="ABK65168.1"
FT                   /translation="MNASAEHIRYEKRGRIATITLDRPASRNAIDPAMDRRLRDIWAEF
FT                   RDDDGVDVAILTGAGEAFCAGADRNTWFHQWLDADAAVVRRNAKGVGFGGITRGLHRIT
FT                   KPVIGAVNGWALGAGLELALACDIRIASERAMFGVPLVGLGFHHGDGGISRLVDTCGLA
FT                   VALDLELSGEPIDAQRALQVNLVTRVVAHDDLMTAAHALAERIAGYHQAAVRSAKDTVL
FT                   DVVGRPLDEQLEREAMSAYSIDRHSAREIIAAVGMRGH"
FT   gene            142659..143237
FT                   /locus_tag="MAV_0149"
FT   CDS_pept        142659..143237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0149"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65718"
FT                   /db_xref="GOA:A0A0H2ZV50"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZV50"
FT                   /protein_id="ABK65718.1"
FT                   /translation="MATATRERFLTAATGLFRRQGYSGTGLKQIVAESRAPLGSLYHFF
FT                   PGGKQDLAVQAIAHTAERYRELLDRVFAKSTDIGQATVTWFNWAARALQETDYADGCPI
FT                   GTVACEVASSNEALRQATQAVLASWQSRVAAELIGAGVPTAQARRLATFAVASLEGAIL
FT                   LARAHRSTRPLRETGRVVADTLRAATDRG"
FT   gene            143254..143652
FT                   /locus_tag="MAV_0150"
FT   CDS_pept        143254..143652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0150"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66586"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVQ6"
FT                   /protein_id="ABK66586.1"
FT                   /translation="MLGHLGINVPDLSVAKRYYDALMPLVGFEPFFAAADEFSYRPAGN
FT                   KPGTYLFFYPAAEPHEYSAQRTGLQHLAFMVRGRSAVHEVHTHVIRIGGTVIYPPRHFP
FT                   QYPGHYYATFWYDPFGIKLEAVCHHDRD"
FT   gene            143926..144237
FT                   /locus_tag="MAV_0151"
FT   CDS_pept        143926..144237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0151"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64915"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZT92"
FT                   /protein_id="ABK64915.1"
FT                   /translation="MVVSVQSEMVLASAGAESAISAETEAAASAASPALLGVMPMGGDP
FT                   DSAMFAAALNACGASYLGVVSEHAAQRGLFAGAQGMASGVYTTTEAMRSLAMGISSVL"
FT   gene            144262..145451
FT                   /pseudo
FT                   /locus_tag="MAV_0152"
FT                   /note="PPE family protein; this gene contains a frame shift
FT                   which is not the result of sequencing error; identified by
FT                   match to protein family protein HMM PF00823"
FT   gene            145552..145866
FT                   /locus_tag="MAV_0153"
FT   CDS_pept        145552..145866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68593"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A345"
FT                   /protein_id="ABK68593.1"
FT                   /translation="MTIKVTPQMLRDTSNAIQANMEHAIGIGQGYVANQENVMNPATWS
FT                   GDAVAASHATAIEVQNDLNKVLTGGTRLAEGLTKAAALMEGHEADSSHAFSALFGGHGS
FT                   "
FT   gene            145913..146200
FT                   /locus_tag="MAV_0154"
FT   CDS_pept        145913..146200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69418"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR020167"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A655"
FT                   /protein_id="ABK69418.1"
FT                   /translation="MSDPITYNPGAVADFATDVASRAGQLQSIFDDTSNRTHALQEFFA
FT                   GHGASGFFEAQAQMLSGLQGLIDTIRQHGQTTSHVLDSAISTDQHIAGLF"
FT   gene            146305..147135
FT                   /locus_tag="MAV_0155"
FT   CDS_pept        146305..147135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0155"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69078"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A406"
FT                   /protein_id="ABK69078.1"
FT                   /translation="MLTTTVDGLWVLQAVTGIEQTCPELGLRPLLPRLDTPERALRHPA
FT                   AAELVAAGALDEAGNVDPMIREWLTVLLRRDLGLLVMIAVPGREPSRASICRFATWWVV
FT                   LERHDQLVRLYPAGTASSEAAASEIVVGQIERLCGVAEAAPLRPITLDTEQLLASVHDT
FT                   ASLRAFLLEQRLDADQLQTVLTAADSARSAHANIVALQAGVGPDELARVAVGDSSVSIV
FT                   DTPGGRVCIESVVSGQRRYQILSPGSRSDIGGAVQRLIRRLPAGDEWYSYRRVV"
FT   gene            147365..148288
FT                   /locus_tag="MAV_0156"
FT   CDS_pept        147365..148288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0156"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68177"
FT                   /db_xref="GOA:A0A0H2ZZH2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZH2"
FT                   /protein_id="ABK68177.1"
FT                   /translation="MRITDLAAPRKIPPGSGWRKFIYTISFHKINPGESPRERHYRDLQ
FT                   NRIRRHIRRQYVITVVSGKGGVGVTTLVACIGGVFRECRPQNVIAIDAVPGFGTLADRI
FT                   DESPPGDYTAIINDTDVQGYADIREHLGQNAVGLDVLAGNRTSDQPRPLVPAMFSGVLS
FT                   RLRRTHTVMIVDTSPDLEHEVMKPVLENTDTLVFVSGITADRSRPVLRAVDYLRSQGYH
FT                   ELVSRSTVIVNHTDQITDKDALAYLTERFTKVGATVEALPFDPHLAKGGIIDTVHELKK
FT                   KTRLRLFEITAGLADKYIPDAERAVP"
FT   gene            148384..149814
FT                   /gene="snm"
FT                   /locus_tag="MAV_0157"
FT   CDS_pept        148384..149814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="snm"
FT                   /locus_tag="MAV_0157"
FT                   /product="secretion protein Snm4"
FT                   /note="identified by match to protein family HMM PF04600;
FT                   match to protein family HMM TIGR02958"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66453"
FT                   /db_xref="GOA:A0A0H2ZXR0"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXR0"
FT                   /protein_id="ABK66453.1"
FT                   /translation="MEGFFEGMVELFDADLKRKGFDGIALPAGSYELHKINGVRLDINK
FT                   SLDELGVQDGDTLVLVPRVDGESFEPQYESLSSGLAAMGKWLGREGGDRMFAPVTPLTA
FT                   AHTAVAVIAMAVAVVVGLCLRARTFTDGPIPAAVAGGIGALLLIATLVVRSGWRERRDL
FT                   FSGFAWLAVVALAVAGACAPPGVLGAAHALIGVVVVILGAIAIGVTARNRWQTAVVTAV
FT                   VTVCGVLAAVAAVRMFRPASVQVLAICVLVGLLVLVRMTPLIALWVARVRPPHFGSITG
FT                   RDLFARREGMPVDTVAPVSEDESEEQDNELTDITARGAAIAASARLVNAVQVGLCVGVS
FT                   IVLPAAVWGVLTPGRPWAWLALVVAGLVVGIFITQGRGFAAKYQAVALVCGASAAVCAG
FT                   VVKYALAAPHDAMTGLLWPVVAVTTFAAFGLAAALLVPAMRFRPFIRLTVEWVEVLAFI
FT                   VLLPAAAALGGLFTWIRH"
FT   gene            149799..151457
FT                   /locus_tag="MAV_0158"
FT   CDS_pept        149799..151457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0158"
FT                   /product="subtilase family protein"
FT                   /note="identified by match to protein family HMM PF00082"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64457"
FT                   /db_xref="GOA:A0A0H2ZRQ5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZRQ5"
FT                   /protein_id="ABK64457.1"
FT                   /translation="MDSPLRRAAALAGMTLVALSANVPAAQAITPPSVDPGMVPPDGPP
FT                   RPDQPMRRANSCSAPITVRNPDVAQLAPGFNLLNIAKAWQYSTGNGVPVAVIDTGVSPN
FT                   PRLPVVPGGDYIMGEDGLSDCDAHGTIVSSIIGAAPQGILPMPRPMPATPAFPPPAGPP
FT                   PAVGAPPPPVEVPPPVAPPPPPPPVTITQVLPPPPPPPPPPPEGGGATAASNGPPDPQT
FT                   EDEPAVPPLPPGAPDGVVGVAPHATIISIRQSSRAFEPVNPPPGDPNSDEKVKAGTLNS
FT                   VARAVVHAANMGAKVINISVTACLPAAAPADQRALGAALWYAATVKDAVVVAAAGNDGE
FT                   AGCNNNPMFDPLDPSDPRDWHQVKVVSAPSWFSDYVLSVGAVDASGAALDKSMSGPWVG
FT                   VAAPGTHIMGLSPQGGGPVNAYPPSRPGEKNMPFWGTSFSAAYVSGVAALVRAKFPELS
FT                   AHQVINRIVQSAHNPPAGVDNKVGYGLVDPVAALTFNIPPGDRMAPGSQSRIITPAPPP
FT                   PPPDHRARNIAIGFLGTVAAGVLVLAIAARLRRAR"
FT   gene            151454..153040
FT                   /locus_tag="MAV_0159"
FT   CDS_pept        151454..153040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0159"
FT                   /product="putative conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66033"
FT                   /db_xref="GOA:A0A0H2ZUA2"
FT                   /db_xref="InterPro:IPR021368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUA2"
FT                   /protein_id="ABK66033.1"
FT                   /translation="MRPNLTGFSRGSNRRVVGVWVVFVLALASWLLGGYIAAAVAVLVG
FT                   VALVFVRWWGQPAWSWAVLWRRGRRPIDWSAPITVANNRSGGGVRVQDGVAVVAVQLLG
FT                   RAHRATLVTGSVTVETENVLDVVELAPMLHQALGLQLDSISVVTVGSRHGNVGDYPRVY
FT                   DSEIGTPPYAGRRETWLIMRLAVIDNAQALRWRTTVGAAAISVAQRIAGLLRCQGLRAK
FT                   VANATDLAELDRRLGWDAVSGTVQRWKAIRGEAGWMTTYAYPPQAITSRNLSQAWTLRA
FT                   DEVIQNVTVYPDGHCSATITVRTPTPAPTPPSVILRRLNGEQAAAAAANMCGPRPHLRG
FT                   LRRSRLPAELITEIGPSGVLIGKLPNGDRLLMPVTDAGELSRVFVAADDPIAKRIVIRT
FT                   AGAGERVCVHTRDMSRWVSVRMPEISVVNSSRPAPRTTVSVVEYAPRRGEGVEAAISPT
FT                   PRPATVITVAPAGTTLSEAQRHGFEVIIEQVSPAVVNVSAAGKNWLVEMDMFRAEHRYV
FT                   SLEPVSMSVGM"
FT   gene            153067..154908
FT                   /locus_tag="MAV_0160"
FT   CDS_pept        153067..154908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0160"
FT                   /product="ATPase, AAA family protein"
FT                   /note="identified by match to protein family HMM PF00004"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67919"
FT                   /db_xref="GOA:A0A0H3A1L3"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023835"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1L3"
FT                   /protein_id="ABK67919.1"
FT                   /translation="MMGDLQTARRHFDRAMAIMSRQGRAAALPEFVAATDADPSMADAW
FT                   LGRIACGDSDLASLRKLYATSEWLHRETTRIGQTLAAEIQLGPYIGITVTDASQVGLAL
FT                   SSALTIAGEYAEADKLLANRDLLDSWTNYQWHQLARTFLMYRTQRWPDVLLTAAEELPP
FT                   QAIIMSAVTASICALAAHAAAHLGQGRVALDWLDRVDVIGQTQASSRFDADVLTASIGP
FT                   ADIPLLVADLAYVRGMVHRQLGEEDKAQIWLSKATINGVLTEAAKEALADPNLHLVITD
FT                   EQTIDSRTDRWDASSAKSRDELDDDAAAERRAELLAEGRRLLAKQVGLAAVKQAVAALE
FT                   DQLEVRMMRLEHGLPVEGQTNHMLLVGPPGTGKTTTAEALGKIYAGMGIVRHPEIREVR
FT                   RSDFCGHFIGESGPKTNELIEKSLGRIIFMDEFYSLIERHQDGTPDMIGMEAVNQLLVA
FT                   LEAHRFDFCFIGAGYEDQVDQFLTVNPGLAGRFNRKLRFESYSPAEIVEIAHRYATPRA
FT                   SLLDEAARETLLDAATTIRNYTTPGGRHGIDAMQNGRFARNVVERAEGFRDTRVVAQKR
FT                   AGQPVTVDDLKIITAADIEAAVRSVCSDNRDMAAIVW"
FT   gene            complement(154922..155362)
FT                   /locus_tag="MAV_0161"
FT   CDS_pept        complement(154922..155362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR00026"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67220"
FT                   /db_xref="GOA:A0A0H2ZXV7"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXV7"
FT                   /protein_id="ABK67220.1"
FT                   /translation="MTALRPPRYLKPMNKVMMAVQRLGIPTGPAMVLTVPGRKSGQPRS
FT                   TPMTPFEFRGGLYVVAGYPGADWAANARAAGTGTLRRGRRSRRVRIVELSADEARPVLR
FT                   EFPAKVPVGVGFAKRSGLVRDGTADEFEALAGQLAVFRFDPA"
FT   gene            complement(155364..156224)
FT                   /locus_tag="MAV_0162"
FT   CDS_pept        complement(155364..156224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05368"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68261"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A195"
FT                   /protein_id="ABK68261.1"
FT                   /translation="MTIVVTGATGNVGRPLVTALLAAGAPVRAVTRRSGPAGFPAQVEL
FT                   FDTAADALPGASAVFLNARALGGQLEDVVARCARGGVTKLVALSAINADDDFSRQPSRF
FT                   RGDRNREVEQLAVGSGLAWVSLRPTVFATNFAGMWSAQLREGDVVAGPYAAASSAPIVE
FT                   TDIADVAAHALLTDDLVGQRIPLTGPQALSNAQLVEVIGTVLGRSLRYREIPAAAVRRR
FT                   FVGLGLGAGFADAYLAMLAETLDKPALVTHDVEKILGRPAVPFAHWVATHRDLFDRRNE
FT                   RKEGV"
FT   gene            156337..157194
FT                   /locus_tag="MAV_0164"
FT   CDS_pept        156337..157194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0164"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65291"
FT                   /db_xref="GOA:A0A0H2ZSI2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSI2"
FT                   /protein_id="ABK65291.1"
FT                   /translation="MNRSQSADDQVAEAWRRHRPYLVNLAYQMLGDIGDAEDVAQEAFL
FT                   RLSAAGDIDDVRGWLTVVASRLCLDQLRSARARHERPGDVGEQPAPPRFDPADRITLDD
FT                   EVRTALLEVLRRLSPGERVSFVLHDVFGVPFEAIAQTVGRPVGTCRQLARRARAKFVAA
FT                   QPKLNTVGAAEHQRVTEKFITACANGDLAGLAAVLDPTVWGVGTVLADPAPPPQVNHGP
FT                   DAVATNLLRYLWPDVTLVGGPAGAPVLLAFSRRRLFAVIVLSIRDARVVKIEAIADPAA
FT                   RSAG"
FT   gene            complement(157191..158342)
FT                   /locus_tag="MAV_0163"
FT   CDS_pept        complement(157191..158342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0163"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65021"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZRS9"
FT                   /protein_id="ABK65021.1"
FT                   /translation="MNERDEFLRDRLQPERPSARPAPAPPPPPVASRPAPPRPPTPAPT
FT                   PPTRPPAPPTFRPHPPAAAPAPAAPPTPRPQPSGAPQLPDRGWRRALRLATFGLIDLGP
FT                   SPAQRREAQFEQAIQARLYGNYKVGVLGKGGVGKTSVAASVGSLFAELRRQDHVVAIDA
FT                   DTAFGRLGSRIDPASTGSFWELTADQNLRSFDDVVARLGRNAAGLHVLGGEPASGPRRV
FT                   LDPAIYREATRRLDRHFTISVIDCGSTMDAPLTQEVLRDLDALIVVSSPWADGASAAAR
FT                   TLEWLADHGLTTLLAHSLVVLNDSDGHADKRTRALLAREFIDHGRPVIEVPFDPHLRPG
FT                   GVIDVNGEMAPATRRKFLEVTATIAGYFARRPDRSADRHPPQH"
FT   gene            complement(158806..158961)
FT                   /locus_tag="MAV_0165"
FT   CDS_pept        complement(158806..158961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0165"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67681"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZB3"
FT                   /protein_id="ABK67681.1"
FT                   /translation="MHLTLHLNVLRGRWQRPRRGHTGGCGRTPSALSRWAVRQAEMILL
FT                   GTSVQL"
FT   gene            158956..163545
FT                   /locus_tag="MAV_0166"
FT   CDS_pept        158956..163545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0166"
FT                   /product="ferredoxin-dependent glutamate synthase 1"
FT                   /EC_number="1.4.7.1"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01493; match to protein
FT                   family HMM PF01645; match to protein family HMM PF04898"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64908"
FT                   /db_xref="GOA:A0A0H2ZRJ2"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZRJ2"
FT                   /protein_id="ABK64908.1"
FT                   /translation="MHMTPKRAGLYNPAFEHDACGVAMVVDMHGRRSRDIVDKAITALL
FT                   NLEHRGAQGAEPRSGDGAGILIQVPDAFLREVVDFELPPEGSYATGIAFLPQSSKDAAT
FT                   ACAAVEKIAEAEGLTVLGWRNVPTDDSSLGALSRDAMPTFRQVFMAGASGMTLERRAYL
FT                   VRKRAEHELGTKGPGQDGPGRETVYFPSLSGQTFVYKGMLTTPQLKAFYLDLQDDRLTS
FT                   ALGIVHSRFSTNTFPSWPLAHPFRRIAHNGEINTVTGNENWMRAREALIKTDVFGTEAD
FT                   VEKLFPICTPGASDTARFDEVLELLHLGGRSLAHAVLMMIPEAWERHESMDPARRAFYQ
FT                   YHASLMEPWDGPASMTFTDGTVIGAVLDRNGLRPSRIWVTEDGLVVMASEAGVLDLDPA
FT                   TVVRRMRLQPGRMFLVDTAQGRIVSDEEIKAELAAEHPYQEWLDRNLVPLDDLPQGDYK
FT                   RMPHDRLVKRQQTFGYTYEELNLLVAPMVRTGAEPIGSMGTDTPVAVLSQRPRMLYDYF
FT                   QQLFAQVTNPPLDAIREEVVTSLQGTTGGERDLLTPTELSCHQIVLSQPILRNRELAKL
FT                   VNLNPDDEVNGRPHGMRSKVIRCLYPVAEGGAGLAAALEDVRAQASAAIADGARVIILS
FT                   DRESDEKMAPIPSLLAVAGVHHHLVRDRTRTHVGLVVESGDAREVHHMAALVGFGAAAI
FT                   NPYMVFESIEDMLDRGVIEGIDRNTALNNYVKAAGKGVLKVMSKMGISTLASYTGAQLF
FT                   QAVGISEDVLDEYFTGLSCPIGGITLDDIAADVAARHALAYLDRPNERAHRELEVGGEY
FT                   QWRREGEYHLFNPETVFKLQHATRTGQYKIFKDYTRLVDDQSERMASLRGLLKFRAGVR
FT                   PPVPLEEVEPASEIVKRFSTGAMSYGSISAEAHETLAIAMNRLGGRSNSGEGGEDVKRF
FT                   DRDPDGSWRRSAIKQVASGRFGVTSHYLTNCTDIQIKMAQGAKPGEGGQLPGHKVYPWV
FT                   AEVRHSTPGVGLISPPPHHDIYSIEDLAQLIHDLKNANPAARVHVKLVSENGVGTVAAG
FT                   VSKAHADVVLISGHDGGTGATPLTSMKHAGAPWELGLAETQQTLLLNGLRDRIVVQVDG
FT                   QLKTGRDVMIAALLGAEEFGFATAPLVVSGCIMMRVCHLDTCPVGVATQNPVLRERFTG
FT                   KPEFVENFFMFIAEEVREYMAQLGFRTLNEAVGQVKSLDTTLARAHWKAHRLDLGPVLH
FT                   EPESAFMNQDLYCSSRQDHGLDKALDQQLIVMSREALDSGKPVRFSTTISNVNRTVGTM
FT                   LGHEVTKAYGGQGLPDGTIDITFDGSAGNSFGAFVPRGITLRVYGDANDYVGKGLSGGR
FT                   IVVRPSDNAPADYVAEDNIIGGNVILFGATSGEAYLRGVVGERFAVRNSGAHAVVEGVG
FT                   DHGCEYMTGGKVVVLGRTGRNFAAGMSGGVAYIYDPPGEFPQHLNAEMVELESLDDDDI
FT                   EWLHGMIQAHVDATDSAVGQRILGDWAQQQRHFVKVMPRDYKRVLQAIAEAERDGGDVD
FT                   KAIMAAAHG"
FT   gene            163538..165013
FT                   /gene="gltD"
FT                   /locus_tag="MAV_0167"
FT   CDS_pept        163538..165013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="MAV_0167"
FT                   /product="glutamate synthases, NADH/NADPH, small subunit"
FT                   /EC_number="1.4.1.-"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR01317"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66769"
FT                   /db_xref="GOA:A0A0H2ZYC3"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYC3"
FT                   /protein_id="ABK66769.1"
FT                   /translation="MADPSGFLKYTHRELPKRRPVPLRLRDWREVYEEFDHGTLREQAT
FT                   RCMDCGIPFCHNGCPLGNLIPEWNDLVRTGRWRDAIERLHATNNFPDFTGRLCPAPCEP
FT                   ACVLGINQDPVTIKQIELEIIDNAFDEGWVQPLPPDKLTGKKVAVVGSGPAGLAAAQQL
FT                   TRAGHSVTVFERSDKIGGLLRYGIPEFKMEKRVLDRRLDQMRAEGTEFRAGVNVGVDIT
FT                   ADQLRADFDAVVLAGGATAWRDLPIPGRELDGIHQAMEFLPWGNRQASGDLDEADMDAD
FT                   GQPPITAKGKKVIIIGGGDTGADCLGTVHRQGATEVHQFEIMPRPPDTRAPSTPWPTYP
FT                   LMYRVSSAHEEGGERVFSVNTEEFVGENGRVTALKAHEVTMEDGKFVKVEGSEFELEAD
FT                   LVLLAMGFVGPEKEGLLTDLGVKFTERGNVARGADFDTSIPGVFVAGDMGRGQSLIVWA
FT                   IAEGRAAAAAADRFLMGATALPAPVKPTAVPLQ"
FT   gene            165167..165307
FT                   /locus_tag="MAV_0168"
FT   CDS_pept        165167..165307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66065"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW44"
FT                   /protein_id="ABK66065.1"
FT                   /translation="MHINPVPRSRMGRIAWSWLRHPVKSREFPAKHERLVTAQDLLLFG
FT                   V"
FT   gene            complement(165375..166226)
FT                   /locus_tag="MAV_0169"
FT   CDS_pept        complement(165375..166226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67902"
FT                   /db_xref="GOA:A0A0H2ZYV0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019952"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYV0"
FT                   /protein_id="ABK67902.1"
FT                   /translation="MRFAFKTSPQNTTWAQMLAVWQAADDIDVYESGWTFDHFYPIFSD
FT                   SSGPCLEGWTTLTALAQATKRLRLGTLVTGIHYRHPAVLANMAAAVDIISGGRLELGIG
FT                   AGWNEEESGAYGIELGSIRERFDRFEEACAVLTSLLSQETTDFDGKFYQLKGARNEPKG
FT                   PQRPHPPICIGGSGEKRTLRITARYAQHWNFVGGPPDVFAHKRDVLASHCADIGRDPKE
FT                   ILLSAHLRLEPDLDYGKVIDDAAALAAEGLDLGIVYLPPPHDPAVLEPLAEAIRDSGLL
FT                   RS"
FT   gene            166278..166718
FT                   /locus_tag="MAV_0170"
FT   CDS_pept        166278..166718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67170"
FT                   /db_xref="GOA:A0A0H2ZXR6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXR6"
FT                   /protein_id="ABK67170.1"
FT                   /translation="MTFGCGSLGLDTKITLLAAGLIFLLALILGVWKYREMMTSENHLA
FT                   HPYVDIAHRAALLYSFATLLIAVFVQLSAWPVWVNLAAAGVLVFFFLAAILAYIGHGAR
FT                   RDTVNQFERPTAGLRWSMAALIVGEIGGFGVLFAGFVAGQLW"
FT   gene            166797..167801
FT                   /locus_tag="MAV_0171"
FT   CDS_pept        166797..167801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0171"
FT                   /product="PHP domain protein"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM PF02811"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68971"
FT                   /db_xref="GOA:A0A0H3A1L6"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR017078"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1L6"
FT                   /protein_id="ABK68971.1"
FT                   /translation="MDPVVALRQIAYYKDRSRHDPRRVMAYRNAADVIEGLDEATRERH
FT                   GQANSWQSLPGIGPKTAKVIAQAWSGREPDMLVELRSAAEDLGGGDIRSALRGDLHVHS
FT                   NWSDGSAPIEEMMAAAAALGHEYCALTDHSPRLTIANGLSPERLRKQLDVIDRLQDTVA
FT                   PMRILTGIEVDILEDGGLDQEPELLERLDVVVASVHSKLSMDSAAMTRRMLRAVQNPHA
FT                   DVLGHCTGRLVSGNRGIRPESKFDAEAVFTACREHGTAVEINSRPERRDPPTRLLNLAL
FT                   EMGCVFSIDTDAHAPGQLEFLGYGAQRALDAGVPVDRIVNTWPAERLLEWTAG"
FT   gene            complement(167808..169010)
FT                   /locus_tag="MAV_0172"
FT   CDS_pept        complement(167808..169010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0172"
FT                   /product="DNA polymerase IV 2"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00817"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65621"
FT                   /db_xref="GOA:A0A0H2ZTE5"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTE5"
FT                   /protein_id="ABK65621.1"
FT                   /translation="MFVRCDASILHADLDSFYASVEQRDDPTLRGRPVIVGGGVVLAAS
FT                   YEAKAYGVRTAMGGAQARRLCPHAVVVPPRMHAYTRASDAVFRVFRECTPLVEALSVDE
FT                   AFLDVGGLRRVSGTPVAIAQRLRADVRDRVGLPITVGIARTKFLAKVASQQAKPDGLLL
FT                   VPPDQELAFLRPLPVRRLWGVGAVTAEKLRAHGIATVADVAELSESTLGSMVGAAMGRQ
FT                   LYALSRNIDRRRVSTGVRRRSVGAQRALGRAGNTMSDSEIDAVVVNLIDRITGRMRAAG
FT                   RTGRTVVLRLRFDDFTRATRSHTLPWATSSTAPILAAARRLVAGAAPMIARRGLTLVGF
FT                   AVSGIDRDGAQQLMLPFEGRPPDAIDAAIDRVRRRYGKAALTPAVLLGRDPGLEMPHLP
FT                   D"
FT   gene            complement(169040..169681)
FT                   /locus_tag="MAV_0173"
FT   CDS_pept        complement(169040..169681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0173"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64925"
FT                   /db_xref="GOA:A0A0H2ZRH3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZRH3"
FT                   /protein_id="ABK64925.1"
FT                   /translation="MTTAGQTRALRGRRAIRPTGDEREQAILATALRLLETRPFAGISV
FT                   DDLAKGAGLSRPTFYFYFKSKEAVVLSLLEPVIARADAEFDGAVQRLPTDPRRVWRNGI
FT                   KAFFTAFSSHRALARAATEALATSSELRSVWSGFMQKWIDQTAAMITAERERGAAPDTI
FT                   PAADLATSLNQMNERTMMAALSAETPAVAEDRVVDTLTHIWVSSIYGESG"
FT   gene            169807..171228
FT                   /locus_tag="MAV_0175"
FT   CDS_pept        169807..171228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0175"
FT                   /product="monooxygenase, flavin-binding family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65989"
FT                   /db_xref="GOA:A0A0H2ZWF6"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWF6"
FT                   /protein_id="ABK65989.1"
FT                   /translation="MSAAWHLQNRCPTKSYAILERRADLGGTWDLFKYPGIRSDSDMFT
FT                   LGFRFKPWRSAKSIADGASIKAYIKEAAVENRIEPHIRYRHRVVAADWSDADNRWTVTV
FT                   EHDGQRSEITCSFLFACTGYYNYDEGYSPTFPGAEDFGGTIVHPQHWPEDLDYAGKRIV
FT                   VIGSGATAITLIPALVNSGAGHVTMLQRSPTYIGSLPGVDPFAERANRLLPDRLAHMAN
FT                   RWKAIAFSTFQYQLSRKAPAYMRKTLMTMAKRRLPEGYDVEKHFGPRYNVWDERLCLAP
FT                   DGDFFRTIRHGKADVVTDTIDRFTTTGIRLNSGEELPADIIVTATGLNMQLLGGVTPTR
FT                   NGDPVDLTSLMTYKGLMFSGMPNFAITFGYTNASWTLKADLVSEFVCRLLNYMDAKGFD
FT                   FVEPQHPGEDVDALPFMDFTPGYFRRSMHLLPKSGSRAPWRLKQNYFFDMRTIRRGRVD
FT                   DEGLKFAKKRAPVAV"
FT   gene            complement(171225..171710)
FT                   /locus_tag="MAV_0174"
FT   CDS_pept        complement(171225..171710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0174"
FT                   /product="regulator of ribonuclease activity A"
FT                   /note="identified by match to protein family HMM PF03737;
FT                   match to protein family HMM TIGR01935"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65807"
FT                   /db_xref="GOA:A0Q981"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0Q981"
FT                   /protein_id="ABK65807.1"
FT                   /translation="MTVSFRPTADLVDDIGPDVRSCDLQFRQLGGRTEFAGPISTVRCF
FT                   QDNALLKSVLSEPGGGGVLVVDGGGSLHTALVGDVIAELARANGWAGLIVNGAVRDSAA
FT                   LRGMDIGVKALGTNPRKSTKTGAGERDVDITLGGVTFTPGDIAYSDDDGIVVVAAGD"
FT   gene            complement(171719..172129)
FT                   /locus_tag="MAV_0176"
FT   CDS_pept        complement(171719..172129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0176"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67736"
FT                   /db_xref="GOA:A0A0H3A149"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A149"
FT                   /protein_id="ABK67736.1"
FT                   /translation="MADPQDPTNSAADGAGDPPEKKPPAKAAKKTAKAPAKKAPAKKAP
FT                   AKKAPAKKAPAKKAPAKNTPTGGGQRADTNGDLTAAAKDAAAQAKSTVEAADNPVAPAV
FT                   VGPAAGQSPVPLIVAVAVSLLAILLIRQLRRR"
FT   gene            complement(172226..172732)
FT                   /locus_tag="MAV_0177"
FT   CDS_pept        complement(172226..172732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0177"
FT                   /product="copper resistance protein CopC"
FT                   /note="identified by match to protein family HMM PF04234"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67243"
FT                   /db_xref="GOA:A0A0H2ZX86"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZX86"
FT                   /protein_id="ABK67243.1"
FT                   /translation="MRRWAVGACVGALVLIAGLTAPAAWAHAARVATDPAADAALTTGP
FT                   HRVSATFNEQLQTTFAAMTVVGPDGNVWSTGEPTVQGAVVSVAVRPLGPAGTYTANYRV
FT                   TSADGHVVAGSWSFRLTVPGTGTPGPAAAGHAGGGGGAVPVWPFVAAAAALIAGGAWWA
FT                   ARRGR"
FT   gene            complement(172729..173361)
FT                   /locus_tag="MAV_0178"
FT   CDS_pept        complement(172729..173361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0178"
FT                   /product="nuclear export factor GLE1 family protein"
FT                   /note="identified by match to protein family HMM PF07987"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69050"
FT                   /db_xref="GOA:A0A0H3A343"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A343"
FT                   /protein_id="ABK69050.1"
FT                   /translation="MPPRKRRAPRLLVAVAALCLGSVAWSPIASAHVHAGSDNPVRGAM
FT                   AVVTFQVPNESNTGAATTALTVALPNVAAAHTETMPGWTARLDRDAASGTVRSVTWTAA
FT                   AGGGIGPDQFALFRLSVKLPDADTVSFPATQTYADGTVVKWDQPPLPDGGEPEHPAPTL
FT                   ALAAGPAAGHQHPGGPAAADNAARWLGGAALVLAALGIAIALVRRRA"
FT   gene            complement(173367..174023)
FT                   /locus_tag="MAV_0179"
FT   CDS_pept        complement(173367..174023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0179"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2N8"
FT                   /protein_id="ABK69317.1"
FT                   /translation="MGLFRKRKSRATRRAEARAIKARAKLEAKLAAKNEARRAKSALRA
FT                   QDKALKAQIRAQRDSDRNALKVAEAELKAAREGKILSPTRIRRILTVSRLLAPILTPLV
FT                   YRAAVSARALIDQRRADRLGIPLAKIGQFSGHGAQLSARIAGAEKSLRMVQERKPKDGE
FT                   TKQFVAAISERLTDLAAAVTAAENMPAARRRAAHAAISSQLDGIEADLMARLGLS"
FT   gene            complement(174170..174568)
FT                   /locus_tag="MAV_0180"
FT   CDS_pept        complement(174170..174568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65615"
FT                   /db_xref="GOA:A0A0H2ZVB0"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVB0"
FT                   /protein_id="ABK65615.1"
FT                   /translation="MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYL
FT                   SQLRSGNRTNPSSATMAALANFFRIKPAYFTDDEYYEKLDAELSWLAMSRDDNVRRIAM
FT                   RTAELSPEAQREVMDRVNELRRAEHLDA"
FT   gene            complement(174992..175456)
FT                   /locus_tag="MAV_0181"
FT   CDS_pept        complement(174992..175456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64941"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTB3"
FT                   /protein_id="ABK64941.1"
FT                   /translation="MISGRWPDSTKEWAQLLMVAVRVASLPGLLSTTTVFGAREELPDE
FT                   PEPGTVGLVLAEGTVFGESAIPPGHFADHQPPALLMLHPPSETMPSLPECTGAASGCVL
FT                   LPGLPYLGLEHRAAWVEAEADGTITSMVSRVGVDPISHPDTAILAMLLAA"
FT   gene            complement(175683..176306)
FT                   /locus_tag="MAV_0182"
FT   CDS_pept        complement(175683..176306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0182"
FT                   /product="[Mn]-superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="identified by match to protein family HMM PF00081;
FT                   match to protein family HMM PF02777"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66442"
FT                   /db_xref="GOA:A0A0H2ZVN7"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVN7"
FT                   /protein_id="ABK66442.1"
FT                   /translation="MAEYTLPDLDWDYAALEPHISGQINEIHHTKHHATYVKGVNDALA
FT                   KLEEARANEDHAAIFLNEKNLAFHLGGHVNHSIWWKNLSPDGGDKPTGELAAAIDDAFG
FT                   SFDKFRAQFSAAANGLQGSGWAVLGYDTLGSRLLTFQLYDQQANVPLGIIPLLQVDMWE
FT                   HAFYLQYKNVKADYVKAFWNVVNWADVQKRYAAATSKAQGLIFG"
FT   gene            complement(176467..176622)
FT                   /locus_tag="MAV_0183"
FT   CDS_pept        complement(176467..176622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0183"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65758"
FT                   /db_xref="GOA:A0A0H2ZTT0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTT0"
FT                   /protein_id="ABK65758.1"
FT                   /translation="MATHSFGPGSPAPSKSYGGSPAWNHSYSVAALRAGLIALALLAVL
FT                   ALIVLS"
FT   gene            177234..178055
FT                   /locus_tag="MAV_0184"
FT   CDS_pept        177234..178055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0184"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68940"
FT                   /db_xref="GOA:A0A0H3A2W3"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2W3"
FT                   /protein_id="ABK68940.1"
FT                   /translation="MRPGAAPPPRRGRRPLGPTPRYAVIPRWGLADRVEPPPAVAAASA
FT                   HPGPPAQLVRSTSFVGVLVLGIAALVYVVRYLLLVINRDTLLYSWVAIGADWLGVLASV
FT                   GAVGAVIASGVALIRWMIARRAAVFAHHGLPDPRSARALGAGCVVPLANLLWAPVFVIE
FT                   LALLEEHYHRLKGPILQWWITWVCSYAVSVSAIATSFVTDAQGIANNTILMVFGYLFAA
FT                   ATLAAATRIFEGFQRKPVARPAHRWVMVPDDGPPPPAPGAPVEFKGQEPAA"
FT   gene            178060..178878
FT                   /locus_tag="MAV_0186"
FT   CDS_pept        178060..178878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0186"
FT                   /product="Glycerophosphoryl diester phosphodiesterase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66026"
FT                   /db_xref="GOA:A0A0H2ZWJ0"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWJ0"
FT                   /protein_id="ABK66026.1"
FT                   /translation="MTWADEVLAGHPFVVAHRGASAARPEHTLAAYDLALKEGADGVEC
FT                   DVRLTRDGHLVCVHDRRLDRTSTGAGLVSTMTLAQLRELEYGAWHDSWREDGAHGDTSL
FT                   LTLDALVSLVLDWRRPVKLFIETKHPVRYGSLVETKLLALLHRFGIAAPASADRSRAVV
FT                   MSFSASAVWRIRRAAPLLPTVLLGKTARYLISGAPTAVGATAVGPSLPTLREYPQLADR
FT                   AIAQGRAVYCWNVDDYQDIDFCRDVGVAWLATHHPGRTKAWLQGHRDGNG"
FT   gene            complement(178875..179828)
FT                   /locus_tag="MAV_0185"
FT   CDS_pept        complement(178875..179828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0185"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF03816;
FT                   match to protein family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65304"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZU77"
FT                   /protein_id="ABK65304.1"
FT                   /translation="MASALLVVLLLAGVGLGAGVAWFDTKLHREPVLADYPGRPEPGRG
FT                   SNWLIVGSDSRQGLSAEQQQQLATGGDIGDGRTDTILLVHLPGVGSGVAPTMVSIPRDS
FT                   YVPIPEHGKDKINAAFAMGGATLLVRTVEQATGLRIAHYAEIGFGGFAALVDALGGVRV
FT                   CPQAPMHDPLAGLDLPAGCQTLDGRNALAYVRSRDTPRADLDRMVNQRQFVAALLHRAA
FT                   SPAVWLNPWRWYAAPRAVADSLTVDRADHAWDLARLGWALHGSPATVTVPIGEFTSGDA
FT                   GSVVVWDHARAARLFDALSSDGQLPAGSTDEQQPSS"
FT   gene            complement(180134..180928)
FT                   /locus_tag="MAV_0187"
FT   CDS_pept        complement(180134..180928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0187"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65188"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTX9"
FT                   /protein_id="ABK65188.1"
FT                   /translation="MLPQTCPAPSTAERIRSACVRAGGALLAIEHDDPVPTPVHHLIGA
FT                   GPFAGSFSLALPVEREHRLRPVAGAPALLELTDYAPLPLREPVRSLVWVRGRLHEVDPA
FT                   QILETLDVIAAECPHPALLGVDTPRRADGTEPRYVLRRLEIASVVVTDATGAEPVDVAD
FT                   LLAARPDPFCALESDLLWHLDTAHGDVVSRLVSRLPAPLRRGQVRPLGLDRYGVRFRVE
FT                   GNDRDHDVRLPFHKPVDDMTGLSQAIRVLMGCPFINGLRARG"
FT   gene            181019..181966
FT                   /locus_tag="MAV_0188"
FT   CDS_pept        181019..181966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0188"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="identified by match to protein family HMM PF00800;
FT                   match to protein family HMM PF01842"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64544"
FT                   /db_xref="GOA:A0Q994"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0Q994"
FT                   /protein_id="ABK64544.1"
FT                   /translation="MARIAYLGPEGTFTEAALRQITAAGLVPGQGADGVRPTPVDGTPA
FT                   ALDAVRDGAADYACVPIENSIDGSVTPTLDSLAIGSPLQVFAETTLDVAFSIVVKPGLS
FT                   AADVRTLAAIGVAAAQVRQWVAANLAGAQLRPAYSNADAAQQVAEGRADAAVTSPLAAA
FT                   RWGLDTLADGVVDEPNARTRFVLVGPPAPPPARTGADRTSVVLRIDNAPGALLAALAEF
FT                   GIRGIDLTRIESRPTRTGLGIYRFFADCVGHIDDEPVAEALKALHRRCADVRYLGSWPT
FT                   GTPAGALPPSTEEAVRWLAAVRDGKPEPPGESRR"
FT   gene            181963..182658
FT                   /locus_tag="MAV_0189"
FT   CDS_pept        181963..182658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0189"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66621"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW68"
FT                   /protein_id="ABK66621.1"
FT                   /translation="MSGRLILVRHGQSYGNVERRLDTRPPGAELTPLGRDQAREFARRS
FT                   GRPAMLAHSVATRASQTAAVIGGQLALPPVELGGIHEVQVGRLENRNDDEAVAEFNAIY
FT                   ERWHRGELEVPLPGGETGSEVLDRYLPVLTELRLRYLDDHDFHGDIVVVSHGAAIRLAA
FT                   AVLAGVEADFALDHHLDNAQSVALTPITDGRWSCVRWGTLTPPFYPEAAEIPATPVADA
FT                   VRSTTDPMG"
FT   gene            complement(182668..182826)
FT                   /locus_tag="MAV_0190"
FT   CDS_pept        complement(182668..182826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTU2"
FT                   /protein_id="ABK65878.1"
FT                   /translation="MDHCHGTIIRHALHRSECTEPDCFTPELMPHAFVIDCDAVGCACT
FT                   EVIALAV"
FT   gene            complement(182914..183258)
FT                   /locus_tag="MAV_0191"
FT   CDS_pept        complement(182914..183258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06262"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68012"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A085"
FT                   /protein_id="ABK68012.1"
FT                   /translation="MRMDPQRFDELVSDALDLIPPELAAAMDNVVVLVDDRHPEEPDLL
FT                   GLYEGVALTERDSDYSGALPDAITIYRAALLDVCESEQQVIEEVAVTVIHEIAHHFGID
FT                   DERLHQLGWA"
FT   gene            complement(183270..184616)
FT                   /locus_tag="MAV_0192"
FT   CDS_pept        complement(183270..184616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0192"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67357"
FT                   /db_xref="GOA:A0A0H3A010"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A010"
FT                   /protein_id="ABK67357.1"
FT                   /translation="MEPMSQAPEKDLPEAGEAPAVETTAASAFLWPRSLQARATRRALL
FT                   LTALGGLLIAGLVTAIPVGGGTGSGRLLDASPVRSTGAKSDAAFNRAASGECLMWPDTT
FT                   PESAKIVNCGDDHKFEVAESIDMRTFPGSEYGPNAAPPTPARIQQITQEQCEAAVRNYL
FT                   GPKFDPNSKFTVSLLWPGDRAWRQGGDRRMLCGLQLPGANNQQQVFKGKVADVDQSKIW
FT                   PTGTCLGIDSATNQPTDVPVDCAAPHAMEVTGTVNLAEKFPGALPAEPDQDAFIKDSCT
FT                   KMTDAYLAPVKLRTTTLTLIYPTVPLASWTAGSREVACSIGATLGNGGWATLLNSAKGQ
FT                   LLINGQPPVPPPDIPEERLSMPPIPLQAPAQSPSTQSGSAAAPEMPPNNQHLPGQQPVV
FT                   TQPPQAPPPPVDNGAPPPANPAPEAPPAAPPPPPPPAPEAPPGGPPPAG"
FT   gene            184726..186003
FT                   /gene="serS"
FT                   /locus_tag="MAV_0194"
FT   CDS_pept        184726..186003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="MAV_0194"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02403; match to protein
FT                   family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69523"
FT                   /db_xref="GOA:A0Q999"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0Q999"
FT                   /protein_id="ABK69523.1"
FT                   /translation="MIDLKLLREDPDAVRRSQQSRGEDPSLVDALLAADAARRAAISTA
FT                   DTLRAEQKSASKSVGAASPEQRPALLARAKELAEQVKAAETAQAEAEAAFTAAHLAISN
FT                   VVIDGVPAGGEDDFAVLDVVGEPTALENPRDHLELGESLGLIDMARGAKVSGSRFYFLT
FT                   GKGALLQLGLLQLALRLAVENGFVPMIPPVLVRPEVMAGTGFLGAHAEEVYRIEADDLY
FT                   LVGTSEVPLAGYHADEILDLSAGPLRYAGWSSCFRREAGSYGKDTRGVIRVHQFDKVEG
FT                   FVYCTPADAEAEHQRLLGWQREMLARIEVPYRVIDVAAGDLGSSAARKFDCEAWVPTQQ
FT                   TYRELTSTSNCTTFQARRLSTRYRDGGDAKGKPQIAATLNGTLGTTRWLVAILENHQRP
FT                   DGSVRVPEALVPFVGTELLEPVGPRG"
FT   gene            complement(186000..186749)
FT                   /locus_tag="MAV_0193"
FT   CDS_pept        complement(186000..186749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0193"
FT                   /product="transcriptional regulator, AraC family protein"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69000"
FT                   /db_xref="GOA:A0A0H3A4Z4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A4Z4"
FT                   /protein_id="ABK69000.1"
FT                   /translation="MSEIGQHGLATSAQTLPPGARIARHRHPLHQIVYPSTGAVSVTTP
FT                   AGTWITPANRAIWIPAGCWHEHKFHGHTNFHGVALDPARYRRGPAAPAVLAVTPLMREL
FT                   IIACSRARDTDAGAHHRMLAVLHDQLQATSVAEPLWIPTAVDGRLRAACALIADNLREP
FT                   LTLRQIGERIGVGQRTLSRLFRDELAMTFPQWRTQVRLQHALVLLAERRDVTSVAAECG
FT                   WATPSAFIDTYRRAFGHTPGRLAPRPS"
FT   gene            186819..187400
FT                   /locus_tag="MAV_0196"
FT   CDS_pept        186819..187400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65509"
FT                   /db_xref="GOA:A0A0H2ZV07"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZV07"
FT                   /protein_id="ABK65509.1"
FT                   /translation="MIAMAMNLLHRHRCSSAGWAKEVADELLPWALDGVELGSRTLEIG
FT                   PGYGATLSALLDRTASLTAVELDPVMADRLQRRYGDRARVIQASGTETGLPANHFTSVV
FT                   CFTMLHHVPSPQLQDQLFAEALRVLQPGGTFAGSDGVPSWVFRLLHVADTYNPIAPKDL
FT                   PGRLAAAGFADIHADARGGRQRWRAVKPID"
FT   gene            complement(187397..187882)
FT                   /locus_tag="MAV_0195"
FT   CDS_pept        complement(187397..187882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0195"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65292"
FT                   /db_xref="GOA:A0A0H2ZSD5"
FT                   /db_xref="InterPro:IPR021362"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSD5"
FT                   /protein_id="ABK65292.1"
FT                   /translation="MVSLLVHAVLGFSVIAWIVASNAKVFARPAGGPLFSPMEVVYYLV
FT                   GIASVALGWYFNITFVQQYSHGSTNPLWGEHGSWAEYIRLMFTNPAASSASQDYTIANV
FT                   VLLPLFTIVDGYRRGLRRPWLYFVSSLFTSFAFAFAFYFATMERQRRHEQARETVPA"
FT   gene            187952..188590
FT                   /locus_tag="MAV_0197"
FT   CDS_pept        187952..188590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0197"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65330"
FT                   /db_xref="GOA:A0A0H2ZU99"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZU99"
FT                   /protein_id="ABK65330.1"
FT                   /translation="MVRPAQTARSERTREALRQAALVRFLAQGVEDTSAEQIAADAGVS
FT                   LRTFYRHFRSKHDLLFADYTGLHWFRAALDARPADEPIIDSVQAAIFSFPYDVDAVTKI
FT                   AALRHEELDPGRIVRHIRDVQADFAEAIAAQLQRRGRGAGAPTADQRVRAAVTARCIAA
FT                   AVFGAMEVWMVGDERSLGELARLCHAALESLRAGITDSWSTATAPQVSS"
FT   gene            188639..190213
FT                   /locus_tag="MAV_0198"
FT   CDS_pept        188639..190213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0198"
FT                   /product="FAD dependent oxidoreductase, putative"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68302"
FT                   /db_xref="GOA:A0A0H3A2S0"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2S0"
FT                   /protein_id="ABK68302.1"
FT                   /translation="MNDYDAIVIGAGHNGLTAAVLLQKAGLRTLCLDAKLYAGGMASTV
FT                   ELFDGYRFEIAGSVQFPTSQAVVDELGLDTIPTIDLDVMSVAVRGVGDDPLVQYSDPVK
FT                   LFTHLNEVHGADAVNGMAGLMAWAQAPTRALDRFEAGTPPKSLDEMYACATNEFERSAI
FT                   DDMLFGSVTDILDRYLPDREKHGALRGSMTVLAVNTLYRGPATPGSAAALAFGLGVPDG
FT                   DTMQMKKLRGGIGALTSHLCDVLERHGGELRLRTKVTEILVEHAGSGGRVTGVRTESGE
FT                   TLSAPIVVSGIAPDVTLNELLDPAALPADLRARYARIDHRGSYLQMHFALQEAPVFAAP
FT                   YQVLNEPAMQASIGLFCTPEEVQQQWEQARRGVVPADPTVVLQIPSQNDPGLAPEGKHA
FT                   ASAFALWFPIEGEVDYGQAKIEMGQRVIDKITRLAPNFEDSIIRHTTFTPRHMGVMFGA
FT                   PGGDYCHGLLNANQVGPNRPGPRGFLGQPIPIEGLYLGSAGCHGGPGITFIPGYNAARQ
FT                   ALTDRSG"
FT   gene            complement(190215..190550)
FT                   /locus_tag="MAV_0199"
FT   CDS_pept        complement(190215..190550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0199"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSV9"
FT                   /protein_id="ABK64737.1"
FT                   /translation="MNETYDDGLVQLDRAAITLRRYHFPSGTSKVIALDAIRGYKAEPL
FT                   GIFMHRFRVWGSSDLRRWLPLDIGRPFKSTLITLDVPGTRPAPAFTPARPDEFTALLDE
FT                   LLARRGS"
FT   gene            complement(190547..192085)
FT                   /locus_tag="MAV_0200"
FT   CDS_pept        complement(190547..192085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0200"
FT                   /product="Rieske 2Fe-2S family protein"
FT                   /note="identified by match to protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66229"
FT                   /db_xref="GOA:A0A0H2ZWI2"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWI2"
FT                   /protein_id="ABK66229.1"
FT                   /translation="MQVTSVGHAGFLIRTQAGSILCDPWVNPAYFASWFPFPDNSTLDW
FT                   DQLGDCDYLYVSHLHKDHFDAKNLAEHVNKDAVVLLPEFPVPDLRNALQELGFHRFFET
FT                   ADSVKHRVGGLDVMIIALRAPADGPIGDSALVVSDGSTTLFNMNDARPVELDVLASEFG
FT                   HIDVHLLQYSGAIWYPMVYDMPARAKESFGIQKRQRQMDRARQYLAQVGATWVVPSAGP
FT                   PCFLDPELRHLNDDHGDPANIFPDQMVFLEQMRAHGQGGGLLMIPGSTADFSGSTLNSL
FT                   HHPLPTAEVEAIFTTGKADYIAAYAERMAPVIAAERAGWAPATGEPLLEPLRALFEPIM
FT                   SQSDEICDGIGYPVELVLGPERVILDFPKRTVREPIPDEKVRYGFTIAPELVRTVLRDR
FT                   EPDWVNTIFLSTRFKAWRVGGYNEYLYTFFKCLTDERIAYADGWFAETHDNSASITLDG
FT                   WQIQRRCPHLKADLSKFGVVEGNTLTCNLHGWQWRLDDGRCLTAKGHQLRSSRA"
FT   gene            complement(192146..192289)
FT                   /locus_tag="MAV_0201"
FT   CDS_pept        complement(192146..192289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0201"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZ18"
FT                   /protein_id="ABK66965.1"
FT                   /translation="MSRLKRRKEPTADLPSVRVDQLGGVEPDGFYRRLWQADDEDRDVA
FT                   AR"
FT   gene            192316..193083
FT                   /locus_tag="MAV_0202"
FT   CDS_pept        192316..193083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0202"
FT                   /product="acyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67054"
FT                   /db_xref="GOA:A0A0H2ZZB7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZB7"
FT                   /protein_id="ABK67054.1"
FT                   /translation="MEPVYGTVIQLARLIWRVQGLKITITGVENLPKSGGAVIAINHTG
FT                   YLDFTFAGLPAYKQGLGRKVRFMAKQEVFDHKITGPIMRSLRHISVNRQDGAASYEAAV
FT                   RNLKDGELVGVYPEATISRSFEIKEFKSGAARMAVEAGVPIVPHIVWGAQRIWTKDHPK
FT                   KLWRPKVPIIVLVGEPIQPTLGVEELKGLLHSRMQHLLERAQEMYGPHPAGEFWVPHRL
FT                   GGGAPSLAEAARLDAEEAAARAARRGQSAGAPE"
FT   gene            193090..193869
FT                   /locus_tag="MAV_0203"
FT   CDS_pept        193090..193869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0203"
FT                   /product="acyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67200"
FT                   /db_xref="GOA:A0A0H2ZXU1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXU1"
FT                   /protein_id="ABK67200.1"
FT                   /translation="MVEPTFRALELLAVLAVKATGTEITYHGEENIPERGGAVVAINHT
FT                   SYVDFLPAGLAVHRRGRRLRFMIKAEMQQVKVVNFLIKHTRTIPVDRGAGAGAYAVAVQ
FT                   RLREGELVGVYPEATISRSFELKEFKTGAARMAIDADVPIIPLIVWGAHRIWTKDHPRT
FT                   LGRAKIPITVQVGAPLRAREDIAQTDAALRDAMTTLLHQAQQHYPMQPGAYWVPRRLGG
FT                   TAPTPAEAARMEADEAAARAAAAAAKKAANRAGRPGR"
FT   gene            193883..194668
FT                   /locus_tag="MAV_0204"
FT   CDS_pept        193883..194668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0204"
FT                   /product="acyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69333"
FT                   /db_xref="GOA:A0A0H3A3P8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3P8"
FT                   /protein_id="ABK69333.1"
FT                   /translation="MAEGFYRLGEWVVPPLVAMQGTKFTYQGLENIPAHGGALLAQNHT
FT                   SYLDWLPTLMAVRERHRRAYFMIKAEMADVKAVNYVIKHARLIPVDRRSGHDAFDVAVQ
FT                   RMREGELIGMHPEATISRSFELREFKTGAARMALAAQVPIVPIIVWGAHRIWPKDHPKK
FT                   VFRNKVPITVAAGRPLPPRGTPEQLNAALREAMNALLYRVQEEYPHPKDEFWVPRRLGG
FT                   GAPTQEDSRALRLSELQERMRKYGTDGVTRPGQRQSGLH"
FT   gene            194697..195512
FT                   /locus_tag="MAV_0205"
FT   CDS_pept        194697..195512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0205"
FT                   /product="conserved hypothetical protein, putative"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM TIGR00099; match to protein family HMM
FT                   TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66059"
FT                   /db_xref="GOA:A0A0H2ZUD1"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUD1"
FT                   /protein_id="ABK66059.1"
FT                   /translation="MTLPRLIACDVDGTLFDDDERITPRTRAAVRAAVAGGARFVVATG
FT                   RPPRWIRPVVDALGFAPIAVCANGAVIYDPANDRVLSARTLDVDTLAELAELATRVIPG
FT                   AGLAVERIGERAHDTATPQFISSPGYEHAWLNPDNTEVSIEDLLSAPAIKLLIRRAGAR
FT                   SSDIAAELAKHVGLEGDITYSTDNGLVEIVPLGISKATGIEEIARPLEIAREEVVAFGD
FT                   MPNDLPMLRWAGHGVAMGNAHPEVQAAADEITAANNDDGVGRVLERWWL"
FT   gene            complement(195539..197167)
FT                   /locus_tag="MAV_0206"
FT   CDS_pept        complement(195539..197167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0206"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /note="identified by match to protein family HMM PF01510"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68124"
FT                   /db_xref="GOA:A0A0H2ZZD2"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR006619"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZD2"
FT                   /protein_id="ABK68124.1"
FT                   /translation="MSRSRAPTTLLTAIAATVVLVSWVGDATRDRGAAGAPPARGTQLT
FT                   EQPLIGLGAGVTVREISQQTPFSLVALTGDLAGTSTRVRARRRDGSWGPWYQTEYETAA
FT                   PDPGHAGEATEGPRGTDPVFVGTTTTVQIAVTRPLDAPATQPPPRPADDLGYRPASREQ
FT                   PFGQNISAVLISPPQAPSETHWTPPSGVVMPGQAPPIISRAEWGADESLRCGSPQYDNG
FT                   IRAAVVHHTAGNNDYSPLESAGIVKAIYTYHSKTLGWCDIAYNALVDKYGQVFEGSAGG
FT                   LTKAVEAFHTGGFNRNTWGVAMIGNFDDVPPTPVQLRAVGRLLGWRLGMDGVDPKGTVQ
FT                   LESAGSHYTTYAAGTVATLPTIFTHRDVGNTDCPGNAAYALMDEIRDIAAHVNDPPEEL
FT                   IKALQGGAIYAHWQEIGGMNSVLGAPTAPEDSAADDARFVTFVRGAMYWSPQTGAQPVT
FT                   GAIYDAWGSQSYERGPLGLPTSAEIQEPLQITQNFQHGTLNYERLTGNVTEVLDGITTP
FT                   LATQLPSGPTVPAEHFSLPTHPAAT"
FT   gene            complement(197302..198348)
FT                   /locus_tag="MAV_0207"
FT   CDS_pept        complement(197302..198348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0207"
FT                   /product="Erp protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64887"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZT94"
FT                   /protein_id="ABK64887.1"
FT                   /translation="MPNRRRRKLSTAMSAVAALAVASPCAYFLVYESTAGNKAPEHHEF
FT                   KQAAVMSDLPGELMGALSQGLSQFGINLPPVPALSGGATSTPGLASPGLGSPGLGSPGL
FT                   GTPGLGTPGLTNPGLTSPGATSPGLTSPGLTSPGLTSPGLTSPGAAPTTPGLTAPGALP
FT                   TTPGGGVATPGAGLNPALSNPGLTSPAGTAPGLGSPTVAPSEVPIDSGAGLDPGAGGTY
FT                   PILGDPSTFGNASPIGGGGTGLGGGSSSGGSGGLVNDVMQAANQLGAGQAIDLLKGLVM
FT                   PAITQGMHGGAAAGALPGAAGALPGAAGALPGAAGALPGAAGALPAAAGAAGALPAAAG
FT                   AAPALPPV"
FT   gene            198603..199811
FT                   /gene="glf"
FT                   /locus_tag="MAV_0208"
FT   CDS_pept        198603..199811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glf"
FT                   /locus_tag="MAV_0208"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /note="identified by match to protein family HMM PF03275;
FT                   match to protein family HMM TIGR00031"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65049"
FT                   /db_xref="GOA:A0A0H2ZTR9"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTR9"
FT                   /protein_id="ABK65049.1"
FT                   /translation="MTARFDLFVVGSGFFGLTIAERVATQLGKRVLVVERRPHIGGNAY
FT                   SEPEPHTGIEVHKYGAHLFHTSNKRVWDYVRQFTDFTDYRHRVFAMHNGQAYQFPMGLG
FT                   LVSQFFGKYFSPEEARKLIAEQAAEIDTADAQNLEEKAISLIGRPLYEAFVKGYTAKQW
FT                   QTDPKELPASNITRLPVRYTFDNRYFSDTYEGLPVDGYTAWLQNMAAHENIEVRLNTDW
FT                   FDVRDGLRAGSPEAPVVYTGPLDRYFDYAEGRLGWRTLDFEVEVLPIGDFQGTPVMNYN
FT                   DLDVPYTRIHEFRHFHTERDYPTDKTVIMREYSRFAEDDDEPYYPINTEADRALLAAYR
FT                   ARAKAETASAKVLFGGRLGTYQYLDMHMAIASALNMYDNVLAPHLRDGASLTEAQSKQE
FT                   SGA"
FT   gene            199871..201748
FT                   /locus_tag="MAV_0209"
FT   CDS_pept        199871..201748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0209"
FT                   /product="bifunctional udp-galactofuranosyl transferase
FT                   glft"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64664"
FT                   /db_xref="GOA:A0A0H2ZSP5"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR040492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSP5"
FT                   /protein_id="ABK64664.1"
FT                   /translation="MSLLSRIILPRPGEPLDVRKLYLEESTTNARRAHATSRTSLEIGK
FT                   ESEVSFATYFNAFPASYWRRWSICESVVLKVELTGTGRVDVYRTKATGVRISVQGRQFV
FT                   GTDDQPAVVEIEVPLKPFEDGGWIWFDITTDTEVNLISGGWYATEPAPGTANIAVGIPT
FT                   FNRPADCVNALADLTADPLVDKVIGAVIVPDQGTRKVRDHPDFPAAAAGLGNRLSIHDQ
FT                   PNLGGSGGYSRVMYEALKNTDCQQILFMDDDIRIEPDSILRVLALHRFAKTPMLIGGQM
FT                   LNLQEPSHLHIMGEVVDQSNFMWTAAPHAEYDHDFAQFPLNDKNPRSALLHRRIDVDFN
FT                   GWWTCMIPRQVAEELGQPLPLFIKWDDAEYGLRAGEHGYPTVTLPGAAIWHMAWSDKDD
FT                   AIDWQAYFHLRNRLVVAALHWDGDITGLVRSHLKATLKHLACLEYSTVAIQNRAIDDFL
FT                   AGPEHIFSILESALPEVHRLRKEYPDAVVLPAASELPPPRYQSKAMKPPVNPLSIGYRL
FT                   ARGIAHNATKADPEAHRRPQYNVPTQDARWFRLCTVDGVTVTTADGCGVVYRQRDRRKM
FT                   FSLLFASLRRQRKLLTRFDEMRRVYRGALPVLSSKQKWETALLPAAEHA"
FT   gene            201828..202280
FT                   /locus_tag="MAV_0210"
FT   CDS_pept        201828..202280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0210"
FT                   /product="PAP2 superfamily protein"
FT                   /note="identified by match to protein family HMM PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69334"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A4N4"
FT                   /protein_id="ABK69334.1"
FT                   /translation="MLTVARALSHFGEHSIGWVAAAALGALCSPRRRADWLAAGAGAFV
FT                   AHAAAVVVKRIVRRERPHHPAVVVNVGTPSRLSFPSAHATSTTAAAILLGRITGLPLPA
FT                   VLVPPMALSRMVLGVHYPSDVACGIALGAGVAAVARRAPQLARGDQ"
FT   gene            202277..203194
FT                   /locus_tag="MAV_0211"
FT   CDS_pept        202277..203194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0211"
FT                   /product="prenyltransferase, UbiA family protein"
FT                   /note="identified by match to protein family HMM PF01040"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68390"
FT                   /db_xref="GOA:A0A0H3A2N5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2N5"
FT                   /protein_id="ABK68390.1"
FT                   /translation="MTEETQEAVAGPPANVVSGVIKAIRPRQWVKNVLVLLAPVAALGG
FT                   PVQYDYTDVLGQVSVAFVVFSLAASSIYLVNDARDVEADREHPTKRFRPIAAGVVPEWL
FT                   AYTLAVLLAAASLGIGWWLTPNLAAVMAVYIAIQLAYCFGLKHQAVMDICIVSSGFLLR
FT                   AIAGGAATNIRLTQWFLLMMAFGSLFMAAGKRYAELQLAERTGAKIRKALESYTSTYLR
FT                   FVWTLSATALVVCYGLWAFDREHGEARWFVVSMVPFTIAILRYAVDVDGGLAGEPEDIV
FT                   LRDRVFQLLALAWMVTVGAAVAFG"
FT   gene            203181..205163
FT                   /locus_tag="MAV_0212"
FT   CDS_pept        203181..205163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0212"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67928"
FT                   /db_xref="GOA:A0A0H3A0G5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0G5"
FT                   /protein_id="ABK67928.1"
FT                   /translation="MPSVSPELQALKARIMGSRPVMRRPGWPVFPYTTMVRSSLWIGVA
FT                   VVAVLFAWGGWQRRWIADDGLIVLRTVRNLLAGNGPVFNQGERVEANTSTAWTYLMYAG
FT                   SWVGGPLRMEYVALALALTLSVLGVALLMLGAARLYAPSLRGRRAIMLPAGALVYIALP
FT                   PSRDFATSGLESGLALAYLGLLWWMMVCWAQPVRNRSDRREFAGALAFVAGFSVLVRPE
FT                   LALMGGLALIMMLVAARTWRRRALIVAAGGALPVAYEIFRMGYYGLLVPGTALAKDAAG
FT                   DKWSQGMTYLSNFDAPYLVWVPAALLVLLGVLLAAARRRPSFLRPPLAPNYGRVARAVH
FT                   SPPAVVAWVLVSGLLQALYWIRQGGDFMHARVLLAPLFCLLAPVAVVPVMVPDGQDYSR
FT                   ETGNWVAGAACALWLGIAGWALWAANSPGMGDDATHVTYSGIVDERRFYAQATGHAHPL
FT                   TAADYLGYPRMAAILTALNNTPEGALLLPSGNYTQWDLVPMAQPPPGTTPDKFPQKPQH
FT                   TVFFTNLGMVGMNVGLDVRVIDQIGLANPLAQHTERLKHGRIGHDKNLFPDWVIADGPW
FT                   VKVYPGIPGYLDAQWVAEAVSALQCPDTRAVLASVRAPMTPHRFLSNVLHSFQFTGYRI
FT                   DRVPRYELARCGLPVPEEAPPPPRE"
FT   gene            205160..205318
FT                   /locus_tag="MAV_0213"
FT   CDS_pept        205160..205318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0213"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66911"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZY24"
FT                   /protein_id="ABK66911.1"
FT                   /translation="MSAAQKNFRPIRHRPGRGVRDKLAATSHLTPDQLATAVKHMRRRR
FT                   LLYTCWM"
FT   gene            205514..206557
FT                   /locus_tag="MAV_0214"
FT   CDS_pept        205514..206557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0214"
FT                   /product="antigen 85-A"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00756"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69313"
FT                   /db_xref="GOA:A0A0H3A3N6"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3N6"
FT                   /protein_id="ABK69313.1"
FT                   /translation="MTLVDRLRGAVAGMPRRLVVGAAGAALLSGLIGAVGGSATAGAFS
FT                   RPGLPVEYLQVPSAAMGRDIKVQFQSGGANSPALYLLDGMRAQDDFNGWDINTPAFEWY
FT                   NQSGISVAMPVGGQSSFYSDWYKPACGKAGCTTYKWETFLTSELPQYLSAQKQVKPTGS
FT                   GVVGLSMAGSSALILAAYHPDQFVYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADM
FT                   WGPKEDPAWARNDPSLQVGKLVANNTRIWVYCGNGKPSDLGGDNLPAKFLEGFVRTSNL
FT                   KFQDAYNGAGGHNAVWNFDANGTHDWPYWGAQLQAMKPDLQSVLGATPGAGPATAAATN
FT                   AGNGQGT"
FT   gene            206704..207621
FT                   /locus_tag="MAV_0215"
FT   CDS_pept        206704..207621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0215"
FT                   /product="antigen 85-C"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00756"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64781"
FT                   /db_xref="GOA:A0A0H2ZSK0"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSK0"
FT                   /protein_id="ABK64781.1"
FT                   /translation="MDMTVVRGVSALLRVFCIAVLAAGLGVALQPAAVTGAARAAGYES
FT                   LMVPSAAMGRDIPVAFLAGGPHAVYLLDAFNAAPDVSNWVTAGNAMNTLGGKGISVVAP
FT                   AGGAWSMYTNWEQDGSKQWDTFLSSELPDWLAANKGLAPGGHAAVGASQGGYGAMALAA
FT                   FHPDRFGFAGSLSGFLYPSSTNYNGAILAGLQQYGGVDGNGMWGAPQLGRWKWHDPYVH
FT                   ASLLAQNNTRVWVWSPTNMGGDDAAMIGQAGAAMGSSREFYQQYRSNGGHNGHFDFPGG
FT                   GDNGWGSWAGQLGAMSGDIVGAIR"
FT   gene            207786..208796
FT                   /locus_tag="MAV_0216"
FT   CDS_pept        207786..208796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0216"
FT                   /product="cutinase superfamily protein"
FT                   /note="identified by match to protein family HMM PF01083"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65610"
FT                   /db_xref="GOA:A0A0H2ZVA4"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVA4"
FT                   /protein_id="ABK65610.1"
FT                   /translation="MPTNARRKRRRTLAWIAALSVAGVVLLVIVAAVVVLRGREAPPSA
FT                   VPPGVLPPTSTTGHPHKPRPASQDASCPDVLLVNVPGTWESAPQDDPGNPLQFPNALLH
FT                   KVTASLTEQFPPSRLQAYTTPYTAQFHNPLSGDTQMTYNASRAEGTRATVAAMTDMNNK
FT                   CPLTSYVLMGFSQGAVIAGDIASDIGNGRGPVDDDLVLGVTLIADGRRQQGVGNDIGPN
FT                   PPGQGAEVTLHEVPILSGLGLTMTGARPGGFGDLNAKTNEICAPGDLICAAPEEAFSVA
FT                   NLPATLNTLAGGAGQPVHALYATTQCWSLDGVPATDWTLNWAHGLIANAPQPKHG"
FT   gene            209078..210976
FT                   /locus_tag="MAV_0217"
FT   CDS_pept        209078..210976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0217"
FT                   /product="acyl-CoA synthase"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66189"
FT                   /db_xref="GOA:A0A0H2ZUZ7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUZ7"
FT                   /protein_id="ABK66189.1"
FT                   /translation="MAYHNPFIVNGKIKFPENTNLVKHVEKWARVRGDKLAYRFLDFST
FT                   ERDGVACDISWSEFSARNRAVGARLQQVTEPGDRIAVLCPQNLDYLIALFGALYAGRIA
FT                   VPLFDPSEPGHVGRLHAVLDDCTPSTILTTTEAAEGVRKFIRARSAKERPRVIAVDAVP
FT                   NEVNSTWVPPEADENTIAYLQYTSGSTRTPTGVEITHLNLPTNVLQVLNGLEGKEGDRG
FT                   LSWLPFFHDMGLITAMLSPVLGHNFTFMTPAAFVRRPGRWIREMARKPDDAPDCEVFTV
FT                   APNFAFEHAAVRGVPKEGEPPLDLSNVKGILNGSEPVSPSSMRKFYEAFKPYGLRETAI
FT                   KPSYGLAEATLFVSTTPMDQAPTVIHVDRAELNKQRFVEVPADAPNAVAQVSAGVIGVD
FT                   EWAVIVDPETASELPDGHIGEIWLHGNNMGIGYWGKEEETNEVFRNILKSRISQSHAEG
FT                   APDDAMWVKTGDYGTYYKGHLYIAGRIKDLVIIDGRNHYPQDLEYSAQEASKALRTGYV
FT                   AAFSVPANQLPKEVFDNPHTGLKYDPDDTSEQLVIVAERAPGTHKLDYQPIADDIRAAI
FT                   AVRHGVTVRDLLLVQAGTIPRTSSGKIGHRACRAAYLDGSLRSGVGSPTAFANSTD"
FT   gene            210988..216363
FT                   /locus_tag="MAV_0218"
FT   CDS_pept        210988..216363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0218"
FT                   /product="polyketide synthase"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF00550; match to protein
FT                   family HMM PF00698; match to protein family HMM PF00975;
FT                   match to protein family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67083"
FT                   /db_xref="GOA:A0A0H2ZZC7"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZC7"
FT                   /protein_id="ABK67083.1"
FT                   /translation="MADIDEPQENTPAKKSDMRAGDDAERSDAEERRPTTVPEMREWLR
FT                   NWVGRAVGKSPDEIDESVPMVELGLSSRDAVAMAADIEDMTGVTLSVAVAFQHPTIESL
FT                   ATRIIEGEPEAVDAGDDMDWSRSGPAERVDIAIVGLSTRLPGDMNSPDETWQALMEGRD
FT                   AITDLPEGRWSEFLEEPRIAARVAGARTRGGYLKDIKGFDSEFFAVAKTEADNIDPQQR
FT                   MALELTWEALEHARIPASSLRGEAVGVYVGFSNNDYQFLAVSDPTVAHPYAITGTASSI
FT                   IANRVSYFYDFRGPSVAVDTACSSSLVATHQAVQALRNGECDVAIAGGVNALLTPLVTL
FT                   GFDEIGQVLAPDGRIKSFSADADGYTRSEGGGMFVLKRVDDARRDGDQILAVIAGSAVN
FT                   HDGRSNGLIAPNQDAQAEVLRRAYKDAGIDPRTVDYIEAHGTGTVLGDPIEAEALGRVV
FT                   GRGRPADRPALLGAVKTNVGHLESAAGAASLAKVVLALQHDKLPPSINFAGPSPYIDFD
FT                   GMRLKVIDSPTDWPRYGGYALAGVSSFGFGGANAHLVVREVLPRDVIEREPEPTPAPQA
FT                   AAEPTESPEPQAHALRFDDFGNVIPDPEAPEEGEHELPGLTEEALRLKAIALEELAAQQ
FT                   ESEPTKPLIPLAVSAFLTSRKKAAAAELADWMESPEGQASSLESIGRALSRRNHGRSRA
FT                   VVLAHDHEEAIKGLRAVAEGKQRPNVFSTDGPVTNGPVWAMAGFGAQHRKMGKNLYLRN
FT                   EVFAEWIEKVDALIQDERGYSVLELILDDSHEYGIETSNVVIFAIQIALGELLRHHGAK
FT                   PAAVVGQSLGEPASAYFSGGLSLADATRVICSRSHLMGEGEAMLFGEYIRFMALVEYSA
FT                   DELKTVFADFPGLEVCVYAAPSQTVIGGPPEQIDAIVARAEAEGRFARKLQTKGAGHTS
FT                   QMDPLLGEFSAELQGIKPMSPTVGIFSTVHEGTYIKPGSEPVHDVAYWVKGMRHSVYFT
FT                   HGIRNAVDSGHTTFLELAPNPVALMQIGLTTAAAGLHDAQLIPTLAKKQDDVESMISAM
FT                   AQLYVYGHDLDIRTLFTRAKGPQDYANIPPTRFKRKEHWLDVHFSGDGSVIMPGTHVAL
FT                   PDGRHVWEYAPRNGETDLAALVRSAATQVLPDAQLVASEQRAVPGPGARLVTTMTRHPG
FT                   GASVQVHARIDESFTLVYDALVSRAGQNVAALPTAVGAGAAIAVAPTVAAPEQPAEAPV
FT                   EEDTNAETLSDSLTARYLPAGTGKWSPDSGETVAERLGLIVSAAMGYEPEDLPWEVPLI
FT                   ELGLDSLMAVRIKNRVEYDFDLPPIQLTAVRDANLYNIEQLITYAIEHRDEVEALHEHQ
FT                   KTLTPEEIAKEQAQLLSGATPASVAAPAPDPQAEPETQPAPPPPSDTPIPPPPTDPSGP
FT                   SANGGQPKPSLAEALSSEAVTKALNSDVPPRDAAERVTFATWAIVTGKSAGGIFNPLPK
FT                   LDADTAAKMAQRLSERADGPITVEDVQTAETIEALAERVRTYLEAGQIDGFVRTLRARP
FT                   EGSTKIPVFVFHPAGGSTVVYEPLLKRLPPDTPMYGFERVEGSVQERAAQYVPKLLELN
FT                   EDNPFVLVGWSLGGALAYACAIGLKRAGADVRFVGLIDTVRAGEEIPQTKEETRKRWDR
FT                   YARFAERTFNVEIPAIPYEQLEELDDEGQVKFVLDIVQQSGVQIPGGIVEHQRTSYLDN
FT                   RALETVQIEPYDGHVTLYMADRYHDDVIEFEPRYAIRQPDGGWGEYVADLEVVPIGGEH
FT                   IQVIDEPIIGKVGAHLTDVLNKVEAQTSQTSEVGK"
FT   gene            216363..217937
FT                   /locus_tag="MAV_0220"
FT   CDS_pept        216363..217937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0220"
FT                   /product="propionyl-CoA carboxylase beta chain"
FT                   /EC_number="6.4.1.3"
FT                   /note="identified by match to protein family HMM PF01039"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67636"
FT                   /db_xref="GOA:A0A0H3A0U3"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0U3"
FT                   /protein_id="ABK67636.1"
FT                   /translation="MTEMAPAPIQHTTAEKLAELYRRLELAKEPGGEKAAAKRDKKGIP
FT                   SARARIHALVDPGTFLETGALAKTPNDPNALYGDGCVTGHAMIDGRPVGLFSHDQTVFQ
FT                   GTVGEMFGRKVARLMEWCAMVGCPIIGIQDSGGARIQDAVTSLAWYAELGRRHEALSGL
FT                   VPQISLIFGKCAGGAVYSPIQDDLLVSVRDQGYFFVTGPDVIREVTGEEVTLDELGGSD
FT                   AQARYGNIHHVVNTEAEAFQYVREYLSFLPSNCFDQPPIVNPGLEPEITPTDLELDSIV
FT                   PDSDNMSYDMHEILLRIFDDGDFLEVAAQHGPAIITGYARVDGHPVGVIANQPMHLSGS
FT                   IDNEASDKAARFIRFCDAFNIPLVFVVDTPGFLPGAEEEKRGIIKRGGRFLYSVVEADV
FT                   PKVTITVRKSYGGAYAVMGSRQLTADFNFAWPTARIAVIGAEGAAQLLMKRFPDPTTPE
FT                   AQQIKKDFIEGYNLNMAIPWTAAERGFIDAVIDPHETRLLLRKSLKLLRDKQLWFRVAR
FT                   KHGLIPV"
FT   gene            complement(217934..218773)
FT                   /locus_tag="MAV_0219"
FT   CDS_pept        complement(217934..218773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0219"
FT                   /product="methyltransferase, putative, family protein"
FT                   /note="identified by match to protein family HMM PF02409;
FT                   match to protein family HMM TIGR00027"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67089"
FT                   /db_xref="GOA:A0A0H2ZXJ9"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXJ9"
FT                   /protein_id="ABK67089.1"
FT                   /translation="MMDANLAAVADTALLVAAIRAHETTRDDRLFADPFAARLAGDRGH
FT                   ELLAGALAATGESATAQIVVRTRFWDDALLEAAQQISQVVILAAGMDARAYRLAWPDGT
FT                   VVYELDQPHVLSAKDGVLAGERPACRRVAVGVDLAQDWPAALRRAGLDPSAPAVWLIEG
FT                   LLQYLDEAAVTALLDRVDALSARASVLLYDVVGKALLESDFMAPVLESMARSGAPWRFG
FT                   TDDPGGLCERLGWSATVTDVAEPGNRYQRWYAPAVPMDVAGVPRGYFVQATKQAAGD"
FT   gene            complement(218828..219634)
FT                   /locus_tag="MAV_0221"
FT   CDS_pept        complement(218828..219634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0221"
FT                   /product="transcriptional regulator, AraC family protein"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65279"
FT                   /db_xref="GOA:A0A0H2ZTZ1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTZ1"
FT                   /protein_id="ABK65279.1"
FT                   /translation="MYRPSPPLAEHIEYFGYWRGDEALGVHTSRALPRGAVTAIIDVGG
FT                   RTDLGFYASDARTPLTVPPAFAAGAGATAYVVRVAPAHTVMTIHFRPAGALAFLGSPLS
FT                   DLEDALVGLEDLWGRDAALLREQLIDAGSPPRRVALLQAFLVRRMRRNAVWPPARLAPV
FT                   LRGADLDPSMRVSKAQELSGLSRKRFAALFRCEVGLSPKAYLRVLRLQAALRALDTPAR
FT                   GATIAADLGYFDQAHFVREFRAFTGATPTQYARRRSSMPGHVELAR"
FT   gene            complement(219658..221427)
FT                   /locus_tag="MAV_0222"
FT   CDS_pept        complement(219658..221427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0222"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65867"
FT                   /db_xref="GOA:A0A0H2ZU29"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZU29"
FT                   /protein_id="ABK65867.1"
FT                   /translation="MSDYAVEAVDRLPFSTAEKSQRYATENYCGAVGLNWYDTDPTLQF
FT                   TMSYYLQPDELALAERHLSRIGELMGGPVARWAEETDRNPPRLERYDRWGHDISRVVMP
FT                   PSFVQSKRAVLEAQRALRTEARAAKMSSSLPLFASNYLLNQADIGMGCALGTGGGMVQS
FT                   LVAAYAPADVREHVLAKFASGEWAGETAQLLTERTGGSDLGALETTATRHGDSWLLNGF
FT                   KWFASNCAGEAFIVLAKPEGAPDNSRGVANFLVLRTRRDGSRNGVRVRRLKDKLGTRSV
FT                   ASGEVEFVDAEAFLLSGEPTDGAASDGKGLGRMMELTNAARLGIALFGLGNARRALVES
FT                   LCYARQRRAFGGALIDKPLMRRKLAELIVDVEAAQAMVFDGTGATNHRQPRGMRQRIAV
FT                   PVTKLRVCRLGITAASDAIEIHGGNGYIENWPVARLLRDAQVNTIWEGPDNILCLDVRR
FT                   GIEQTRAHETLLARLRDAVSVADDDEATRLVAGRIEDLDAAITAWGKLDKPLAEARLFA
FT                   LAQFMGDIYGGALLVEQAAWERATRGGDRKALVARLYAQRYLADRGALRGIDADSDEAL
FT                   QRFDELVDGAFRP"
FT   gene            complement(221438..221953)
FT                   /locus_tag="MAV_0223"
FT   CDS_pept        complement(221438..221953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0223"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXH6"
FT                   /protein_id="ABK66491.1"
FT                   /translation="MHTLIRLGTHAAAVTSLILPAAVSSPATAAAEGGGTTVVFDNYLR
FT                   RCDFSKVSIAPKVPSPMLGTGSAVVRVNGSTAVAEVHLVDAPEPGMHFDVGLIEEPRPS
FT                   SAGCGPGDPGTAFTGMDLDGAGRGTATVSDTVRPGTTGVWLIIERPNPNSQNPAEFYTS
FT                   EFVVPVGA"
FT   gene            complement(222098..225518)
FT                   /pseudo
FT                   /locus_tag="MAV_0224"
FT                   /note="probable arabinosyltransferase A, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error"
FT   gene            complement(225293..228574)
FT                   /locus_tag="MAV_0225"
FT   CDS_pept        complement(225293..228574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0225"
FT                   /product="probable arabinosyltransferase C"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68482"
FT                   /db_xref="GOA:A0A0H3A1T7"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1T7"
FT                   /protein_id="ABK68482.1"
FT                   /translation="MAAVAGIAGLLLCLAVPLLPVRQTTATVLWPQGTVDGHVSQITAP
FT                   LVSGAPRALDISIPCPAVATLPADGGLVVSTLPPGGMDAGKNGLFVRANKDVVVVAFRD
FT                   TVAAVAQRPAVAAGACSVLHAWADAGAAGAEFVGIPGAAGTLPAEKKPQVGGIFTDLKV
FT                   PAGPGLSARVDIDTRFITAPTVLKQIVMVLGTLAVLTAIVALAVLDRRSRGGGTLINWR
FT                   SPIAWLSRYRPGTHLANWRRVGLATWIADAAVLATLLLWHVVGATSSDDGYNLTIARVA
FT                   PKAGYLVDYYRYFGTTDAPFDWYLGLLSRLASVSTAGVWMRLPATLAGIGCWLIISHWV
FT                   LRRLGPGRGGLAANRVAVFTAGAVFVAAWLPFNNGLRPEPLIALGVLVTWMLVERAIAL
FT                   QRLAPAAVAVVVALLTATLAPQGLIAVAALLTGARAVAQAIRRRRASDGLLAPLAVLAA
FT                   ALSLILVVVFRSQTVATVLESARIKYKVGPTIAWYQDWLRYYFLTVESNPDGSMARRFA
FT                   VLVMLLCLFGMLVILLRRGHVPGVASGPAWRLIGTTAVGLLLLTFTPTKWAVQFGAFAG
FT                   LAGALGALTAFACSRIGLHNRRNLTLYVTALLFVLAWATSGINGWFYVGNYGVPWYDIQ
FT                   PVIASHPVTSMFLTLSIITGLLAAWQHFRMDYAGHTEVKDSRRNRVLASTPLLVVATIM
FT                   VVGEVASLTKGAVFRYPLYTTGKANLAAIASGLSPTSCAMADDVLAEPDANAGMLQPLP
FT                   GQTFGPDGPLGGVNPVGFKPDGVGDDLQSDPVVTKPGLVNSDASPNKPNVAYSDSAGTA
FT                   GGKGPVGVNGSHAALPFGLDPARTPVMGSYGENSLAATATSAWYQLPPRTPDRPLVVVS
FT                   AAGAIWSYKEDGTFTYGQSLKLQWGVARPDGSTVPLAEVQPIDIGPQPAWRNLRFPLAW
FT                   APPEANVARIVAYDPNLSSEQWFAFTPPRVPVTETLQQLIGSQTPVMMDIATAANFPCQ
FT                   RPFSEHLGVAELPAYRILPDRKQTAASSNLWQSSEAGGPFLFLQALLRTSTIPTYLRGD
FT                   WYRDWGSVEQYFRLVPADQAPDAAIEQGVMTVHGWSRQGPIRALP"
FT   gene            228797..229951
FT                   /locus_tag="MAV_0226"
FT   CDS_pept        228797..229951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0226"
FT                   /product="EmbR protein"
FT                   /note="identified by match to protein family HMM PF00486;
FT                   match to protein family HMM PF00498; match to protein
FT                   family HMM PF03704"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69189"
FT                   /db_xref="GOA:A0A0H3A3W2"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3W2"
FT                   /protein_id="ABK69189.1"
FT                   /translation="MANAGLGFGVLGPLSVTAGGAQLPLGAPKQRAVLAMLLIHRNRPV
FT                   SVDALIDGVWGAAPVPAARTSIQSYVSTLRRLLRSALPNPNGLLASVPPGYQLNVADAD
FT                   CDLGRFRGHKTAGVQAASRGRFEEASGHLAAALREWRGPVLDDLHNFAFVDAFANLLLE
FT                   ERVAAHTARAEAEIACGRADGVIGELEALVAQHPYREPLWAQLITAYYVTERQSDALGA
FT                   YRRLKTALAEGLGIDPGPTVKALQQRILRQEPLGPGQPGKAARRAMLSTHKQSTVRSES
FT                   AAAVVDNPVVARLRDKAGRHYQLNGVTTRIGRLDDNEIVLDDTEVSRHHAVIIDTGTDF
FT                   LITDMKSTNGVQVRGRRVQRSATLVDGDHIRIGNSEFVFEIRPA"
FT   gene            complement(229955..230578)
FT                   /locus_tag="MAV_0227"
FT   CDS_pept        complement(229955..230578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0227"
FT                   /product="conserved hypothetical protein, putative"
FT                   /note="identified by match to protein family HMM TIGR03083"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65384"
FT                   /db_xref="GOA:A0A0H2ZUL1"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUL1"
FT                   /protein_id="ABK65384.1"
FT                   /translation="MTSELMAMARAERADLAEFLATLGPRDWEAPSLCSRWSVKDVVAH
FT                   VISYEELGAFGLLKRFAKGWVVRANQVGVDEFADLTPQQLLEFLREHLEPRGLTAGFGG
FT                   MIALVDGTIHHQDIRRALGRPRVVPPDRLQRVLSLVPGNPRLGAGRRIRGLRLRATDID
FT                   WTHGDGPQVSGPGEALLMAMSGRPAALADLDGPGRATLAARLGQ"
FT   gene            230761..230973
FT                   /locus_tag="MAV_0228"
FT   CDS_pept        230761..230973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0228"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64732"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZR56"
FT                   /protein_id="ABK64732.1"
FT                   /translation="MKEKVSKLRIAAGVGLGAIGLSIAGSLMPAVASASPYVPHSGPLH
FT                   PVRHYAANFLNPGWALTHPLRASVP"
FT   gene            complement(231032..234190)
FT                   /locus_tag="MAV_0229"
FT   CDS_pept        complement(231032..234190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0229"
FT                   /product="probable arabinosyltransferase A"
FT                   /EC_number="2.4.2.-"
FT                   /note="identified by match to protein family HMM PF04602"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65496"
FT                   /db_xref="GOA:A0A0H2ZSX3"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSX3"
FT                   /protein_id="ABK65496.1"
FT                   /translation="MLLAVATPLLPVDQTTAQLNWPQNGSFGSVEAPLIGYVATDLNIT
FT                   VPCQAAAGLAGRGNPGKTVLLSTVPKQAPKAVDRGLLIVRANDDLVLVVRNVPVVTAPL
FT                   SQVLGPACQRLTFTAHADKVTAEFVGLTQGPNTEHPGAPLRGEKSGYDFRPQIVGVFTD
FT                   LSGPAPPGLSFSATIDTRYSSSPTPLKMAAMILGLVLTGAALVALHILDTADGTRHRRF
FT                   LPARWWSIGGLDALVIAVLTWWHFVGANTSDDGYILTMARVSEHAGYMANYYRWFGTPE
FT                   APFGWYYDLLALWAHVSTTSIWMRLPTLAMALTCWWVISREVMPRLGHAVKQNRAAAWT
FT                   AAGMFLAVWLPLDNGLRPEPIIALGILLTWCSVERAVATSRLLPVAVACIIGALTLFSG
FT                   PTGIASIGALLVAIGPLRTILHRRITRFGALPLIAPLLAAATVTAILIFRDQTLAGEVQ
FT                   ASMLKRAVGPSLSWFDEHIRYERLFMASPDGSVARRFAVLALVLALAVTVAMSLRKGRI
FT                   PGTATGPSRRIVGITIISFVAMMFTPTKWTHHFGVFAGLAGPLGALAAVAVTAAAMRSR
FT                   RNRTVYAAVVLFLVALSFASVNGWWYVSNFGVPWSNAFPAWHYAFATALLGLTVLVLLL
FT                   AAWFHFVAPDDGPPKTRWGARLAGIIQSPLAIATWALVVFEVASLTLAMTDQYPAWSVG
FT                   RSNLQALTGKTCGLAEDVLVEQDPSAGLLSPVGGPAGSSAADALGAGLSEAFTANGIPA
FT                   DVRADPVMERPGDRSFVNDEEKTGSNQAGTEGGTTPAPGINGSSAQLPFNLDPARTPVL
FT                   GSWRSGIQVPAHLRSGWYRLPARDKARPLLVVSAAGRFDPREVQVQWATDEQAAGGHPG
FT                   GSFQFADVGASPAWRNLRLPLSAIPAAATQVRLVADDEDLAPQHWIALTPPRIPQLRTL
FT                   QDVVGSKDPVFLDWLVGLAFPCQRPFGHQNGVDETPKWRILPDRFGAEANSPVMDNNGG
FT                   GPLGVTELLAKATTMATYLKDDWSRDWGSLQRLTPYYPDARPAQLLLGTATRSGLWNPA
FT                   PLRH"
FT   gene            complement(234314..236362)
FT                   /locus_tag="MAV_0230"
FT   CDS_pept        complement(234314..236362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66246"
FT                   /db_xref="GOA:A0A0H2ZX57"
FT                   /db_xref="InterPro:IPR020959"
FT                   /db_xref="InterPro:IPR020963"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZX57"
FT                   /protein_id="ABK66246.1"
FT                   /translation="MRSALATLGQMAVAVLVAVVVAVVSLTAIAGVQWPAFPSSNQLHA
FT                   LTTVGQVGCLAGLVAVGWVWHSFTGRVRRLAQLGGLVFVSAFTVVTLGMPLGATKLYLF
FT                   GISVDQQFRTEYLTRLADSPALRDMTYLGLPPFYPPGWFWIGGRAAALSGTPAWEVFKP
FT                   WAITSITVAVAVALVLWWRMVRFEYALIVTTATAAVTLAYGSPEPYSAMITVLLPPMLV
FT                   LTWSGLRAGECRAGGMPETAERAAGGAPETAERETNFTVGAERETNFTLAAGEAPSAPR
FT                   ETPSAPGETPRSGWAAVVGAGLFLGFTATWYTLLFGFTAFAVGLMALWLAGLRWRRHGV
FT                   RAALEPLRRLAVIVGIAVAIGCTTWLPFLVRAARNPVSNTGSAQHYLPADGAELTFPML
FT                   QFTLLGVVCMAGTLWLVLRARASVRAGALAIGVLAVYLWSLLSMLTTLARTTLLSFRLQ
FT                   PTLSVLLVAAGAFGLVEAALALRRRSRAVIPVAGAIGLAAAIAFSQDIPDVLRPDLTIA
FT                   YTDTDGHGQRGDRRPPSAEKFYASIDDVITRETGRPRDQTVVMTADYSFLSFYPYWGFQ
FT                   GLTSHYANPLAQFDLRAAQIDKWSKLKTADELLHALDTCPWPPPTVFLMRHGANNTYTL
FT                   RLAEDVYPNQPNVRRYTVELRAALFDSPRFAVHRVGPFVLAVRKPAA"
FT   gene            complement(236365..237129)
FT                   /locus_tag="MAV_0231"
FT   CDS_pept        complement(236365..237129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0231"
FT                   /product="putative oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66958"
FT                   /db_xref="GOA:A0A0H2ZY65"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZY65"
FT                   /protein_id="ABK66958.1"
FT                   /translation="MVLDAVGNPQTILLLGGTSEIGLAICERYLQNAHARIILAAMPGD
FT                   PGRDAAVEQMKAAGARSVEVIDFEATDTDTHPKMIEQAFAGGDVDVAIVAFGILGDAEE
FT                   LWQDQRKAVQAAEINYTAAVSVGVLLAEKMRGQGFGQIIAMSSAAGERVRRSNFVYGST
FT                   KAGLDGFYLGLGEALREYGVRVLVIRPGQVRTRMSAHVKEAPLTVDKEYVANLAVTAAA
FT                   KGKELVWAPAAFRYVMMVLRHIPRPIFRKLPI"
FT   gene            complement(237130..238530)
FT                   /locus_tag="MAV_0232"
FT   CDS_pept        complement(237130..238530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0232"
FT                   /product="oxidoreductase, FAD-binding"
FT                   /note="identified by match to protein family HMM PF01565"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67634"
FT                   /db_xref="GOA:A0A0H2ZZT4"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZT4"
FT                   /protein_id="ABK67634.1"
FT                   /translation="MSSTDPLITPARLTGFGRTAPSVAQVLRTRDPEVIAKAVARVADS
FT                   GHSKSRGVIARGLGRSYGDNAQNGGGLVIDMTGLNRIHSISADTRLVDVDAGVSLDQLM
FT                   KAALPFGLWVPVLPGTRQVTVGGAIACDIHGKNHHSAGSFGNHVRSMELLMADGTVRTI
FT                   TPDGPDASDAELFWATVGGNGLTGIVLRATIAMTPTETAYFIADGMATKDLDETVAVHL
FT                   DGSEADYTYSSAWFDLISPPPKLGRAAVSRGSLARLDQLPKKLAKNPLKFDAPQLLTVP
FT                   DVFPVSAMNKLSFMAIGEVYYRLGGTYTGKIMNLSQFYHMLDLVSGWNNAYGPRGFAQH
FT                   QFLVPPDAMDEFKAIIRWIQTRGHYSALNVFKLFGPGNRAPLSFPMAGWNVAMDFPNKP
FT                   GVNEFLNELDRRVLQFGGRVYTAKDSRTNAETFHAMYPRIDEWIAVRRKVDPTGVFASD
FT                   MARRLELL"
FT   gene            complement(238563..238967)
FT                   /locus_tag="MAV_0233"
FT   CDS_pept        complement(238563..238967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0233"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF04138"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68241"
FT                   /db_xref="GOA:A0A0H3A0V2"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0V2"
FT                   /protein_id="ABK68241.1"
FT                   /translation="MVASPNLKLTTQVMRFVVTGGLAGIVDFGLYATLYKVVGVQVDVA
FT                   KAISFIVGTITAYLINRRWTFQAAPSTARFVAVMALYAVTFAVQVGLNHLCLAFLHYRG
FT                   WAIPVAFVIAQGTATVINFVVQRAVIFRIR"
FT   gene            complement(238978..239454)
FT                   /locus_tag="MAV_0234"
FT   CDS_pept        complement(238978..239454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0234"
FT                   /product="nucleoside diphosphate kinase regulator"
FT                   /note="identified by match to protein family HMM PF01272"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69153"
FT                   /db_xref="GOA:A0A0H3A3M8"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3M8"
FT                   /protein_id="ABK69153.1"
FT                   /translation="MTNKRQSPADAARKNLEAELDRLRQRRDRLEVEVKNDRGMVGDHG
FT                   DAAEAIQRADELVVLSDRINELDRRLRAGPPDADTSATLPGGTEVTLRFADGEVVTMHV
FT                   ISIVEETPVGREGETLTARSPLAQALAGRQPGDTVTYPTPQGEKQVELIAVKLP"
FT   gene            complement(239896..240783)
FT                   /locus_tag="MAV_0235"
FT   CDS_pept        complement(239896..240783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0235"
FT                   /product="taurine catabolism dioxygenase TauD/TfdA"
FT                   /note="identified by match to protein family HMM PF02668"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68373"
FT                   /db_xref="GOA:A0A0H3A1J3"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1J3"
FT                   /protein_id="ABK68373.1"
FT                   /translation="MEIVASGPGFAAELRGVTIADVAASPDVYAQVRAAFEEHSVLVFR
FT                   DQHVSDEAQLAFSRRFGPLGVTKVGAVGHGSHLVVLKTLDDDGNVVPADHRLALENKAN
FT                   QLWHTDSSFKRVPALASVLSSRIVPGRGGETEYVSTRIAFERLDPGLRERVENSFAWHE
FT                   YAYSRGKIAPDLARPEERAALPPQCWRLVWRNPVNGRKALYLASHAYGIEGMEPAAARE
FT                   LLAALTEAATAPGASYLHSWRAGDVVMWDNRATMHRGRPWPAHQPRCMVRSTIAATAAD
FT                   GLEAMYPPWHAVAR"
FT   gene            complement(240808..241638)
FT                   /locus_tag="MAV_0236"
FT   CDS_pept        complement(240808..241638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0236"
FT                   /product="O-antigen export system, permease protein"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69161"
FT                   /db_xref="GOA:A0A0H3A3C3"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3C3"
FT                   /protein_id="ABK69161.1"
FT                   /translation="MTFLDAAAQSRTLRRARSDLVDGFRRHELWLHLGWQDIKQRYRRS
FT                   VLGPFWITIATGTTAVAMGGLYSKLFHLELSVHLPYVTLGLIIWNLINAAILEGADVFV
FT                   ANEGLIKQLPTPLSVHVYRLVWRQMILFAHNIVIYVVIAMIYPKPWSWADLSVIPALAL
FT                   IVLNCIWVSLCFGILATRYRDIGPLLFSVVQLLFFMTPIIWNDDTLRQQGAGRWSSIVE
FT                   LNPLLHYLDIVRAPLLGSHQELRHWAVVLVLTAVGWLLAAFAMRQYRARVPYWV"
FT   gene            complement(241635..242549)
FT                   /locus_tag="MAV_0237"
FT   CDS_pept        complement(241635..242549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0237"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68441"
FT                   /db_xref="GOA:A0A0H3A1Q2"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1Q2"
FT                   /protein_id="ABK68441.1"
FT                   /translation="MNDTVFAVVVTHRRPDELAKSLDALSSQTRLPDHLIVIDNDACDD
FT                   GRVRELVAAQPIPTTYLQSRRNLGGAGGFALGMLHALAQGADWVWLADDDGRPQDARVL
FT                   ATLLACADKHGLAEVSPMVCNLDDPERLAFPLRRGLVWRRRASELRTEAGQDLLAGIAS
FT                   LFNGALFRASALESIGVPDLRLFIRGDEVEMHRRLVRSGLPFGTCLDAVYLHPCGSDEF
FT                   RPILGGRMHTQYPDDATKRFFTYRNRGYLLSQPGLRKLLVQEWVRFGWFFLVTRRDPRG
FT                   LAEWIRLRRLGRRELFGKPGGSR"
FT   gene            complement(242546..243307)
FT                   /locus_tag="MAV_0238"
FT   CDS_pept        complement(242546..243307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0238"
FT                   /product="O-antigen export system ATP-binding protein RfbB"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65477"
FT                   /db_xref="GOA:A0A0H2ZUJ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUJ5"
FT                   /protein_id="ABK65477.1"
FT                   /translation="MEFPIFDAKSRSLKKAFLGKAGGTIGRNNSNVVVVEALRDITMSL
FT                   ELGDRVGLVGHNGAGKSTLLRLLSGIYEPTRGWAQVTGRVAPIFDLGVGMDPEISGYEN
FT                   IIIRGLFLGQTRKQMLAKVDEIAEFTELGDYLSMPLRTYSTGMRVRLAMGVVTSIDPEI
FT                   LLLDEGLGAVDADFMKKAQSRLQGLVERSGILVFASHSNEFLARLCKTAMWIDHGEIRM
FT                   SGGIEDVVRAYEGEDAARHVREVLAETAEQP"
FT   gene            complement(243368..243877)
FT                   /locus_tag="MAV_0239"
FT   CDS_pept        complement(243368..243877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64794"
FT                   /db_xref="GOA:A0A0H2ZR96"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZR96"
FT                   /protein_id="ABK64794.1"
FT                   /translation="MSTRNDDDGVEVIGGVDPRMMGVDDDDADERSLTDLVEQPAKVMR
FT                   IGTMIKQLLEEVRAAPLDDASRNRLREIHATSIRELEEGLAPELREELDRLTLPFNEDA
FT                   APSDAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEKMRQGALPSGIGKPGSAP
FT                   GHGQYL"
FT   gene            complement(243899..245841)
FT                   /pseudo
FT                   /locus_tag="MAV_0240"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which is not the result of sequencing error"
FT   gene            245990..247186
FT                   /locus_tag="MAV_0241"
FT   CDS_pept        245990..247186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0241"
FT                   /product="cysteine desulfurase family protein"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM TIGR01976"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68213"
FT                   /db_xref="GOA:A0A0H3A293"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR011340"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A293"
FT                   /protein_id="ABK68213.1"
FT                   /translation="MAYDVARVRGLHPSLGDGWVHFDAPAGMLIPDSVATTVSTAFRRS
FT                   GPTTVGAHPSAQRSAAILEAARAAVADLFNAEPAGVVLGADRAILLSALAEASSSRAGL
FT                   GYEVIVSRLDDEANIAPWLRAAHRYGAKVKWAEIDIETGELPTWQWEGLIGKSTRLVAV
FT                   ASASATLGTVTDLRAMTKLVHDVGGLVVVDHSAAAPYRLLDVKETDADVVAVNAAAWGG
FT                   PPIGAMVFRDPALLNSFSSISADPKATGAARLEIGAHQFGLLAGVVASIEYLASLDESA
FT                   RGTRRERLAVSMQSATSYLNRIYDYLMVSLRSLPLVMVIGRPEVRIPVVSFALHGVPAE
FT                   RVVQRLADNGILAVTNESSRALDVLGVNDVGGAVTVGLAHYSTTAEVDQLVRALASLG"
FT   gene            complement(247191..248171)
FT                   /locus_tag="MAV_0242"
FT   CDS_pept        complement(247191..248171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0242"
FT                   /product="quinone oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM TIGR02824"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67320"
FT                   /db_xref="GOA:A0A0H2ZY41"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZY41"
FT                   /protein_id="ABK67320.1"
FT                   /translation="MATMRAIVAESADQLSWQEVADVSAGPGEVVVKVAAAGVNRADVL
FT                   QAAGKYPPPPGASETIGMEVSGVIAEVGDGVTEWSVGQEVCALLAGGGYAEYVAVPAGQ
FT                   LLPIPAGVDLVDAAGLPEVACTVWSNLVLIAGLRNGQLLLVHGGASGIGSHAIQVARAL
FT                   GARVAVTAGSAEKLGFCRELGADITINYRDEDFVARLADETGGADVILDIMGAAYLDRN
FT                   IDALATDGQLVIIGMQGGVKAELNIGKLLAKRARVIGTTLRGRPVSGPNSKTEIVQAVT
FT                   ASVWPMIADGRVRPIIGARLPIQQAGDAHRRLVASEVTGKIVLTV"
FT   gene            248200..248289
FT                   /locus_tag="MAV_0243"
FT   tRNA            248200..248289
FT                   /locus_tag="MAV_0243"
FT                   /product="tRNA-Ser"
FT   gene            complement(248295..249413)
FT                   /locus_tag="MAV_0244"
FT   CDS_pept        complement(248295..249413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0244"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67685"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR040701"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0Z6"
FT                   /protein_id="ABK67685.1"
FT                   /translation="MDSQRFRKLLDAPGPFVSVYFDDSHDTHDAEAQLELKWRAIREDL
FT                   ERRGVGAPIVAGIEDAVMNLRPPIGRSGRAVIAGADGVLINEHLARPAATTILRVSELP
FT                   YLVPILEQSFDHPDYVLVVVDHSGADITTHIGGTLRSETVDGAGYPVHKAAGAETAGYG
FT                   DPQLRTEEAARKNVRAAADRVAELADDKAIDVIFVVGEVRSRSDLLAALPERLHDRAVT
FT                   LEVGARHSGHDFTEIERAIEAEFVKRQLRAIDDAAQRFTAEIGRQSGLAAQGLDAVCSA
FT                   LRQGAVETLIIGDIGDATVVADEGLTTVAPNENVLSEQGAAPARTLRADEALPFSAIKV
FT                   GANLVRTDERIAPADGVGAVLRYAPTLHQSVE"
FT   gene            complement(249454..249645)
FT                   /locus_tag="MAV_0245"
FT   CDS_pept        complement(249454..249645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67147"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZM7"
FT                   /protein_id="ABK67147.1"
FT                   /translation="MATYRVLNPKGDVVATKDIESADKAHAWFADQKVEGNELGWRMEV
FT                   EHDGQWHFFDDSEGDRSY"
FT   gene            complement(249674..250918)
FT                   /locus_tag="MAV_0246"
FT   CDS_pept        complement(249674..250918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0246"
FT                   /product="beta-lactamase"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69115"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A5A8"
FT                   /protein_id="ABK69115.1"
FT                   /translation="MTTPTLDGKIRLPADLDAVTTIGAEDHSEIDAAAVDRIWAAGRHW
FT                   YQGGFHPAIQLCIRRHGRVVLNRAIGHGWGNAPTDPPDAEKIPVTPDTPFCVYSAAKGI
FT                   AATVVHMLVERGVFSLDDRVCDYIPTFTSHGKHRITIRHVMTHSAGLPFPTGPRPDVTR
FT                   ADDHEYAQQKLGELRPLYRPGLFHMYHALTWGPLVREIVYAATGKEIREILATEILDPL
FT                   GFRWTNFGVAKQDVPLVAPSHATGRTLPPVVAQIFRKAIGGTVHEMIPYTNSPMFLTTI
FT                   IPSSNTVSTAHEMSRFAEIWRRGGELDGVRVISPETMYHAVAECRRLRPDFAVGLQPAR
FT                   WGTGFILGTNRWGPFGRNAPHAFGSLGLTNIAIWADPARGLAAGVISSGKPGRDPEARR
FT                   YTALMDTITAAIPRD"
FT   gene            complement(250938..251762)
FT                   /locus_tag="MAV_0247"
FT   CDS_pept        complement(250938..251762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0247"
FT                   /product="enoyl-CoA hydratase"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68522"
FT                   /db_xref="GOA:A0A0H3A3H3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3H3"
FT                   /protein_id="ABK68522.1"
FT                   /translation="MAQAYESVTVEKKGHVAQVTLIGPGKGNAMGPAFWSELPELFETL
FT                   DADPEVRAIVLTGSGKNFSYGLDVPAMGGSFTPLLSGDALAGPRAVFHREVKRMQGAIT
FT                   AVADCRTPTIASVHGWCIGGGVDLISAVDIRYASADAKFSVREVKLAIVADVGSLARLP
FT                   YILNDGHLRELALTGKDIDAARAEKIGLVNDVYADADACLAAAHATAAEIAANPPLTVH
FT                   GIKDVLDQQRASAVAESLRYVAAWNAAFLPSKDLTEGIAATFEKRPAQFTGE"
FT   gene            251777..252373
FT                   /locus_tag="MAV_0248"
FT   CDS_pept        251777..252373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR03083;
FT                   match to protein family HMM TIGR03086"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64834"
FT                   /db_xref="GOA:A0A0H2ZSQ5"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017520"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSQ5"
FT                   /protein_id="ABK64834.1"
FT                   /translation="MANMAPDLRPGPDSPPTDELDGAEAALRVMQQVLHPIAADDMPRP
FT                   TPCAQFDVTRLTDHLLKSLEALGGMAGADFPDHADSADSVERRVIAVARPALDAWRQRG
FT                   LDGTVSFGGGEMPARNACAILALELLVHAWDYARAVGRDARAPEPLAEYVLGLAHRVIR
FT                   PEVRGQAGFDDPVEVPADADALTKLVAFTGRNPAR"
FT   gene            complement(252454..252915)
FT                   /locus_tag="MAV_0249"
FT   CDS_pept        complement(252454..252915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66533"
FT                   /db_xref="InterPro:IPR025568"
FT                   /db_xref="InterPro:IPR025951"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZY15"
FT                   /protein_id="ABK66533.1"
FT                   /translation="MDLARKKFTEFKERSGDIPDSELDDFWAELAPATIEEMLGEWKGG
FT                   EFRTGHKMNGQLEKAGWFGKTFKSARDVQPLVCLDADGNKFSNVELGKGEASLWLEEFR
FT                   GEVTATMVYDGQPVHDHFKKIDDNAVMGIMNGKGVRDNGKYYYFYLERV"
FT   gene            complement(252926..253993)
FT                   /gene="hisC"
FT                   /locus_tag="MAV_0250"
FT   CDS_pept        complement(252926..253993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="MAV_0250"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /EC_number="2.6.1.9"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM TIGR01141"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66277"
FT                   /db_xref="GOA:A0Q9F3"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0Q9F3"
FT                   /protein_id="ABK66277.1"
FT                   /translation="MTARLRPELAGLPVYVPGKNVPGSIKLASNETVYGPLPSVHAAIE
FT                   RAVAIVNRYPDNACVDLKAALAMHLGSDVAPEQIAVGSGSVTLCQQLVQITSAAGDEVM
FT                   MGWRSFECYLPIVQVAGAIAVKVPLREHTYDLDAMLAAITDRTRLIFVCNPNNPTSTVV
FT                   DPDALVRFVDAVPADILIAIDEAYVEYIRDGLLPNSLELALSRSNVVVLRTFSKAYGLA
FT                   GLRVGYAIGHPELITALDKVVMPFAVTNVAQAAAIASLEASGELMARTDALVAERTRVS
FT                   TTLRDAGFELPPSQANFLWLPLGSRTEDFVQEAANARLVVRPFASEGVRVTIGAPAEND
FT                   ALLQFACDWIARTER"
FT   gene            254077..254165
FT                   /locus_tag="MAV_0251"
FT   tRNA            254077..254165
FT                   /locus_tag="MAV_0251"
FT                   /product="tRNA-Ser"
FT   gene            254201..254276
FT                   /locus_tag="MAV_0252"
FT   tRNA            254201..254276
FT                   /locus_tag="MAV_0252"
FT                   /product="tRNA-Arg"
FT   gene            complement(254394..255593)
FT                   /locus_tag="MAV_0253"
FT   CDS_pept        complement(254394..255593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0253"
FT                   /product="site-specific recombinase, phage integrase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65789"
FT                   /db_xref="GOA:A0A0H2ZVS2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVS2"
FT                   /protein_id="ABK65789.1"
FT                   /translation="MAKIPDYVKALDLDSGRRYEVRPEVTGPDGKRKQQRKRFKTLKEA
FT                   TDFYTRIAGDRSRGVHVAPSELTVEAAVDAWLAAQRVRTKAMTGYVTALRPLVDHLGGK
FT                   AVQAVTKADIEKVVAALRGGTSKMGTWNAPEKIKGKQVRAKWGPSGTNHFIRRSRAVFE
FT                   DLVQQGVLGRNPAALVQPVPMARAELNTLTAAQAERLLAATRNDVFAAAWRLALMGLRR
FT                   GEILGLSWDSVDLDAGLLTVRANRAPVPGGVEVGSPKTAAGLRTLPMPAELTVAMKQAR
FT                   KQQRERRLALGSKWVESGLVVVGEDGAPPHPDTLSHVWAETIAAHKLPAVRLHDARHTC
FT                   ATLMHQDGVPLAVISAWLGHTNAAFTLATYGHSSDDSLAAAAQRLDALTGGKATPAEAK
FT                   "
FT   gene            255751..256011
FT                   /locus_tag="MAV_0254"
FT   CDS_pept        255751..256011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0254"
FT                   /product="DNA binding domain, excisionase family protein"
FT                   /note="identified by match to protein family HMM TIGR01764"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68328"
FT                   /db_xref="GOA:A0A0H3A145"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A145"
FT                   /protein_id="ABK68328.1"
FT                   /translation="MNESTTPDIAAAVAALLAAVGQTQAPAPTAPVTMLTVSETAELLR
FT                   CSESLIYAQLRDGRLRGVKVGRRRLIPMREIDRLIAGDAAA"
FT   gene            complement(256081..256689)
FT                   /locus_tag="MAV_0255"
FT   CDS_pept        complement(256081..256689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0255"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2S5"
FT                   /protein_id="ABK68908.1"
FT                   /translation="MNENAYRHAAYAIARDSDAPAAVTAYAGAVAAAMHRAQLEGTTLA
FT                   CQLITELSSDPVTHAAAVSIGPFGVLTLSDWLQEVWGDVTEIAALTEVPELIESEVLYR
FT                   RATVELFAETDASASTATLAFAGALAVANVRWLATGSDPAASGFVSSVLDADPVAAAAR
FT                   EELDESTRASIAISVGNRWTEIMERVQVMEMVAAIETAA"
FT   gene            complement(256769..256915)
FT                   /locus_tag="MAV_0256"
FT   CDS_pept        complement(256769..256915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0256"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69314"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A4L4"
FT                   /protein_id="ABK69314.1"
FT                   /translation="MTDPNENHDENLQRIWTPDPNAPRVPPGDPFGVYAGKTDGNPETD
FT                   ADI"
FT   gene            complement(256997..257146)
FT                   /locus_tag="MAV_0257"
FT   CDS_pept        complement(256997..257146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0257"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67934"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYX1"
FT                   /protein_id="ABK67934.1"
FT                   /translation="MTDPDAENPYVPDEPGTVDLIVRIAQVLAGDWMPDLGTALEADRT
FT                   SEAH"
FT   gene            complement(257171..257470)
FT                   /locus_tag="MAV_0258"
FT   CDS_pept        complement(257171..257470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0258"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66049"
FT                   /db_xref="GOA:A0A0H2ZUC1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUC1"
FT                   /protein_id="ABK66049.1"
FT                   /translation="MNIKRILADPITHFALLVIGAVVATALVTYNFFPRHEEGVAPPAS
FT                   VYQASVDGVCSTVVHGFNSDEVWAGPLHGGELRRVDPRAVGVTGCRTDPDPSRR"
FT   gene            complement(257485..258138)
FT                   /locus_tag="MAV_0259"
FT   CDS_pept        complement(257485..258138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0259"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66768"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXQ1"
FT                   /protein_id="ABK66768.1"
FT                   /translation="MKKYIAPVGVAALAAATMLTGCTSAGPASAPSTSTSTPVTSAVDE
FT                   VIRHVVGLGATGLDATTARGALESGRPVLVGLPQGPVVACHTALLVPGDPRPWFLNRDA
FT                   VPVTGTAFETDFAQVGCSGRSVPASTTAPAPAAGMDTAAAEAAAAQGRPFIYAIPDGTN
FT                   PTCNVAVIVGDEEWFLNRSGGPRAAGDALARIHDGYGCTAGEVVPGVPTTPTGN"
FT   gene            complement(258151..258717)
FT                   /locus_tag="MAV_0260"
FT   CDS_pept        complement(258151..258717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0260"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65149"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTL2"
FT                   /protein_id="ABK65149.1"
FT                   /translation="MNKQKYSFPVAALAAVMTLAACGTPTEPASAPSSVSASPFGAREV
FT                   KRAEAQVGERELALHGVLSIPSTVDRIAAEAAASKALPYAFTYRTGCTWLRTWDAKLWS
FT                   LHSGGGVLARGVDDERWFRSNPGAASDSICRETGSVPTADDASVSTPYRWRDGNRDLVR
FT                   VQGVVFELPRDIPEPGVALRPAKQN"
FT   gene            complement(258789..259973)
FT                   /locus_tag="MAV_0261"
FT   CDS_pept        complement(258789..259973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0261"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65284"
FT                   /db_xref="GOA:A0A0H2ZTZ7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTZ7"
FT                   /protein_id="ABK65284.1"
FT                   /translation="MCFQTRDLHVYPGFEGADESKPNPGSATSRATSTATTPATSTVAV
FT                   DQPEWSAGAASVAVDQPVRPVPPFPQVKAYDEEKYMNSDRKAFTRLLLGCTTVSLAGNV
FT                   AYAVERGAVTPVSIALAAVAPILLPVGVHFIPKAARVRRGARFVVTVAVIVAAVAAFVL
FT                   SFEALSGLMRMRGHDGWTAYLLPVAIDVLAAAAAYALVVEPDAVREEAPVTQRVEAPAM
FT                   RDAEPAPTATQTPSVRDAELATHTDATPEEPATQPDALRDADTEEIPVTCSDSRDAAAK
FT                   QGTESSTTRRLAAVPTPRPAATQTAASPATQTATNRDADDDAQLLRRATQLVEAGRTKA
FT                   PVDAAHRVLRGKSAGETNRDLASETGLTESAVQRIWTAARELDATAEEPEPAFA"
FT   gene            complement(260039..260374)
FT                   /locus_tag="MAV_0262"
FT   CDS_pept        complement(260039..260374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0262"
FT                   /product="putative chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66391"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZX72"
FT                   /protein_id="ABK66391.1"
FT                   /translation="MTRFVTHDPTAAAAATDALCEAAKSLAATITVASTKLNPHPEDPF
FT                   TADDALAGLERWVRGEKARRRRVGHMLLLLVETGVSERALADRLGLGRHAVSQMVADAR
FT                   VEREAGA"
FT   gene            complement(260406..261287)
FT                   /locus_tag="MAV_0263"
FT   CDS_pept        complement(260406..261287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0263"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3E5"
FT                   /protein_id="ABK68737.1"
FT                   /translation="MTTQTDCIITAADAVVHAHADALAPLTAIGRGTVEDPPTVEASLA
FT                   AALHLIAAKPALDAAVTDLLRELIDAGVRESKLARLLSIRSSTLTDRLAASAPTAVPVP
FT                   ELHYGMFRRKDKVSRRAARESMIAAARDLGRTYAAALRPISTVSQGSVPEAAVVDEALE
FT                   AVLHLHRSRSALDAALDPILAALVLGGVRRMSLAEGLGVHATTLQRRLAGQPLAHARHA
FT                   DLRDEGEGKWSVIRAEVGRYAPAQELDKAVVQAAVNEAITGIQETAPTRGAREDSVTVP
FT                   QSPSQFSDGLAR"
FT   gene            complement(261316..263352)
FT                   /locus_tag="MAV_0264"
FT   CDS_pept        complement(261316..263352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0264"
FT                   /product="ftsk/spoiiie family protein, putative"
FT                   /note="identified by match to protein family HMM PF01580"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65451"
FT                   /db_xref="GOA:A0A0H2ZUM7"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUM7"
FT                   /protein_id="ABK65451.1"
FT                   /translation="MADIDELLGTGTGGVASSTRPAPDPAQETKPKREKKSPSGPHVVD
FT                   EAPTGPTAAEAKAAQTAAITAAVDELAALWKEIEAGATCPSPQRIEDTAAEESPNRVAR
FT                   IWQQRLVDEAKRRELFGCNAAVQVRATGTGVTIRAEIRPDMDAAESIARFQQAALAMGS
FT                   GHYAGWLEAGTRGPHGGQVIMLNRAVVGTDPATAFRAVNHRVYQVYADESERRESLWFN
FT                   AGLAVRKIDKRYSQKPRAVYRYEFPTIIECLAESDSRRGPAFVIELHREQGVEDFEAAL
FT                   PKLRALLRCDLNLVPREEGLVELQLLQRKQTSWPKETPLSPTQLWRPRNRAESLVAARD
FT                   GVLIPFGVDRSGSPLMLDMRKRPHFLITGTSGAGKSTALRLILRALQMQLGRGGTIVLG
FT                   DGKAADMIPVYAANVGQNLSLENASIHRAIAYAYDELGRRKKMYKRLIARELPEIFPLL
FT                   ILCIDELGAWAGQGLAKGSPKRDAVGVEAAMAKLRYVLRQGRSYGVHVIISTQDVTIES
FT                   GINTALLSVVSTRVVVGRPEEGSGSAMDKLFTNAERPRVAAAAKEIPPGSRGIGVMVDE
FT                   AGVPTLFKAFYNDGEAARVFDAATAAAGRARRFAWKFPDDDGAWLARTCAEFEGLEPVD
FT                   SIPTIPLEDERGRYIEQNARYDEGNVAEHAPGTPADNTAHETY"
FT   gene            complement(263356..264168)
FT                   /locus_tag="MAV_0265"
FT   CDS_pept        complement(263356..264168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0265"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68059"
FT                   /db_xref="GOA:A0A0H3A0R0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0R0"
FT                   /protein_id="ABK68059.1"
FT                   /translation="MTLAVATLNTPVAAAEPVVRCRTLAGGGDYVCVTETPTAPATTGS
FT                   TGTSSGSNGLGDWFSEHAGTVMFVIAVAAVIAIAAMVKSGTSKDKAAEAAAVHARGRQI
FT                   ALDASVEPAAQSPEDLKRFGAFGWAVPWIPGTAFGNLVTRDGSTDRVNAAWAQAAEIAR
FT                   LGHVDVQGSFAPAATVVNVNGYADGTGDLELSVNTADYTVGEAQLNRVLAHLVRTARVE
FT                   TATGFTRDAVRDWHVTRLSMIPAAVQQYAAASEQEQTVAPDPTVNWEW"
FT   gene            264511..264810
FT                   /locus_tag="MAV_0266"
FT   CDS_pept        264511..264810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0266"
FT                   /product="DNA binding domain, excisionase family protein"
FT                   /note="identified by match to protein family HMM TIGR01764"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67363"
FT                   /db_xref="GOA:A0A0H2ZY87"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZY87"
FT                   /protein_id="ABK67363.1"
FT                   /translation="MGYKEAAEIAGVSIRKMRYLVESGEILARRCGSRVLIAERDLEAW
FT                   LDSLPLVVDTGAEAEADTETATYDEGEGVPSRARREGAARVRAASVPDVHEAAA"
FT   gene            264807..265031
FT                   /locus_tag="MAV_0267"
FT   CDS_pept        264807..265031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0267"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW02"
FT                   /protein_id="ABK66008.1"
FT                   /translation="MSTESIRAAAGAAFRAAHPDDRHGATIAGCRAAARVADPDHALPF
FT                   TVGSLAAEETTRAREIDSWLDRNWSDIAP"
FT   gene            265325..268261
FT                   /locus_tag="MAV_0268"
FT   CDS_pept        265325..268261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0268"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67770"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A180"
FT                   /protein_id="ABK67770.1"
FT                   /translation="MSEVPFTPAEHKAIDAKLADRKPNNSAWAAGLADAFHVLPLERAR
FT                   KRPVNRGWPTAPALTEAALAWHLDQGGNIGALLGASGERGLIAWDADNAAGAEAIEAAG
FT                   YTPFAIPANALNPNHSKGRYGGRHFLWSVPAEWAVPGMELTSPRATVTLAGGGTVDVLA
FT                   GPKFLVLPPSYLCEEGHLNPYNPGAGWTPSPPPLPVQFWPDWVRPEGTPDPPAELAALR
FT                   VDIRKRTAFERAEDRMLSAGSRALTELIDAVPMATWLAMDDQRYIEVLDTAGSCGCPKG
FT                   RFSLQSSATGMELHDGCAYGRGVHVYSGTLAAHLAGNGETRDHMSWPDFIAGLYGRSFR
FT                   DVVRDAGIELRAERQELDHVTAEQLDQAAGEAEARGDTARAEELRVAAAKQRAAVMAYA
FT                   EQHGEVFLTEAAVGGVPAAPIPAVGVAPQLTLIAGGAPLQSAPAIGTLGVAVDGSLALK
FT                   PEPAPVETVAAEPAAAPVVEPATEPGMAPAATEPAAQPAAEPVAADDPAGRTQAVKDRA
FT                   REALHHSVEPELLERLFCTKELQRVRKRAEEGLAPPVLALTADLAGVLSLVPPTTRIPP
FT                   IVMNRQSGFNAIYSSVAESGGGKSGTASVSFNPVAGAVGLPKPFVPPCMPLGSGPAMAE
FT                   LFVTMEKDKETKERYPVVHNDSARVYWPEISRMDATKTQSGSTLSSEMCQAFSSEELGS
FT                   LTKTNCAYAMPHTYRLIMAMGSQLATAGAALDPLSALMGLSQRVWWVCGETFDVPVEGT
FT                   PEFEAWAERIPDSMKGDDDGLVDLPIPAFPAGNVPVDREVRIEVRKIRMRLQAAKRDPE
FT                   TALETHTALIRLRWAFAAAVYHGEAPAITKKWWDWTAIFEEHHRRVRRACQIAQPLLRT
FT                   GEAVQAGILDDIRSSTREAAQHRDAKQNLLRWARAQHVAGKQFTAAQGANSGKAGSYRR
FT                   QHGAQLVQELVEDGLLGVQLVHVAQVGGELAYHGPTQLGLDVDLDAVQ"
FT   gene            268746..269240
FT                   /locus_tag="MAV_0269"
FT   CDS_pept        268746..269240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0269"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVM1"
FT                   /protein_id="ABK66426.1"
FT                   /translation="MTLDELRTLVADSTASDWHRILKIGPTYRDRFGSWSSPADGTSGI
FT                   DHDSHVELAVYRPDIDLTIAYGMAENQHDRDLSFEWSENFPDSKIREISLVDFFWRGSL
FT                   VDRLNYVHVDGARGILPLGGGHQGLRITQYELTVARLLSDIGDYREFDRYYSSVPFELQ
FT                   D"
FT   gene            269297..269698
FT                   /locus_tag="MAV_0270"
FT   CDS_pept        269297..269698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0270"
FT                   /product="acetyltransferase, gnat family protein"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65812"
FT                   /db_xref="GOA:A0A0H2ZVU4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVU4"
FT                   /protein_id="ABK65812.1"
FT                   /translation="MPPFDFDTAYENEQWWDDVPYLFDAPWYVQVLDGGAEVARVELDD
FT                   PGGINPEYADVPELGPERLEIQFLEVATAERGRGVGTRVVRALQERHPDRRLFAYSEEA
FT                   HGFWTSLGWERFDHPEGEQFYRPLFIQRG"
FT   gene            269790..270074
FT                   /locus_tag="MAV_0271"
FT   CDS_pept        269790..270074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0271"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65240"
FT                   /db_xref="GOA:A0A0H2ZS88"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZS88"
FT                   /protein_id="ABK65240.1"
FT                   /translation="MGDDDQQWVPKRVSAADAAAGAVLRRVRERAGLTLDQAAEASRIS
FT                   KAVLSRTERGERPARVTELLPLAAAYDMTAAELAAAIAADPAVQAAAMQ"
FT   gene            complement(270077..270274)
FT                   /locus_tag="MAV_0272"
FT   CDS_pept        complement(270077..270274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0272"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65285"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUC6"
FT                   /protein_id="ABK65285.1"
FT                   /translation="MEPADDRLLTIPEAIQALRISRTHFFRLKRRGEIVGMRLGHRILI
FT                   PAREITRLINENYHPPSSGG"
FT   gene            complement(270362..270778)
FT                   /locus_tag="MAV_0273"
FT   CDS_pept        complement(270362..270778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0273"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66278"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWS7"
FT                   /protein_id="ABK66278.1"
FT                   /translation="MARRADSDEHYVLDLCDELLGVPGIRQARFDWLRGDPSPTRPRGV
FT                   TLPVDGYWPDLRLVVEFQEEQHSQPSPFFDRRQTVSGMGRGEQRRRYDERKRTLIPEHG
FT                   LRLVVIEKSVFTLKSRRIDRDRTRDLEVVRRHLA"
FT   gene            complement(270792..273383)
FT                   /locus_tag="MAV_0274"
FT   CDS_pept        complement(270792..273383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0274"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69202"
FT                   /db_xref="GOA:A0A0H3A2C4"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2C4"
FT                   /protein_id="ABK69202.1"
FT                   /translation="MEYTLKDYQVGAVAGVLDNLTQARTLYKQFGSKSRFALSAVTGAG
FT                   KTVMAAAVIEALFFGSDEFDFAADPGAVVLWFSDDPSLNEQSRRRIQAAGGEQLDSRLR
FT                   IIESTFNEPKLRPGNVYFLNAQKLSKGARLVRGDRNGDTDEMALVPRPDEVQSNIYDVI
FT                   AETIADERLTLYFVQDEAHRGWNNSAGDRTTIVQRLVNGHGTTPPMPIVWGISATTQNF
FT                   EDAFKDAPHGRVALPAVEVDSALVQASGLLKDDIVLSIPSESGTFDTVLLKRAVRKVIA
FT                   STKAWAQYAKEQGETDPVVPLLVVQVRDGDTAATQTAVARAVEAVFEEWTDLPTQSFAN
FT                   VFGEHQDLSVNQVPVPYVAPETVQEETWIRVLFAKTAISTGWDCPRAEVLVSFRPAVDP
FT                   THITQLLGRMVRTPLARRIPGNQVLNSVECLLPFFDRKTATAVAEELMRGATGGGDGDS
FT                   GGGPGRRVLFDPVTLLPNPEVPEEVWERFDMLPAQTIPKRAAKPIKRLTAIAKALSDDD
FT                   LITDAGKQAHAHLHAVLDGRRVQYKDKIDAAVKDVMTMEGEELRGKLHSNTAISRKAFT
FT                   DTADHRAIQDAYRAAGRVFSADLARTYVGHLAGDDADDDELRDATVQLAAAALVPEVAE
FT                   AIDDEANKLAADWLQQTRVQRKGLTDERQAVYDELESMTTQPQPILLTRPRTGQADTKV
FT                   RDAAGNESDLPTHKHHLLCDENGDVPANLNDWETLVLKQEMNAAGFVAWWRNPSRTAKD
FT                   SLSIAYRDMSSGAFKALRPDFLFFSRRADGTIAANIVDPHGHHMSDAMPKLRGLADFAE
FT                   TFGAEYGRIEAVAKVGDTLRVLDLTKESVRKAVRDGADAKALYESDAAVDY"
FT   gene            complement(273383..275371)
FT                   /locus_tag="MAV_0275"
FT   CDS_pept        complement(273383..275371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0275"
FT                   /product="adenine specific DNA methylase Mod"
FT                   /note="identified by match to protein family HMM PF01555"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64822"
FT                   /db_xref="GOA:A0A0H2ZSX9"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSX9"
FT                   /protein_id="ABK64822.1"
FT                   /translation="MRKGDKVHILPPRGSRSRGDQRLWAVTGFEGRGENRSAKLVEAAQ
FT                   VEEPESTTAPVADLVVVAEFRDHIYPGLIETGRVERGGDKPFHTVINAENFHALEMLTY
FT                   THRHAIDAIYIDPPYNSGAKDWKYNNDYVESDDDYRHSKWLAMMERRLLIARELLNPAD
FT                   SVLIVTIDEKEYLRLGLLVEQMFPEARIQMVSSVINPGGASRTAAFTRVDEYIFFVKIG
FT                   SAAPAKHSNDMLFTDVSEPDENRSPIWRGMLRGGSGPLRSDSPSKFYPVLVDRTTGAVV
FT                   GAGEALPLGVDRATYTPPDGLDAVWPLKRGGVEGRWELNAATFEFRRSQGYVRAGDPNR
FT                   RTGVRTIYYLRNAEIERLESGELISRGMNDRGFLDVDYNPERERTLPAKTVWNRQSHNA
FT                   TEYGSNLLKAILPNRKFPYPKSLYAVEDTLRFFIDDKPDAVVLDFFSGSGTTAHAVMRL
FT                   NKQDGGRRQCISVTNNEVSADEQTRLRREGLRPGDADWEALGICDYITKPRITAAITGK
FT                   TPEGAAISGEYKFNDEFPMSEGFEENAAFFTLTYEGPLSVAHHRAFARIAPMLWLRAGA
FT                   RGPIITEIGDKGWDLTDVYGVLDDLDTAARFVTEVKKTPSVATVYIVTDDDLAFQMVCR
FT                   ELPKGVRPIQLYESYLRNFEINSGRFA"
FT   gene            275691..276152
FT                   /locus_tag="MAV_0276"
FT   CDS_pept        275691..276152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68161"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZG2"
FT                   /protein_id="ABK68161.1"
FT                   /translation="MTTIAFRTTTTRRSSDLSKHSAEVFAEAEDHPVTVTRRDGAPLVL
FT                   MSQREAEGRARLLEFAAQLIGVAVDDDGPLAGRMSKAFPWMLALSPEDRATCAQDLVDA
FT                   ARASFSTDQPHLALSELTSWRETATAIAAGLGQADLDWLDDGDTVVERP"
FT   gene            276155..276499
FT                   /locus_tag="MAV_0277"
FT   CDS_pept        276155..276499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0277"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68822"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A178"
FT                   /protein_id="ABK68822.1"
FT                   /translation="MAGKGELVPRPPKKVEYEIRFATTNAKKGWQDLAATIRNPLADAW
FT                   DFLTRTPLANTPTNYPLKGQLGTITRGGERYERWQHKPTKQGDARIWFYVEGRTVYLEQ
FT                   VHTSHPNETK"
FT   gene            complement(276509..277969)
FT                   /locus_tag="MAV_0278"
FT   CDS_pept        complement(276509..277969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0278"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67552"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYW8"
FT                   /protein_id="ABK67552.1"
FT                   /translation="MAPSGEHRPENLGQAAVHAAAVATGNSATTLRQQVKNLNAHASGK
FT                   TITEQCELLTKQAGIAEKVSADLGIVAAALKIREDAARAWNRDAPKDSEIAAAKKAVAD
FT                   AKKALMDASAASGDTSAASPKLEAAQKKLGELIRRRRDADKAYDAAEKRADAKLKEISG
FT                   QYAPHGGGRGHTADGTPETPAPSPGSPSPGAGSPSPGTGKPSAGAPGKTASGTAKPSAT
FT                   PAATPSSTKPTETETKSGDDLSGLLTQLASQQQQQPQSAQQAQPTAQATPAAATPQQQP
FT                   EKDKDTAQGKASPLDRILGADGILDTGDLATLGVGAPLTLGGGSSHATPAAAVTPSAPA
FT                   SAAPSSTGLSASATANAQPVTSGTSAQGLHTSTDVTGRSGEPRSAFSVGPETKTSGASG
FT                   ATGTSAAPAHAAGTRPMGAGGMPMMPMGGMGGPAGGAGSSKDKESTTLASGSAESDLLH
FT                   GRHTAAEAVPGGTIAQKDHPRRRGEDAA"
FT   gene            complement(278017..278811)
FT                   /locus_tag="MAV_0279"
FT   CDS_pept        complement(278017..278811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0279"
FT                   /product="trypsin domain protein"
FT                   /note="identified by match to protein family HMM PF00089"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68185"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2E3"
FT                   /protein_id="ABK68185.1"
FT                   /translation="MAGQPVAVQSSATTISTTAAQQPLRWVDVEAEAPQLDHDSVGARF
FT                   GSAVYPGIGLTQVGPDKSTVDCSAGPAVTGGVVVAAHCDAAPGGRVQIYPNAKGSSPIP
FT                   VGVITDRVLQQVDPVRDFALLRSTTVASGSTVIAGRWAIAGVLTEEAAPSALPVGSPVC
FT                   VNAAYTGIRCGAVLSTDDDGELLFNVRTEIGDSGAAVFAVNADTGAATLIGIVRGGDEM
FT                   TSTATYLAPALDKLGVSALVDPTASANTVADSRYSRMTTPAP"
FT   gene            278816..278962
FT                   /locus_tag="MAV_0280"
FT   CDS_pept        278816..278962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0280"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65359"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSJ5"
FT                   /protein_id="ABK65359.1"
FT                   /translation="MEHADNTTAAAMPAAAAPSRVFVLMRSILADEAEQPADARVTSPI
FT                   RMP"
FT   gene            complement(278976..279179)
FT                   /locus_tag="MAV_0281"
FT   CDS_pept        complement(278976..279179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0281"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65232"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZU82"
FT                   /protein_id="ABK65232.1"
FT                   /translation="MSTSYRPLITNLDRSIHDDVSGARTRLREAIKLLEQAPSTVADAE
FT                   KLTAVVADLRAVERRLVELADR"
FT   gene            280305..280772
FT                   /locus_tag="MAV_0282"
FT   CDS_pept        280305..280772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0282"
FT                   /product="DNA binding domain, excisionase family protein"
FT                   /note="identified by match to protein family HMM TIGR01764"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65739"
FT                   /db_xref="GOA:A0A0H2ZVB4"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVB4"
FT                   /protein_id="ABK65739.1"
FT                   /translation="MTTTTTTRIRIGTPAVAERLGVSDETIRQEIKRGNLPAIRVGRTY
FT                   RVLESDVDEYIAAAEAEAYSARKRKVGVEVTSGESEAGAEVRISGPSGSGKSSLVRELR
FT                   GLWGDAVTAHRYSDDGSEVLRLSTIDVEPSIADVAENDGLPPRFHLANLNA"
FT   gene            281053..281202
FT                   /locus_tag="MAV_0283"
FT   CDS_pept        281053..281202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0283"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64860"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZT08"
FT                   /protein_id="ABK64860.1"
FT                   /translation="MDGRTDADLAAAPAEPVAVPRLMIASVLWWRHVDEVYAAIRATHA
FT                   GVIA"
FT   gene            281199..283997
FT                   /locus_tag="MAV_0284"
FT   CDS_pept        281199..283997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0284"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64646"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSN1"
FT                   /protein_id="ABK64646.1"
FT                   /translation="MSDSNRAVLERIVALGGHLMPLKPGIKKALLANWQLAPAITVDEA
FT                   LAHLAAGGNVGVHLGFSGLIALDAENLPATQHLLGAGFQLTVAPAKSRIEGNPKHQGSH
FT                   VWLRVPKGIDPMALSSGERTMQVRLPGGGLIDVLAGGRYAVAPPSQLAEAPGWAYSAYA
FT                   GSPLDLAVPLEDVEVAEAPKWLFDPTLPCPEPLTALRGCLAPKARRDLAELDARSVALT
FT                   TEIDQVPWGDWIAGDRRLSPTGQVDGCGCEVWHWTDAEHDKSATLHDDCEVGSGAHLWS
FT                   GTMMAALRLGSHCSRLDLATALRGESRSKTAASVGIRLGGEQELTAIDADDLDESAEEA
FT                   EQRGDLTAAAELRKAAAVMRSRQHAVAPKEGAVFVGADSVVGAPAAPAAPTLTVVQGGG
FT                   GVQPAAGESDGTDEDTAIEADDIDAGIPPEKLEAWAEIKRRGFNPNDRAVYPLGFHSTP
FT                   EILERVMDYSDLTRATFHAARRAHAVHPIALYLNDLVRFGMRLPTDLGPFPGQPLSTFV
FT                   AAVGRSGTGKTQSSRMSASPHDWTQIGRVCRPGTTPAETGDTPPPGLPEVFISVGAEAL
FT                   NRTHRLGSGQVLVDLYGEIEPLYDEDTGKVIKGKSHFLPNEHLALHVHEDEMSALIARS
FT                   GGPQSTTMQTLCAAWARADIGDASRNAGTKAALSGDLDPYNLFLTGGLQPARAWTFFLT
FT                   ASLGFIQRFIHAAVTDPYRAVGLPVLADPGAVPPPSLDVGTATAFTLCESIKAAQAEAE
FT                   KDSGVDSLAGFTELDSHELMVRIRLACLVAAYHGTLTVDELCWEHSGWIMEYSRRSRAH
FT                   AEVEKERAAADDAGDAEKLRTHGKRVAAADDESRVRSAANRILGKLAEAGDAGLTEGEA
FT                   RKWLSGVRRNGRPSERALYGADALRVVKASEGVTFDGIRMRSASRGQAPLTAAPTIGSL
FT                   GA"
FT   gene            complement(284492..285316)
FT                   /locus_tag="MAV_0285"
FT   CDS_pept        complement(284492..285316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0285"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A267"
FT                   /protein_id="ABK68163.1"
FT                   /translation="MTVEAAPWPSTFPSYVASWYRWSMDSDATDAGIRNELARVLAIVE
FT                   VVTERPDHHAETSSDLAADEARFPDIWAATVARRGLVHAAENFEAACLLMLNGDWTAPQ
FT                   YALLRAAYESAGAATWLLQPGDIDTRLARLLWQHRESWRYSTKAYGGTPLDHDREERQR
FT                   WADDAAARLGIDLRAGRSGGFENLIEEIDDLPGQPESPADRMAAVLRREPREDVGPERG
FT                   DHGDRQRRDLRARTDQSANPEPGAVPHRPERGAASGAAGVGLVPHPHHDAAA"
FT   gene            285508..285789
FT                   /locus_tag="MAV_0286"
FT   CDS_pept        285508..285789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0286"
FT                   /product="carnitine racemase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZS58"
FT                   /protein_id="ABK65207.1"
FT                   /translation="MTIAETISSADAAVGSLVHALASNLDADALRTAVQQALLAAEIEH
FT                   GDAFFLGELLPDVIAAEVWHGEAVLTAPEALRVGLGYVAAAIVAGATL"
FT   gene            285974..286585
FT                   /locus_tag="MAV_0287"
FT   CDS_pept        285974..286585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0287"
FT                   /product="gp6 protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64681"
FT                   /db_xref="GOA:A0A0H2ZR19"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZR19"
FT                   /protein_id="ABK64681.1"
FT                   /translation="MLNPSTAGRTVVGLDLSLTGAGIAAFDLVTGDLSTAVHRSQAPKS
FT                   DTLGAHVARHRALVDGIVQQTIGCDPALVVVEGLRFSVSAQDSSLSRRGFLWWAVVEGL
FT                   VNAGAPVLEVTPSQIKQLATGKGNASKNMIVAEYALRWPDATRDKNVEDRADAAFAAAL
FT                   GVAYLRAPVLPFKVTGTRRKALAKLPAPSIPPRIAAAEAA"
FT   gene            286609..286875
FT                   /locus_tag="MAV_0288"
FT   CDS_pept        286609..286875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0288"
FT                   /product="glutaredoxin"
FT                   /note="identified by match to protein family HMM PF00462"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65393"
FT                   /db_xref="GOA:A0A0H2ZUE6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUE6"
FT                   /protein_id="ABK65393.1"
FT                   /translation="MTITLYTQPGCGGCIFAAKDLTKAGVPFTERNVRADPDAADMVHR
FT                   LYQEHRDPGVVPETPVIVIDDEVFFGAVELHAYLRELGRESAA"
FT   gene            286872..287255
FT                   /locus_tag="MAV_0289"
FT   CDS_pept        286872..287255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0289"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65223"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZS74"
FT                   /protein_id="ABK65223.1"
FT                   /translation="MSGAIRRPAPGGGVFITRPAAAALRGVTRRRIDSLIQQGKLPAYE
FT                   VAGRVMVLEADVLALELPTAPPDGWISRHAAAKVLGCTHRAVGLMVARGDLPAETFNGR
FT                   LYVREADVRAAANPRRVIPPRRR"
FT   gene            287283..289778
FT                   /locus_tag="MAV_0290"
FT   CDS_pept        287283..289778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67270"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXA4"
FT                   /protein_id="ABK67270.1"
FT                   /translation="MAQFGGLASPIPDPTPQPHGAASTTDIPVRGTPDAADTKPEPATE
FT                   SKPDAEEKRRPNRDGKTPADPKPVPDAGEKPDTDEKPKPDVDKAEPKAKVKDIGQVTAN
FT                   DKVSTIGKSFGKAYLEAAKSPIKGIPAIVKAEYKAGTALGEKLAGKIAGEGLLKSASRV
FT                   SLKTAGRLVPGVGTAIGVISAYKNFEQGDYVGAAINMVSAIPGPIGWVGIAASTAWEAF
FT                   DLGGNKIGQWDSPDGSTTHILPAAAHDIGGVTALDSQLREAQQCVFSFQDGPRGKVWDS
FT                   NPPEALRLDGADIQKEIAEALGGISDLFAEVDRVMSSAGEAYFDEYKARLQPHLEAMAA
FT                   LKEQVKPFTQQLGNASDGAATAYTAVLDANRAAREQLVADGKLSDQGPASTFTSAVSAA
FT                   GSQVTAADQNIANLFGEPAAVLTATVASGTGTRIDPSKKGAPVQTTASPAAQTPVTPTS
FT                   QTPTVTPKTETPAKTTDALGDLLRSLNQKQQMPTTPSTPNLGNGLGSGSPLGTGGSPLS
FT                   TSPSKPLDTSSDRKLDDGRKGEEKKEERKLAEPKKEKSETKPSLAASKTDNAKAPESKL
FT                   ATAEKPGAHTAAVPAQPSAAAAAANPAAPAAQGQSAPPEQSKQVDVKGTRVEFPDAKTA
FT                   KLASLLANADPAHPLSLAEAAKMAGLTPPVPGQDPGSQVAPAQAKPGDLLVAGDKKYML
FT                   LEPGKFYDLQEYKVVSADQLPQDAGSRGGYFHLNDPSPTGAPGTQPVSGQTPGGVDQAV
FT                   PGGTPPPAAPADATPQKPHDPAAGAPAPSGGVPSAGTPGAPKPTATGGGPSSAEATQTG
FT                   VGQPSPSPSTSALDPTAVR"
FT   gene            complement(289849..289971)
FT                   /locus_tag="MAV_0291"
FT   CDS_pept        complement(289849..289971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0291"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66583"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXT7"
FT                   /protein_id="ABK66583.1"
FT                   /translation="MNQVTESPAGRGEHMSGPVYDNEDVRDDGDQWPDEEHDRD"
FT   gene            290359..291492
FT                   /locus_tag="MAV_0292"
FT   CDS_pept        290359..291492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0292"
FT                   /product="putative integrase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67993"
FT                   /db_xref="GOA:A0A0H3A0L3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0L3"
FT                   /protein_id="ABK67993.1"
FT                   /translation="MILPAVTAGAELPDLPVDVVERIRIATIDSQSEGTRRAYSSAWRR
FT                   FEGWCRRNGYESLPAHPTVIAAYLVDAAETVTENGERAYSTVSLGKWCAAIFDRHRRAG
FT                   VEPNPAAHELVRQTASGIRRQYAARGDRPRQPRTPLLTDDVMLLVSTAREQATGWASQV
FT                   CERRDSALLLMGFAGAFRRSELSGLTGGDVELHAADGIHVHLRKSKTDQLGEGGTYPLP
FT                   RTKDALRCPACAYVRWAAVVSAHEDGGNGAVIRLLTDSPEFGSRHTCRSRAPKIDRRAP
FT                   LFRSCRNGVLSEGPLSGAGIHAVIRRRALRAGFDREAVERLGGHSLRAGFVTQAARAGA
FT                   DHHAIMRQTGHRTPAMVTRYVRESAPLIGNAVTVLGL"
FT   gene            complement(291493..291816)
FT                   /locus_tag="MAV_0293"
FT   CDS_pept        complement(291493..291816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0293"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66809"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW76"
FT                   /protein_id="ABK66809.1"
FT                   /translation="MIAEIRLQSNNGESTAAFWSAIFNVPAEHLGADRWGLDSWRISPA
FT                   VGPDVVVSTTTVVEAITRCDMTVAVDVGAADRLRENLFEVSVDGRQAVDVNGTDGTVFL
FT                   VQQ"
FT   gene            complement(291813..291992)
FT                   /locus_tag="MAV_0294"
FT   CDS_pept        complement(291813..291992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0294"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67430"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0D7"
FT                   /protein_id="ABK67430.1"
FT                   /translation="MSNTATTRPVIRATTRDIARLAEFLSLLFDAPVVITSAGDEVPAP
FT                   ADRHLVMIVAETAA"
FT   gene            292102..293013
FT                   /locus_tag="MAV_0295"
FT   CDS_pept        292102..293013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0295"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69409"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2Z0"
FT                   /protein_id="ABK69409.1"
FT                   /translation="MLLGLLHLQRNLHQGIESRGVSTGGHHQDMSDENDLEMTDAERAS
FT                   LAASRAAIGDLAHALVEGADPEEAEAALAAVRQASSQLDREALLNKIHMPDDAAGFEDD
FT                   LRAIMRRIPPNWGRWVGCSRGWYPIIIALDQALAAIDPAYELHQVKEKFGGLRFYFHAS
FT                   ESITEADRQRMEQLVDEAEEKCERTCELCGEPGVRHVTPRGWYRTLCSTCAAAEGKGYE
FT                   RVGELVNNLTAGTTGVWRVGCYADAPESIWDLDRGEVTVGSDRHRDFEVLAYPSVLRTW
FT                   RIRLADGTEVESGVIAAIERVR"
FT   gene            293069..293629
FT                   /locus_tag="MAV_0296"
FT   CDS_pept        293069..293629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65861"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVX8"
FT                   /protein_id="ABK65861.1"
FT                   /translation="MSVGRGWATIEADLRAELAAIGVEKVSVYEKYGWLRADPTPWSEA
FT                   AQAICDRAEERSETTCEVCGARPAERNRLPSGWIKTLCAWHRTGPIVRYRPGWQARVDR
FT                   LVTELAGVEPNAMVTIVEPTTLGPKGMFHTETEAGRELIWAALEELARTCGRCGCVGAE
FT                   RIDWCETCASRRVQAKRPASEEP"
FT   gene            293626..293958
FT                   /locus_tag="MAV_0297"
FT   CDS_pept        293626..293958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0297"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65520"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZT63"
FT                   /protein_id="ABK65520.1"
FT                   /translation="MTEHIAFPPPKTVAELRKILDRLPPGMPVLVDAYEAAYSPVDSVM
FT                   ITEVQELSGRPSYLGRFEHVADAARAVAGVDAAGWISEPGPLPQRVGEPVVALVLRREE
FT                   RGDDEQ"
FT   gene            293984..294226
FT                   /locus_tag="MAV_0298"
FT   CDS_pept        293984..294226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0298"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64801"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSW0"
FT                   /protein_id="ABK64801.1"
FT                   /translation="MRAAAAGDPGPNMTVMERAAVTFLQSDDPELDLHTAMVLAELVAV
FT                   DVPATERVGFTQMWMGELRDALRRGHPDQGSGDTT"
FT   gene            294476..294892
FT                   /locus_tag="MAV_0299"
FT   CDS_pept        294476..294892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0299"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64436"
FT                   /db_xref="GOA:A0A0H2ZQH8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZQH8"
FT                   /protein_id="ABK64436.1"
FT                   /translation="MTVLVSVLGDTVTVLGGSVVVGVSVLDGGTVSVTVWVGAGAPPPP
FT                   WCRGSWVVVVTGVVVDGVVVVVVAAGPCAGELVASLTAAKTTAPSSSTPSAPKATSAAG
FT                   RRYQGVGGSGGGRSSYPPYSPYPPPYRAAWVGSE"
FT   gene            complement(294941..296005)
FT                   /locus_tag="MAV_0300"
FT   CDS_pept        complement(294941..296005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0300"
FT                   /product="phosphotransferase enzyme family protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66739"
FT                   /db_xref="GOA:A0A0H2ZY83"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZY83"
FT                   /protein_id="ABK66739.1"
FT                   /translation="MTPTSPEGMTVDAVDLPAVADWMSAQGLGEGPLHDVATLTGGTQN
FT                   VMLRFSRAGRSYVLRRGPRHLRPRSNNVILRETKVLAALAGSDVPHPHLIAVCDDPGVL
FT                   GDAVFYLMEPVDGFNAGEGLPPLHAGNPQVRHQMGLSMADALAKLGAVDHVAVGLADFG
FT                   KPEGFLERQVPRWLSELESYSQYDGYPGPQIPGIDQVSAWLEQHRPAHWTPGIMHGDYH
FT                   AANVMFSRTGPEVVAIVDWEMCTIGDPLLDLGWLLATWRQPDGSAVFSHALGGQEGLAS
FT                   TDELFRRYAANTSRDLSHIAWYTVLACFKLGIVIEGTLARACAGQAEKEVGDQLHAATV
FT                   HLFERALRLIDEQG"
FT   gene            296096..297040
FT                   /locus_tag="MAV_0301"
FT   CDS_pept        296096..297040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0301"
FT                   /product="methyltransferase, putative, family protein"
FT                   /note="identified by match to protein family HMM PF02409;
FT                   match to protein family HMM TIGR00027"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65850"
FT                   /db_xref="GOA:A0Q9K2"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0Q9K2"
FT                   /protein_id="ABK65850.1"
FT                   /translation="MPRTDNDSWDITQSVGATALGVAAARAAETESENPLISDPFARIF
FT                   VDAAGKGMWSIYADPALLTKADDLEPDLRGRLQLMIDFMATRTAFFDEFFLAAADAGVR
FT                   QVVILAAGLDARSWRLPWPDGTVVYELDQPKVLDFKSTTLREHGAQPKAELVNVPIDLR
FT                   QDWPKALQEAGFDASRPAVWSAEGLVRYLPAQAQDLLFERIDALSVPGSRLASNVPDSG
FT                   FTDPDRLARQREDMRRMRAAAAKLVDAEITDFDDLWYPEERTPVDSWLRERGWDVSTAT
FT                   FAELMARYGRSIPQGAQDSMPPTLYVSAQRRAG"
FT   gene            297208..297435
FT                   /locus_tag="MAV_0302"
FT   CDS_pept        297208..297435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68167"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A114"
FT                   /protein_id="ABK68167.1"
FT                   /translation="MRGSGIIGTVALVWLLIGVFAAWQRDYFKNDQTTCASAGTVAVTV
FT                   IAGPLNYFGVNPKVTDCHLPQPSSMQSINI"
FT   gene            297457..297612
FT                   /locus_tag="MAV_0303"
FT   CDS_pept        297457..297612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0303"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67329"
FT                   /db_xref="GOA:A0A0H3A046"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A046"
FT                   /protein_id="ABK67329.1"
FT                   /translation="MVILGIVLLVLGYFFHVPVLSTLGIVLLVIGAVLWILGSIGRPVA
FT                   GRRYWY"
FT   gene            297688..298428
FT                   /locus_tag="MAV_0304"
FT   CDS_pept        297688..298428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0304"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68332"
FT                   /db_xref="GOA:A0A0H3A2V6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2V6"
FT                   /protein_id="ABK68332.1"
FT                   /translation="MSQPRASAERVVMCRADGNPINVLVVDDEAVLAEMVSMALRYEGW
FT                   NIATASDGASAIAAARNQRPDVVVLDVMLPDMSGLDVLHKLREENPQLPVLLLTAKDAV
FT                   EDRIAGLTAGGDDYVTKPFSIEEVVLRLRALLRRTGVTTVDSGAQLVVGDLVLDEDSHE
FT                   VTRAGEPISLTSTEFELLRFMMRNSKRVLSKAQILDRVWSYDFGGRSNIVELYISYLRK
FT                   KIDNGREPMIHTLRGAGYVLKPAR"
FT   gene            298475..299965
FT                   /locus_tag="MAV_0305"
FT   CDS_pept        298475..299965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0305"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68765"
FT                   /db_xref="GOA:A0A0H3A3F9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3F9"
FT                   /protein_id="ABK68765.1"
FT                   /translation="MADTRRVWSLRLRLLVGQIVVLALVCLGITAVTELALNHHLVKQL
FT                   DGQLAGTSFRSALMYPEPNHPRHEHSPYPRPGPGPRFLDAPGQPAGMVAAVVSHGKTVD
FT                   AGYLTSSGTRDALTSTAQTQLEQIAGSRAPVTVNLDGLGRYRVVAAPSRNGSDIIVTGL
FT                   SMANIDATLIRMLVIFGIVTVIALAAATIAGVVIIRRALAPLRRVAQTAREVADLPLAR
FT                   GEVELPVRVRESDANPSTEVGQLGAALNRMLDHIADALSARQASETRVRQFVADASHEL
FT                   RTPLAAIRGYTELTQRMGDDREAVAQAMSRVASETERMTRLVEDLLLLARLDSGRPLER
FT                   EPVDLSRLAVDAVNDAHVAGPDHQWELDLPEEPVVITGDAARLHQVLTNLLANARVHTG
FT                   AGTVVTTRLSTEPAHTVLQVIDNGPGIPAELQSEVFERFARGDSSRSRKGGSTGLGLAI
FT                   VSAVVKAHNGTISVNSSPGHTEFTVRLPPNGWQPHASA"
FT   gene            complement(299967..300452)
FT                   /locus_tag="MAV_0306"
FT   CDS_pept        complement(299967..300452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0306"
FT                   /product="lipoprotein LpqH"
FT                   /note="identified by match to protein family HMM PF05481"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64615"
FT                   /db_xref="GOA:A0A0H2ZS38"
FT                   /db_xref="InterPro:IPR008691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZS38"
FT                   /protein_id="ABK64615.1"
FT                   /translation="MKRQLTIAVAGAAILAAGVSGCSSGNKSAPSSSASSSSTSASASS
FT                   GGAAGTKVIIDGKDQNVSGSVVCTNAGGTVNIAIGGAATGIAAVLSDGNPPQVKSVGLG
FT                   NVNGVTLGYTSGTGQGNASAEKNGNSYKITGTATGVDMANPLQPVNKPFEIDVTCNS"
FT   gene            300594..302468
FT                   /locus_tag="MAV_0307"
FT   CDS_pept        300594..302468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0307"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69259"
FT                   /db_xref="GOA:A0A0H3A2I0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR029229"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2I0"
FT                   /protein_id="ABK69259.1"
FT                   /translation="MDHKPPSPVIEAAHHACVLPFSDDADFRDADRGFIAALSPCVVRG
FT                   ADGRVVFDNDAYAFLDGPAPTSVHPSLWRQSTLAAKHGLYEVVPGIYQVRGLDISNVTF
FT                   VETDTGIIVIDPLVSTEVAAAALTLYRTHRGGDRPVVAVIYTHSHVDHFGGVLGVATQA
FT                   DVDAGRVAVLAPEGFVEHAVQENVYAGPAMLRRATYMYGTLLPRGLFDHVGCGLGQAAS
FT                   MGEVALIVPTVDIRETGETHTIDGVEIEFQMAPGTEAPAEMHFYFPQFRALCMAENATH
FT                   NLHNLLTLRGALVRDPRAWSGYLTEAIDTFADRADVVFASHHWPTWGRDGIVEFLSLQR
FT                   DLYAYLHDQTLRLLNQGHTGVEIAEMFRLPPALERAWHARGYYGSVSHNVKAIYQRYMG
FT                   WFDGNPARLWPHPPEALGPRYVAAMGGIDRVVDLAQQAFDSGDYRWAATLLDHAMFTDG
FT                   EHVGARELYADTLEQLAYGAENATWRNFFLSGATELRDGNFGTAGQVTSPTMLAQLTPE
FT                   QIFDGLAIRVNGPRSWGLDITVDVTLADTAVNHRLALRNGVLVQRKVPADPTTATVTVR
FT                   LANKIRLLALAAGDFASPGLELTGDRGALQSLVGALDAPDPDFNIVTP"
FT   gene            complement(302478..303446)
FT                   /locus_tag="MAV_0308"
FT   CDS_pept        complement(302478..303446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0308"
FT                   /product="alcohol dehydrogenase, zinc-binding"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65402"
FT                   /db_xref="GOA:A0A0H2ZSN2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSN2"
FT                   /protein_id="ABK65402.1"
FT                   /translation="MRAVVCRSYGTPEDLVLDEVPDPVPGPGQLLVRVRAAAVNFPDVL
FT                   FIAGKYQVKIPPPFIPGNEIAGEVIAAGEGARFLPGQRVAGTTFGAFAEQALLDADQAE
FT                   PIPDDADFASAAAFGVTYRTAYHALRSTAGVTAGDWVVVLGAAGGVGLAAVDLAVAMQA
FT                   RVLAAASSPEKLELCRRRGAEATVDYDREDLKTRIRDLTGDRARVVLDPVGGPYSEPAL
FT                   RGLARGGTFVTLGYASGTIPAIPLNLVLLKDICVRGMEIRTFMTDRPDDAVRDLTELSQ
FT                   MFAAGTVRPYIGARFPLARTAAALRHVADRKVLGKVVIDVA"
FT   gene            complement(303446..304060)
FT                   /locus_tag="MAV_0309"
FT   CDS_pept        complement(303446..304060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0309"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65929"
FT                   /db_xref="GOA:A0A0H2ZW66"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW66"
FT                   /protein_id="ABK65929.1"
FT                   /translation="MISDRVTAAVERALDDRQREATEEVERILAAAVRVMERVAPEPPR
FT                   VSDIVAEAGSSNKAFYRYFAGKDELILAVMERGVAIVVSYLEHQMAKEATPRGKIARWI
FT                   EGTLAQVADPHLISMTRAAAGQMSAGTSWRAADQEMMRPLRELLVEPVAALGSSDVDRD
FT                   VEAVFSCTAATLRRYVGSAQQPAPDDIAHVVRFCLRGLGVR"
FT   gene            complement(304050..305332)
FT                   /pseudo
FT                   /locus_tag="MAV_0310"
FT                   /note="putative acyl-CoA dehydrogenase; this gene contains
FT                   a frame shift which is not the result of sequencing error;
FT                   identified by match to protein family protein HMM PF02770"
FT   gene            complement(305354..306118)
FT                   /locus_tag="MAV_0311"
FT   CDS_pept        complement(305354..306118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0311"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68355"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2X7"
FT                   /protein_id="ABK68355.1"
FT                   /translation="MGYAEQLFDLADRVVLITGGSRGLGREMAFGAARCGADVVIASRN
FT                   LDNCVATAQQIEHETGRRAMAYQVHVGRWDQLDGLVEASYDRFGKIDTLINNAGMSPLY
FT                   DKLTDVTEKLFDAVVNLNLKGPFRLSALVGERMVAAGRGSIINVSTAGSLRPTPDIVPY
FT                   AASKAGLNAMTEALAKAFGPAVRVNTLMAGPFLTDVSRAWNLEAAQENPFRHLALQRAG
FT                   DPREIVGAALFLASDASSFTTGSILRADGGIP"
FT   gene            complement(306120..307178)
FT                   /locus_tag="MAV_0312"
FT   CDS_pept        complement(306120..307178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0312"
FT                   /product="phosphotransferase enzyme family protein"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68841"
FT                   /db_xref="GOA:A0A0H3A4I6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A4I6"
FT                   /protein_id="ABK68841.1"
FT                   /translation="MAGQRGGVESGLDAGVLARWLDANDAPGSGEETRLTPLQGGSQNT
FT                   LYLIERGPARMVLRMPGARADAARIDGLLREIRLVRALSGTDVPHAALIAADDTGTVLG
FT                   MPFYVMAAIDGWSPMDGGWPAPFDTDPRARRGLAFQLVEGAAKLGRVDWRKQGLEGFGR
FT                   PDGFHERQVDRWLAFLDAYRVRELPGLDEASDWLRRNRPAHYRPGIMHGDYQFANVMFA
FT                   HGEPARLAAIVDWEMTTVGDPLLDLAWCLLGYDGENPREDGFYLDMRGMPSRSELLEHY
FT                   ESVSGLSTENIDYYLVLANWKLGIVLEKTYAAGVRGGSRNEGVDPKITEAFGAMIPQLI
FT                   ATAAELARQLGN"
FT   gene            complement(307234..307917)
FT                   /locus_tag="MAV_0313"
FT   CDS_pept        complement(307234..307917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0313"
FT                   /product="thiopurine S-methyltransferase (tpmt) superfamily
FT                   protein"
FT                   /note="identified by match to protein family HMM PF05724"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69405"
FT                   /db_xref="GOA:A0A0H3A3U2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3U2"
FT                   /protein_id="ABK69405.1"
FT                   /translation="MTQPDTDWDAAYRQAAPPPWSIGRPQPELERLIDEGKFRSDVLDS
FT                   GCGHAALSLRLAALGHTVVGLDASATAIAEATAAAAAQGLTTATFARADVTDFADYPPG
FT                   SEGRFATIVDSGLFHALPPQRRQDYLRSIFRAAAPGAALYILAFAAGALAPAHPDRPGP
FT                   QGFTETELREAVSVLWHIDDLRAARVYGNDDSAGAPDSPLAHLERDGEGHFMAPGFLVS
FT                   AHKRD"
FT   gene            307994..308602
FT                   /locus_tag="MAV_0314"
FT   CDS_pept        307994..308602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0314"
FT                   /product="phosphoglycerate mutase family protein, putative"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64825"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZRC3"
FT                   /protein_id="ABK64825.1"
FT                   /translation="MQVLLVRHALPLRSEHGQGSDPDLSADGLAQIERLPKALERFPIS
FT                   RVVSSPQRRAVQTAAPVAADRGLSVEIDDRFAEYDRDLPVYIPVEQIRDEMPEEWARLA
FT                   QGHLPSAVDEDAFRARVRAAVDDLVAAAEPEDTVAVFSHGGVINVLLHEILGTARLLSF
FT                   PVDYASVTRLLFSRSGQATVAAVNTTEHVWDLLPRIQRW"
FT   gene            308637..309689
FT                   /locus_tag="MAV_0316"
FT   CDS_pept        308637..309689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0316"
FT                   /product="Phosphotransferase enzyme family protein"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66148"
FT                   /db_xref="GOA:A0A0H2ZUJ9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUJ9"
FT                   /protein_id="ABK66148.1"
FT                   /translation="MTSADQLEGLDLAALDSYLRSLGIGRDGELRAEFISGGRSNLTFR
FT                   VYDDATSWLVRRPPLHGLTPSAHDMAREYRVVAALQDTPVPVARTIGLCEDESVLGAPF
FT                   QIVEFVAGQVVRRRAQLESFSHTVIEGCVDSLIRVLVDLHSVDPDAVGLADFGKPSGYL
FT                   ERQVRRWGSQWALVRLPEDRRDADVERLHSGLGQAIPQQSRTSIVHGDYRIDNTILDAD
FT                   DPTKVRAVVDWELSTLGDPLSDAALMCVYRDPALDLIVNAQAAWTSPLLPTADELADRY
FT                   SLVAGIPLAHWEFYMALAYFKLAIIAAGIDFRRRMSDQARGLGEAAEHTPEVVAPLISR
FT                   GLAELAKLPG"
FT   gene            complement(309686..310036)
FT                   /locus_tag="MAV_0315"
FT   CDS_pept        complement(309686..310036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0315"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66286"
FT                   /db_xref="GOA:A0A0H2ZUW9"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUW9"
FT                   /protein_id="ABK66286.1"
FT                   /translation="MSSHTPDSPGQQPPKPTPAGKTPAPAKEPAIGFTRAGALWSSLIA
FT                   GFVILILLLIFITQNTAPTAFRFLGLHWSLPLGVAILLAAVVGGLITVAVGTARILQLR
FT                   RVAKKQHAAGGR"
FT   gene            310174..311082
FT                   /locus_tag="MAV_0317"
FT   CDS_pept        310174..311082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0317"
FT                   /product="ABC transporter, quaternary amine uptake
FT                   transporter (QAT) family protein, substrate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF04069"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66271"
FT                   /db_xref="GOA:A0A0H2ZWM1"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWM1"
FT                   /protein_id="ABK66271.1"
FT                   /translation="MAVLLTTMFVVAACSNSDPLGAQVRSPDSIVVGSGDFPESQIIAE
FT                   IYAQALQANGFDVGKRMGIGSRETYIPAIKDHSIDLVPEYIGNLLLYFEPASSATTLDA
FT                   VEQELHRRLPADLSILTPAPATDTDTVSVTSQAANSWNLRTIGDLAPHSADVRFGAPSA
FT                   FATRPAGLPGLRQKYGLDIKPGNFVAIDDGGGAVTVRALLEGRVNAANIFTTSPAIPQH
FT                   HLVALDDPEHNFIAGNVVPLVNSQKRSERLKLVLDAVSAKLTTPGVAGLNAAVSGNSGV
FT                   DPDQAARNWLRDNGLNHPIGP"
FT   gene            311084..312178
FT                   /locus_tag="MAV_0318"
FT   CDS_pept        311084..312178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0318"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66860"
FT                   /db_xref="GOA:A0A0H2ZWU2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWU2"
FT                   /protein_id="ABK66860.1"
FT                   /translation="MIVFDNVSKVFADGTAAVDRLSLTVPTGKLTVFVGSSGSGKTTAL
FT                   RMINRMIEPTSGTISIDGVDVSTLDPVKLRLGIGYVIQHAGLMPHQRVIDNVATVPVLR
FT                   GQRRRAARTAAYQVLERVGLDVKLARRYPAQLSGGEQQRVGVARALAADPPILLMDEPF
FT                   SAVDPVVRHDLQNEILRLQSELHKTIVFVTHDIDEALRLGERVAVFKGGMLQQCDEPAR
FT                   LLSRPANDFVSRFIGLGRGYRWLQLIDAAGLPVHDVRRLFAENLSGADVFDGWAVVVDE
FT                   AGAPLGWIDAEGLRRHRDGLALSDSMTGVGSLFRPRGNLSQALDAALSSPSGIGVAVDD
FT                   DGRVIGGVLAADVLAAVESQRKSR"
FT   gene            312178..312864
FT                   /locus_tag="MAV_0319"
FT   CDS_pept        312178..312864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0319"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67041"
FT                   /db_xref="GOA:A0A0H2ZWU7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWU7"
FT                   /protein_id="ABK67041.1"
FT                   /translation="MHYLLTHLDDAARLTVVHLRLSLVPVLIGLAIALPLGMLVQRRRF
FT                   ARRLTTAVASVVFTIPSLALFVVLPMIIGTRILDEANVMVALTAYTAALLVRAVLEALD
FT                   AVPAQISDAATAVGYPRLTRMMKVELPLAVPVLIAGLRVVVVTNIAMVSVGSVIGIGGL
FT                   GSWFTQGYQTGKSDQILAGIIALFALAVAVDGLIVLGGRLVTPWAHAVRGGARRSVVAP
FT                   VVGGAR"
FT   gene            312861..313577
FT                   /locus_tag="MAV_0320"
FT   CDS_pept        312861..313577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0320"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67921"
FT                   /db_xref="GOA:A0A0H3A001"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A001"
FT                   /protein_id="ABK67921.1"
FT                   /translation="MNFVQRAIAYLLSADNWTGPVGLAARILEHLEYTGIAVGASALIA
FT                   VPVGLLIGHTGRGTLLVVGAVNGLRALPTLGVLLFGTLLFGLGLGPSLVALMLLGVPAL
FT                   LAGTYAGIANVEPTVVDAARAMGMTESQVLLRVEVPNALPLILGGLRSATLQVVATATV
FT                   AAYASLGGLGRYLIDGIKEREFHLALVGALTVAALALVLDGLLAVAVWASVPGTGRLRR
FT                   TYRPLPHRLAGTSYGR"
FT   gene            313677..314177
FT                   /locus_tag="MAV_0322"
FT   CDS_pept        313677..314177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06475"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65489"
FT                   /db_xref="InterPro:IPR009467"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUY8"
FT                   /protein_id="ABK65489.1"
FT                   /translation="MSGNRIKANGRIVAAATDANPAFGAYYDLQTDETGATKRLGMTVT
FT                   LAERERVFSFARDEENMWLVTDPQGEHRAAYNGALDVDVEFSPFFNALPIRRLGLQERA
FT                   ASVTLPVVYVNVPEMSITADTVSYSSTGSRDEIKVHSPISDTTVSVDEQGFIVDYPGLA
FT                   ERI"
FT   gene            complement(314140..315084)
FT                   /locus_tag="MAV_0321"
FT   CDS_pept        complement(314140..315084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0321"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="identified by match to protein family HMM PF02153"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69117"
FT                   /db_xref="GOA:A0A0H3A222"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A222"
FT                   /protein_id="ABK69117.1"
FT                   /translation="MCVLGLGLVGGSIMRAATAAGREVFGYNRSIEGAQAATADGFDAD
FT                   TDLTATLSRAADSDALIVLAVPMPALPSMLAHVKETAPQCPLTDVTSVKKAVLDEVVAA
FT                   GLRDRFVGGHPMAGTAHSGWTAGHAGLFTGAPWVVSVDDHVDPVVWAMVMTLALDCGAV
FT                   VVPARSDEHDAAAAAISHLPHLLAEALAVVAGDVPLAFALAAGSFRDGTRVAATAPDLV
FT                   RAMCEGNSDQLVPTADHVIELLRRARDSLAHHKSVADLIEAGHAARTRYDSFPRTDIFH
FT                   VVIGAENWRQELAAAGRAGGVIRSALPTLDSPR"
FT   gene            315227..315748
FT                   /locus_tag="MAV_0323"
FT   CDS_pept        315227..315748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0323"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66261"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWL2"
FT                   /protein_id="ABK66261.1"
FT                   /translation="MGAQRASAQGLSADTPDGFGVAVVREEGQWRCAPMAPKSLTSLSA
FT                   AETELRELRSSGAVFGLLDVDDEFFVIVRPAPSGTRLLLSDATAALDYDIAAEVLDKLD
FT                   ADIDPEDLEDSDPFEEGDLGLLSDIGLPEAVLGVILDETDLYADEQLGRIAREMGFADQ
FT                   LSAVIDRLGR"
FT   gene            315745..316203
FT                   /locus_tag="MAV_0324"
FT   CDS_pept        315745..316203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0324"
FT                   /product="cytidine and deoxycytidylate deaminase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66874"
FT                   /db_xref="GOA:A0A0H2ZYP3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYP3"
FT                   /protein_id="ABK66874.1"
FT                   /translation="MISDEDLIRSALAVAATAGPRDVPIGAVVVGADGTELARAVNARE
FT                   ALGDPTAHAEILALRAAAAALGDGWRLEGATLAVTVEPCTMCAGALVLARIARLVFGAW
FT                   EPKTGAVGSLWDVVRDRRLNHRPEVRGGVLERECAALLEGFFARQRLG"
FT   gene            316233..316322
FT                   /locus_tag="MAV_0325"
FT   tRNA            316233..316322
FT                   /locus_tag="MAV_0325"
FT                   /product="tRNA-Ser"
FT   gene            316495..317412
FT                   /locus_tag="MAV_0326"
FT   CDS_pept        316495..317412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0326"
FT                   /product="endoglucanase A"
FT                   /EC_number="3.2.1.4"
FT                   /note="identified by match to protein family HMM PF01341"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66869"
FT                   /db_xref="GOA:A0A0H2ZYN6"
FT                   /db_xref="InterPro:IPR001524"
FT                   /db_xref="InterPro:IPR016288"
FT                   /db_xref="InterPro:IPR036434"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYN6"
FT                   /protein_id="ABK66869.1"
FT                   /translation="MGPVAEPAPAIRLAADGNPLAGAPFYVNPNSAAMRAAQSADPPSP
FT                   ELTTIANTPQAYWIVPGGSAATVGKYVGDANAAGAIPVLAIYGIPHRDCGSFAAGGMAS
FT                   ADDYRGWIDGIASGVGASRVAIVVEPDALAMADCLSGDQRQERFDLVRYAVDTLTRDPN
FT                   AAVYVDAGHLRWHSPEDMAARLNQAGVAHARGFSVNTANFYTTEDEIGYGEAISGLTNG
FT                   AHYVIDTSRNGAGPAPDSDLNWCNPSGRALGTPPTAATAGAHADAYLWIKRPGESDGSC
FT                   GKGDPPAGNFVNQYAIDLVHNVGH"
FT   gene            317505..317978
FT                   /locus_tag="MAV_0327"
FT   CDS_pept        317505..317978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00188"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69220"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A4E0"
FT                   /protein_id="ABK69220.1"
FT                   /translation="MTRKAEIVAVFAICTAFMTASGAFGGFAARADDPGVLYNGINQLR
FT                   QACGPIAEDPRLTEAAQQHADDMLRNGVNGHIGSDGSSPQARIAAAGYRSRYSGEIVFW
FT                   ATGSAATPGEALDMWMQSPPHRAIILNCGFTAGGFATARDGNKMTAVGDFAAS"
FT   gene            318572..318904
FT                   /locus_tag="MAV_0328"
FT   CDS_pept        318572..318904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0328"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWD2"
FT                   /protein_id="ABK66700.1"
FT                   /translation="MAQSMNDSGIQGWLVAESGEHLSRYQSGDVASQWPYVSNTAAVVL
FT                   PNKVIVQAWYTTNDPSAASRNQLLSQLIGASGHPRPRSALPPKLADWSQAQISTLLPAG
FT                   ASRGVV"
FT   gene            318957..320231
FT                   /locus_tag="MAV_0329"
FT   CDS_pept        318957..320231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0329"
FT                   /product="transposase, Mutator family protein"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69008"
FT                   /db_xref="GOA:A0A0H3A1M9"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1M9"
FT                   /protein_id="ABK69008.1"
FT                   /translation="MVKRPRITTERNIAMALDQSALLEVLDALRTADAGERITQAAETI
FT                   YQALIDAELTAFIGASPHERTETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSFFPAL
FT                   LERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEVSRICKDLDTEVAA
FT                   FRDRPLGDQRFPYVFLDATYCKARVNHRVVSQAVVIATGVAADGRREVLGFEVGDSEDG
FT                   AFWTAFLRSLKSRGLAGVQLVISDAHAGLRSAIDAVLIGAAWQRCRVHFLRNVLAQVPK
FT                   GSAEMVAAAIRTVFAQPDAEHVREQLDTIAGMLGRQFPKVETMLREAAADITAFADFPV
FT                   AHWKKIWSTNPLERLNKEIKRRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVADKRYLS
FT                   ETSLALLDVSDQSAETIAPTAALTA"
FT   gene            complement(322189..322707)
FT                   /locus_tag="MAV_0330"
FT   CDS_pept        complement(322189..322707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64798"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZT04"
FT                   /protein_id="ABK64798.1"
FT                   /translation="MVKETSGVITLISAAFSIACTAHADLPKFPDLSADAPVNVRDYTI
FT                   DVPNPGRPPLPTVYFLTPDGVVCNFTPDQAQCSGNNLPSVPPAPSHPDAGITGVNWIGT
FT                   TTGLKQTNEGEPSRVVDGHPVKTLPPGHSITVDGIICGVDNSGTTACKDPQGRGFVLSP
FT                   HGSGWLPHV"
FT   gene            complement(322745..324382)
FT                   /locus_tag="MAV_0331"
FT   CDS_pept        complement(322745..324382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67602"
FT                   /db_xref="InterPro:IPR025442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZR0"
FT                   /protein_id="ABK67602.1"
FT                   /translation="MQLTNLSEAELIASAGGDPWAINQSLQAGSPFQISQLAQAFHTAG
FT                   RCTAEADHAFEDARKRFDAAWNHQNGDHPINDSDEVQRVTKSLGAQSLQLPKIGADLEG
FT                   IAASLAEAQKAGAQEIAELERELRGLDNITGAINHDLTLDLSASERSELESLKKAVHAD
FT                   AVDDVRDALKQMNSIRNGYSETLRKSMDSLHTEGYDPPTTVDTWMESPLKPGEVRDLGP
FT                   VAGTGGVPGIPGIGAADLGEVVEIPGQPGKYLAIFGDSFSGNKMGEGEHYRSVAVPVTF
FT                   DAEGHPHFGAPLTGPEGSGHELFPIPSDAKGVTDTLPSGTITLGDKTYMMVTGTKDDLK
FT                   PVASWLVEVNGDPGKGWTMVPGSFRGAGDAPTQVSGYKGSDGKVYIAADSFDRSRGITM
FT                   YRADPANVFERDKWQPWTGKDWGNPRDQAVQVTNDRYGELSFREIGGRPVLSGFNVDAH
FT                   KGSVEVRVGTSPTDMFGADVPTTLVVQNGDPGAPKFMPQPYGGYILPGSTLDDLKLLGS
FT                   QWNTAKDGNGVPIGTPYNTREFQLNPFH"
FT   gene            complement(324946..326079)
FT                   /locus_tag="MAV_0332"
FT   CDS_pept        complement(324946..326079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0332"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65310"
FT                   /db_xref="GOA:A0A0H2ZU81"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZU81"
FT                   /protein_id="ABK65310.1"
FT                   /translation="MERRTALKLPLLLAAGAAVARAPRASAEEAGRWSPERANRWYQAQ
FT                   GWLVGANYIPANAINQLEMFQPDTFDPRRIDTELGWAQFYGHNTARVFLHDQLWAADQR
FT                   GFQTRLGQFVDIAARHRIKPLFVFFDSCWDPQPRAGRQRPPRPGVHNSGWVQSPGAERL
FT                   GDPRYIPVMRDYVTSVMTQFRNDDRVLGWDLWNEPDNPARQYRNVERSDKEQLVANLLP
FT                   QVFRWARAVDASQPLTSGVWRGDWGQPQGRSAISDIQLANADVITFHSYAEPAGFESRI
FT                   NELTPLGRPILCTEYMARPRGSTVESILPVAKRHNVGAINWGLVAGKTQTYFPWESWDH
FT                   PYTSVPKVWFHDLIRPEGRPFQDIEALTVRKLAGSPT"
FT   gene            326265..326402
FT                   /locus_tag="MAV_0333"
FT   CDS_pept        326265..326402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0333"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66091"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW65"
FT                   /protein_id="ABK66091.1"
FT                   /translation="MDNESGNPIGVCGGLRPSSSMTAHGKIHPTQSAELLQTSPPRAQY
FT                   "
FT   gene            326533..326793
FT                   /locus_tag="MAV_0334"
FT   CDS_pept        326533..326793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0334"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66658"
FT                   /db_xref="InterPro:IPR018714"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXF5"
FT                   /protein_id="ABK66658.1"
FT                   /translation="MMTAEFLEHQRSIGNDLLTPVPEYRFPGLLPGDRWCVTALNWLRA
FT                   HHDGCAAPVVLASTHESTLEVVPLEALQEHKIDVPDDLANL"
FT   gene            326801..328066
FT                   /locus_tag="MAV_0335"
FT   CDS_pept        326801..328066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65401"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZST4"
FT                   /protein_id="ABK65401.1"
FT                   /translation="MGSAVDDIDFDDLTSPRLTDVQRQILEFTEAKPVDLDIDRMLAEA
FT                   IEQAGLPGADLDDTHGFVDRLHVHVAAIEADHGLRQLTRGSLRQRVVRLLRNRLSLTEL
FT                   LQRYPEIESIPIEQPFIVVGMPRSGTTHLVNLIACDPRRRALPYWESQEPIPARGQGPD
FT                   VFGVDPRYARAKAEHEALMASAPVVAAMHDRFPEAIEEEVELLDLDLASYVLEWHARVP
FT                   AWRDHYLSLDQTRHYAYLKKVLQALTFLRGPRTWVLKSPQHCEQLGPLMATFPDATIAF
FT                   THRDPVAVIQSAITMMAYSDRLRRTSIDPQWLLDYWSDRVHRLLSACVRDRDLVAPERS
FT                   VDISFHQLSGNEIPVIERLYERGGVELPQRVRDRFQRYLDGNPRGKHGRIRYQLQRHFG
FT                   ISADELRARFGFYFDKFDVRPE"
FT   gene            328078..329316
FT                   /locus_tag="MAV_0336"
FT   CDS_pept        328078..329316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0336"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66185"
FT                   /db_xref="GOA:A0A0H2ZUN0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUN0"
FT                   /protein_id="ABK66185.1"
FT                   /translation="MPEPVYRSRPGAEAMRPASAERADPIAPGLWCSPGLSNSYLLTTA
FT                   EGRVIVNTGMGFEGPVHRANFDAVDSSPVRYIVFTQGHVDHVGGLDSVRDPDTVVVAQA
FT                   NWTMWRDDNERLIPYRASRSAFAFKDTLAGGIKAIQRRLGTTRLPGQSVPVVDLDFEDT
FT                   LTLELGGRRMELISVPGGETTDSLVVWLPDERICLCGNTFGPLFGHIPNLVTMRGDRYR
FT                   DALTAIASVERVRGLRAELLVTGHFEPIAGADRIDEELTRLRDALGYLHDQTVAGMNAG
FT                   KDVRTLMREITLPTEYEVGQGYGKVSWDVRAIWENYSGWFHHESTTELYPVGFDAVAHD
FT                   VVELAGADALLDRARAHLAADRALHAIHLAQLLPAEHSGAREVLRQAHEKLLASSTNFW
FT                   ESAWLRHQIARNS"
FT   gene            329313..329795
FT                   /locus_tag="MAV_0337"
FT   CDS_pept        329313..329795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0337"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66932"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZY40"
FT                   /protein_id="ABK66932.1"
FT                   /translation="MTVFALRPEDFYHTGIIVPDLEAAMARLSALAGYRWITPVSYTLP
FT                   FRTVSGTREVTSTFVYSLQAPHVELIQEVPGTAWAAAPGNAVHHLGYWCDDLAQSAQLL
FT                   EDNGFAFEATADTAAPDLALFAYYVDAAGTRIEIVDRALFPDFPAFLQSAAAPEAQ"
FT   gene            329809..330783
FT                   /locus_tag="MAV_0338"
FT   CDS_pept        329809..330783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68739"
FT                   /db_xref="GOA:A0A0H3A493"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A493"
FT                   /protein_id="ABK68739.1"
FT                   /translation="MLLTVLRFNFASPHGDPRTQSRLMSAALELAQWGESHGITSVSVD
FT                   EHHATGHGWSCNPIMAAAMFLARTSTLIASVDCALGPLWNPVRLAEDIALVDNMSRGRL
FT                   HTTVGLGYRPVEYDALGADFGRRGALMDSLLERMLAVWSGGGAPAGICTGTWTRPHPPL
FT                   YVGGGARATARRAARFRLPLSLADHLPEIADYYRELCAEIDLAPVVLMPGPLNRGMIYL
FT                   HEDPERAWAELGDHILWEAVTYGGWSTDQRSLMHLPGVQTLDEVRASGRYRFLTPDQLI
FT                   AEVRDAPDFGPIVLHPLVGGMPVEEAWQSVQLLTDKVLPALKG"
FT   gene            complement(330795..331451)
FT                   /locus_tag="MAV_0339"
FT   CDS_pept        complement(330795..331451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0339"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68225"
FT                   /db_xref="GOA:A0A0H3A2J2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2J2"
FT                   /protein_id="ABK68225.1"
FT                   /translation="MAAIDISGTVRERAARELRDRILTGALPAGSRIDLDAITAEFATS
FT                   RTPVREALLELSFEGLVQVAPRSGVTVIGISPEDVLDSFTILGVLTGQAAAWAAERIGP
FT                   EELATLRELAAEVVAKSGDDSIGEANWHFHQMIHRAAHSPRLANQIKHAARVVPTNFLT
FT                   LFPEHEKHSLDEHAQLLDALGDKDVERARAIAERHVLDAGRSLAEWLEQRRDGER"
FT   gene            331513..332868
FT                   /locus_tag="MAV_0340"
FT   CDS_pept        331513..332868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0340"
FT                   /product="nitrilotriacetate monooxygenase component A"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67975"
FT                   /db_xref="GOA:A0A0H3A1T2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1T2"
FT                   /protein_id="ABK67975.1"
FT                   /translation="MRTDKMALVAFMQAGSTSVYAGSWRHPANEHRYLDAAYYAKIGRQ
FT                   LEEGCFDLMFFDDRLAMPGVYGGSVGEAVRYGARPVKLDLGVILGVLAQATSRIGLGAT
FT                   YSTTYYPPFHVARTFASLDHLSGGRAAWNVVTSVNDSEAQNFGVDAHLGHDERYDRADE
FT                   FMDVVTGLWDTWEDDAVLHDRVSGRYADPAKVHELGHVGEFFSARGPLTVPRTPQGRPV
FT                   IIQAGSSGRGREFASRWAELIFTGDPGIDVARSHYADQKDRIADAGRDPAAVRICPMAY
FT                   AVVGESEAHAKDREAMLLNDLVHPMASLTLLSELMNYDFAQHDLDDPVTDDILASVSGI
FT                   RGLVQNLRAHIGGDAVTVRDLANHRATLLQGPRFVGTGPQVADQMADWFQTGACDGFVL
FT                   AATHLPGAFEDVVRMVVPELQRRGLFRTEYRSATLRGHLGLPRPANARVAHA"
FT   gene            332861..334045
FT                   /locus_tag="MAV_0341"
FT   CDS_pept        332861..334045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0341"
FT                   /product="caib/baif family protein"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66101"
FT                   /db_xref="GOA:A0A0H2ZW74"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW74"
FT                   /protein_id="ABK66101.1"
FT                   /translation="MLDGLRVLDLATLAAAPLVATYLGEFGADVIKVEEPRHGDPIRGW
FT                   GNQRDGVGLMWKSISRNKKSITLDLRSADGQQLVRRLVEHADVAIFNTRPQTLRKWGLD
FT                   YESLRAVNERLVMLHITGYGLSGPKSERPGFGTLGEAMSGFAHITGQAGAPPTLPPFML
FT                   ADGVASLNAAYAVMMALYHRDVHGGPGQLIDVNLIDPLARLLEQTLLGYDQLGLVPERS
FT                   GNRWDISAPRNTYQTADGRWLAMSGSSPALALRVFRAIGRDDLLGDPDFSDPQRRLARA
FT                   REVDTLVADWVAGKTLSEAMAVFEAHEVAAAPVYDISDLVADEQLAHRGVFVSVDDQQL
FT                   GPMTVQAPVPRFSSASGTVEHLGPRLGEHNAEVYGELLGLTPDEIDQLRARGVV"
FT   gene            334063..334989
FT                   /locus_tag="MAV_0343"
FT   CDS_pept        334063..334989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0343"
FT                   /product="malyl-CoA lyase"
FT                   /note="identified by match to protein family HMM PF03328"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69262"
FT                   /db_xref="GOA:A0A0H3A5Q9"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A5Q9"
FT                   /protein_id="ABK69262.1"
FT                   /translation="MTQLLRRSELAVPASNDNMFDKAAGCGADLVFLDLEDAVPPAFKE
FT                   ESRGKAISALNDLDWGRTARAVRINGLDTPWCHDDLIEVVTAAGRNLDTVIIPKARRAR
FT                   DVWWVDVLLSQLEAKLNLGNKIRLEVLIEEVEGLANAEEIAVASPRLDALIFGVGDFSL
FT                   SQGARVDTNFVPLGEYPGDFWQYARNKVIVAARIAGIDAIDAPYPDYRDLAGYERDARR
FT                   AALMGYTGKWAIHPDQVPVANRVYAPTADEIARAEANLAAYREAESNGRGAVGVNGVLV
FT                   DAAHVKMAQQTLARAALINGTGGSNDR"
FT   gene            complement(334986..338369)
FT                   /gene="pyc"
FT                   /locus_tag="MAV_0342"
FT   CDS_pept        complement(334986..338369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyc"
FT                   /locus_tag="MAV_0342"
FT                   /product="pyruvate carboxylase"
FT                   /EC_number="6.4.1.1"
FT                   /note="identified by match to protein family HMM PF00289;
FT                   match to protein family HMM PF00364; match to protein
FT                   family HMM PF00682; match to protein family HMM PF02436;
FT                   match to protein family HMM PF02785; match to protein
FT                   family HMM PF02786; match to protein family HMM TIGR01235"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67280"
FT                   /db_xref="GOA:A0A0H2ZXB3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXB3"
FT                   /protein_id="ABK67280.1"
FT                   /translation="MLAKVLVANRGEIAIRAFRAAYELEMATVAVYPYEDRNSVHRLKA
FT                   DESYQIGEEGHPVRAYLSVDEIVGTALACGADAIYPGYGFLSENPDLAAACAAAGITFV
FT                   GPSAEVLELTGDKSRAIAAARAAGLPVLASSPPSTSVQELLSAAETMTFPLFVKAVAGG
FT                   GGRGMRRVTDPGALAEAIEAASREAESAFGDASVFLEQAVINPRHIEVQILADTHGNVM
FT                   HLYERDCSVQRRHQKVIEIAPAPNLDPALRERICADAVAFARSIGYTCAGTVEFLLDER
FT                   GNHVFIEMNPRIQVEHTVTEEITDVDLVSAQLRIASGQTLEEIGLSQDSVISRGAALQC
FT                   RITTEDPANGFRPDTGRITAYRTPGGAGIRLDGGTTLGAEISAHFDSMLIKLTCRGRDF
FT                   PTAVRRARRAVAEFRIRGVSTNIPFLQAVLDDPDFQAGRITTSFIEQRPQLLTARSSAD
FT                   RGTKILNYLADVTVNKPHGERPSAVYPHDKLPDIDLAASPPAGSKQRLTELGPERFAAW
FT                   LRESGGVGVTDTTFRDAHQSLLATRVRTSGLLKVAPYIARTMPQLLSVECWGGATYDVA
FT                   LRFLKEDPWERLTALREAMPNICLQMLLRGRNTVGYTPYPETVTTAFVAEATETGIDIF
FT                   RIFDALNNVDSMRPAIDAVRETGSAIAEVAMSYTGDLSDPAEKLYTLDYYLKLADQIVE
FT                   AGAHVLAIKDMAGLLRAPAAATLVSALKSRFDLPVHVHTHDTPGGQLATYVAAWQAGAD
FT                   AVDGAAAPLAGTTSQPALSSIVAAAANTEYDTGLSLPAVCDLEPYWEALRKVYAPFESG
FT                   LPAPTGRVYHHEIPGGQLSNLRQQAIALGLGDRFEDIENAYAGADAILGHLVKVTPSSK
FT                   VVGDLALALVGAGVGAQDFAEDPSRYDIPDSVIGFLRGELGDPPGGWPEPLRTKALQGR
FT                   GPAKPEQPLTAEDEAALAAPGARRQAALNRLLFPGPTKELEEHREQYGDTSGLSANQFF
FT                   YGLRQGDEHRVELERGVELLIGLEAISDPDERGMRTVMCILNGQLRPVVVRDRSIAIDV
FT                   PAAEKADRANPDHIAAPFAGVVTVAAEVGRQVEAGQTIATIEAMKMEAAVTSPKSGKVA
FT                   RIAVSRTAQVEGGDLLMVID"
FT   gene            complement(338375..339502)
FT                   /locus_tag="MAV_0344"
FT   CDS_pept        complement(338375..339502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0344"
FT                   /product="citrate synthase 2"
FT                   /EC_number="2.3.3.1"
FT                   /note="identified by match to protein family HMM PF00285;
FT                   match to protein family HMM TIGR01800"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65561"
FT                   /db_xref="GOA:A0A0H2ZUR1"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUR1"
FT                   /protein_id="ABK65561.1"
FT                   /translation="MSTLEDNQPRIHKGLAGVVVDTTAISKVVPETNSLTYRGYAVQDL
FT                   AAHCSFEQVAYLLWYGELPDDQQLALFSQRERAARRLNRSQLSLLHKLPDTCHPMDVVR
FT                   TFISSMGAEDPDEDDNSASANHAKALRMFAVLPTIVAADMRRRRGLEPIAPHSHMSYAQ
FT                   NFLHMCFGDVPEQVIVDAFEQSMILYAEHSFNASTFAARVVTSTQSDIYSAVTAAIGAL
FT                   KGSLHGGANEAVMHDMLEIGTPDRAAEWLQGKLSRKEKVMGFGHRVYKNGDSRVPTMKQ
FT                   ALQRVAAVRDGQKWLDIYQILERGMARANGIKPNLDFPTGPAYYLMGFDIGAFTPIFVM
FT                   SRITGWTAHIIEQTASNALIRPLSEYVGPPQRALS"
FT   gene            complement(339514..340416)
FT                   /gene="prpB"
FT                   /locus_tag="MAV_0345"
FT   CDS_pept        complement(339514..340416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpB"
FT                   /locus_tag="MAV_0345"
FT                   /product="methylisocitrate lyase"
FT                   /EC_number="4.1.3.30"
FT                   /note="identified by match to protein family HMM TIGR02317"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68690"
FT                   /db_xref="GOA:A0A0H3A273"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A273"
FT                   /protein_id="ABK68690.1"
FT                   /translation="MRDMIGAARSPEQKRAQLRAALESGRLQRFPGAFSPLVAKLVAEL
FT                   GFDGVYVSGAALSADLGLPDIGLTTLTEVSGRGAQIAAVTELPTLIDADTGFGEPLNAA
FT                   RTVTMLEYAGLAGCHLEDQVNPKRCGHLDGKAVVPVDEMVRRLRAAVSARRDPNFVVCA
FT                   RTDAAAIEGLPAAIERARAYADAGADLIFTEALQCPTEFERFRAALDTPLLANMTEFGK
FT                   SPLLGADRLADIGYNVVIYPVTTLRLAMHAVEAGLREIADTGTQSGLLDRMQHRSRLYQ
FT                   LLRYADYNHFDSDIYNFPR"
FT   gene            complement(340416..341921)
FT                   /locus_tag="MAV_0346"
FT   CDS_pept        complement(340416..341921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0346"
FT                   /product="2-methylcitrate dehydratase 2"
FT                   /EC_number="4.2.1.79"
FT                   /note="identified by match to protein family HMM PF03972"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64498"
FT                   /db_xref="GOA:A0A0H2ZRT2"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZRT2"
FT                   /protein_id="ABK64498.1"
FT                   /translation="MRIHDVRTRRSAEDFPRSEHLAWKIAEVAADPVAVPAETEAMVIN
FT                   RVIDNAAVSAASVLRRPVTVARAQAQAHPAAAKGAKVFGIRGDYSPEWAAWANGVAVRE
FT                   LDFHDTFLAAEYSHPGDNIPALVAVAQHVGVGGADLIRGIATGYEIQIDLARGICLHEH
FT                   KIDHVAHLGPSVAAGLGTMLRLDPETIYQAIGQALHLTTSTRQSRKGLISSWKAYAPAW
FT                   AGKVAIEAVDRAMRKEGAPAPIWEGEDGVIAWLLSGPEHTYRVPLPEPGEPKRAILDSY
FT                   TKEHSAEYQSQALIDLARRMRERIGDLNQIATIVLHTSHHTHYVIGTGAGDPQKFDPDA
FT                   SRETLDHSVMYIFAVALQDGSWHHERSYAPERAHRPDTVELWRKISTVEDPEWTRRYHS
FT                   TDPNDKAFGARAVVTLKSGEVIVDELAVADAHPLGARPFERTQYVGKFHELAEGVVTDA
FT                   EQQRFLSVAEGLPALPPGAAGELNIVVDPAVLATAPAIPGGIF"
FT   gene            342041..343465
FT                   /locus_tag="MAV_0348"
FT   CDS_pept        342041..343465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0348"
FT                   /product="transcriptional regulator, XRE family protein"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM PF06114"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67152"
FT                   /db_xref="GOA:A0A0H2ZZN2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZN2"
FT                   /protein_id="ABK67152.1"
FT                   /translation="MAKTFAGARLRRLREEQGLTQVALARVLGLSTSYVNQLENDQRPI
FT                   TVPVLLTLTERFDLPTQYFAPDSDARLIADLREVLAETPATPGQVEELVARMPAIGQTL
FT                   VNLHRRLHDTTADLEALYSRANLDISDTPGLPHQPMPFEEVRDFFYDRKNYIGELDVAA
FT                   EEMFDHNRLRIGGLDGQLAQLLGEQLGVAVVIDDGQLLAPNSKRLFDPESKTVYLARWL
FT                   HPGQRAFQLATQIALLTQPELITAIIAGDDQLSDDARGVARIGLANYFAGALLLPYRRF
FT                   LDAAERVRYDIDQLSRRFEVGFETVCHRLSTLQRPNARGVPFIFVRTDSAGNISKRQSA
FT                   TAFHFSRVGGNCPLWVVHHAFSRPGQFLTQVAQMPDDRTYFWIARTTSGGPSRYLGPHK
FT                   SFAIGLGCDVDHADKLIYSVGIDLRDTESIVPIGAGCKICDRPACPQRAFPYLGRPVSV
FT                   DPHRSTDLPYPPAITP"
FT   gene            complement(343455..344333)
FT                   /locus_tag="MAV_0347"
FT   CDS_pept        complement(343455..344333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0347"
FT                   /product="kinase, PfkB family protein"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65058"
FT                   /db_xref="GOA:A0A0H2ZTL4"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTL4"
FT                   /protein_id="ABK65058.1"
FT                   /translation="MVVIGQIGRDLVLRTDRPPTAGESATVLRREELLGGKGANQAVGL
FT                   AQLGVPVTLIGVVGDDQAGTSILQQAQRDGIDVSKVARRGTTALLVDVVAAPPERMLLE
FT                   DVPDSSLVRVADLDRSSSLFDTADTVSIQLQQPAATALEAAQRARQRGLRVVADGVPAP
FT                   QVRADLLATLDVLRADATEASIIAGTEITTVEQAFELADHLLSGGPELVALAVPDVGDL
FT                   LTWRGGSELFEFADVEVVDPTGAGDAFVAGLVAALREGAAPREAGRRAAAAAGATVQRL
FT                   GGRPDLTGLRA"
FT   gene            344443..345432
FT                   /locus_tag="MAV_0349"
FT   CDS_pept        344443..345432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0349"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein"
FT                   /note="identified by similarity to GB:BAB40320.1; match to
FT                   protein family HMM PF00389; match to protein family HMM
FT                   PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65440"
FT                   /db_xref="GOA:A0A0H2ZUL8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUL8"
FT                   /protein_id="ABK65440.1"
FT                   /translation="MPRLAILDDYARVALQVADWSRVQKRCDITVFDEHLSEQQAVDAL
FT                   RPFDVVCTMRERMAFPRSLIERLPHLRLLTIVGRQLPNLDMAAATEHGIAVARSEFAHP
FT                   RFAALRDATPELAWGLMIATVRHLADEHRQMRAGGWQRTAGMTLSGKTLGLLGLGRVGS
FT                   RMAGFAAAFGMEVIAWSQNLTDDAAAAVGARRVSKAALFESADVVSVHLVLSERTRGLV
FT                   GEPELALMKPSAYLINTARGPIVDEPALIAALTAGRIAGAGLDVYDVEPLPGDHPLRSL
FT                   PNVTLSPHLGYVTREMLGAFYADTVESVLAWLDGTPIRIANPEVLQRD"
FT   gene            complement(345439..346035)
FT                   /locus_tag="MAV_0350"
FT   CDS_pept        complement(345439..346035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0350"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67313"
FT                   /db_xref="GOA:A0A0H3A030"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A030"
FT                   /protein_id="ABK67313.1"
FT                   /translation="MTPESLRDRQRAQIRADIRRAAFRLFVERGYDAVTTEEIATAAGV
FT                   SPRTFFRHVPAKEELLLAPVRYGGAAIVHLLEGRPAGESPDVALINAIITRTRSFEPAD
FT                   TEEWRQALLVAPGLLDKVTVHRPADKERATKLIADRMRVDPHTDIRPGLLVQLAFAAAD
FT                   FGFQQWVLQSGRRWPLDRYVAEALKAVKSPHWRRK"
FT   gene            complement(346032..346805)
FT                   /locus_tag="MAV_0351"
FT   CDS_pept        complement(346032..346805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0351"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69520"
FT                   /db_xref="GOA:A0A0H3A417"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A417"
FT                   /protein_id="ABK69520.1"
FT                   /translation="MSYSHPDSMRGQVAIVTGAAQGVGKGIAAALLERGAAVLLVDIQQ
FT                   ETLEATAAELRALGRVERLVTDLRDPDSAPRIAAAAVDAFGSVHGLVNNAIATNEPKAF
FT                   VDITTDDLALGYEVGPRATFLLMQAVHPLLVKEGGGAIVNLGSGTGTGGEPRWGGYAAA
FT                   KEGIRGLSKVAALEWGRDNIRVNVVCPFAESDGVKLWKQFAPNDYAKAVGRVPMKRIGD
FT                   VRTDVGALVAFLLSTDATFITGQTIHVDGGIGCFR"
FT   gene            complement(346802..347011)
FT                   /locus_tag="MAV_0352"
FT   CDS_pept        complement(346802..347011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0352"
FT                   /product="lactoylglutathione lyase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66623"
FT                   /db_xref="GOA:A0A0H2ZXC9"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXC9"
FT                   /protein_id="ABK66623.1"
FT                   /translation="MSPVLDDAHRRFVSAGYQPDQEPFEIGGVRMFFVKDPDGTPVEFI
FT                   ELPGGARSTYEMHRGVRLRLGPVT"
FT   gene            complement(347008..348087)
FT                   /locus_tag="MAV_0353"
FT   CDS_pept        complement(347008..348087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0353"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66366"
FT                   /db_xref="GOA:A0A0H2ZXH7"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXH7"
FT                   /protein_id="ABK66366.1"
FT                   /translation="MSSPSKLRVIQWASGGVGKAAIQCVLNHPRLELAGCWVHSAEKNG
FT                   VDVGRIIGTQELGVTASTSVDEVLALDADCVVYSPLIPNDDEVIAILRSGKNVVTPVGW
FT                   VYPDPGNPRHRAVADAALESGVTLHGSGIHPGGITERFPLMVSSLSSAVTHVRAEEFSD
FT                   IRTYNAPDVVRHIMGFGGTPEEATGGPMAGLLDGGFKQSVRMIADHMGFRIDPNIRTIQ
FT                   DVAVATADIDYDPFPITAGTVAARRFRWQALVDGEPVITAAVNWLMGEQNLDPAWDFGG
FT                   RGERFEVEITGDPDVSLTFKGLQPETIAEGLVKNPGVVVTANHCVNAIPDVCAAAPGIK
FT                   TYLDLPLFAGRPAPGLATS"
FT   gene            348205..349062
FT                   /locus_tag="MAV_0354"
FT   CDS_pept        348205..349062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0354"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family protein"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65788"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVB7"
FT                   /protein_id="ABK65788.1"
FT                   /translation="MGVLEGKVAIVTGTSRGVGVGIAHELLRAGATVVGCARSPLDTIP
FT                   GIEPDWAERAFQRVCDQGDYRGIDAFVTDVVATHGRVDILVNNAGGTVPAPHAETIPEL
FT                   VQRIQGSPAADDDYARTALFHAFAVQMNLIGPLWFAIRAYRQMQTQDGMGCIINISSGA
FT                   GHPAGAPTLVSYGAAKSGLNHLTRSLAQEWGPKVRVNCVALGPTMTENFRSFVLPKDDP
FT                   TGEKYFAAVPLRRAGEPAEVGRICVFLAGGQADFVNGTTIECDGGMLPGVLYDAGLKTI
FT                   TDLL"
FT   gene            349101..350456
FT                   /locus_tag="MAV_0355"
FT   CDS_pept        349101..350456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0355"
FT                   /product="bifunctional wax ester
FT                   synthase/acyl-CoAdiacylglycerol acyltransferase"
FT                   /note="identified by match to protein family HMM PF03007;
FT                   match to protein family HMM TIGR02946"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66610"
FT                   /db_xref="GOA:A0A0H2ZY76"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZY76"
FT                   /protein_id="ABK66610.1"
FT                   /translation="MELIMPTDAVFLLGESREHPMHVGGLQLYQPPEGAGRNFVRDFYK
FT                   QLVAQPDFQPTFRKHPAKFVGGIANLGWSYDADVDVDYHVRRSALPSPRRVRELLELTS
FT                   RWHSSLLDRHRPLWETHIVEGLKDGRFAIYTKVHHALIDGVSAQKLMQRALSSDPDDPE
FT                   IRAPWTLPKRSRKAGPSSRLSSLVHAAGSVAALAPSTVSLARAALVEQQLTLPFGAPRT
FT                   MLNVKIGGARRCAAQSWPLERIKNVKNAAGVTVNDVVLAMCSGALRYYLLEQNALPDTP
FT                   LIAMVPVSLRTEEEADAGGNLVGAILCNLATDSDDPAQRLLTISESMRSNKKVFSQLPR
FT                   FQALALSAANLSSLALAAVPGWVSATSPPFNIVISNVPGPTAPLYYGGARLDGNYPLSI
FT                   VLDGQALNITLASNAGNLDFGLVGCRRSVPHLQRLLMHLESSLKDLERAVGE"
FT   gene            350463..350948
FT                   /locus_tag="MAV_0356"
FT   CDS_pept        350463..350948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0356"
FT                   /product="nudix hydrolase"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65817"
FT                   /db_xref="GOA:A0A0H2ZVV0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVV0"
FT                   /protein_id="ABK65817.1"
FT                   /translation="MPKLSAGVLLYRTGDGVVEVLIAHPGGPFWARKDDGAWSIPKGEY
FT                   DEGEEPWPAARREFAEELGLAVPPGERIDLGTLKQSGGKLVTVFAVHGDLDVTEARSNT
FT                   FALEWPKGSGTLREFPEVDRVGWFPVAAARTKLLKSQHGFLDRLMAQPAVAGLSEGT"
FT   gene            350950..351855
FT                   /locus_tag="MAV_0357"
FT   CDS_pept        350950..351855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0357"
FT                   /product="haloalkane dehalogenase"
FT                   /EC_number="3.8.1.5"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65442"
FT                   /db_xref="GOA:A0A0H2ZUV0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUV0"
FT                   /protein_id="ABK65442.1"
FT                   /translation="MHTLRTPDDRFHTVPDFPYPPRYCEVSDDDGGALRVAWVEDGPAG
FT                   ADPVLMLHGEPSWSYLYRKMIPVLAGAGHRVVCPDLVGFGRSDKPTRREDHSYARHVEW
FT                   MRAVAFDVLDLHNVTLVGQDWGGLIGLRLAAEHPERFARMVVANTGLPNGDQPMADVWW
FT                   RFREAITSAPQLNIGAFVQGGCRRRLSDAERAGYDAPFPSDEYCAGPRAMPTLVPTSPE
FT                   DPAAAANKAAWAKLAVSPTPMLVAFSDSDPITGPMAAIFQREMRGAQGIDHPLIRGAGH
FT                   FLQEDAGAELAGHIVEFLRR"
FT   gene            351892..353127
FT                   /locus_tag="MAV_0358"
FT   CDS_pept        351892..353127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0358"
FT                   /product="cytochrome P450"
FT                   /note="identified by match to protein family HMM PF00067"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64707"
FT                   /db_xref="GOA:A0A0H2ZR37"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZR37"
FT                   /protein_id="ABK64707.1"
FT                   /translation="MTTAPTESAESQGLLLQLLDPANRADPYRLYAQFRERGALQLPEA
FT                   NLAVFLSYRDCDEVLRHPSSSSDNVNSTVAKRQAAAGTAPVRQGPPGFLFLDPPDHTRL
FT                   RRLVSKAFAPRVVAALEPDIRSLVDGLLDRAADRGELEIVEDFAYPLPVAVICRLLGVP
FT                   LDDEPQFSRASALLAQALDPFSTITGVPAEVASERQQAGTWLRDYFHQLIEARRSRPGD
FT                   DLLSGLIAVEESGDQLTEEEIVSTCNLLLIAGHETTVNLIGNAVLAMLRDPGQWAALGA
FT                   DPGRAPAIVEETLRYDPPVQLAGQIALDDMVIGGVEVPAGDVMMLLLAAANRDPAEFDR
FT                   PDTFDPDRKSLRHLGFGRGVHYCLGAPLARLEAGVALSAVTARFPRARLDGEPQYKTNV
FT                   TLRGLSRLVVAV"
FT   gene            complement(353273..353635)
FT                   /locus_tag="MAV_0359"
FT   CDS_pept        complement(353273..353635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0359"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A4Y0"
FT                   /protein_id="ABK69465.1"
FT                   /translation="MTAFQDLPLADRDREWDGDAAEKRVRKWAGAQDEPNEKYRDAHVW
FT                   YDADKKENFTAYKLLIADVIGGELKAVPRGVMAAGAIMDGARGGIDVPKSDIDRIKSHL
FT                   AKYYQKMGESPPWERS"
FT   gene            353728..354075
FT                   /locus_tag="MAV_0361"
FT   CDS_pept        353728..354075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69365"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A4Q7"
FT                   /protein_id="ABK69365.1"
FT                   /translation="MNTTHHRKPIVAGALLAGGIAAAGLGIASAAAQPSAPHLIGPLPT
FT                   DNFTVPHDWCPGQPLPMPDVRWDMNVCHHWYWVPVGGMGNVGQFVWEGDAPRQPLGGPP
FT                   CYGAPICLPGL"
FT   gene            complement(354042..355136)
FT                   /locus_tag="MAV_0360"
FT   CDS_pept        complement(354042..355136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0360"
FT                   /product="DNA ligase"
FT                   /note="identified by match to protein family HMM PF01068;
FT                   match to protein family HMM PF04679"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65986"
FT                   /db_xref="GOA:A0A0H2ZU69"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZU69"
FT                   /protein_id="ABK65986.1"
FT                   /translation="MPPVSPMLAKSVGAIPPAASYEPKWDGFRSICFRDGDEVELGSRN
FT                   ERPMTRYFPELVAAVRAELPQRCVIDGEIVIATDHGLDFEALQQRIHPAESRVRMLAEA
FT                   TPASFIAFDLLALGDEDYTGRPFRERRAALLEAVGGPGPSIHVTPATTDLDTARRWFDE
FT                   FEGAGLDGVVAKPLDITYQPDKRVMFKIKHERTADCVVAGYRVHKSGADAIGSLLLGLY
FT                   QDDGQLASVGVIGAFPMAERRRLFTELQPLVTDFEDHPWNWAAHQAGERTPRKNEFSRW
FT                   NAGKDLSFVPLRPERVVEVRYDHMEGRRFRHTAQFNRWRPDRDPRSCTYEQLEQPVTFR
FT                   LGDIVPGLGASRADHKPGKQIGAP"
FT   gene            355178..356206
FT                   /gene="ligD"
FT                   /locus_tag="MAV_0362"
FT   CDS_pept        355178..356206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligD"
FT                   /locus_tag="MAV_0362"
FT                   /product="DNA polymerase LigD, polymerase domain"
FT                   /note="identified by match to protein family HMM TIGR02778"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68595"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1W1"
FT                   /protein_id="ABK68595.1"
FT                   /translation="MAAAEEVDVDGIAVRLTNPDKVYFPKLGSKGTKRHLIDYYRAVAG
FT                   GPMLDALRDRPTHLQRFPDGIDGEEIYQKRIPQHHPDYLQTCRVTFPSGRTADALKVTH
FT                   PAAIVWAAQMGTVTLHPWQVRCPETDHPDELRIDLDPQPGVAFAQARSVAVDVLRPLLD
FT                   ELGLVGYPKTSGGRGIHVFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTSWWKEER
FT                   GARIFIDFNQNARDRTMASAYSVRRTPIATVSMPLTWDQLAGADPDDYTMATVPDLVSA
FT                   RENPWAAIDDVAQSIGPLLRMAEADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTEHKK
FT                   KN"
FT   gene            356245..356403
FT                   /locus_tag="MAV_0363"
FT   CDS_pept        356245..356403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0363"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67864"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1H9"
FT                   /protein_id="ABK67864.1"
FT                   /translation="MQSMVTGVVQAEVVMAVAARTMPRTSLYFKRDITTPFVEKECFAR
FT                   ERLSYVS"
FT   gene            356608..358620
FT                   /locus_tag="MAV_0365"
FT   CDS_pept        356608..358620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0365"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67495"
FT                   /db_xref="InterPro:IPR021345"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYP2"
FT                   /protein_id="ABK67495.1"
FT                   /translation="MFALLMLVIAGTGSAAAQPSPSTARPFGDRLVGWDTYRRLDLLPY
FT                   LSADTQSLQLSSFDRSGGDFDISTGNKNGTGGCLAPSGAGCVIAEDHGAGEVDSIWLTR
FT                   DGGNLRAIGNIRVELDGQTVLDTPVQSLVDGQLGAPFVWPLVANAGESPGGDYIKVPMP
FT                   YRRSMRISVESHLEYYHVDYRQFPTAEGVSTFSPADPAVDVLDRFRAAGTVDPKPAAPG
FT                   EVHSNRVIELPGGAEQTIAESTGPASISALRLYLPAPADQPLTGLRLRIEFDGRTTVDS
FT                   PLGEFFGAGLGPTPVRSLMFAAFPQPDGSMALWCWWPMPFARSARVSLANTGAGPVSAI
FT                   AAEVTTTPDARWAGALASGRAGYFTARSHAGPTILGQDWLFADEQGRGKFVGVSQTIRG
FT                   QRTRTAFSDNAPYFLEGAERVYTDGAASPQWYGTGTEDLYEGGWYFKDGTHFSDPLNGQ
FT                   PDQRTATAGCADYCVAVYRIMPAEAIGYHSALRFGIEHGKRNMVEPDYSSTAFLYTQPD
FT                   AELTGTDDVNPTDPLSRALHGYTDTDAIDQLLVSEYEGTEDTRPVAGTVRSAQGAITFH
FT                   VQVDPDNHGVLLRRSGDQVNGFQSADVAIDGAPVGNWFQPRANPFHRWLDDTYPVPGSV
FT                   TAGKAELTVTLTPTAGSPPWTASRYHVDALVGPSG"
FT   gene            complement(358561..359616)
FT                   /locus_tag="MAV_0364"
FT   CDS_pept        complement(358561..359616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0364"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68200"
FT                   /db_xref="GOA:A0A0H3A285"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A285"
FT                   /protein_id="ABK68200.1"
FT                   /translation="MSLLTLPSSRPMPTSTDRMLGDRPNLCRRPCLAASRRVRQDAAGG
FT                   RRSVKICGIGVKASLRTRHRPAPTGTVTGMTVVEFTGGAAPRGARPRRSTLPGPGSVRV
FT                   TAAYAAALLVVYLVLAALGPHARQVAVSRMSTNVHNLGRGQLGTLIGSAFVDDGGQLFF
FT                   WLPGLVCLLALGELLWRGKGLLVTFAVGHIGATMIVAVGLVAAIESGMLPASVARASDV
FT                   GISYGAMCVLGAITAALPVRWRGVWAGWWLGTAVVATVGADFTAVGHVVALLLGIGLSF
FT                   RLRSTASWTPVHLALLCVGATFGYLLLAGAASMAPIGGLAGAFIGVLARRPLAGRPDER
FT                   VDVVAAGRPGR"
FT   gene            359623..360825
FT                   /locus_tag="MAV_0366"
FT   CDS_pept        359623..360825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0366"
FT                   /product="cytochrome P450 superfamily protein"
FT                   /note="identified by match to protein family HMM PF00067"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68229"
FT                   /db_xref="GOA:A0A0H3A2A4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2A4"
FT                   /protein_id="ABK68229.1"
FT                   /translation="MTVANDTAVYYDPYDIGIITDPYPTYARLREEAPIYYNERYDFWA
FT                   LSRHSDVERALANWQVFSNRRSDILELIQSKFDMPGGVMMFQDPPEHTVLRGLMSRVFT
FT                   PRRMAALEDQIRQYCIRCLDPLVGSSSFDIIAELASMMPMRVIGMLLGIPESEQVSVRD
FT                   ANDANLRTKPGAPLRVADADSIADGRIYADYVEWRSKNPSDDLMTTLLNVEFDDEDGVR
FT                   RKLTRKEVLHYTQVVAGAGNETTGRLIGWLAKVLAEHPDQRREVYRDRSLLTRTVDETL
FT                   RFEPTGPHVARWMAADFECYGTTVPAGSAMLLLFGAANRDPRRYTDPDTFNIHRDNISH
FT                   ITFGKGVHYCLGANLARLEGRVALDELLNRWPEWDIDYDTAQLASTSTVRGWERLRIVV
FT                   P"
FT   gene            complement(360830..361405)
FT                   /locus_tag="MAV_0367"
FT   CDS_pept        complement(360830..361405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0367"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67522"
FT                   /db_xref="GOA:A0A0H2ZXX5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXX5"
FT                   /protein_id="ABK67522.1"
FT                   /translation="MTRRPHPGDSTTRDLLIDATIKVMVEDGYAAATSRRVAAEAGVKP
FT                   ALVHYYFPTMDELYLDVFRRGAAAYQERQTRALTSDRPLHALWDTLIEPKDTRLLLEFM
FT                   GLANHRKAIRAELAAWFGRWRDTQITALNSIVREHDMDAGEFPPAGIAVILAAIGRMLI
FT                   LEDALGATAGHDAAVALVNRFIDRFELP"
FT   gene            complement(361365..362384)
FT                   /pseudo
FT                   /locus_tag="MAV_0368"
FT                   /note="oxidoreductase; this gene contains a frame shift
FT                   which is not the result of sequencing error; identified by
FT                   match to protein family protein HMM PF00106; match to
FT                   protein family protein HMM PF01073; match to protein family
FT                   protein HMM PF01370; match to protein family protein HMM
FT                   PF07993"
FT   gene            complement(362407..363102)
FT                   /locus_tag="MAV_0369"
FT   CDS_pept        complement(362407..363102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0369"
FT                   /product="serine esterase cutinase"
FT                   /note="identified by match to protein family HMM PF01083"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65326"
FT                   /db_xref="GOA:A0A0H2ZU41"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZU41"
FT                   /protein_id="ABK65326.1"
FT                   /translation="MSFQVRAALTVLTAAAALCVAPMPGAPAAGADPCPDVEVVFARGS
FT                   GEPPGIGGIGQPFVDALRSQIGSRSLAVYAVKYPASTDFSNPDFPATVIDGIRDASSHL
FT                   ESMVASCPNTREVLGGYSQGAAVAGYTTSAVVPPGVPASAVPPPMPPEVAKHVAAVTLF
FT                   GTPSGQFLQKYHAPPLAIGPLYQPKTLQLCAVGDPICGTGGGNDLAAHTSYPVNGMTNQ
FT                   AAQYVFSHL"
FT   gene            363163..363315
FT                   /locus_tag="MAV_0370"
FT   CDS_pept        363163..363315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0370"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67272"
FT                   /db_xref="GOA:A0A0H2ZZY9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZY9"
FT                   /protein_id="ABK67272.1"
FT                   /translation="MSTAIVVAVVAGLMLLGIGIVVNQLLRLRRYLNESPPDRSGDPEP
FT                   PERAD"
FT   gene            complement(363331..364398)
FT                   /gene="dapB"
FT                   /locus_tag="MAV_0371"
FT   CDS_pept        complement(363331..364398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="MAV_0371"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="identified by match to protein family HMM PF01113"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64773"
FT                   /db_xref="GOA:A0A0H2ZR66"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZR66"
FT                   /protein_id="ABK64773.1"
FT                   /translation="MPNTYRVVQWNTGNVGKSSLKSIVTNPTLELVGCYAWSAEKVGRD
FT                   AGELVGIPPLGVAATNDVDELLALKPDCVVYNPMWIDVDELVRILSAGVNVVTTASFIT
FT                   GGNLGDGRDRILQACQQGGSTIFGSGVSPGFAELLAIVSAMVCNRIDKVTVNEAADTTF
FT                   YDSPETEKPVGFGQPIDHPDLPAMAAKGTAIFGEAVRLVGDALGVELDDVRCVAEFAQT
FT                   TEDLVMASWTIPAGHVAGTYISWQGIVGDQVLIDLNVRWRKGQTLDPDWKIEQDGWVIQ
FT                   IDGQPTVTTKVGFLPPPYFEATTIEEFMDLGHIMTAMPAINAIPAVVAAAPGIASYADL
FT                   PLTLPRGNAHVAGQP"
FT   gene            complement(364437..365573)
FT                   /locus_tag="MAV_0372"
FT   CDS_pept        complement(364437..365573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66954"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYY9"
FT                   /protein_id="ABK66954.1"
FT                   /translation="MRLVADSGLWTTGRADVTEEPPLVALLEVSGAVLSWTLDDPDDAP
FT                   PRLTFTDVSRADWLWRVLGEAGHVALVSAVRDAAVPAGGIELAGVDLAPGALAPLRRLA
FT                   TGHWLRRWWPASRQDGIAGLDRALLDAELALLTAGAQHFFPDDTLDSDVAGLLAPHATA
FT                   LLGHLVSPDPRVADLVRASAGLADGIGVDAGRWPELLAALDDSSLVVAPPSDRRDDYAL
FT                   AAGAGAGPRAAAIARGVASVAWSGVPPGVFDAAEDTVGWIIRVDGSAVVAVVQADVIGP
FT                   DPATGIAVRLRSAAVEGAGALDAAGRATFPLTGARGALTESAAWGHDWSATELQVGAAV
FT                   STESRHTRERVRRWARARLESPPRDAFLAERLAAESAY"
FT   gene            complement(365570..366904)
FT                   /locus_tag="MAV_0373"
FT   CDS_pept        complement(365570..366904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0373"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A103"
FT                   /protein_id="ABK67690.1"
FT                   /translation="MLMSAEPQPPTVPAGAAAGHPRRSVIEAAWRAIGPGVEVLSADDG
FT                   GPLSRTIKRIIDPLVLRLRSNPAYSAPVVTPETAAAMHELIVGSGPELRAAAAWFEALK
FT                   LERRRQRIRTGNAQELYFPVCFELAVTKGAPAPHDNETAAAVLADIHRDRDRTAIEVLH
FT                   RYAGNSDVVAALADQLQRSWRDVRAGPVDTGPFLAELATVLGMAGGHRGAAARQRVWSA
FT                   MITDATPYNLGALAHIDCASLPWSIVEVGLSSVEPQRVPEVAAASEGQRPLDRSVLDRV
FT                   RATLRRALDRDALPDIPLLCEEEVDRACAPWGLLAEDKQATLVAGIEVAVQLAPLDPSA
FT                   CCRDDLAAQIQARLRKEAYVLHARRYLAANGPIHPRQQQVVDDLAVFAQPYLNRLWARL
FT                   HGRDVWQEPCDDVDDVRALLDGVARSVSLDHRQRIKAMLELQVAG"
FT   gene            366949..367281
FT                   /locus_tag="MAV_0374"
FT   CDS_pept        366949..367281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0374"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66219"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWL8"
FT                   /protein_id="ABK66219.1"
FT                   /translation="MVADRPRHPERMNTLLRLADWLKSRRRRDVGNRTVGVGTVRKVKR
FT                   QVFIEVVAVSGETFIGKLARCDADLDLSVLRPGLVVLVAFDPAAREELSLPDDVLAVHA
FT                   AWVAAL"
FT   gene            complement(367284..368666)
FT                   /locus_tag="MAV_0375"
FT   CDS_pept        complement(367284..368666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0375"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64688"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSL6"
FT                   /protein_id="ABK64688.1"
FT                   /translation="MTESGRLTLVLRYADLGIATYASLRIVGQPERTVAWVVEEPLLLA
FT                   ALQELAAALPEPHDAENRRAAIGRALSTGAFAAPDTELTLAYILGVLLIGSAGWQLLTE
FT                   CVSSPRAVLFVSPSARLARVPWGLLAIPKSGPSKEELVRARQDAITAAGRAAAQIPWRL
FT                   GDLAALTDGHRLMELVEVLMAVPPNIVHAPRTATEWDARRDGPPLLVLDPRVPGQRPDS
FT                   ALGSVLGRPSPDTPVGRHFAELVRRRPVLPRVDAVVDLFRRRDADRRWLAGLLARSPCR
FT                   LLYVGHASSADDDHRHGGRADRAALHLADPAAVPGDANAIGDHRPLTASDLMALRLPMP
FT                   PRVALLACGSGGDYQFDEATGLVAAMILNGAQLVTATLWSLPTTAAYRQFAMPARGSPE
FT                   SVDPMADLVSAVDTAHDAPADAGCALNRWQRAQMRRWRDGDRVASPLYWAALATFTVDG
FT                   AR"
FT   gene            complement(368663..370351)
FT                   /locus_tag="MAV_0376"
FT   CDS_pept        complement(368663..370351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0376"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65392"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSM2"
FT                   /protein_id="ABK65392.1"
FT                   /translation="MSIPDGLQRARRMALAADEAGARDLLLSLIPRIERDDRDDLMLEV
FT                   LAQLGEIYLARGADDGVEESIRRIQDCLAAYASMPADAENARMICRYSRRARFLQTGLA
FT                   AARGDHEGAAAALDLLSDTGSEFPELAAEHAQLCARARVLCATALCDDDLHVQSVPLWD
FT                   KILEHIGDSGDDDENADHLWVTAATGYGRFCVETGRLAEAEPWLRRAEARADAHGWELA
FT                   RARAQLERATARWAANDHAGTEQLVSQAYPVIARHARAHDVARCWLYLGLTRLGSGALE
FT                   AADECWEHAERHWRELGKPLHLHRILLQRSWIAIFWSRFADAVELIAQARELLDSSPRS
FT                   SWLQYAQLDSHLGTVWRADALADLGFDSSGDPEESLQETEARQAEGLGILRGELGTPEY
FT                   RRGMSKLQQAAELKVPAALAVDSVRYSIADADARARWATTIAAPILAGAFAVAWEWENT
FT                   ALISELVEYHSARGTFEALQRPQTGEWASTAVASVPLDTGAEPAALAAAGPPVAGGVSL
FT                   TRLGPLPPLRMHPGEAPILDHYRTLAVQRYGRAVTADEPAWSTWP"
FT   gene            complement(370449..370907)
FT                   /locus_tag="MAV_0377"
FT   CDS_pept        complement(370449..370907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0377"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68406"
FT                   /db_xref="GOA:A0A0H3A2Q0"
FT                   /db_xref="InterPro:IPR008691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2Q0"
FT                   /protein_id="ABK68406.1"
FT                   /translation="MGCAAAAVTLVGCSSGGHSAAPASSTAPSASTGTNAQVKVGGADL
FT                   PGVNPASVTCVRTGGKIDIGSGSTGGAQQALAVVLTDEATPKVESLALVVDGNALAVSN
FT                   NMGAKVGSADVAVDGKTYTITGQAQGADMKNPMAGMITKDFSIKVSCG"
FT   gene            371084..371461
FT                   /locus_tag="MAV_0379"
FT   CDS_pept        371084..371461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0379"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1V9"
FT                   /protein_id="ABK69059.1"
FT                   /translation="MLSVKWLEAPEAHDFPAAADYLSMLADAQTVKKVIKKLKRATVMQ
FT                   RKAKDILRAARLDLLPVDNPHVAADLTKIEKGLPLSPILLVRGDFLAGVPLQIADGYHR
FT                   VCASYHTDENTPIPVLLAVAR"
FT   gene            complement(371458..372291)
FT                   /locus_tag="MAV_0378"
FT   CDS_pept        complement(371458..372291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0378"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67588"
FT                   /db_xref="GOA:A0A0H3A0U2"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0U2"
FT                   /protein_id="ABK67588.1"
FT                   /translation="MGRKVAIPWHASFSIAAGVLYFFFVLPRWPELMGDTTHSLGTALR
FT                   IVAGVLAALAALPVVFTLLRTRKPELGTPQLALSLRVASIVAHVLAGLLIIGTAVSEIW
FT                   LSLDAAGRWLFGIYGAAAAIALLGIFAFYLSFVAELPPPPPKPIKAKKPKKRRLRRKKA
FT                   GEEVETAETAEAEEAEAEEADETEAAQTVTAETEAAEAAGETEAAEDTAEAEKPAANEP
FT                   EAETLVAEDSDESRAKLRNRRPTGKGTHRMRRRRTRAGVAVDQTAEQSGDDADED"
FT   gene            complement(372356..372444)
FT                   /locus_tag="MAV_0380"
FT   tRNA            complement(372356..372444)
FT                   /locus_tag="MAV_0380"
FT                   /product="tRNA-Ser"
FT   gene            372870..374156
FT                   /locus_tag="MAV_0381"
FT   CDS_pept        372870..374156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0381"
FT                   /product="aspartate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66025"
FT                   /db_xref="GOA:A0A0H2ZW23"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW23"
FT                   /protein_id="ABK66025.1"
FT                   /translation="MVSLESLTPAELAEVHARHQQGYADLQAKKLSLDLTRGKPAPAQL
FT                   DLSNALLSLPGDDYRDSEGTDTRNYGGLHGLPELRAIFGELLGIPVQNLIAGNNSSLEL
FT                   MHDLVAFSMLYGGVDSQRPWKDEPSVKFLCPVPGYDRHFAITETMGIEMIPVPMLSDGP
FT                   DVGLIEELVAADPAIKGMWTVPVFGNPTGVTYSWDTVLRLVQMRTAAPDFRLFWDNAYA
FT                   VHTLTHDFIRQVDVLGLAAAAGNPNRPYVFASTSKITFAGAGVSFFGGSLGNIAWYLQY
FT                   AGKKSIGPDKVNQLRHLRFFRDADGVRLHMLRHQQILAPKFALALEILDQRLSDSKIAS
FT                   WTEPKGGYFISLDVLPGTAKRTVALAKDAGIAVTEAGASFPYRKDPNDTNIRIAPTFPS
FT                   LPDLRDAVDGLATCALLAASESLLARDRV"
FT   gene            374305..376131
FT                   /locus_tag="MAV_0382"
FT   CDS_pept        374305..376131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0382"
FT                   /product="DNA polymerase III gamma/tau subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64935"
FT                   /db_xref="GOA:A0A0H2ZRH9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZRH9"
FT                   /protein_id="ABK64935.1"
FT                   /translation="MALYRKYRPATFAEVVGQEHVTEPLSIALEAGRINHAYLFSGPRG
FT                   CGKTSSARILARSLNCVQGPTATPCGVCDSCLALAPNAPGSIDVVELDAASHGGVDDTR
FT                   ELRDRAFYAPAQSRYRVFIVDEAHMVTTAGFNALLKIVEEPPEHLIFIFATTEPEKVLP
FT                   TIRSRTHHYPFRLLPPKTMRALIGRICEQEGVVVDDAVYPLVIRAGGGSPRDTLSVLDQ
FT                   LVAGAEGGHVTYQRALGLLGATDLALIDDAVDALAAGDAAALFGAVESVIDAGHDPRRF
FT                   ATDLLERFRDLILLQAVPDAASRGVVDAPEDVLERMRDQATRIGPATLTRYAEVVQAGL
FT                   GEMRGATAPRLLLEVVCARLLLPSASDTEAALLQRVERIETRLDMSIPAGSTPAEPVEQ
FT                   PVRFTRPSAAPKPASKPEPAAAKSEHEPEPQPEARPEPRPEPTPEPKPARASETPSAPG
FT                   ELNAAAVRSMWSTVRDKVRQRSRTTEVMLAGATVRAIEDNTLVLTHESAPLAKRLCEQR
FT                   NADVIAEALKDALGVNWRVRCEAGSPAPATAGPPHPKPEQPVHEPDSARRDEEEHMLAE
FT                   AVRDEPAARRDPEEAALELLQNELGARRIDGS"
FT   gene            complement(376143..377453)
FT                   /locus_tag="MAV_0383"
FT   CDS_pept        complement(376143..377453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0383"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /note="identified by match to protein family HMM PF02353"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65456"
FT                   /db_xref="GOA:A0A0H2ZSU7"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR020803"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSU7"
FT                   /protein_id="ABK65456.1"
FT                   /translation="MTTTKQPHRSRTGKLSMAEILEVFAATGRHPLKFTAYDGSTAGSE
FT                   DAELGLDLRSPRGATYLATAPGELGLARAYVAGDLQAYGVHPGDPYRLLKTLTDRVQFK
FT                   RPPARVLANVVRSIGFERLLPVAPPPQETRPRWRRIADGLMHTKARDAEAIHHHYDVSN
FT                   RFYELVLGPSMTYTCAVYPHPDATLEEAQENKYRLIFDKLRLAPGDRLLDVGCGWGGMV
FT                   RYAARRGVRAIGATLSAEQAKWAQRRIDDEGLGDLAQVRHSDYRDVAETGFDAVSSIGL
FT                   TEHIGVKNYPAYFGFLKSKLRTGGLLLNHCITRHDNTSTSFAGGFTDRYVFPDGELTGS
FT                   GRITCAIQDVGFEVLHGENFRHHYAMTLRDWCRNLVEHWDAAVDEVGLPTAKVWGLYMA
FT                   ASRVAFEQNNLQLHHVLAANVDARGDDDLPLRPWWSP"
FT   gene            complement(377450..378874)
FT                   /locus_tag="MAV_0384"
FT   CDS_pept        complement(377450..378874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0384"
FT                   /product="FAD/FMN-containing dehydrogenase"
FT                   /note="identified by match to protein family HMM PF01565"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68325"
FT                   /db_xref="GOA:A0A0H3A1F2"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR040165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1F2"
FT                   /protein_id="ABK68325.1"
FT                   /translation="MHGLLSKTRVYLVPVLGSALSAHQAGVDRLLESYRSIPATSAVRL
FT                   AKPSSNLFRARTKRDAPGLDTSGLTGVLGVDPETRTADVAGMCTYEDLVAATLPYGLSP
FT                   LVVPQLKTITLGGAVSGLGIESASFRNGLPHESVLEMDILTGAGELLTASRTQHADLFR
FT                   AFPNSYGTLGYSTRLRIELEPVAPFVTLRHIRFHALADLIAAAERIIDTGGHAGTPVDY
FT                   LDGVVFSADESYLCVGRRTTTPGPVSDYTGQHIYYQSIRHDSPGDEPTKDDRLTMHDYF
FT                   WRWDTDWFWCSRAFGVQNPRVRRWWPRRYRRSSVYSKLVSLDRRLRISDRIEARNGRPP
FT                   RERVVQDVELPVERTLEFLEWFLETVPITPIWLCPLRLRDHDGWPLYPMRPDHTYVNVG
FT                   FWSSVPAGATEGATNRLIEAKVSELDGHKSLYSDSFYTREEFDELYGGEAYNTVKKTYD
FT                   PDSRLLDLYAKAVQRR"
FT   gene            378923..379360
FT                   /locus_tag="MAV_0386"
FT   CDS_pept        378923..379360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0386"
FT                   /product="KanY protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69522"
FT                   /db_xref="InterPro:IPR014488"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A6D3"
FT                   /protein_id="ABK69522.1"
FT                   /translation="MGQVSADSTILINADPAATLAAVADYQTVRPKILSPQYSDYQVLQ
FT                   GGQGAGTVAKWKLQATKSRVRDVQVDVDVAGHTVIEKDANSSMVTNWTVAPAGPGSSVT
FT                   VKTTWTGAGGVKGFFEKTFAPLGLKKIQGEVLANLKRELES"
FT   gene            complement(379357..380094)
FT                   /locus_tag="MAV_0385"
FT   CDS_pept        complement(379357..380094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0385"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="identified by match to protein family HMM PF01520"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67002"
FT                   /db_xref="GOA:A0A0H2ZZ53"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZ53"
FT                   /protein_id="ABK67002.1"
FT                   /translation="MAVGALVAASTAIIPTAAPAAWGVPSNIAGMVVFIDPGHNGSNDA
FT                   SINRQVPTGRGGTKDCQASGTATNTGYQEHTFTWDTALRVRAELTALGVRTALARANDT
FT                   GLGPCVDERANMANALHPNAILSIHADGGPPSGRGFHVNYSAPPLNQVQAGPSVQYARI
FT                   MRDQMQASGIPPANYIGQNGLYGRSDLTGLNLAQYPSILVECGNMKNPADSALMESAEG
FT                   RQKYADAMVRGVAGFLGSQGQAR"
FT   gene            380253..380579
FT                   /locus_tag="MAV_0387"
FT   CDS_pept        380253..380579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02575;
FT                   match to protein family HMM TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67757"
FT                   /db_xref="GOA:A0A0H3A174"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A174"
FT                   /protein_id="ABK67757.1"
FT                   /translation="MSALLAQAQQMQQKLMEAQQQLANAEVHGQAGGGLVKVVVKGSGE
FT                   VVAVKIDPSVVDPSDVETLQDLVVGAMADASKQVTRMAQERLGSLAGGFGAPPGQPPAP
FT                   APGV"
FT   gene            380605..381216
FT                   /gene="recR"
FT                   /locus_tag="MAV_0388"
FT   CDS_pept        380605..381216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="MAV_0388"
FT                   /product="recombination protein RecR"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF02132; match to protein
FT                   family HMM TIGR00615"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65269"
FT                   /db_xref="GOA:A0Q9T5"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0Q9T5"
FT                   /protein_id="ABK65269.1"
FT                   /translation="MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPPDIDRLTAV
FT                   LARVRDGVRFCAVCGNVSDDERCRICSDPRRDASVVCVVEEPKDVQAVERTREFRGRYH
FT                   VLGGALDPLSGVGPDQLRIRELLSRIGERVDDVDITEVIIATDPNTEGEATATYLVRML
FT                   RDIPGLTVTRIASGLPMGGDLEFADELTLGRALAGRRAMV"
FT   gene            complement(381231..381938)
FT                   /locus_tag="MAV_0389"
FT   CDS_pept        complement(381231..381938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0389"
FT                   /product="CobB/CobQ-like glutamine amidotransferase"
FT                   /note="identified by match to protein family HMM PF07685"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68913"
FT                   /db_xref="GOA:A0A0H3A4P8"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A4P8"
FT                   /protein_id="ABK68913.1"
FT                   /translation="MADSVVRIGLVLPDVMGTYGDGGNALVLRQRLRLRGIDAEIVELT
FT                   LADPVPESLDLYTLGGAEDYAQRLATRHLLRYPGLQRAAERGAPVLAICAAVQVLGHWY
FT                   ETSAGERVDGVGMLDATTSPQDARHIGELVTKPLLAGLTEPLTGFENHRGGTVLGPAAA
FT                   PLGAVVKGAGNRAGDGFDGVVQGSVVATYMHGPCLARNPQLADLLLGKVVGGLPELQMP
FT                   EVELLRRERLAAR"
FT   gene            complement(381931..383181)
FT                   /locus_tag="MAV_0390"
FT   CDS_pept        complement(381931..383181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0390"
FT                   /product="mur ligase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67307"
FT                   /db_xref="GOA:A0A0H2ZZ09"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZ09"
FT                   /protein_id="ABK67307.1"
FT                   /translation="MLTTRARLALAAGASARWASRVTGRGAGAMIGGLVAMTLDRSVLR
FT                   QLATGRRTVVVTGTNGKSTTTRMTAAALATMGSVATNAEGANMDAGLVAALAANRGARL
FT                   AALEVDEMHVPHVSDAVRPGVVVLLNLSRDQLDRVGEINVIERTLRAGLARHPDAVVVA
FT                   NCDDVLMTSAAYDSPHVVWVAAGGSWANDSVSCPRSGEVIVREQGHWYSTGADFKRPSP
FT                   HWWFDPQDGGNLYGPGGVALPMRLALPGAVNRGNAAQAVAAAVALGADPAAAVTAVSTV
FT                   DEVAGRYRTVRVGRHDVRMLLAKNPAGWQEALSMVDPHADGVVISVNGRVPDGEDLSWL
FT                   WDVRFEHFNDAFQTTPVVAAGERGTDLAVRLGYAGVEHTLVHDTVAAIESCPPGRVEVV
FT                   ANYTAFLALQRALARHG"
FT   gene            383431..384420
FT                   /locus_tag="MAV_0391"
FT   CDS_pept        383431..384420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0391"
FT                   /product="DNA polymerase III subunit epsilon"
FT                   /note="identified by match to protein family HMM PF00929;
FT                   match to protein family HMM TIGR00573"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65271"
FT                   /db_xref="GOA:A0A0H2ZSG0"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSG0"
FT                   /protein_id="ABK65271.1"
FT                   /translation="MSAVCWGRPASEPDAGWAVIDVETSGFRPGQARIISLAVLGLDAG
FT                   GKVEQSVVSLLNPGVDPGPTHVHGLTAAMLEDQPQFADIAGDVVEVLRGRTLVAHNVAF
FT                   DYAFLAAEAELAGIELPVDTVMCTVELARRLDLGIDNLRLETLAAYWGVTQQRPHDAFD
FT                   DAMVLTGVLASALQRARERDIWLPVHPVTRRRWPNGRVTHDELRPLKVLASRMPCPYLN
FT                   PGPYVGGRPLVQGMRVALAAEVERTHEELVERILHAGLAYSDTVDRETSLVVCNDPAAE
FT                   HGKGYLARQLGVPVISDAQFLDCVRAVIGGTSMDEFTDATPDPQLALF"
FT   gene            complement(384421..386220)
FT                   /gene="leuA"
FT                   /locus_tag="MAV_0392"
FT   CDS_pept        complement(384421..386220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="MAV_0392"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="identified by match to protein family HMM PF00682;
FT                   match to protein family HMM TIGR00970"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66178"
FT                   /db_xref="GOA:A0A0H2ZUY6"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUY6"
FT                   /protein_id="ABK66178.1"
FT                   /translation="MTSHPDAFSSSRSIVKPAGPPGPGQPAWNPQRGSSMPVNRYRPFA
FT                   EEVEPIRLPDRTWPDKVIDRAPLWCAVDLRDGNQALIDPMSPARKRRMFDLLVRMGYKE
FT                   IEVGFPSASQTDFDFVREIVTEGAIPDDVTIQVLTQCRPELIERTFAACQGAPQAIVHF
FT                   YNSTSILQRRVVFRADRAAVQEIAVAGARKCVEEAAKYPETRWRFEYSPESYTGTELEY
FT                   AKQVCDAVGEIIRPTPENPIIFNLPATVEMATPNVYADSIEWMSRNLARRDSVILSLHP
FT                   HNDRGTAVAAAELGYAAGADRIEGCLFGNGERTGNVCLVTLGLNLFSRGVDPQIDFSNI
FT                   DEIRRTVEYCNQLPVHERHPYGGDLVYTAFSGSHQDAINKGLDQMEIDADAADTDVEDM
FT                   LWQVPYLPIDPKDVGRTYEAVIRVNSQSGKGGVAYIMKADHGLALPRRLQIEFSQVIQK
FT                   ISEGEGGEVSPKEMWDAFFEEYLAPVWPLERVKQRVDASDEDSGVTSISATVKINGEQT
FT                   EINGTGNGPLAAFVHALAGVGFDVAVLDYSEHAMSSGDDAQAAAYVEASVNGRTVWGVG
FT                   IAPSITTASLRAVVSAVNRAARA"
FT   gene            386513..387778
FT                   /locus_tag="MAV_0393"
FT   CDS_pept        386513..387778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0393"
FT                   /product="asparate kinase, monofunctional class"
FT                   /EC_number="2.7.2.4"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM PF01842; match to protein
FT                   family HMM TIGR00656; match to protein family HMM
FT                   TIGR00657"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68709"
FT                   /db_xref="GOA:A0A0H3A280"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A280"
FT                   /protein_id="ABK68709.1"
FT                   /translation="MALVVQKYGGSSVANADRIRRVAERIVATKKQGNDVVVVVSAMGD
FT                   TTDDLMDLAQQVCPAPPPRELDMLLTAGERISNALVAMAIESLGAQARSFTGSQAGVIT
FT                   TGTHGNAKIIDVTPGRLQAALDEGRIVLVAGFQGVSQDTRDVTTLGRGGSDTTAVALAA
FT                   ALGADVCEIYTDVDGIFSADPRIVHNARKLDTVTFEEMLEMAACGAKVLMLRCVEYARR
FT                   YNIPVHVRSSYSDKKGTVVVGSIKDKPMEDPILTGVAHDRSEAKVTVVGIPDIPGYAAR
FT                   VFRAVADADVNIDMVLQNVSKVEDGKTDITFTCSREAGPTAVAKLDALKDEIGFTQLLY
FT                   DDHIGKVSLIGAGMRSHPGVTATFCEALAQVGVNIELISTSEIRISVLCRDTELDKAVV
FT                   ALHEAFGLGGAETATVYAGTGR"
FT   gene            387779..388813
FT                   /gene="asd"
FT                   /locus_tag="MAV_0394"
FT   CDS_pept        387779..388813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="MAV_0394"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF02774; match to protein
FT                   family HMM TIGR01296"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67762"
FT                   /db_xref="GOA:A0A0H3A036"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A036"
FT                   /protein_id="ABK67762.1"
FT                   /translation="MVAIGVVGATGQVGQVMRRLLDERDFPATSVRFFASSRSQGRKLE
FT                   FRGAEIEVEDAATADPTGLDIALFSAGKTMSLVQAPRFAAAGVTVIDNSSAWRKDPDVP
FT                   LVVSEVNFERDAHRRPKGIIANPNCTTMAAMPVLKVLHDEAGLQRLVVSSYQAVSGSGI
FT                   AGVEELATQARAVIDGAEQLVHDGRAVSFPAPQTYVAPIAFNVVPLAGSLVDDGSGETD
FT                   EDQKLRHESRKILGVPDLAVSGTCVRVPVFTGHSLSINAEFARPLSPERARELLDGAPG
FT                   VKVVDVPTPLAAAGVDESLVGRIRRDPGVPDGRGLALFISGDNLRKGAALNTIQIAELL
FT                   AAQL"
FT   gene            388821..389969
FT                   /locus_tag="MAV_0395"
FT   CDS_pept        388821..389969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0395"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68140"
FT                   /db_xref="InterPro:IPR025442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0M9"
FT                   /protein_id="ABK68140.1"
FT                   /translation="MSAAHTRLVARCSLALTLLAPQWFTAARADPPAPEPEPIVGPLAP
FT                   GQVLRIGPTAGTGTPTGDYGIGATDLCEFVEFPTELLQVCGDSFAGQGVGFGGWYAPVA
FT                   LRVDTASVDDPAGVRYTGVTGISNPLLADPAPPGASQLPAGVVQINRRNYLMVTTTKSL
FT                   EPQSSRLVTAEPVRAGWQTIPGSTRPASYQGGSQTQISGYYDPIPTEESPSGWVYIVAD
FT                   SFTRRDPVVLYRATPQAFTDRSRWQGWAAGPQGGWGKPPTPLWPDAVGEMCIRQIDGKA
FT                   VLSYFNATTGNMEVRVADDPRMLGDAPVTTVVQHDEWPEPAESLPPPYDNRLAQPYGGY
FT                   ISPGSTLDELRIFVSQWDTRARVAAPYRVIQFAVNPFKPGQP"
FT   gene            390145..390579
FT                   /locus_tag="MAV_0396"
FT   CDS_pept        390145..390579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0396"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65750"
FT                   /db_xref="GOA:A0A0H2ZVC4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVC4"
FT                   /protein_id="ABK65750.1"
FT                   /translation="MRTSTATAPAPAAAAPYRAPRVFQVAAWVAIVAGIVFIVAVIFFT
FT                   GFILGHRGGHHGHHHHKHHAMMHHRGPGGPGGPGSFGGPGGPGGQGGQTGPGTSTAPAT
FT                   PSPVRPSGLAPNQLPASVFHSAATSHGALGQAPRVIVLTN"
FT   gene            390722..391240
FT                   /locus_tag="MAV_0397"
FT   CDS_pept        390722..391240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0397"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69039"
FT                   /db_xref="GOA:A0A0H3A1T6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1T6"
FT                   /protein_id="ABK69039.1"
FT                   /translation="MSQTPEPQAEPTTPEPTPAAAVPPPPPPPERVKPPRLYTAAAWVV
FT                   IVAGIVFIISSVFFVGAFIWKHSYYHCHHHHGVFHPGGPGPGNGPWQYGGPGPGNGPWP
FT                   GGPGGSGAWYGGPGGPDNGPWPGGPGLIVPMPPGGPGGPGGPVSGPGVSGPGQPSPVSP
FT                   APSTPAPRP"
FT   gene            391308..391970
FT                   /locus_tag="MAV_0398"
FT   CDS_pept        391308..391970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67479"
FT                   /db_xref="InterPro:IPR026954"
FT                   /db_xref="InterPro:IPR038232"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0D3"
FT                   /protein_id="ABK67479.1"
FT                   /translation="MTMRITRVCRAVLFVGVAAAGAVALPVAAAHPSEPGVVNYAVLGK
FT                   GSVGNIVGGPMGWESVFTQPGQGDWVDLPECNNWADIGLPEVFNDPDLASFNGAVTQTS
FT                   ATDQTHLVKQAVGVFATNDAADRAFHRVVDRTVGCSGQTTAIHLDNGSTQVWSFDGGPA
FT                   GPADENWTKQEAGTDRRCFNQTRLRENVVLQAKVCQSGNAGPAVNVLAGAMQNALGQ"
FT   gene            392176..393486
FT                   /locus_tag="MAV_0399"
FT   CDS_pept        392176..393486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0399"
FT                   /product="putative glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="identified by match to protein family HMM PF04107"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66233"
FT                   /db_xref="GOA:A0A0H2ZUS5"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017809"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUS5"
FT                   /protein_id="ABK66233.1"
FT                   /translation="MTFAPSTAAASRPAGGDPAAELRIAELTDSAAVAHYIARGCLADA
FT                   PLGRVGLEVEAHCHDPQDPCRRPGWDEIAAVLDALPALPGGSRVTVEPGGAVELSGPPA
FT                   DGVLAAIDAMRRDQAVLRPAFAEAGLGLVFLGADPLRPPQRINPGARYRAMERFFATSR
FT                   SGEAGAAMMTSTASIQVNVDAGPREGWAARVRLAHALGPTMIAMTANSPMLDGDFTGWV
FT                   SSRQRVWGRMDSARCGPILGASGDDPGTDWARYALKAPVMLVHTPDAEAVTRWVPFADW
FT                   VDGRVLLGGRRPTVADLEYHLTTLFPPVRPRQWLEIRYLDSVPDTLWPAVVFTLVALLD
FT                   DPVAAGLAARAVEPVATAWDVAARVGLRDRRLYAAANACLAIAAERAPAELAEPMRRLV
FT                   RLVEQGRCPGDDFADQVIEHGIAASVSRAARGPQGGP"
FT   gene            393483..394784
FT                   /locus_tag="MAV_0400"
FT   CDS_pept        393483..394784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03781"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66715"
FT                   /db_xref="GOA:A0A0H2ZWE5"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR032890"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWE5"
FT                   /protein_id="ABK66715.1"
FT                   /translation="MTSPEAIADQLARTRARTLRLVDFDDDELRRQYDPLMSPLVWDLA
FT                   HIGQQEELWLLRGGDPARPGMLPPAVEGLYDAFVHSRASRVDLPLLSPEQARAYCRKVR
FT                   AAVLDTLDALPDDPDAAFVYAMVVSHENQHDETMLQALNLRSGAPLLRDTSVLPAGRPE
FT                   LAGTSVLVPGGEFVLGVDAADEPESLDNERPAHVLDLPAFRIGTIPVTNGEWQQFVADG
FT                   GYDEPRWWSRRGWQHRQAAGLTAPQFWHPDARARTRFGHVEDIPADEPVQHVSFFEAEA
FT                   YAAWAGARLPTEMEWEKACAWDPSTGTRRRYPWGATPPSPAVANLGGAALRPAPVGAYP
FT                   AGASACGAEQMLGDVWEWTTSPLRPWPGFAPMLYERYSQPFFDGDYRVLRGGSWAVEPG
FT                   ILRPSFRNWDHPYRRQIFAGVRLAWDVPGARDHR"
FT   gene            394784..395482
FT                   /locus_tag="MAV_0401"
FT   CDS_pept        394784..395482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64814"
FT                   /db_xref="GOA:A0A0H2ZT20"
FT                   /db_xref="InterPro:IPR017808"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR032889"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZT20"
FT                   /protein_id="ABK64814.1"
FT                   /translation="MCRHLGWLGADATVSSLMLEPPFGLRVQSYAPRRQKHGLLNADGW
FT                   GAGFFDGEVPRRWRSPAPLWGDVSFESVAPALHSHCVVAAVRSATAGMPIEISATAPFT
FT                   DGRWLLSHNGVVDRSVLPVTSRAESVCDSAILAAVIFERGLDALGEVIAEIGAADPAAR
FT                   LNILAANGSRLLATAWGDTLSILRRADGVVVASEPYDDDSDWEDVPDRHLVDVTADGVT
FT                   LTPLDHPKGF"
FT   gene            395479..396447
FT                   /locus_tag="MAV_0402"
FT   CDS_pept        395479..396447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0402"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64570"
FT                   /db_xref="GOA:A0A0H2ZQT6"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032888"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZQT6"
FT                   /protein_id="ABK64570.1"
FT                   /translation="MMTLSLSNHLAADSAHHALRRDVLDGLRRTPKSLPPKWFYDSVGS
FT                   DLFDQITRLPEYYPTRAEAEILRAQAPGIASASEADTLVELGSGTSEKTRVLLDALRER
FT                   GALRRYVPFDVDAGILSASAAAIQREYAGIEIQAVCGDFEEHLTEIPEGGRRLFVFLGS
FT                   TIGNLTPGPRAQFLAALSAQMRPGDSLLLGTDLVKDTERLVRAYDDAAGVTAAFNRNVL
FT                   AVINRELDADFDVDAFEHVARWNVDEERIEMWLRATGRQRVRVGALGLTVDFRAGEEML
FT                   TEVSCKFRPERVSAELAAAGLRRTRWWTDGAEDFGLSLAVK"
FT   gene            396444..397589
FT                   /locus_tag="MAV_0403"
FT   CDS_pept        396444..397589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0403"
FT                   /product="pyridoxal-phosphate-dependent transferase"
FT                   /note="identified by match to protein family HMM PF00266"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67210"
FT                   /db_xref="GOA:A0A0H2ZXV1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027563"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXV1"
FT                   /protein_id="ABK67210.1"
FT                   /translation="MSGGTPLADTWRSARPPAAGLHLDSAACSRQSFAVIEATAQHARN
FT                   EAELGGYVAAEAAAPVLDAGRFAFTALTGMTDAEAVFTTGSLHALDLLLGSWPAERRTL
FT                   ACLPGEYGPNLAVMAAHGFDRWLLPTLADGRVALDDAALALQTDPPDLVHLTTIGSHSG
FT                   VVQPVSMIARLCRELGLPLVVDAAQALGQVDCTAGADVTYSSSRKWIAGPRGVGMLAVR
FT                   RELMENLHPRLAAPDWAPGSTVAQQLEFGEANIAARVGFSLALGEYLGYGPAAVCARLA
FT                   ELGGLSRGVLTDVTGWAVVEEAEEPSAITTLAPTDGADPRAVRDWLLAERRILTTFVGV
FT                   QRAPLRLTAPVLRISPHLDTTAEDLETFAEALIAATAATSA"
FT   gene            complement(397593..398273)
FT                   /locus_tag="MAV_0404"
FT   CDS_pept        complement(397593..398273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0404"
FT                   /product="thiopurine S-methyltransferase (tpmt) superfamily
FT                   protein"
FT                   /note="identified by match to protein family HMM PF05724"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68700"
FT                   /db_xref="GOA:A0A0H3A2B8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2B8"
FT                   /protein_id="ABK68700.1"
FT                   /translation="MSSDQVMDWDSAYREQAHFEGPPPWNIGEPQPELAALIEQGKFRS
FT                   DVLDAGCGCAELSLALAARGYTVVGIDLTPTAVAAATRAAAERGLTTASFVQADITSFT
FT                   GYDGRFATVVDSTLFHSLPVEGRDGYLRSIHRAAAAGASLFILVFAKGAFPAEMQPKPN
FT                   EVDEDELRAAVGKYWVIDEIRPSFIVSNVPQIADAPFEFPAHERDERGRMKMPAYLLTA
FT                   HKAQ"
FT   gene            complement(398284..399756)
FT                   /locus_tag="MAV_0405"
FT   CDS_pept        complement(398284..399756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0405"
FT                   /product="CBS domain pair protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66728"
FT                   /db_xref="GOA:A0A0H2ZXL4"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR016602"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXL4"
FT                   /protein_id="ABK66728.1"
FT                   /translation="MGEEVKRATYDSAHRREFRRKVALCLDVFETMLARSCFESEQPLT
FT                   GMEIECNLVDADYQPAMSNRHVLDAIGDPAYQVELGAYNIEFNVPPHALPGHTGLDLEA
FT                   EVRASLNEAETKAGAAGGAHIVMIGILPTLMPEHLDHDWMSESTRYAALNDSIFTARGE
FT                   DIPIDISGPEPLSWHTATIAPESACTSTQLHLQVAAETFAANWNAAQTVAGPQLALGAN
FT                   SPFFFGHQLWAETRIELFAQSTDTRPEELKTQGVRPRVWFGERWIDSVLDLFAENIRYF
FT                   GSLLPEVSDEDPVAELAAGRTPQLSELRLHNGTVYRWNRPVYDVAEGRPHLRLENRVLP
FT                   AGPTVIDMLANSAFFYGMLRSLSEADDPLWERMDFAVAEANFLTAARHGIDARLRWPGF
FT                   GEVSARELVLDTLLPIADEGLRRWGVDAEVRDRFLGVIDGRARAGRNGASWQVATVRAL
FT                   QDGGLSRRAALAEMLRRYCEHMHANEPVHTWE"
FT   gene            399863..401389
FT                   /gene="glpK"
FT                   /locus_tag="MAV_0406"
FT   CDS_pept        399863..401389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="MAV_0406"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM PF02782; match to protein
FT                   family HMM TIGR01311"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67587"
FT                   /db_xref="GOA:A0A0H2ZZP6"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZP6"
FT                   /protein_id="ABK67587.1"
FT                   /translation="MAEFAEFIAAIDQGTTSTRCMIFDHQGAEVARHQLEHEQILPRAG
FT                   WVEHDPIEIWERTSSVLTSVLNRANLSAENLAALGITNQRETTLVWNRKTGRPYYNAIV
FT                   WQDTRTDRIASALDRDGRGQVIRRKAGLPPATYFSGAKLQWILDNVDGVREAAERGDAL
FT                   FGTADSWVLWQLTGGPRGGVHATDVTNASRTMLMDLETLDWDDELLSFFTIPRAMLPEI
FT                   GPSSSPRPFGVTSDTGPAGGRIPITAVLGDQHAAMVGQVCLAEGEAKNTYGTGNFLLLN
FT                   TGESIVRSEHGLLTTVCYQFGDAKPVYALEGSIAVTGAAVQWLRDQLGIISGAAQSESL
FT                   ARQVDDNGGVYFVPAFSGLFAPYWRSDARGAIVGLSRFDTNAHLARATLEAICYQSRDV
FT                   VDAMAADSGVRLEVLKVDGGITGNDLCMQIQADVLGVDVVRPVVAETTALGAAYAAGLA
FT                   VGFWADPGELRANWREDKRWTPAWSDEQRAAGYAGWRKAVQRTLDWADVT"
FT   gene            complement(401422..402192)
FT                   /locus_tag="MAV_0407"
FT   CDS_pept        complement(401422..402192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0407"
FT                   /product="transcriptional regulator, PadR family protein"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65006"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZRN7"
FT                   /protein_id="ABK65006.1"
FT                   /translation="MFRSARPVRKPTNVRTKTMSNPFTPPDGPFGARPGFGFGFGPGRV
FT                   DRRALHEARRQARRDFREHLREHAGGHDGPLGFGPGFGPGFGPAFGPGFGFGPGGPRGA
FT                   WRRGGPGRGKRGDVRAAVLALLAERPMHGYEMIQLIAERSNGLWKPSPGSVYPTLQLLA
FT                   DEGLITATETDGSKKLFELTDDGRAAAEKIETPPWDEIAEGADPGHMNLRAAIGQLFGA
FT                   VGQSAHTASPEQQQRIVDILNNARREIYGILGED"
FT   gene            402344..402733
FT                   /locus_tag="MAV_0409"
FT   CDS_pept        402344..402733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66265"
FT                   /db_xref="GOA:A0A0H2ZUV2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUV2"
FT                   /protein_id="ABK66265.1"
FT                   /translation="MDANDKLTVDGGAAGAVASGRPGRPGGRNVWPWVNWGLALATVPA
FT                   AAIVMLFALGAVMSTDGCSDRSCPNLGHGGIDFGVAFYGAPAVAVVVIIVSFLTAKRRG
FT                   GIVVPLCGWALLIADVALMAASVSS"
FT   gene            complement(402730..403602)
FT                   /locus_tag="MAV_0408"
FT   CDS_pept        complement(402730..403602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0408"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF06271"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67201"
FT                   /db_xref="GOA:A0A0H2ZX58"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZX58"
FT                   /protein_id="ABK67201.1"
FT                   /translation="MSEVVTGDAVVLDVQIAQLPVRALSALIDIAVIVVGYLLGLMLWA
FT                   ATLTQFDTALSNAILLIFTVLVIVGYPLILETATRGRSVGKIALGLRVVSDDGGPERFR
FT                   QALFRALASLVEIWMLFGSPAVICSILSPKAKRIGDIFAGTVVVNERGPRLGPPPAMPP
FT                   SLAWWASSLQLSGLSSGQAEVARQFLSRAAQLDPGLRLQMAYRIAGDVVARIAPPPPPG
FT                   APPELVLAAVLAERHRRELARLRPPAPWPAPGYPPAWPGSGPAPQWPAPGPANPGPPEG
FT                   FSAGFTPPR"
FT   gene            403683..404675
FT                   /locus_tag="MAV_0410"
FT   CDS_pept        403683..404675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0410"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69002"
FT                   /db_xref="GOA:A0A0H3A1P9"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1P9"
FT                   /protein_id="ABK69002.1"
FT                   /translation="MDVDAFVLAHRPTWDRLDRLVGRRRSLSGAEIDELVELYQRVSTH
FT                   LSMLRSASSDSMLVGRLSSLVARARSAVTAAHAPLSSTFVRFWTVSFPVVAYRSWRWWV
FT                   ATGAAFFAVVVIVALWVAGNPEVQSALGTPSDIDQLVNHDVESYYSEHPAAAFALQIWV
FT                   NNSWVSAQCIALSVVLGLPIPLVLFENAANLGVIAGLMFPAGKGGLLLGLLAPHGLLEL
FT                   TAVFLAGATGMRLGWSVISPGDRPRGQVLAEQGRAVVSVAVGLVAVLLVSGLIEALVTP
FT                   SPLPTFVRVGIGVVAEAAFLCYIGYFGRRGVKAGESGDIEEAPDVVPTG"
FT   gene            complement(404687..406009)
FT                   /locus_tag="MAV_0411"
FT   CDS_pept        complement(404687..406009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0411"
FT                   /product="lipoprotein"
FT                   /note="identified by match to protein family HMM PF01882"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68610"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3U1"
FT                   /protein_id="ABK68610.1"
FT                   /translation="MILTGRTGLVALICVLPIALSPWPAMVFTALLAALAVAVAVDAAL
FT                   AASPARLRCIRSPDRSARLGQHADAALLIHNDGPRRFRGQIRDAWPPSARARPRLHRVD
FT                   IPAGQHQHIATRLEPVRRGDQRATVVTARSIGPLGLAGRQGSQSVPGQLRVLPPFLSRK
FT                   HLPSRLARLREIDGLLPTLVRGQGTEFDSLREYVVGDDVRSIDWRATARRADVVVRTWR
FT                   PERDRRVVIVLDTGRTAAGRVGVDPTAADPAGWPRLDWSMDAALLLAALASRAGDHVDF
FT                   LAHDRVGRAGVFGASRTELLAQLVDAMAPLQPTLVETDWRAMVSAIALRARRRSLVVLL
FT                   TDLNAAALDEGLLPVLPQLSAKHHLLVAAVADPRVDQMAAGRSDAAAVYDAAAAERSRN
FT                   ERAAIAARLRHGGVEVVDAAPAELAPALADHYLAMKATGRL"
FT   gene            complement(406006..406989)
FT                   /locus_tag="MAV_0412"
FT   CDS_pept        complement(406006..406989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0412"
FT                   /product="ATPase family protein associated with various
FT                   cellular activities (AAA)"
FT                   /note="identified by match to protein family HMM PF07726;
FT                   match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69341"
FT                   /db_xref="GOA:A0A0H3A494"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A494"
FT                   /protein_id="ABK69341.1"
FT                   /translation="MTQPTQPVTASPTAESAREALLALRAELAKAVVGQEGVVSGLVIA
FT                   LLCRGHVLLEGVPGVAKTLLVRALAAALQLEFKRVQFTPDLMPGDVTGSLVYDARTAAF
FT                   VFRPGPVFTNLLLADEINRTPPKTQAALLEAMEERQVSVEGEAQPLPEPFIVAATQNPV
FT                   EYEGTYQLPEAQLDRFLLKLNVTLPPREAEIAILHRHAHGFDPRDLSVVQPVAGPADLA
FT                   AGRDAVQQVRVADEVLGYIVDIVGATRSSPALQLGVSPRGATALLATARSWSWLSGRNY
FT                   VTPDDVKAMARPTLRHRVMLRPEAELEGATCDGVLDGILASVPVPR"
FT   gene            complement(406986..408119)
FT                   /locus_tag="MAV_0413"
FT   CDS_pept        complement(406986..408119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64589"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSH9"
FT                   /protein_id="ABK64589.1"
FT                   /translation="MATTTATATAPRRRRSWRWVLATLLVLAVIAGVDAYLSAPRPGTR
FT                   MDAASTDPDGAHALVALLRDGGVDVVVADHIADVESAARPDALILVAQSQYLADSVLDR
FT                   LARIRSDLLLVEPTTEARKALLPGVRISGTNGFDSDPNCTLREAVRAGSVRFGRATTFE
FT                   SEDGRAMTRCYDGALIRFRDGGRAITAVGSTDFMTNGSLLQAGNAALAMNLAGGRPRLI
FT                   WYAPHFVEGESSSKATVLDLIPANVYWVVGQLAVVVLLVAVWRGRRPGPLVAEELPVVV
FT                   RASETVEGRGRLYRSRRARDRAAAALRTAALQRLTPKLGLAGGATPEAVVSTAAQRTGS
FT                   DPGWVSYHLFGPPPTTDHDLLQLARALDDIERQVAHP"
FT   gene            complement(408119..408772)
FT                   /locus_tag="MAV_0414"
FT   CDS_pept        complement(408119..408772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0414"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64757"
FT                   /db_xref="GOA:A0A0H2ZSS3"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSS3"
FT                   /protein_id="ABK64757.1"
FT                   /translation="MPSIDIDRDAAHRAAADELHKPIYSKGSTPSQLVAWLNDAIYRML
FT                   QKISTVPGGWLTATVLFLLLAIAAVVAVHILRRTMRTRRGGDHLLFEAAPLTAAQHRAT
FT                   AESCAAERDWAAAIRHRLRAVARQLEETGVLTAAPGRTANELARDAGAALPHLAGELAQ
FT                   AATAFNDVTYGEQPGTQAAYQLIADLDEHLRSRWQGVTPPPGQPVVAESWAQVR"
FT   gene            complement(408797..410053)
FT                   /locus_tag="MAV_0415"
FT   CDS_pept        complement(408797..410053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0415"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64920"
FT                   /db_xref="GOA:A0A0H2ZRH0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZRH0"
FT                   /protein_id="ABK64920.1"
FT                   /translation="MCATLRAGARVNVVKWSGRRQDGAHDEPPVHEPRGSVSAPPPGYP
FT                   VGPPPAYGSQSHYGTQYGAQYPGQYGVHYGPPPTYPPPGYPPAPAFGPPPGYGVLKPGI
FT                   IPLRPLTLGDIFNGAVGYIRANPKATLGLTAIVVIAMQIITKAAVLGPLAAYGRFTGDR
FT                   SDELTAGVLGAWSVSVGAGVLVGWLGGMLLSGMLTVIVGRAVFGSSITVGETWTKIRGR
FT                   LPALLGLALLEAVVVAAIAGLVVVVIAILAAIGNAAAAVVLGIPLVLTVIAVLVYLYTV
FT                   VLFAPVLIVLERLPVLDAITRSFRLVRRGFWRVLGIRALAFLVTAVVANAVAVPFSIVG
FT                   QVFQISSSGTAFLISTAILSVGAAIGEIITAPFNAGVIVLLYTDRRMRAEAFDLLQSGA
FT                   AQGSYAAASTDNLWLTRPR"
FT   gene            410052..410516
FT                   /locus_tag="MAV_0416"
FT   CDS_pept        410052..410516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0416"
FT                   /product="GatB/Yqey domain protein"
FT                   /note="identified by match to protein family HMM PF02637"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67676"
FT                   /db_xref="GOA:A0A0H2ZYD0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYD0"
FT                   /protein_id="ABK67676.1"
FT                   /translation="MAELKSRLRADLTAAMKAQDKLRTATLRMLLAAIQTEEVSGKQAK
FT                   DLTDDEVIKVLAKESRKRAESAEIYTQNGRGDLAANEHAEARIIDEYLPTPLTEAEVAD
FT                   VVDTAIAQVAEEIGERPSMKQMGMVMKAATAIAAGKADGARLSAAVKERL"
FT   gene            complement(410526..412238)
FT                   /locus_tag="MAV_0417"
FT   CDS_pept        complement(410526..412238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0417"
FT                   /product="elongation factor Tu GTP binding domain protein"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03144"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65919"
FT                   /db_xref="GOA:A0A0H2ZU79"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZU79"
FT                   /protein_id="ABK65919.1"
FT                   /translation="MFVLATAGHVDHGKSTLLHRLTGMWPDRLAEEQRRGLTIDLGFVW
FT                   TELAGRRLAFVDVPGHERFVANMLAGVGPVPAVVFVVAATEGWMPQSEEHLAALDALRV
FT                   RHGLLVISKADLADPGPAVAQATERFAATSLAGAPVAIGTDLERVRAELVALTDRLPPP
FT                   DPHADVRLWVDRSFTVRGAGTVVTGTLAAGTVRVGDELEHAGRRVTVRGLQSLGRNEIR
FT                   VGAVARVALNLRGVDRRDIGRGDTVRTPGAWRDTAEIDVALRGPGTAEDTLHSQLVLHV
FT                   GSAAVPVRVRRLGPAAARLRLARPLPLRVADVGLLRDPGQHRIAAGVEVLDVRPPELRR
FT                   RGAARLRAAELATGSAPAPHIVRADDLRAMGVPARGQRVGDWVVDPQWWAERRDEAAAQ
FT                   VRRWAGEHDIAAGMPLETLRRQVGLPAAELVPKLLQGTGFEVADGLVRAPGAGLPARVD
FT                   KAVREVEAWLAAEPFRAPEADELAGLGLGPRELAAAVRAGRLTRIADGVVLGPDALARA
FT                   AGVLAGLPQPFTVSEARRALGTTRRVAVPLLEQLDARRVTRRASDGTRVLIAD"
FT   gene            complement(412226..413506)
FT                   /gene="selA"
FT                   /locus_tag="MAV_0418"
FT   CDS_pept        complement(412226..413506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selA"
FT                   /locus_tag="MAV_0418"
FT                   /product="L-seryl-tRNA selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="identified by match to protein family HMM PF03841;
FT                   match to protein family HMM TIGR00474"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66941"
FT                   /db_xref="GOA:A0A0H2ZX33"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZX33"
FT                   /protein_id="ABK66941.1"
FT                   /translation="MPGTDTLLADPRLAAAQRVLGRALVKSVITQAQQRARAGEISPEQ
FT                   VAEHALAALPATASSLRPVINATGVVVHTNLGRAPLSRAALDAVVAAGGATDVEFDLAT
FT                   GRRARRGRGALAALARAVPAAGGVHVVNNNAAALLLVALTLAPGREIVLSRGELVEIGD
FT                   GFRIPELLESTGARLREVGTTNRTGLRDYTEALGPQTGFVLKVHPSNFHVTGFTSAVGV
FT                   AALAAELRTRDIPLVVDIGSGLLAPHPVLPDEPDATSTLADGADLVTASGDKLLGGPQA
FT                   GLLFGRGDLVERLRRHPAARALRVDKLTLAALEATLTGPPPPVAAALDADVGRLRARAQ
FT                   SLAAALPADADAVALDCVAAVGGGGAPGVELPSAAVSLPERYAAALRAGRPPVVGRLEG
FT                   GRCLLDLRTVSPEDDELLAAAVRACSS"
FT   gene            complement(413550..413640)
FT                   /locus_tag="MAV_0419"
FT   tRNA            complement(413550..413640)
FT                   /locus_tag="MAV_0419"
FT                   /product="tRNA-Sec"
FT   gene            413668..414660
FT                   /gene="selD"
FT                   /locus_tag="MAV_0420"
FT   CDS_pept        413668..414660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selD"
FT                   /locus_tag="MAV_0420"
FT                   /product="selenide, water dikinase"
FT                   /EC_number="2.7.9.3"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR00476"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67328"
FT                   /db_xref="GOA:A0A0H2ZZ27"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZ27"
FT                   /protein_id="ABK67328.1"
FT                   /translation="MTYRLTQYAHGGGCACKIPPGELEDVVRGLGAASPRDPLGELLVG
FT                   LDSGDDAAVVRIQQGTALIATTDFFTPVVDDAYDWGRIAATNALSDVYAMGGRPVVAVN
FT                   LLGWPREVLPFELAAETLRGGLDVCGLAGCHLAGGHSVDDPEPKYGLAVTGIADPNRLL
FT                   RNDSGKPGLPLSLTKPLGIGVLNNRHKATGERFEEAIAVMTTLNAEAAGAALAAGVECA
FT                   TDVTGFGLLGHLHKLARASGVTAVLDAAAVPYLDGAREALAAGYLSGGTRRNLDWVAPH
FT                   VDLSGVGEDEALLLADAQTSGGLLIAGEIPGAPVIGELVPRGEHTIVVR"
FT   gene            414733..415314
FT                   /locus_tag="MAV_0421"
FT   CDS_pept        414733..415314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0421"
FT                   /product="molybdopterin oxidoreductase Fe4S4 region"
FT                   /note="identified by match to protein family HMM PF04879"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68799"
FT                   /db_xref="GOA:A0A0H3A4E6"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A4E6"
FT                   /protein_id="ABK68799.1"
FT                   /translation="MAPKKALSKVFLEWPVLRQVRSTDKLGRGSAVTSKHTRALAPRTA
FT                   TADRVVQSVCPYCAVGCGQRVYVKDERVVAIEGDPDSPISRGRLCPKGSASEQLVNSPG
FT                   RQLQVLYRAPRATEWQPLQLDTAIDMIADRFVESRRNSWQDIDKKGNLLRRTMGIAALG
FT                   GATLDNEENYLIKKLFTAAGAIQIENQARI"
FT   gene            415384..418047
FT                   /locus_tag="MAV_0422"
FT   CDS_pept        415384..418047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0422"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="identified by match to protein family HMM PF01568"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67750"
FT                   /db_xref="GOA:A0A0H3A027"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A027"
FT                   /protein_id="ABK67750.1"
FT                   /translation="MANADCIVIQGSNMAECHPVGFQWVEEARARGARVIHVDPRFTRT
FT                   SAVSDRHIPIRAGSDVVLLGALINHVLTNDLWFSEYVVAYTNAATVINENFRDTEDLGG
FT                   LFSGFDPETGQYDTSSWAYEEEDDGRSGGEIESPGGGHTHGATATHSAAGDEHGSGGPP
FT                   LAHARVRRDETLQHPRTVFQILKRHYARYTPEMVKDVCGISREDFDYLARSIVENSGRE
FT                   RTTCFAYAVGWTQHTLGAQFIRTATILQLLMGNVGRPGSGIMALRGHATIQGSTDIPTL
FT                   FNLLPGYLPMPKAGVHDTLADYLDAVGSKKQKGFWANADAYTVSLLKAWWGEAATADND
FT                   WAYDYLPRLTGPHGTYQTVMGMLADEVEGYFLLGQNPAVGSAHGRMQRLGMSHLKWLVV
FT                   RDFNLIESATWWKDGPEIASGELKTEEIETEVFFLPAATHVEKAGSFTQTQRLVQWRHQ
FT                   AVEPPGQCQSELQFFYELGKRIRQRLAGSTDERDRPLLDLTWDYPTDEHGDPDGEAVLA
FT                   EINGYRVGEPADPLASYTELRADGSTAAGCWIYTGVYANAVNQAARRVPNGGASPSQSE
FT                   WGWAWPADRRVLYNRASADPDGKPWSERKRYIWWDPDQRRWVGYDVPDFVVDRAPGARP
FT                   DPELGGPDALAGDDPFIMQADGKGWLFAPKGVVDGPLPTHYEPQESPVANALYPQQRNP
FT                   ARITFARKDNLSAPSAGEPGSDVYPYVFTTYRLTEHHTAGGMSRWLPYLSELQPEMFCE
FT                   VSPELAAERGLQPYGWATIISPRAAIEARVLVTKRVAPLVINGHTVHQIGLPYHWGVGG
FT                   DAVVSGDAANDLLGVTLDPNVQIQESKAGSCDIRPGRRPRGEELLRLIADYQSRSGVTA
FT                   ETGNVRVDDAVWERGS"
FT   gene            418029..419021
FT                   /locus_tag="MAV_0423"
FT   CDS_pept        418029..419021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0423"
FT                   /product="4Fe-4S binding domain protein"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68460"
FT                   /db_xref="GOA:A0A0H3A093"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A093"
FT                   /protein_id="ABK68460.1"
FT                   /translation="MGKGELMGQLTGPTDPAADAGWADRKPRKGFFTDTSICIGCKACE
FT                   VACKEWNRNPQDGDLELLGSSYDNTGALGASTWRHVAFVEQGRERIEQARESGRALIDL
FT                   GMPTLPGAASEPTEPAVPHTPEFRWLMSSDVCKHCTHAGCLDVCPTGALFRTEFGTVVV
FT                   QHDVCNGCGTCVAGCPFGVVERRNDGTYATPAQRPDRPSEEIVTGVAQKCTLCYDRLLE
FT                   DEIPACAKTCPTTSIKFGDHDDLVAMARRRVAALHAQGLTEARLYGANEHDGVGGTGSI
FT                   FLLLDEPEVYGLPPDPRVCTADLMTMFKRAGLAAAGMVGAAVLAFWRSR"
FT   gene            419018..420103
FT                   /locus_tag="MAV_0424"
FT   CDS_pept        419018..420103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0424"
FT                   /product="polysulphide reductase, NrfD superfamily protein"
FT                   /note="identified by match to protein family HMM PF03916"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69144"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A238"
FT                   /protein_id="ABK69144.1"
FT                   /translation="MSTSEFDSFRPPEPAGGKRRKGKRGGRRGAGDGSREMPMVPEAEF
FT                   SSYYGRPVVKPAPWGHEVGAYLFLGGVAGGSGLLAAGAQLTGRDTLRRNTRLTALAAVL
FT                   LSLVALVKDLGRPERFLNMLRTVKLTSPMNLGSWILSAFSAGISVAAAAEVDRMTGQRL
FT                   PLGPLRPVLRAAEGPAGLQAAVLAPPLAVYTAVLLADTATPTWNAAHEDLPFVFVSSAS
FT                   LAASGLAMVTTPVHQAGPARTLAVLGALGDLAASKVMERRMDPVAAEPLHTGGPGRMLR
FT                   ASERLVIAGGLGTLLGGRHRAVAVVSGLALATASALTRFGVFEAGLESARHPRYTIEPQ
FT                   QRRLAARRAAGITSDSITTAG"
FT   gene            420128..421138
FT                   /locus_tag="MAV_0425"
FT   CDS_pept        420128..421138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0425"
FT                   /product="dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64990"
FT                   /db_xref="GOA:A0A0H2ZRQ6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZRQ6"
FT                   /protein_id="ABK64990.1"
FT                   /translation="MQPGIPVRMTNFGYTLMTEQSGPKELVRYAISAEERGFDFHVCSD
FT                   HFSPWLTSQGHAPNAWAVLGAVAQATERVDLYTYVTCPTMRYHPAIVAQQAATVQILSD
FT                   GRFTLGLGSGENLNEHVVGKGWPTITRRQDMLREAIKIIRELFGGQLVDFTGDYFRVDS
FT                   ARVWDVPDVPVGIGVAIGGTRAVDKFAKLADHLIATEPNADLVDAWHGARQAANLAGGG
FT                   RVVGQIPVSWDPDPDTAVKRAHDQFRWFAGGWKVNADLPTPAGFAGATQFVRPEDVADA
FT                   IPCGPDLDAIVEGVRPYWEAGFTDIALVQIGGDTQERFLKEAAEPLLAALRDAAK"
FT   gene            421176..421718
FT                   /locus_tag="MAV_0426"
FT   CDS_pept        421176..421718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0426"
FT                   /product="intracellular protease, PfpI family protein"
FT                   /note="identified by match to protein family HMM PF01965;
FT                   match to protein family HMM TIGR01382"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65563"
FT                   /db_xref="GOA:A0A0H2ZT97"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZT97"
FT                   /protein_id="ABK65563.1"
FT                   /translation="MQGKKIAILAADGVEKVELEQPAAALREAGAGVEVVSLQDGEIQA
FT                   RNHDLEPAGTFTVDRKVADASVDDFDGLVLPGGTVNPDKLRLDDTAVSFVRDFVGSGKP
FT                   VAAICHGPWTLVEAGVAAGRTLTSYPSIRTDLRNAGAHVVDEEVVVDGNLITSRSPKDL
FT                   PAFCSTILAQFAGATTG"
FT   gene            421829..422518
FT                   /locus_tag="MAV_0427"
FT   CDS_pept        421829..422518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0427"
FT                   /product="methylase, putative"
FT                   /note="identified by match to protein family HMM PF01170;
FT                   match to protein family HMM PF05175; match to protein
FT                   family HMM TIGR00537"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65209"
FT                   /db_xref="GOA:A0A0H2ZTS6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004557"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTS6"
FT                   /protein_id="ABK65209.1"
FT                   /translation="MTTTYPEPAVLPAHNVYQPQEDSRLLVDVMHGTGLIPGRRVLDLC
FT                   TGSGFVAIAAAEMGCASVTAFDKCPHAVRCARENAALAGVDVDVREGSWLAAVDCAPFD
FT                   VVVSNPPYVPTPPGAVLDELGPVTGPSWAWNAGRDGRLVLDPLCESAPKLLRDGGSLLL
FT                   VHSALAGVQQSLDSLKWAGMDAKVIASKWIPFGPVMLSRAHWLEDVGLIPRGRREEELI
FT                   VIRAEKR"
FT   gene            complement(422532..422672)
FT                   /locus_tag="MAV_0428"
FT   CDS_pept        complement(422532..422672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0428"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSQ7"
FT                   /protein_id="ABK64735.1"
FT                   /translation="MSHNGYRRLRRQVQIATMKRSDSTTSPPGISMRTGPETSTGPLGT
FT                   T"
FT   gene            complement(422696..423727)
FT                   /locus_tag="MAV_0429"
FT   CDS_pept        complement(422696..423727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0429"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66072"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWN5"
FT                   /protein_id="ABK66072.1"
FT                   /translation="MTRTSIPTQPVLPSAHGPLSTAVRCALTGPPSVDHLARIGASVRD
FT                   SDPYGLDLQLALAMCYELHYRGFTGVDPAWEWNPALLALRAELERVFLAGVRRDVGPID
FT                   PDRTAADEMDAIAAEPVEGTGPSYHLRDRGSWQQMCEYFVHRSLYHLKEGDPHAWAIPR
FT                   LTGTAKAAFVAVEFDEYGAGQGPRLHQQLFADLLAAAGLDTTYWGYIDAVPAESLAVVN
FT                   LMSLFGLHRALRGAAIGHFAATEITSPPGSARMVRALQRMQAPPACITFYSEHVEADAV
FT                   HEQVVRLDVVGDLVAREPELQRDVVFGIRAHAAVEDRLADTIMASWQQGRSSLRRPLDR
FT                   PSP"
FT   gene            complement(423770..425980)
FT                   /locus_tag="MAV_0430"
FT   CDS_pept        complement(423770..425980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0430"
FT                   /product="stage II sporulation protein E (SpoIIE)"
FT                   /note="identified by match to protein family HMM PF00989;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF07228; match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65327"
FT                   /db_xref="GOA:A0A0H2ZUG1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR014787"
FT                   /db_xref="InterPro:IPR017944"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUG1"
FT                   /protein_id="ABK65327.1"
FT                   /translation="MSDDNDFHDQYARALRAYLASRDEASLAVGHELGRRALQEQISLL
FT                   EIIEQHVRLVFEISQDVRIDAPIALEFLLQLLVPLDVATRGFIDGNRRYAEQRARAEGL
FT                   ADRDKFRNALVNSLQEGFFVADHEGSVIEVNNAFIEILGFPAEGLPYRWPHPWLVDPKT
FT                   ASEQIGVVLRTGSAEYETPIRHADGHLAWVKVSINAVKDSGSDRDAYVGTIRDVTAERA
FT                   FAARESAVLRLATAVAVAKSVDELLSITLDECSTAIDVQRVVAVSWPSGDGDPAVQVAG
FT                   RPAASSWRELDPWLRDTFAEARHQLPLTAKTVDHPDNPGKSRGLVAVLSGAGDLALWLE
FT                   LRTPRWVSGEDRLLVTVLIGHLSLALQHVRQFENARETSLTLQRAMLPPVQPPPGFAVR
FT                   YEPAVPPLEIGGDWYDVLPIGDHRIGIVVGDCVGRGLPAAAIMGQLRSSARALLINGAE
FT                   PAVLLDQLDSAASLIPNAYCTTVFLAILDTETGVLQYSNAGHMPAVLAGPEPGTTTLLT
FT                   DAASVPLAVRREDPRPQATRLLPPGSTLMLFTDGLVERKHEPIDDGIGRAAEVLAQTMT
FT                   LPLDTVADEVLRELAPAAGYDDDVAMVIYRHQQSPLRIETAATADQLVRIRHRLADWLG
FT                   AAGITGELAADIVLVVNEACTNCVEHAYRGFVAGTMVLDARLGEGEVHTRITDYGSWKT
FT                   PAANPVNSGRGLPLMKALSQAMELRTSATGTVADITFRRPAE"
FT   gene            complement(425977..426549)
FT                   /locus_tag="MAV_0431"
FT   CDS_pept        complement(425977..426549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0431"
FT                   /product="stage II sporulation protein E (SpoIIE),
FT                   putative"
FT                   /note="identified by match to protein family HMM PF07228"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67208"
FT                   /db_xref="GOA:A0A0H2ZZT1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZT1"
FT                   /protein_id="ABK67208.1"
FT                   /translation="MPSEYTSGDRGIAIDIDGEAALFALVDGLGHGPPAAEAALRAVDT
FT                   VTAAGAEPIEVLIQLCHRALEGTRGVAMTLARIDFAANTLTWAGVGNVTAHLVAKAPTG
FT                   TEVRSSARLAGGIVGYRIPEIRPAQVVSIRPGDLLVMRTDGIIDDYLDHIDFAAPALAI
FT                   AEGLLGKDAKETDDAMVLAARHRGAST"
FT   gene            complement(426596..427006)
FT                   /locus_tag="MAV_0432"
FT   CDS_pept        complement(426596..427006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0432"
FT                   /product="serine/threonine-protein kinase RsbT"
FT                   /EC_number="2.7.11.1"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66463"
FT                   /db_xref="GOA:A0A0H2ZXS1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXS1"
FT                   /protein_id="ABK66463.1"
FT                   /translation="MAADIVVAIDNPDDIVEARKAGHQLALDLGFSLTDVTMIATAISE
FT                   IARNITSYAGRGAVRVAVADREGRKALVVRAEDEGPGIADIERAMEDGYSTGRGLGMGL
FT                   PGARRLMDRLVVESTLGQGTVIEMWKWVPPRA"
FT   gene            complement(426996..427385)
FT                   /locus_tag="MAV_0433"
FT   CDS_pept        complement(426996..427385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0433"
FT                   /product="antagonist protein RsbS"
FT                   /note="identified by match to protein family HMM PF01740"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64917"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTF1"
FT                   /protein_id="ABK64917.1"
FT                   /translation="MPVPILKQGAILIASVQAALSDSDAERLRYDLMERVSRFRAQGII
FT                   VDVTAIDVMDSFAARSLRTIAHMTRLRGADTVIVGLQPEVAFAMVQLGLAFDDMNTALD
FT                   LEEGIALLNRQLAQRKPTIGRDGGG"
FT   gene            complement(427408..428310)
FT                   /locus_tag="MAV_0434"
FT   CDS_pept        complement(427408..428310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0434"
FT                   /product="anti-anti-sigma factor"
FT                   /note="identified by match to protein family HMM PF01740"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65662"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZV52"
FT                   /protein_id="ABK65662.1"
FT                   /translation="MSDSPSDFNSTGTAAQTVGISSEGLLPQLVQHLRQNRTILREEWA
FT                   RRITEAELLTAMTPEELFSEATAVYDNYVEVLETGSVEALQAYARDLSERIIPRGVETD
FT                   EVVGIVLLLRDVLARSLFEKYQTEFEMLNRVLDAYEPAANRIANTVAVSFVQERERIIR
FT                   QQQEAIRELSTPVLQVREQLLILPIIGVLDSQRARQVTEQLLRAIRANRAKVVVIDITG
FT                   VPTIDSTVANHLVQTVDASGLMGASVIITGLSSEIALTLVTIGLDLSKMNAVGDLQGGI
FT                   EEAERLLGYEVTRTGEQTG"
FT   gene            428508..428849
FT                   /locus_tag="MAV_0435"
FT   CDS_pept        428508..428849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0435"
FT                   /product="anti-anti-sigma factor"
FT                   /note="identified by match to protein family HMM PF01740;
FT                   match to protein family HMM TIGR00377"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64980"
FT                   /db_xref="GOA:A0A0H2ZRP9"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZRP9"
FT                   /protein_id="ABK64980.1"
FT                   /translation="MVEDHDGVSVVSVSGEIDLVTAPALEQAIGAVVADSPPALVIDLS
FT                   AVEFLGSVGLKILAATYEKLGKETGFGVVARGPATRRPIHLTGLDKTFPLYPTLDDALT
FT                   AVRDGKLNG"
FT   gene            428894..429403
FT                   /locus_tag="MAV_0436"
FT   CDS_pept        428894..429403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0436"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64537"
FT                   /db_xref="GOA:A0A0H2ZQQ9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZQQ9"
FT                   /protein_id="ABK64537.1"
FT                   /translation="MSGGDVDDPQEDQRWDRRERGETEVQRLDRNWNSLLQELRVVQTG
FT                   VQLLTGFLLTLPFQQRFDVLGPPMRVAYLATVVFSVCATVLLIAPVAMHRILFRRHRLQ
FT                   VLVSAAHRCAYAGLGALGLALIGVTTIIFAAVAGRNVGLVAGACALPLFVLFWFVLPLL
FT                   LRTRGM"
FT   gene            complement(429414..430046)
FT                   /locus_tag="MAV_0437"
FT   CDS_pept        complement(429414..430046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0437"
FT                   /product="hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66854"
FT                   /db_xref="GOA:A0A0H2ZYS8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYS8"
FT                   /protein_id="ABK66854.1"
FT                   /translation="MDSNYLHVHSWQRAFDDEDIAVASWQIHRCIGMDGSTLVRTLSGD
FT                   APDDVGERLRDRHSRYYRELTPLLKPLPGARAMLRRVADLGLQVVLASSAPEDELEILR
FT                   KVLDCDDVIAATTSSRDVDTAKPEPGIVRVALDRAGVRAEEAVFVGDAVWDAHAARGAG
FT                   LACIGLCSGGIARDELRAAGADPVFADPQDLLDHLESTRIAALARGG"
FT   gene            430269..430580
FT                   /locus_tag="MAV_0438"
FT   CDS_pept        430269..430580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0438"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66143"
FT                   /db_xref="GOA:A0A0H2ZUJ4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUJ4"
FT                   /protein_id="ABK66143.1"
FT                   /translation="MDHRNSDPVDHARTFRQHAGETFTYGANVPGLAGSAVAVVAMTVG
FT                   VFAVAAGHLTGGAIALIVAAVVGAVSAGWLLRTHRKVRDAELRWHAAHSDRPPPPPSS"
FT   gene            430703..431003
FT                   /pseudo
FT                   /locus_tag="MAV_0439"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which is not the result of sequencing error"
FT   gene            431106..431699
FT                   /locus_tag="MAV_0440"
FT   CDS_pept        431106..431699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0440"
FT                   /product="restriction endonuclease family protein"
FT                   /note="identified by match to protein family HMM PF04471"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68022"
FT                   /db_xref="GOA:A0A0H3A098"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A098"
FT                   /protein_id="ABK68022.1"
FT                   /translation="MDKALGALLLLGLGVPWYFTQHTTGSLPAGCAAGLAGLAAAVGAL
FT                   WWLSLQRDRLRADAHRRRDVKHARAGLRAIDRMSGAEFEDFVAAQLRVAGYVVTPTAGT
FT                   GDFGVDLIAKKDGVRMAVQCKRLAKAVGVAAVQQVVAGARQHGCDRTVVVTNQTFTKAA
FT                   RRLAITHRCRLVGRTQLRSWTRVAPIPVRGPRVS"
FT   gene            complement(431749..432438)
FT                   /locus_tag="MAV_0441"
FT   CDS_pept        complement(431749..432438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0441"
FT                   /product="antar domain protein"
FT                   /note="identified by match to protein family HMM PF01590;
FT                   match to protein family HMM PF03861"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65177"
FT                   /db_xref="GOA:A0A0H2ZS27"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZS27"
FT                   /protein_id="ABK65177.1"
FT                   /translation="MTNFDDLTLLNDVLRAIYSADTADFPQVLDDLTAASARWVPGAQE
FT                   AGITVTSRQNEVSTPSVTDDCARLLDEFQQRYLEGPCLHAAWTRKVVVVDDLRTDSRWP
FT                   KYQADALARTPIRSILSLPMYAGELSMGALNFYAERPHAFSDDSRRMAALFATLGSLAW
FT                   SNVVRTKQFKEALSTRDMIGQAKGILMERYELDDETAFNTLIKLSQSMNTPLRDIARRV
FT                   IDDTTQR"
FT   gene            432641..433252
FT                   /locus_tag="MAV_0442"
FT   CDS_pept        432641..433252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR03083;
FT                   match to protein family HMM TIGR03086"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65891"
FT                   /db_xref="GOA:A0A0H2ZW17"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017520"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW17"
FT                   /protein_id="ABK65891.1"
FT                   /translation="MLSVPAPTLRLMTERIDLMADKAIGVLIDSVRQVPSANWERPSNL
FT                   AGWSVRDLVGHATGSAAKIVALVAGEQIWQGPSRPSEWLRDDPVRYLNELADRLRGALP
FT                   TADLDAPRTSPQGEVPLRRALIFPVCDLALHSWDIHRCLGRQVELPPDLLALCQGLVES
FT                   LPEEMLRRPGAFGPAQPAPENSSPTARLMAFLGRSVEPPS"
FT   gene            complement(433270..433343)
FT                   /locus_tag="MAV_0443"
FT   tRNA            complement(433270..433343)
FT                   /locus_tag="MAV_0443"
FT                   /product="tRNA-Pro"
FT   gene            complement(433405..434508)
FT                   /locus_tag="MAV_0444"
FT   CDS_pept        complement(433405..434508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0444"
FT                   /product="cysteine synthase/cystathionine beta-synthase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00291"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69464"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3Y2"
FT                   /protein_id="ABK69464.1"
FT                   /translation="MTRTRIAVRNLPRDWTDNAIRLIQADARRSADTHLLRYPLPSAWA
FT                   GDADVALYLKDETTHVTGSLKHRLARSLFLYALCNGWIGEGTTVVEASSGSTAVSEAYF
FT                   AALLGLPFVAVMPESTSAAKVALIESQGGRCHFVADSSQVYAEAERVARQSGGHYLDQF
FT                   TNAERATDWRGNNNIAESIFEQMRDEKHPVPAWIVVGAGTGGTSATIGRYIRYRRHATR
FT                   LCVVDPEHSAFFAAYAEGRDDVVASRSSRIEGIGRPRVEPSFLPGVVDRMVAVPDAASV
FT                   AAARHVSAVLGRRVGPSTGTNVWGAFGLLAELVSQGRGGSVVTLLADSGDRYADTYFDD
FT                   EWVAAQGLDPAGPAAALAEFERSCAWQ"
FT   gene            complement(434505..435518)
FT                   /locus_tag="MAV_0445"
FT   CDS_pept        complement(434505..435518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0445"
FT                   /product="secreted protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64410"
FT                   /db_xref="GOA:A0A0H2ZQF9"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZQF9"
FT                   /protein_id="ABK64410.1"
FT                   /translation="MADAHVSIARRRSGPPRGRRRALPILLRTGAAALGSTVAGLGYAA
FT                   IIERNAFVLREITMPVLSPGSTPLRVLHISDLHMTPGQRRKQAWLRELAGWEPDLVVNT
FT                   GDNLAHPKAVPAVIQALGDLLSRPGVFVFGSNDYFGPHLKNPLNYVTNPSHRVRGEPLP
FT                   WQDLRAAFTERGWLDLTHTRREFEVAGLHVAAAGVDDPHIDRDRYDTIAGPASPAANLR
FT                   LGLTHSPEPRVLDRFAADGYQLVMAGHTHGGQVCLPFYGALVTNCGLDRSRAKGPSRWG
FT                   AHMQLHVSAGMGTSPYAPVRFCCRPEATLLTLIATPMGDRDAVSDLSRSQPTASVR"
FT   gene            complement(435576..437936)
FT                   /locus_tag="MAV_0446"
FT   CDS_pept        complement(435576..437936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0446"
FT                   /product="Transglycosylase"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF00912; match to protein
FT                   family HMM PF03793"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68195"
FT                   /db_xref="GOA:A0A0H3A281"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A281"
FT                   /protein_id="ABK68195.1"
FT                   /translation="MATALLFPVAGGIGLVSNRASEVVANGSAQLLEGEVPAVSTMVDA
FT                   KGNTIAWLYSQRRFEVPSDKIANTMKLAIVSIEDKRFADHNGVDWKGTLTGLAGYARGD
FT                   VDTRGGSTIEQQYIKNYQLLVTAKTDAEKRAAVETTPARKLREIRMALTLDKTFTKPEI
FT                   LTRYLNLVSFGNNSFGVQDAAQTYFGINASDLNWQQAALLAGMVQSTSALNPYTNPEGA
FT                   LARRNLVLDTMIENIPQEADALRAAKAAPLGILPQPNELPRGCIAAGDRAYFCDYVQEY
FT                   LSRAGISKEQVARGGYLIKTTLDPDVQIPVKAAIDKFASPTLPGISSVMSVIQPGKTSH
FT                   KVMAMASNRTYGLDVDAGQTMRPQPFSLVGDGAGSVFKIFTTAAALDMGMGINATLEVP
FT                   GRFQAKGMGSGGAKGCPKDTWCVVNAGNYKGSMNVTEALATSPNTAFAKLIQQVGVTRT
FT                   VDMAIKLGLRSYADPGTARDYNPDSNESLADFVKRQNIGSFTLGPIEVNALELSNVAAT
FT                   LASGGTWCPPNPIDKLIDRKGNEVAVTTETCDQVVPEGLANTMANAMSKDAVGGGTAAG
FT                   SAGAAGWDLPMSGKTGTTEAHRSSGFVGFTNHYAAANYIYDDSPNPTDLCSAPLRHCGE
FT                   GDLYGGNEPARTWFTAMKPIATNFGPVQLPPTDPRYVDGAPGSRVPSVAGLDIDAARQR
FT                   IKEAGFQVADQNNFVNSSAKQGEVVGTTPSGATIPGSIITIQVSNGIPPAPPPPPEGAP
FT                   PPVGSQVVEIPGLPPITIPLLAPPPPAPGQPPP"
FT   gene            438507..438719
FT                   /locus_tag="MAV_0447"
FT   CDS_pept        438507..438719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0447"
FT                   /product="Transcription factor WhiB"
FT                   /note="identified by match to protein family HMM PF02467"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68705"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0X9"
FT                   /protein_id="ABK68705.1"
FT                   /translation="MRGAAQRKAAVICRHCPVMQECGADALDNRVEFGVWGGMTERQRR
FT                   ALLKQHPEVVSWADFFDKRRNRSAG"
FT   gene            complement(438782..439897)
FT                   /locus_tag="MAV_0448"
FT   CDS_pept        complement(438782..439897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0448"
FT                   /product="anion-transporting ATPase"
FT                   /note="identified by match to protein family HMM PF02374"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66624"
FT                   /db_xref="GOA:A0A0H2ZXX4"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXX4"
FT                   /protein_id="ABK66624.1"
FT                   /translation="MAAILADTTNRVVVCCGAGGVGKTTTAAAIALRAAEYGRNVCVLT
FT                   IDPAKRLAQALGVNDLGNTPQRVPLAAEVPGELHAMMLDMRRTFDEMVVQYSGPGRAQA
FT                   ILDNQFYQTVASSLAGTQEYMAMEKLGQLLAEDRWDLVVVDTPPSRNALDFLDAPKRLG
FT                   SFMDSRLWRLLLAPGRGIGRLVTGAMGLAMKAMSTILGSQMLADAAAFVQSLDATFGGF
FT                   REKADRTYALLKRRGTQFVVVSAAEPDALREASFFVDRLSQEGMPLAGLVLNRTHPPLC
FT                   SLPAERAIDGTEMLEHDGDPETTSLAAAVLRIHADRAQTAKREIRLLSRFTGANPHVPV
FT                   IGVPSLPFDVSDLEALRALADQITSNRATAR"
FT   gene            complement(439921..440892)
FT                   /locus_tag="MAV_0449"
FT   CDS_pept        complement(439921..440892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0449"
FT                   /product="anion-transporting ATPase"
FT                   /note="identified by match to protein family HMM PF02374"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66721"
FT                   /db_xref="GOA:A0A0H2ZVZ6"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVZ6"
FT                   /protein_id="ABK66721.1"
FT                   /translation="MTKARLHFVTGKGGTGKSTIAAALALTLAAGGRKVLLVEVEGRQG
FT                   IAQLFDVPPLPYQEVKIATAERGGQVNALAIDIEAAFLEYLDMFYNLGIAGRAMRRIGA
FT                   IEFATTIAPGLRDVLLTGKIKETVIRVDKNRLPVYDAIVVDAPPTGRIARFLDVTKAVS
FT                   DLAKGGPVHSQADGVVRLLHSEQTAIHLVTLLEALPVQETLEAIEELAEMQLPIGSVIV
FT                   NRNIPAYLQPADLAKAAEGDIDADAVRAGLQKAGITLDDKDFAGLLTETIEHATVIATR
FT                   AEIAQQLDALHVARLELPAISDGVDLGSLYELSESLAQQGVR"
FT   gene            441011..441172
FT                   /locus_tag="MAV_0450"
FT   CDS_pept        441011..441172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67445"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0F5"
FT                   /protein_id="ABK67445.1"
FT                   /translation="MSQPTAWEYATVPLLTHATKQILDQWGADGWELVSVLPGPTGEQH
FT                   VAYLKRPK"
FT   gene            441173..441649
FT                   /locus_tag="MAV_0451"
FT   CDS_pept        441173..441649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0451"
FT                   /product="translation initiation inhibitor"
FT                   /note="identified by match to protein family HMM PF01042"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69208"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3H1"
FT                   /protein_id="ABK69208.1"
FT                   /translation="MSAAPSWKARLAELGLTLPEVVAPLASYVPAVRTGNLVYTAGQLP
FT                   MQDGKLATTGKVGAHITPDEGRALARICALNALAAVDALVGIDAVTRVVKVVGFVASAP
FT                   GFNGQPSVVNGASDLLAEVFGEHGAHARSAVGVGELPLDAPVEVELIVEVGARP"
FT   gene            441646..442449
FT                   /locus_tag="MAV_0452"
FT   CDS_pept        441646..442449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0452"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68323"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A139"
FT                   /protein_id="ABK68323.1"
FT                   /translation="MTEVAESPTHPAYGRLRAVTDTASVLLADNPGLLTLEGTNTWVLR
FT                   GPGSDELVIVDPGPDDDEHIARIAALGRIALVLISHRHGDHTDGIDKLVERTGATVRSA
FT                   GSGFLRGLGGELTDGEVIDAAGLRIKVMATPGHTADSLCFLLDDAVLTADTVLGRGTTV
FT                   LDKEDGSLTDYLESLRRLRGLGRRAVLPGHGPDLTDLESVAQGYLEHRRERLDQVRSAV
FT                   RELGEDVSARRIVEHVYVDVDEKLWDAAEWSVQVQLNHLRSEPST"
FT   gene            complement(442682..443356)
FT                   /locus_tag="MAV_0453"
FT   CDS_pept        complement(442682..443356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0453"
FT                   /product="transcriptional regulator, Crp/Fnr family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00027;
FT                   match to protein family HMM PF00325"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67698"
FT                   /db_xref="GOA:A0A0H2ZYE5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYE5"
FT                   /protein_id="ABK67698.1"
FT                   /translation="MDEILARAGIFQGVEPSAVTALTKQLQPVDFPRGHTVFAEGEPGD
FT                   RLYIIVSGKVKIGRRSPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSM
FT                   DRDALRAWIADRPEIAEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGT
FT                   QEGGAMRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARR
FT                   AR"
FT   gene            complement(443461..443841)
FT                   /locus_tag="MAV_0454"
FT   CDS_pept        complement(443461..443841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68137"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0Y8"
FT                   /protein_id="ABK68137.1"
FT                   /translation="MSWLLVAGVPVLLMLAALGLGRLEKELVRDPAAVADVDEFLERTG
FT                   GVDMHTLAAEGMPEALEYLHRREAQQSAGPAPGGRSGGPRHAAPSFAAGFVDPDEMTLP
FT                   TRIGGHSHVNPQFRAPRHANRV"
FT   gene            444012..444710
FT                   /gene="nth"
FT                   /locus_tag="MAV_0455"
FT   CDS_pept        444012..444710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="MAV_0455"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730; match to protein
FT                   family HMM TIGR01083"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66959"
FT                   /db_xref="GOA:A0A0H2ZYZ5"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYZ5"
FT                   /protein_id="ABK66959.1"
FT                   /translation="MRRARRMNRILAQAFPEAHCELDFTTPLELTVATILSAQSTDKRV
FT                   NLTTRALFKRYTCALDYAQADRDELENLIRPTGFFRNKASALIRLGQALVERFDGEVPA
FT                   TMAELVTLPGVGRKTANVILGNAFGVPGITVDTHFARLVHRWRWTAEKDPVKIEHAVGE
FT                   LIERSEWTMLSHRVIFHGRRVCHSRKPACGVCLLARDCPSFGLGPTEPPLAAQLVRGPE
FT                   TEHLLALAGL"
FT   gene            444735..445403
FT                   /locus_tag="MAV_0456"
FT   CDS_pept        444735..445403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66071"
FT                   /db_xref="GOA:A0A0H2ZW75"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW75"
FT                   /protein_id="ABK66071.1"
FT                   /translation="MPIPRPTLTRKVRWHIAILAVVVALIVALLAQLRDDAATPGPPAT
FT                   GRVVADREHRDADTPAALAGPRQRADLPPCPAAGTGPGPAALRGVTAECAADGSVVDAG
FT                   RAVAGRRVVLNFWAYWCAPCAAELPAMAEYQRRAGAEVTVLTVHQDENETAALLRLAEL
FT                   GVRLPTLQDGRRRVAAALRVVNVMPATVVLRPDGSVAQTLPRAFSTADEIAAAIGNDRG
FT                   "
FT   gene            445433..446251
FT                   /locus_tag="MAV_0457"
FT   CDS_pept        445433..446251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0457"
FT                   /product="hydrolase, nudix family protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65294"
FT                   /db_xref="GOA:A0A0H2ZU09"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZU09"
FT                   /protein_id="ABK65294.1"
FT                   /translation="MSAGGSPLRNGDPAPARGTVPLTPDACPSWLRPLVDNVDDVPDAA
FT                   RRRLPADVLAMITTKAASALTSVRGAAREAAVLVLFSGPESGPPGGGPPTDADLLVTVR
FT                   ASTLRHHAGQAAFPGGAADPTDDGPVATALREAREETGIDVSRLHPLATMEKMFIAPSQ
FT                   FHVVPVLAYSPDPGPVAVVNEAETALVARVPLRAFINPANRLMVYRGDLGRRWAGPAFL
FT                   LNEMLVWGFTGQVISALLDVAGWAQPWDTSDQRELDAAMALVGERGDALE"
FT   gene            446248..447456
FT                   /locus_tag="MAV_0459"
FT   CDS_pept        446248..447456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0459"
FT                   /product="serine protease"
FT                   /note="identified by match to protein family HMM PF00089;
FT                   match to protein family HMM PF02674"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67184"
FT                   /db_xref="GOA:A0A0H2ZX34"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZX34"
FT                   /protein_id="ABK67184.1"
FT                   /translation="MNLNSMTPSQWLDVAVLAVAFIAAISGWRSGALGSLLSFVGVLLG
FT                   AIAGVLLAPHLVSHIAAPRAKLFAALFLILALVVIGEVAGVVLGRAVRGAIRSRSIRTV
FT                   DSVIGVGVQLVVVLTAAWLLATPLTQSKDQPELAAAVRGSRVLAKVNEVAPPWLKTVPK
FT                   RLSALLNTSGLPAVLEPFSRTPVIPVASPDPELASNPVVQATAPSVVKVRSLAPSCQKV
FT                   LEGSGFVIAPDRVMTNAHVVAGSNSVQIYASGNPLDATVVSYDPSVDIAILAVPNLPPP
FT                   PLPFAQTEAKTGASVVVLGYPGGGNFTATPARIRELIKLSGPDIYRDPAPVTRDVYTIR
FT                   ASVEQGNSGGPLIDLNGQVLGVVFGAAVDDPDTGFVLTADEVAGQLAKIGETKTVGTGS
FT                   CVS"
FT   gene            complement(447449..448414)
FT                   /locus_tag="MAV_0458"
FT   CDS_pept        complement(447449..448414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0458"
FT                   /product="hydrolase, alpha/beta fold family protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64585"
FT                   /db_xref="GOA:A0A0H2ZQU8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZQU8"
FT                   /protein_id="ABK64585.1"
FT                   /translation="MAPPDPSVTRIDGPWRHLDVHANGIRFHVVEALPVGDARGLPATA
FT                   RPLVMLLHGFGSFWWSWRHQLRGLTGARVVAVDLRGYGGSDKPPRGYDGWTLSGDAAGL
FT                   IRALGHSSATLVGHADGGLACWATALLHARLVSAVALISSPHPAALRQSTLARRDQAGA
FT                   LLPTLLRYQVPLWPERLLTRDGGAEIERLVRSRSCAKWLASEDFSETIGHLRTAIQIPA
FT                   AAHCALEYQRWAVRSQLRDEGRRFLRSMRRQLGVPLLHLRGEEDPYVLADPVDRTRRYA
FT                   PQGRYVTVAGAGHFSHEEAPEEINRHLTSFLEDVHGPAVN"
FT   gene            complement(448415..448954)
FT                   /locus_tag="MAV_0460"
FT   CDS_pept        complement(448415..448954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07332"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69323"
FT                   /db_xref="GOA:A0A0H3A3P1"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3P1"
FT                   /protein_id="ABK69323.1"
FT                   /translation="MSKVEGKNGVPSTLTTIPLTDPHAKPAEPTIGDLIKDATTQVSTL
FT                   VRAEVELARAEITRDVKKGLTGSVFFIAALVVLFYSTFFFFFFVAELLDTWLWRWVAFL
FT                   IVFGVQVVVGAVLALLGFLKVRRIRGPRQTIESVKETRTALTPGHDKAAGARALTESHG
FT                   KHAKPGDGAAADPSGW"
FT   gene            449175..449846
FT                   /locus_tag="MAV_0461"
FT   CDS_pept        449175..449846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69095"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A586"
FT                   /protein_id="ABK69095.1"
FT                   /translation="MAMVALLVAVTGSHPRAAAADVRIPLGGGAGIVVNGDTMCTLTTI
FT                   GGDAAGDLIGFTSAHCGGPGAQVAAEGAENAGILGTMVAGNDNLDYAVIKFDPAKVTPV
FT                   ANFNGFLISGIGPDPAFGEIACKQGRTTGNSCGVTWGMGQSPGTIVMQVCGQPGDSGAP
FT                   VTVNNQLVGMIHGAFSDNLPTCVIKYIPLHTPAVVMSFNAILADINAKHRPGAGFAPLP
FT                   G"
FT   gene            complement(449938..451890)
FT                   /gene="acsA"
FT                   /locus_tag="MAV_0462"
FT   CDS_pept        complement(449938..451890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acsA"
FT                   /locus_tag="MAV_0462"
FT                   /product="acetate--CoA ligase"
FT                   /EC_number="6.2.1.1"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM TIGR02188"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68385"
FT                   /db_xref="GOA:A0A0H3A2N1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2N1"
FT                   /protein_id="ABK68385.1"
FT                   /translation="MTASNTANPPSYPPPPQFVEQANAGEQLYREAERDRLAFWAEQAN
FT                   RLSWATPFTEVLDWSRAPFAEWFADGTLNVAYNCVDRHVQAGHGDRVAIHWEGESPGDQ
FT                   RSLTYSELYTQVCKAANALTDLGLVAGDRVAIYLPLIPEAVIAMLACARLGVMHSVVFA
FT                   GFTAKALQARIADAAAKLLITSDGQFRRGKPAPLKDAADEAVADPDSPVEHVVVVRRTG
FT                   IDVSWTDGRDLWWHDVVDAAAPEHTPEPFPAEQPLFLLYTSGTTGKPKGIVHTSGGYLT
FT                   QAAYTHYYVFDIKADTDVFWCTADIGWVTGHTYGVYGPLANGVTEVLYEGTPDTPTQHR
FT                   HFEIIEKYGVTIYYTAPTLIRTFMKWGREIPDAHDLSSLRLLGSVGEPINPEAWRWYRS
FT                   VIGADRLPIVDTWWQTETGATMISPLPGVAAAKPGSAMRPLPGISARIVDDHGDQLVPG
FT                   IHHGEHVTGYLVLDQPWPSMLRGIWGDPDRYVETYWSRFAEQGWYFAGDSAYYDRDGAI
FT                   WVVGRIDDVMNVSGHRLSTAEVESALVGHHGVAEAAVVGATDATTGQAICAFVVLCADY
FT                   QVHDGIVDELRAEVAREISPIAKPREVHVVPELPKTRSGKIMRRLLRDIAENRELGDTS
FT                   TLLDPGVFDAIRAAK"
FT   gene            452005..452547
FT                   /locus_tag="MAV_0463"
FT   CDS_pept        452005..452547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65636"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUX6"
FT                   /protein_id="ABK65636.1"
FT                   /translation="MPGHSRGLRRSVASFAALATSYAAATAAGWPAAAVPADTTDTPTP
FT                   CWSDQIAVTAAPAQGAVGHRAVTLVFTLAGGAEPCTLTGYAAVDSGAGGALVHAQPTPR
FT                   GYLGGLPAGVDAPPTVILSISTQGQAIVEGVAVDADGQPCPTYTDLLVNPPDTTAVVTV
FT                   PATIEACELQVHPITAV"
FT   gene            452654..454258
FT                   /locus_tag="MAV_0464"
FT   CDS_pept        452654..454258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0464"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family protein 5"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64916"
FT                   /db_xref="GOA:A0A0H2ZT06"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZT06"
FT                   /protein_id="ABK64916.1"
FT                   /translation="MAVLATAAAALLVVASLAGCGGGVLSPDLVVVNGGEPPNPLVPTG
FT                   TNDSQGGRILDRLFAGLMSYDAAGNPAPEVAQSIESGDNVNYRIVLKPGWRFTDGSPVT
FT                   AHSFVDAWNYGALSTNAQLQQSFFSPIDGYDALAAGQPQQTTMTGLRVVNDLEFTVRLK
FT                   APTVDFKLRLGHSAFYPLPQAAFRDMAAFGRHPIGNGPYQLAGGPDGPAWEHNVRIDLR
FT                   PNPDYHGNRKPRNKGLRFEFYANLDTAYADLLSGNLDVLDTIPPSALPVYRRDLGERVT
FT                   AGPAAINQSLDTPLRLPHFGGEEGRLRRLALSAAINRAQICRQIFADTRSPARDFTARS
FT                   LPGFDPNIAGSDALDFDPERARRLWAQADAISAWSGSYPIAYNADAGHQDWVDAVANGI
FT                   KNVLGIDALGAPQPTFAGFRTQITNRSIGSAFRSGWQGDYPSMIEFLAPLFATGAGSND
FT                   VGYSSPRFDAALATAEAAPDLPQAAALANDAQRILFHDMPVVPLWNYISVVGWSGEVSH
FT                   VTVTWNGLPDYENIVKA"
FT   gene            454260..455186
FT                   /gene="dppB"
FT                   /locus_tag="MAV_0465"
FT   CDS_pept        454260..455186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB"
FT                   /locus_tag="MAV_0465"
FT                   /product="ABC transporter, permease protein DppB"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67516"
FT                   /db_xref="GOA:A0A0H2ZYR7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYR7"
FT                   /protein_id="ABK67516.1"
FT                   /translation="MGWYIARRIAVMVPVFLGATLLIYAMVFLLPGDPVAAIAGDRPLT
FT                   PAVAAALRARYHLDDPFLVQYLRYLGGVLRGDLGRAYSGLPVSDVLAHAFPVTLRLSLI
FT                   ALAVEAVLGIGFGVIAGLRQGGLFDSAVLITGLVIIAVPIFVLGFLAQFVFGVRLGIAP
FT                   VTVGNAATFTRLLLPGIVLGSVSFAYVVRLTRSTVAVNAHADYVRTATAKGLSRPRVVT
FT                   VHILRNSLIPVVTFLGADLGALMGGAIVTEGIFNIHGVGGVLYQAVTRQEAPTVVSIVT
FT                   VLVLIYLVTNLVVDLLYAVLDPRIRYG"
FT   gene            455179..456054
FT                   /gene="dppC"
FT                   /locus_tag="MAV_0466"
FT   CDS_pept        455179..456054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="MAV_0466"
FT                   /product="ABC transporter, permease protein DppC"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66824"
FT                   /db_xref="GOA:A0A0H2ZW91"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW91"
FT                   /protein_id="ABK66824.1"
FT                   /translation="MAERIRARGGFWRETWRRLRRRPKFIGAGLLILVILAVALFPALF
FT                   TAADPTYADPAQSLLPPSRTHWFGTDLQGHDVYARTVYGARASVTVGLGAAAIVFVVGG
FT                   ALGALAGFYGGWIDAVVSRVTDVFFGLPLLLAAIVLMQVLHHRTVWTVIAILALFGWPQ
FT                   VARIARGAVLAVRASDYVLAAKALGMSRFQILIRHALPNALGPVIAVATIALGLFIVTE
FT                   ATLSYLGVGLPPSVVSWGGDINLAQTRLRAGSPILFYPAGALAATVLAFMMMGDALRDA
FT                   LDPASRAWRA"
FT   gene            456042..457697
FT                   /gene="dppD"
FT                   /locus_tag="MAV_0467"
FT   CDS_pept        456042..457697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppD"
FT                   /locus_tag="MAV_0467"
FT                   /product="ABC transporter, ATP-binding protein DppD"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68625"
FT                   /db_xref="GOA:A0A0H3A3W0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3W0"
FT                   /protein_id="ABK68625.1"
FT                   /translation="MAGMTTPLLSVEGLHVGFGEHAAVRGLDLRVLPGQTVAVVGESGS
FT                   GKSSTAAAILGLLPPGGRITAGRIMFDGVDISAADRRALRSMRGRQIGYIPQDPMTNLN
FT                   PVWKVGFQIREALRANTSDRDTRRRAVQLLEAAGMPDPAKQAARYPHQLSGGMCQRALI
FT                   AIGLAGRPRLLIADEPTSALDVTVQRQVLDHLQRLTADLGTAVLLITHDLALAAERAES
FT                   VVVVHDGVAVESGAAQSILQDPRHEYTRRLVAAAPALTVSGGARTGPRQPDRTQPEPAD
FT                   ILVASDLTKLYREPRATLWRRTEFRAVDAVSFRLHRARTLAIAGESGSGKSTLALMVLG
FT                   LLPPTSGTVVFDGTRIDDTLSGDQHLAFRRRVQPVFQNPYSSLDPMYSVFRAIEEPLRI
FT                   HRVGDRRQRAKAVHDLVDQVALPSSVLNRLPRELSGGQRQRVAIARALALRPQVLVCDE
FT                   AVSALDVLVQAQILELLARLQAELGLAYLFISHDLAVIRQIADDVLVMRAGRVVEQAPT
FT                   EKLFTAPAQDYTRQLLDAIPRPRRGGDRLSSCDG"
FT   gene            457714..458445
FT                   /locus_tag="MAV_0468"
FT   CDS_pept        457714..458445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67287"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYZ3"
FT                   /protein_id="ABK67287.1"
FT                   /translation="MELPGVAEASDRARDALGRAHRHRANLRGWPVTAAEAALRAARAS
FT                   SVLDGGPVRLEDLAEAGQISDPVFAGALRVAQALEGGEGPVVGIWRRAPLQALARLHML
FT                   AAADQVDDERLGRPRADAGVGPRLELLADLVNGRTRVPAPVLAAVAHGELLTLRPFGSC
FT                   DGVVARAVSRLVTIASGLDPHGLGVPEVSWMRQPAAYRDAARGFADGTPEGVGAWLVLC
FT                   CRAMRAGAQEALSIADSMSNR"
FT   gene            complement(458911..459768)
FT                   /locus_tag="MAV_0469"
FT   CDS_pept        complement(458911..459768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0469"
FT                   /product="HAD-superfamily protein subfamily protein IB
FT                   hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01488; match to protein
FT                   family HMM TIGR01490"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64543"
FT                   /db_xref="GOA:A0A0H2ZQP9"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZQP9"
FT                   /protein_id="ABK64543.1"
FT                   /translation="MTVFDPAAEQSAPEQSAPSGVPHARTAAFFDLDKTIIAKSSTLAF
FT                   SKPFFAQGLLNRRAVLKSSYAQFIYLLSGADHDQMDRMRAHMTNMCTGWDVEQVKSIVN
FT                   ETLHDIVTPLVFAEAADLIAAHKLCGRDVVVVSASGEEIVAPIARALGATHAMATRMVV
FT                   EDGRYTGEIAFYCYGEGKVQAIRELAAREGYPLEHCYAYSDSITDLPMLEAVGHPSVVN
FT                   PDRGLRREALERGWPVMSFSRPVSLRDRIPAPSGAAIATTAAVGISALAAGAVTYSLLR
FT                   RYSF"
FT   gene            460281..461333
FT                   /locus_tag="MAV_0470"
FT   CDS_pept        460281..461333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69075"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3C0"
FT                   /protein_id="ABK69075.1"
FT                   /translation="MLAEPELRAELDRVAAAAGVRVVHAGDAAAVSRKTWAAAAAVVLD
FT                   AAAAARCGRWALPRRDHVTVLTAAEPATTTWAAAVRIGAARVLRLPEHEADLVGELAEA
FT                   AESSRDDGQRGHAVAVIGGCGGAGASLLAVALAQAAGDALLVDLDPWGGGIELLLGGEN
FT                   TPGLRWPDLALQGGRLNWAAVRDALPRHRGVSVLSGTRRGHEVDAGPVHAVVDAGRRGA
FT                   VSVICDLPRRFTDAAQAALGAADLVVVVSRCDVRACAATGALAPVLAAVNPNVGLVVRG
FT                   PSPGGLRAAEIAGITGLPLLAAIKAQPQLGAQVERVGLRLGRRSALAVAARQVLGVLPP
FT                   AGARRKGKAA"
FT   gene            461330..462418
FT                   /locus_tag="MAV_0471"
FT   CDS_pept        461330..462418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0471"
FT                   /product="Type II/IV secretion system protein"
FT                   /note="identified by match to protein family HMM PF00437"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68494"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2X0"
FT                   /protein_id="ABK68494.1"
FT                   /translation="MSSSLIDRVRERLAGETVPLGAPLPASVVAAAIRAESGGMLGDTE
FT                   VLANLRTLQTELTGAGILEPLLCADGTTDVLVTAPDAVWVDDGNGLRRSEIRFPDEAAV
FT                   RRLAQRLALAAGRRLDDAQPWVDGELTGIGAGGFAVRLHAVLPPVAAAGTCLSLRVLRP
FT                   ASQDLAALSAAGAIEPAAAALVADIIAARLAFLVSGGTGAGKTTLLAAILGAVPPDERI
FT                   VCVEDAAELAPPHPHLVKLVARCANVEGVGEVPVRQLVRQALRMRPDRIVVGEVRGAEV
FT                   VDLLAALNTGHDGGAGTVHANNPGEVPARLEALGALGGLDRAALHSQLAAAVLSVGRSG
FT                   VWLTVSDGEIRPCACRREQPYL"
FT   gene            462391..462666
FT                   /locus_tag="MAV_0472"
FT   CDS_pept        462391..462666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0472"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTW3"
FT                   /protein_id="ABK65098.1"
FT                   /translation="MSSGTALSVELYLTVAQAGAELDVTEEAYKAGWDYPPRMGALGVI
FT                   SPRTCPRCPVNRILWWAIAGSVPGSGVSDGGVSVPDVRGPSRESLW"
FT   gene            462660..463934
FT                   /locus_tag="MAV_0473"
FT   CDS_pept        462660..463934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0473"
FT                   /product="transposase, Mutator family protein"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65455"
FT                   /db_xref="GOA:A0A0H3A1M9"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1M9"
FT                   /protein_id="ABK65455.1"
FT                   /translation="MVKRPRITTERNIAMALDQSALLEVLDALRTADAGERITQAAETI
FT                   YQALIDAELTAFIGASPHERTETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSFFPAL
FT                   LERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEVSRICKDLDTEVAA
FT                   FRDRPLGDQRFPYVFLDATYCKARVNHRVVSQAVVIATGVAADGRREVLGFEVGDSEDG
FT                   AFWTAFLRSLKSRGLAGVQLVISDAHAGLRSAIDAVLIGAAWQRCRVHFLRNVLAQVPK
FT                   GSAEMVAAAIRTVFAQPDAEHVREQLDTIAGMLGRQFPKVETMLREAAADITAFADFPV
FT                   AHWKKIWSTNPLERLNKEIKRRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVADKRYLS
FT                   ETSLALLDVSDQSAETIAPTAALTA"
FT   gene            complement(464148..464795)
FT                   /locus_tag="MAV_0474"
FT   CDS_pept        complement(464148..464795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0474"
FT                   /product="TetR-family protein transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67066"
FT                   /db_xref="GOA:A0A0H2ZWW5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWW5"
FT                   /protein_id="ABK67066.1"
FT                   /translation="MFPLRDRLAAELPFDSGLRDRNKMRTRLRLNSEAIRLFAERGYDD
FT                   TSVQDIADAAEVSLRTLFRYFSGKDEILFARDYDLSEFFDNLSRQPAAVPALHAIRTAY
FT                   TQQRALTREETDVILQFRRAVAGNAALQGRFLDLQHRFRHQLARALAKRAGRRKPTEAD
FT                   EVAAATAQTLLDLAFSRWTDRGGRGSLAHLVDRMFATLDEIIGDTGESTVTA"
FT   gene            complement(464814..465872)
FT                   /locus_tag="MAV_0475"
FT   CDS_pept        complement(464814..465872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0475"
FT                   /product="amidohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF04909"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69198"
FT                   /db_xref="GOA:A0A0H3A3G4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3G4"
FT                   /protein_id="ABK69198.1"
FT                   /translation="MNGHAISADSHVTEPIELYAERVDARFKDRVPTISNQDGWRMLHA
FT                   EGMAPRKLMTASELELAVVAGPDPEQRLREQRQDGVVGEVVYPNWALQTCFVGDPELQN
FT                   AICKAYNDWAHDALMTTDWSLPVAMIPMANIDDAIAEAQRAASLGFRALSLPARVEQRE
FT                   YNSEDNDPFWACASELGLPLTFHSGTGYDPRLVRGQGANVINYVLGAQLDGPRVLLHLA
FT                   AGGVLDRFPTLRIVAVETGASWLGWVMTQADAVYADHAFFAKKKLSAPPSEFIRRQCHA
FT                   TFMVDPVAVQNRNITGVECLIWGNDYPHPEGTWPQSATQAAPQFDGVPDEEVDAIVGGN
FT                   AAAVFGFDRTRL"
FT   gene            complement(465869..466309)
FT                   /locus_tag="MAV_0476"
FT   CDS_pept        complement(465869..466309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01796"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66889"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWE4"
FT                   /protein_id="ABK66889.1"
FT                   /translation="MSDAMPGLPAPLPDATTRGYWNAAASGEFVIQRCTECGTDRHPPT
FT                   EVCYSCGALDWAWRTHTGNGSVYSYTWADRPVVPALAALGVYNVSVVELHDTIGVVRIL
FT                   SRVTDIERHELRIGLEVEVHFDSASADTALPVFRPRQQEVSS"
FT   gene            complement(466359..467552)
FT                   /locus_tag="MAV_0477"
FT   CDS_pept        complement(466359..467552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0477"
FT                   /product="lipid-transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67749"
FT                   /db_xref="GOA:A0A0H2ZYH8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYH8"
FT                   /protein_id="ABK67749.1"
FT                   /translation="MISLRNQAAIVGIGHVPFGRRGELAEKGHLRLAVEAITLACEDAG
FT                   ITGKDVDGYSSYYTEVEPAELVSAFGAQRLRYTAQTWGGGGASMCGAFQNAALGVTTGQ
FT                   ADYVVVHKVATMAGTARYGQAFGQMGQGVNAIGGPFAFSVPYGLQSPGQMFALAARRHM
FT                   HLYGTTSEQFAHVAINARTMAANNPAARFREPITVADHQASPMIADPLRRLDFCMESDY
FT                   GCAVVIASADRARDLRQKPAYIAAAAVGAPYRYGNALMSFYNQPDEDFASSGHRTVADE
FT                   LYRHSGLTLQDMHAAMLYDHFTAMMIMALEDFGFCKKGEGGPYVADGNLALGGPLPVNT
FT                   HGGNLAEAYTHGMTHVMEAVRQIRGSAINQIPSATNILVVGGAGPSPTSGMILTGSR"
FT   gene            complement(467549..469909)
FT                   /locus_tag="MAV_0478"
FT   CDS_pept        complement(467549..469909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0478"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65398"
FT                   /db_xref="GOA:A0A0H2ZUF0"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUF0"
FT                   /protein_id="ABK65398.1"
FT                   /translation="MQQDLRPLAGVRVVSTANALPAALVGLVLADAGAEVWLLEPPSGS
FT                   RLRPYAPWAFWARGQRSVCVDLKDPAGVDVARELIRRSDVFVDSWAPGVASRLGLAADD
FT                   LISDNSRLVHARISAFGDDSPWAQLAGWESVVMAVIGGNASFANLAGREGPAFVSTPYC
FT                   SVSAAHLLLHGILGALVERQRSGVGQQVSTTLAQGMLAHDTWNWLIHVLAQRYGSAFTM
FT                   SPPYDLQTLVPNTPFFFRLLVGLTKDGTWLQFSQTTERLWAAFLRACDLDPTDPEIHDA
FT                   PASENAEIRVAFWEKLLAAVRRRTLAEWQAVFDEDPNVWAESFRSGPEVLDHPQLVTER
FT                   RVVSDGHGLRMPGALCSSTLWAADVLATAPALGEGNDDVAELIRQPVGVTAASAAAENP
FT                   SPALDGVTVVELGTFYAAPFGATLLAEQGARIIKVEPPEGDPIRNVVPFPELAGIKVLH
FT                   GKESIELDIGTAQGRAVLHELVRKADVVLQGYRAGVAERLQCTAEHLHAVNPELLYVSA
FT                   PGYGDGPPCGHRPAFAPTMGAASGMAMRNLGGEVAIPRGADLALPVVKHTAMRLASGAM
FT                   AIANADGFAGLGVATTTLLGIVGKLRHGRGDHLRSSMLATMAHTLGDTVTESSTGRPAP
FT                   TPDPQLFGLSPTHRLYPTADGWVMLAVSDDSDRRALTELLEVDVDADDAEKHLATRFLS
FT                   ADASYWQDHLGAAGVTCVKAAETGIELTAMLGEFGAQHGFVTTAQHPAFGEYPRLTQLT
FT                   RFSRSASVLGESPLCGQHTDAVLAELAGQQVLT"
FT   gene            470026..470883
FT                   /locus_tag="MAV_0479"
FT   CDS_pept        470026..470883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0479"
FT                   /product="carveol dehydrogenase"
FT                   /EC_number="1.1.1.275"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65008"
FT                   /db_xref="GOA:A0A0H2ZT91"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR023985"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZT91"
FT                   /protein_id="ABK65008.1"
FT                   /translation="MAGRVEGKVVFITGLAKGQGRAHAVRLAEEGADIIGIDVPGPYDH
FT                   AAYPMATQDDLDETVNLVEKAGGRIIARQGDVRDRASITKALDDGIAEFGHLDVVVANA
FT                   GICAMGPRSAEAFLEALDVDLVGVINTIAAAQPHLRAGASVIVTGSVAAMIPGSVDSLA
FT                   GGPGGAGYGFSKQTIAKLVRELALLWADRSIRVNAVHPTNVSTDLLFNDAMYRTFRPDI
FT                   DVPTKEDALQTFPTMQALPIAYTEPIDVANAVLYLASDEARYVTGLQMRVDAGSVIKMV
FT                   PGVL"
FT   gene            470979..471905
FT                   /locus_tag="MAV_0480"
FT   CDS_pept        470979..471905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65094"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTP8"
FT                   /protein_id="ABK65094.1"
FT                   /translation="MRRNTSIDMTRSPGALDPLYLCGTGRDLQTAADGAAQELRHVGLM
FT                   ATVEMVAGVIRNIETDPPIDGMSRLAGAPAMSGFRAAADAVAPELRQRRDPLYTLIDDI
FT                   PVATLISGHALCASGALGERSGAGYRPMIGQCAGFAPDGLMVSSHQAGEIPVVTGPIAP
FT                   PLESPQDPIAWHQLDDLPLHGMRRRRRIDVSLSSGSEILVDAMFRDSYMRADAQETVIH
FT                   EYTLTATVDADTGVILESRAVARVLPWQECPGAVESAARITGMTLAELHFRVRAELTGT
FT                   STCTHLNDLLRSVADAMALIPVVQGLR"
FT   gene            complement(471929..472915)
FT                   /locus_tag="MAV_0481"
FT   CDS_pept        complement(471929..472915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0481"
FT                   /product="amidohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF04909"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64692"
FT                   /db_xref="GOA:A0A0H2ZR09"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZR09"
FT                   /protein_id="ABK64692.1"
FT                   /translation="MRIITVEEHFQHPEVSARVAELTGPAVEGLAEFGNAFSLDPDSTA
FT                   RLGGNRLAHMDQVGIDVQVVSHGNGSPGTLQHPEAVELCRRVNNDLAAQIAENPDRFRG
FT                   FATLPLYDPAAAAEELRRCVGDLGFVGALIAGSYDGLFLDDERFDPILTAAEAVDFPIY
FT                   VHPGLPEAPVSQRYYAGSWPASVHMMFSGPAFGWHAEAGIHIVRLILSGALDRHPTLKL
FT                   LSGHWGELAAFYLERLDETLGLLPTGLERAPSDYYRQQVWITPSGMYNQNQLNFMTAEL
FT                   GAQRIIYSEDFPYVVRDNVSTFLEQAGLSEADTHAIAHTNAEALLRI"
FT   gene            complement(472964..473845)
FT                   /locus_tag="MAV_0482"
FT   CDS_pept        complement(472964..473845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0482"
FT                   /product="putative oxidoreductase YdbC"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65239"
FT                   /db_xref="GOA:A0A0H2ZSC9"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSC9"
FT                   /protein_id="ABK65239.1"
FT                   /translation="MDHVQLGRYSLARIGFGAMQLPGSGGFGPPRDRDQALAVLRRAVE
FT                   LGVDHIDTAQFYGPDVANELIREALHPYPDQLAIVSKVGARRDDRGGMHPAQQRDDLRR
FT                   GIEDNLRTLGVGQLAAVNLRIVDPDSLRSTRPALDRKQFEQQLTAMIEARDEGLIGGIG
FT                   LSNITVEHLRFALERTEIVCVQNAYNLVDRAAQPVLDECTARGIAFVAYFPLGSGFSTD
FT                   NPVLGNPALRRAAVRLDATPAQIALAWTLSVAPSIALIPGTSSVGHLEENLAAADITLD
FT                   AETRAELAEAAP"
FT   gene            complement(473857..474210)
FT                   /locus_tag="MAV_0483"
FT   CDS_pept        complement(473857..474210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0483"
FT                   /product="monooxygenase"
FT                   /note="identified by match to protein family HMM PF03992"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64712"
FT                   /db_xref="GOA:A0A0H2ZR41"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZR41"
FT                   /protein_id="ABK64712.1"
FT                   /translation="MTQPEPVDEPVTFVNIFEIPAEQVDDFIAAWRARSRLMADAPGHR
FT                   GAELLRATSPTAEFQLINVSRWDSMAAHEAATARPQYQQELQAFTSRPDIDMTPHRGFY
FT                   RVAAITPGHAVRD"
FT   gene            complement(474234..475121)
FT                   /locus_tag="MAV_0484"
FT   CDS_pept        complement(474234..475121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0484"
FT                   /product="cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66579"
FT                   /db_xref="GOA:A0A0H2ZW31"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW31"
FT                   /protein_id="ABK66579.1"
FT                   /translation="MIMPVDTSALPSNWGRWGTTDELGTLNLVTDAVRARAAAEVQTGQ
FT                   SVSLARPIDPAPFAAGPFAPVTSASPAVQQAVMFTGSPPLAMAELLVVTTHHRSLTHLD
FT                   AVVHKPVDGYVYPGVPLAEAAVPFGVRRGSTSAFAAGILTRGVLLDLAPNTRLPEGHPV
FT                   TAADFTAAEEREQVRLEPGDALIVRGGWSAASDHDAALPGITLDAVRWMHERDVAAYAG
FT                   DIGDGHPPVDPEVTSPLHGVALARLGMPLIDVAEVDELATRCAALGRFAFLLSAAPPRI
FT                   GSLTGVPVNPIAIF"
FT   gene            475203..475637
FT                   /locus_tag="MAV_0485"
FT   CDS_pept        475203..475637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0485"
FT                   /product="MarR-family protein transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65709"
FT                   /db_xref="GOA:A0A0H2ZVJ1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVJ1"
FT                   /protein_id="ABK65709.1"
FT                   /translation="MDSDERPTAELLRDGFRWFAQCLEIRSAAAGEPDLSPGAAMTMSY
FT                   LDAAPVKPSDLARRMQVSRQRVHAVLRELSAAGLVELVRDPTSGRDKLIRVTPAGKRRL
FT                   RRVAAALAELDQRAAEQLGAEDLALLRQLLIRLVAIPRPR"
FT   gene            complement(475656..476009)
FT                   /locus_tag="MAV_0486"
FT   CDS_pept        complement(475656..476009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0486"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68274"
FT                   /db_xref="InterPro:IPR007969"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0Y6"
FT                   /protein_id="ABK68274.1"
FT                   /translation="MAVRTPNISGLRTLLVIGTFLGGGVATAIPARAQGADDFLTDINR
FT                   IGIGNRDDPHNFDLVGLGNAICWRLYSGEAPGHVADELVTGSRSNGPAALTHAQATAAV
FT                   GFARADLCPDAAP"
FT   gene            complement(476026..476748)
FT                   /locus_tag="MAV_0487"
FT   CDS_pept        complement(476026..476748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0487"
FT                   /product="dienelactone hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01738"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67580"
FT                   /db_xref="GOA:A0A0H2ZZ23"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZ23"
FT                   /protein_id="ABK67580.1"
FT                   /translation="MTDIDLTDLAAAHAGSQPLRGYLATPSGTGPWPGVVLIHEVFGID
FT                   DVMRRHTDRLAGLGYLTLAVDLFSAGGAARCLISTMTAMIRGRGRAFADIAAARDYLAG
FT                   SADCTGKVGVIGFCMGGGFALLTANTGYDAAAVNYGQLPRHLDTALAGACPIVGSYGGR
FT                   DPSLRGATRKLNEALTKAGIEHDVKEYPAASHAFLNDDEAGPRILRPLLRVAGIGPEPD
FT                   SAQDAWNRIAAFFATHLH"
FT   gene            complement(476745..477392)
FT                   /locus_tag="MAV_0488"
FT   CDS_pept        complement(476745..477392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0488"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69487"
FT                   /db_xref="GOA:A0A0H3A371"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A371"
FT                   /protein_id="ABK69487.1"
FT                   /translation="MVPKLSDQTRARRRQHILTSAWTCFSRGGFHATSMDDVIAATGMS
FT                   SSAVYRYFRSKDELIAATVDEGLAKVRGIFLALLDRDPCPTPAETLSLVVAELDSRTRN
FT                   PQYDMTRIALQTWAEAVRDPFLRKRARSLYRETLRHITELADRWRDNGHLPPEANTHAA
FT                   AATLFSVMHGLIVMHHVVDDVGADALRDGLVLLGAAAAPHAVPTTPLPEAHP"
FT   gene            477488..477916
FT                   /locus_tag="MAV_0489"
FT   CDS_pept        477488..477916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0489"
FT                   /product="GlcG protein"
FT                   /note="identified by match to protein family HMM PF03928"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68583"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A338"
FT                   /protein_id="ABK68583.1"
FT                   /translation="MIDLARARTIVDGALDHARGNDFPPMTIAVLDAAGRLVAFASEDG
FT                   SSLLRGRIARAKARGALNMGVGSRSLAARAESHPAFVNALVALAGGDLVPVPGGVLIRD
FT                   GNDDLIGAVGVSGHDPDHDEACAIQGVAAGGLRADPGN"
FT   gene            477949..478800
FT                   /locus_tag="MAV_0490"
FT   CDS_pept        477949..478800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0490"
FT                   /product="HpcH/HpaI aldolase family protein"
FT                   /note="identified by match to protein family HMM PF03328"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66258"
FT                   /db_xref="GOA:A0A0H2ZX71"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZX71"
FT                   /protein_id="ABK66258.1"
FT                   /translation="MFDTPNRLLAMIEHRQMPVGMQCFTGNHTLIEVMGRTGFDFVWLD
FT                   SEHCDINPRALEDTIRTADGVGLTTLVRIPEPGDGTAARRALEAGAAGVVVPMVRSAVD
FT                   IAGVLDAVTYPPAGKRGICPAYRAAGYSIRTFAEYAAWSDANVLVVPLIETLDALDNIE
FT                   EICAIEQVRILGFASGELAFALGEGNRMHSSTKVQDAYQKVKDTAARHEVALMGGPILD
FT                   PTAQSCTKALEDGITVFCLGIDVMAFRRVCEDTIAAANAAVAAHPAFTRPAAPDSGFPT
FT                   HF"
FT   gene            478831..479370
FT                   /locus_tag="MAV_0491"
FT   CDS_pept        478831..479370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66821"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYI0"
FT                   /protein_id="ABK66821.1"
FT                   /translation="MAKLNRYVVGPNAEGHSAILETEPTNIQSKEGFFWRATLWATQET
FT                   PVDNSIEGDRSLDPGARRDPFPNGMLVRALEIWPDKDAGELRKEFAELNQQVGQKHQPS
FT                   DADAQRHPTMHRTDTLDAITCVRGEVYLVTDVDEVLMTPGDTAIIRGVNHGWSNRTNEP
FT                   CLLIGSMTDAIPAEQR"
FT   gene            479394..480899
FT                   /locus_tag="MAV_0492"
FT   CDS_pept        479394..480899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0492"
FT                   /product="para-nitrobenzyl esterase"
FT                   /EC_number="3.1.1.-"
FT                   /note="identified by match to protein family HMM PF00135"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65779"
FT                   /db_xref="GOA:A0A0H2ZVR0"
FT                   /db_xref="InterPro:IPR000997"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVR0"
FT                   /protein_id="ABK65779.1"
FT                   /translation="MSPTVRLAQGVVSGAEDGGVYRFLGMPYAAPPVGDLRWAPPAPPA
FT                   SWAGVRDATRYGNAAIQTVDTGFDPGAPQSEDCLYLNVWTSTLDVGARRPVMVWIHGGG
FT                   FLNGASSMDLWQGQHLARRGVTVVSLNYRLGAFGFLAHPQAGGNFGLLDWVAALSWVAE
FT                   NIATFGGDPANVTIFGQSAGGAATRALLHTPSARGLFHRAVIQSAGYEDYAVVGSPSYQ
FT                   RVTDASERLFEQLGSADIDELRRLPAEQVRQASFDQCGVNPPPGQVHTPANLVWYPTVD
FT                   GRVMEEDFSGWPADVPVMIGCTEHEGRFFVQPTMLYAHPELDPAQVYTQDTLEHMARAL
FT                   GGERAGDILAHYAASGLSAYEALAELITIGVWHEPALASVERFAALGRRAYHYRFARVS
FT                   PGARTSGLLAKHSAEIPYLFGGLTPAGSYDEVDAAVSDAVQHAWVEFARTGVPRTPDGT
FT                   DFPSYDTTSRQVVVFDDTTEVRPLDANPVTDMIHTLRAAPTRR"
FT   gene            480951..481364
FT                   /locus_tag="MAV_0493"
FT   CDS_pept        480951..481364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07366"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66351"
FT                   /db_xref="GOA:A0A0H2ZV29"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZV29"
FT                   /protein_id="ABK66351.1"
FT                   /translation="MSTTQQQNKEIIARFNKEFIEGGNEALFWETVSPEFINRSAAPGQ
FT                   DGPDGAFQWFTQVLKMAFPDLTVTIHDQIAEGDKTVTRKSYEATHMAPFLGVPATGRRV
FT                   SFGVIDIIRIVDGKYVEHWASPEMFDLYRQITA"
FT   gene            complement(481425..481814)
FT                   /locus_tag="MAV_0494"
FT   CDS_pept        complement(481425..481814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0494"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65981"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVX6"
FT                   /protein_id="ABK65981.1"
FT                   /translation="MMFSGPINSTKQAQGVITPSIDGYAVTGGLTRRPNRGTLRSVISL
FT                   AVRDSSSPQDLVLSKSSRLGKHSREVNPAVGSGNGIPPPPEVICRQARRSFSRRRASGQ
FT                   TRHHLTADQPGNRPWSPPRPAIHPY"
FT   gene            481845..483059
FT                   /locus_tag="MAV_0496"
FT   CDS_pept        481845..483059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0496"
FT                   /product="Transposase IS116/IS110/IS902 family protein"
FT                   /note="identified by match to protein family HMM PF01548;
FT                   match to protein family HMM PF02371"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66043"
FT                   /db_xref="GOA:A0A0H2ZUK4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUK4"
FT                   /protein_id="ABK66043.1"
FT                   /translation="MVARGRVSNDAAGFAALLTLLAEAGDSAAHPIPVGIETDRGLWVA
FT                   ALRETGRVIYPINPLAASRYRARHAVSGAKSDATDAVLLANIVRTDAAAHRPLPADTEL
FT                   AQAIRVLARAQQDAVWARQQIGNQIRDLLKDFYPAAIAAFAGLPEGGLARADARTILAA
FT                   APTPTQAATLTPARLRRLLTKAGRRRHLDRDIERLRAVFTDTYLHQPPAVENAMGIQLA
FT                   ALLRQLEAACTAADELAEAAIAHFEQHPDAKIITSFPGLGMLAGARVLAEIGDDRTRFA
FT                   DARGLKAFAGSAPITRASGKKTVVLHRHIKNRRLAAVGPIWALGSLRASPGARRHYDAR
FT                   RAAGDWNHQAQRHLFNKFLGQLHHCLQTGRLYNEHLAFPLNRPGFDGGSCYWISTSGWS
FT                   VRFVA"
FT   gene            complement(483014..483932)
FT                   /pseudo
FT                   /locus_tag="MAV_0495"
FT                   /note="transposase; this gene contains a frame shift which
FT                   is not the result of sequencing error; identified by match
FT                   to protein family protein HMM PF00665"
FT   gene            complement(483932..484207)
FT                   /locus_tag="MAV_0497"
FT   CDS_pept        complement(483932..484207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0497"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69328"
FT                   /db_xref="GOA:A0A0H2ZRS3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZRS3"
FT                   /protein_id="ABK69328.1"
FT                   /translation="MRMVRTLRAELGTEHGTVHRVARQLGYGIESVRAWVRQADIDDGY
FT                   APGVSTAESKRIKDLEQENRELKRANEILKRAASFFGAELDRQHRK"
FT   gene            484191..484646
FT                   /locus_tag="MAV_0498"
FT   CDS_pept        484191..484646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0498"
FT                   /product="ISAfe2, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66519"
FT                   /db_xref="GOA:A0A0H2ZVY0"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVY0"
FT                   /protein_id="ABK66519.1"
FT                   /translation="MRTIRTAAAFSSGLYLRVVGFPGDCSFGIAPSSFPRSGASRISRA
FT                   IHVLLEFYRYPAEHWIHLRTTNPIESTFATVRLRTKVTKGPGSRAAGIAMAYKLIDAAQ
FT                   ARWRAVNAPHLVALVRAGAVFHKGKLLERPVDITPPEPAESAETEVA"
FT   gene            484989..485357
FT                   /locus_tag="MAV_0499"
FT   CDS_pept        484989..485357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0499"
FT                   /product="hypothetical alanine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66191"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWE7"
FT                   /protein_id="ABK66191.1"
FT                   /translation="MREFAQRCEALSGQVAPALPAETISAWQSTGAAASTVNAGMRTVG
FT                   TACKSRMTANGSKLIKAASAYQNQDDHSAQRLTAVGSHLPAGSGTDGGAGGLPSGIPPL
FT                   VPRSSGGDGGSAGLGIGR"
FT   gene            485366..486772
FT                   /locus_tag="MAV_0500"
FT   CDS_pept        485366..486772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64609"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSE3"
FT                   /protein_id="ABK64609.1"
FT                   /translation="MPGLPTLSEVRAANWDHLRTNAAAWRSLGRTWESAFTEVHNASLR
FT                   PGGTDWTGAGAEAFQDRAYLDLVKIRHPADITDTVAGIAERGADAQDGNKRSILDTVDE
FT                   VEGDNFQVGEDWSVTDRITWYSSAAELEQREQAAQEHRSFLMSKVYKLVGDEADISRNL
FT                   TTASADLHGFSFGDEGADGGAGDGQPHVVLVDDVHRDPTIKGPAATPQHEQNGYDLQDQ
FT                   FQDGQGPVFGGDPRDGVPRSPASELAQGPPGTRPLPTGTALGPDGHRYAFFSHPDGTEV
FT                   PGVNQFVTNGAVWDYTDPAHPVKVGDLPGIYQASGVYDAATNQMVIVGNTSNRNGDLTR
FT                   GMWVSGPIDPAQPNSWISSLQHVGDVSLPGDRESQLVALSGGGYMLVGATNGGPVQAIS
FT                   AATPQGLMGAAPQTLLSQGQLPTVYGPTVMGTSLDPATGVEQIQLRVSTWPPGPTYDPN
FT                   TWTTTFDVQH"
FT   gene            486787..487305
FT                   /locus_tag="MAV_0501"
FT   CDS_pept        486787..487305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68191"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0R8"
FT                   /protein_id="ABK68191.1"
FT                   /translation="MLSKTFNATAAVIGTAVISACTAHAEPPKFPDLDAFQPVDPAPYT
FT                   ASGRAGGGAYFVTPDGIQCSVPHPDHPGEHVSVSCAGPLPGLPDDAPRGKDGCSAVGSP
FT                   TSLPTDLGPYSFQEGTGCPILTTPPLNVGQKITTAGITCAVGGDRLTACIDPVLNRGFV
FT                   LEPSGSWTF"
FT   gene            487350..487658
FT                   /locus_tag="MAV_0502"
FT   CDS_pept        487350..487658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0502"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67644"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYA6"
FT                   /protein_id="ABK67644.1"
FT                   /translation="MLDAVSCNVGWRLAAGLAAVALVLAPAAAADPECSSCVQGKEAID
FT                   DQVLRRHVQLTANDDLHQYCESLLRNVLKSGRVARVDSPPDFVASCEDEGRVLIAGQ"
FT   gene            complement(487796..488134)
FT                   /locus_tag="MAV_0503"
FT   CDS_pept        complement(487796..488134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0503"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67888"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZX6"
FT                   /protein_id="ABK67888.1"
FT                   /translation="MNSRVLKALKDLRREKAPISISSVARRADVTRKSIYHRPTLLALI
FT                   ETHRTVTVVPDEPAPAAAGPESSIVAALRLRLTAKDAQIAELKAALRERDQTIAVLHGE
FT                   IDKLHAGS"
FT   gene            complement(488194..490182)
FT                   /locus_tag="MAV_0504"
FT   CDS_pept        complement(488194..490182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0504"
FT                   /product="putative transposase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68301"
FT                   /db_xref="GOA:A0A0H3A2G4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2G4"
FT                   /protein_id="ABK68301.1"
FT                   /translation="MWLCHHEGLRRIEPSVLKWAGQALTAAAADYRNTHGHQPTSITDL
FT                   SAATIVRHAMLVFEKRNARLPSPGARRNVTHLIEHLHLYLSVRTTDTDWWAHDTWDLRA
FT                   DPRIPQREHEPGHDQSVKIGAITPDWLREGVRFWLRTALDAELLRWSSAVERARDMARH
FT                   FGAFATEHGYADPALADDPAQLRLIFTAFTEYLRSPAAAATPDKPLTPSAIDATQSYTQ
FT                   VFYTFMVDHAPEAAAATGNPRWLALTDAHTRLWGPAFRARRANRVRELSWYSTGELQQM
FT                   LAYLDVLAADRGTLVALTHPDGTASIIKGLGDPQAARIWLLQALTGRRASEILMLDHQP
FT                   LQPIPGAERPTDSDDPDAFVAKLRYQQTKVDDVTPTILVEQAVVNVVTEQQRWLTTTYP
FT                   GLTPKYLFIGVKQNLAGRRPRPYASYNLSLAKLDNIHGLTDAAGNPLRFTQTHRLRHTR
FT                   ATELLNDGVPIHVVQRYLGHKSPEMTMRYASTLAATAEAEFLKHKKIGAHGVEIAISPS
FT                   DILDMTQLSARTDRVLPNGVCLLPPLKTCDKGNACLSCGHFATDITHAAELRDQHTKTA
FT                   ALIELRRQQYRQRTGRELTDDNVWIRERLRELNSLQAILERLAADAGTPESAISGAGTF
FT                   RRLPLHVIATRGAHDSALRKADPRADA"
FT   gene            complement(490409..491614)
FT                   /locus_tag="MAV_0505"
FT   CDS_pept        complement(490409..491614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0505"
FT                   /product="putative transposase"
FT                   /note="identified by match to protein family HMM PF00589;
FT                   match to protein family HMM PF02899"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67643"
FT                   /db_xref="GOA:A0A0H2ZZ77"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZ77"
FT                   /protein_id="ABK67643.1"
FT                   /translation="MVARSQRVSFGEGPDTYTVVGDDGLPIGPAAEYLRFLRDGGASPH
FT                   TVRAYAAGIADWFTVLSHTGHVWDDFPTTLFGQYLQFLRTGDLPGSARIGPPQQRLAAS
FT                   SLQPRAAAVLSMYRYHADAHHVDTPYRRLFTSRGSWRRYRRYVGFLDGVGPQRRGDHPI
FT                   YRMRTQNRCTTPVLTPPQVNTILDACSVQHDGTWSGGPAAVRNRLLFAVLAETGMRLGE
FT                   ALSLRHHDFHIGAGATPFIEIVDRQDHPHGVRVKTGSRRVYVGDDLEALYSEYVWQLVA
FT                   MAADVEVPDLASHFVFVNLAHGPRFAAMRVETVYDKVRGIKRAQPSLPAGWTPHWLRHT
FT                   HATALLLAGVPEHVVMRRLGHADVQTTLSTYGWVTQDAEMRSLASWKNYVAGWKGLHDG
FT                   PP"
FT   gene            complement(491628..492851)
FT                   /locus_tag="MAV_0506"
FT   CDS_pept        complement(491628..492851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0506"
FT                   /product="DNA-binding protein, putative"
FT                   /note="identified by match to protein family HMM PF06114"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68539"
FT                   /db_xref="GOA:A0A0H3A3J7"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3J7"
FT                   /protein_id="ABK68539.1"
FT                   /translation="MKTTVQIYGLRVNQARVMRAMTVTAVMEALGWKHSRLNRLEKSTT
FT                   ALVPVEDFDRLVEVLRFPAKFFTTAPTSRVHPSDLLFRAPRSITVSEREYLAQFAALAG
FT                   EFLDELDSRAQLPPVRLPVLPSHTPVAKAAEVVRQALGFDVDVPIEYLTHEVERSGVVI
FT                   VVRRLLTSSSRRVLGDEDSTGKLDKHLGYSVRVGEFNTRPLIVVRQSNSWERTRWTLAH
FT                   EVGHLSLHASGGVTEEREEQASAFASELLAPAGVLAEEVSRAPSLAELLPVKAKWGISL
FT                   GALLRHLHVSGLLASDRFEALRRQLYTRVNAETDTTWGRVEPGWNDRDVERPLLISRWL
FT                   DIAFSARSAAMLAPYELMWPQDVLEDFMAGQRGATGTHTHGAEERVPALAGRHDNVIVL
FT                   SQRGNRRG"
FT   gene            complement(492919..493602)
FT                   /locus_tag="MAV_0507"
FT   CDS_pept        complement(492919..493602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0507"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67825"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYN9"
FT                   /protein_id="ABK67825.1"
FT                   /translation="MVSDHRQSFATLRYDIERAIPKVGEQWKALFDSPRDIHGQAFCTD
FT                   VRLMVLRMRELRGPQPWDTLSSRCGSGLSVQISNGRGMDLRVRRWPSKVLHGERVRIVA
FT                   MPDGGGLPLLRASTEPGRQMMLDEGSKAELFPAPKTTAAGKPDILSLWWPTDDGSGLAE
FT                   AELAAVIDVDSASRVQILATSPLPPVTESPLLTTPKRSVEPASDFGDLEPPALGSGTDD
FT                   PDEPA"
FT   gene            493805..493978
FT                   /locus_tag="MAV_0508"
FT   CDS_pept        493805..493978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0508"
FT                   /product="TrbB protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68976"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A303"
FT                   /protein_id="ABK68976.1"
FT                   /translation="MLLHVERNRAGRRRLSEIAVLQRVQERVRSVTVWHADRGMTEAAP
FT                   LLRRVLEDRMPS"
FT   gene            493975..494778
FT                   /locus_tag="MAV_0509"
FT   CDS_pept        493975..494778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0509"
FT                   /product="bacterial type II secretion system protein F
FT                   domain"
FT                   /note="identified by match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68393"
FT                   /db_xref="GOA:A0A0H3A028"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A028"
FT                   /protein_id="ABK68393.1"
FT                   /translation="MTGPVVGALLLAVALVVGPPSPRRRLGVAVTGSRRPSARRLAGLG
FT                   WVAAGAGCAALAVLPLPSVLAGAVVAATAGLRHRRRGRIRRAAGEGRALETALDVLVGE
FT                   LRAGSHPVRAFDVAAGETAGPVAVALRSVAARARLGADVAAGLAAASRGSARPEHWQRL
FT                   ALCWRLAGDHGLGIATLMRAAQRDIAERQRFSARVSSSLAGARATAAILAALPVLGVLL
FT                   GQLIGARPLDFLLGGQVGGWLLLVGATLACAGLLWADRIVDRVMA"
FT   gene            494801..495388
FT                   /locus_tag="MAV_0510"
FT   CDS_pept        494801..495388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0510"
FT                   /product="bacterial type II secretion system protein F
FT                   domain"
FT                   /note="identified by match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66046"
FT                   /db_xref="GOA:A0A0H2ZW46"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW46"
FT                   /protein_id="ABK66046.1"
FT                   /translation="MLLAAAVLMGPGPSLTRRRAGTPARAEGPRREPGPGRGRGPDPLA
FT                   IASCLDVLAVCLGAGMAVSAAAAAAVPSAPAQLGRVLRRAADLLALGADPAVAWSMPPD
FT                   PPGGPADPQIDALLRLARRSAASGAALAGGVAELADQSRSDAAHTAAAAAERAGVLIAG
FT                   PLGLCFLPAFVCLGIVPVVAGLAGDVLRSGLL"
FT   gene            495407..495607
FT                   /locus_tag="MAV_0511"
FT   CDS_pept        495407..495607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67165"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZX23"
FT                   /protein_id="ABK67165.1"
FT                   /translation="MRKVFRKFSARVAVLVADESGMSTVEYAIGTIAAAAFGAVLYTVV
FT                   TGDSIVSALTNIIGRALNTKV"
FT   gene            495664..495933
FT                   /locus_tag="MAV_0512"
FT   CDS_pept        495664..495933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0512"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69482"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A365"
FT                   /protein_id="ABK69482.1"
FT                   /translation="MVLVACLAGITAVSMQVRCVDAAREAARLAARGDERSATAAAARL
FT                   APAGARVDLRRDGDLLVATVVAHSKLLPALDIRAQAVSAAEPAR"
FT   gene            495965..496258
FT                   /locus_tag="MAV_0514"
FT   CDS_pept        495965..496258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0514"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68304"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZT3"
FT                   /protein_id="ABK68304.1"
FT                   /translation="MVVVLLSATGAAVYLGAAVVARHRAQAAADLAALAAAARLPSGAD
FT                   AACARAAAVAHSMRVDDIGCVADGLDVVVTARVAVGAVGTAVAAARAGPATG"
FT   gene            complement(496255..497241)
FT                   /locus_tag="MAV_0513"
FT   CDS_pept        complement(496255..497241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0513"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66828"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWR1"
FT                   /protein_id="ABK66828.1"
FT                   /translation="MAQGRQLKNLVPITTFLRRSPYLSAVRTAIAESVQTAQALTSITP
FT                   KRDRVIRTEPVVMSDGFIHGVHVWTGPSDIEPPERPIPGPLKWDLTLGVATDTRESLIN
FT                   SGKNPEVEVTFGRAFAEDLPSRELNPNETKVLAMAVKAKPDQTLCSTWDLTDWRGEAIR
FT                   IGFVARTILEPGPDGREHLVARAINWQAEQKGPAVSTDDLAQRILSGLAQAGVHRALID
FT                   LNNWTLLKWLDEPCTFYDWRSSETGKPRVHPDDHAVMSAMTEEFSGGATSRVLRLAGHD
FT                   GDWVPVHITVNRVELEPDAYAGLVSLRLPTEEELAAAGLPQATGGTP"
FT   gene            complement(497375..499705)
FT                   /locus_tag="MAV_0515"
FT   CDS_pept        complement(497375..499705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0515"
FT                   /product="ATP-dependent rna helicase, dead/deah box family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67271"
FT                   /db_xref="GOA:A0A0H2ZYY2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYY2"
FT                   /protein_id="ABK67271.1"
FT                   /translation="MASFGSELLAAALAGTTADEQPLRHVAELPPRSGRPHDWPAWAEP
FT                   EVVGAFAARGIKSPWSHQFTAADLAWSGRHVVVSTGTASGKSLAYQLPALNALATDPRA
FT                   RVLYLSPTKALGHDQLRAAHALTAAIPRLREPGFAVAPTAYDGDSPTEVRRFARERSRW
FT                   VFSNPDMIHLSTLRNHARWAVLLRGLRFVIVDECHYYRGVFGSHVAMVLRRLLRLCARY
FT                   ASAPAVIFASATTDSPGATAAELIGLPVREVTEDGSPQGARTVALWEPALRADLVGENG
FT                   APVRRSAGGEAARVMADLIAEGAQTLTFVRSRRAAELTALGAQARLDEIAPELSAQVAS
FT                   YRAGYLAEDRTALERALAEGRLRGLATTNALELGVDIAGLDAVVLAGFPGTVASFWQQA
FT                   GRSGRRGQGALVVLIARDDPLDTYLVHNPAALLGKPVERVVIDPRNPYILGPQLLCAAT
FT                   ELPLQEAEVRELDATEVAEGLVDDGLLRRRNGKYFPAPGLQPHAAVDIRGAGGQVVILE
FT                   ADTGRLLGSAGAGQAPASVHPGAVYLHQGESYVVDSLDLQEGIAFVHAEDPGYATFARE
FT                   ITDIAVTGAGERLVFGPVTLGLVPVRVTHRVVGYLRRRLSGEVIDFIELDMPEHTLATT
FT                   AAMYTITEEALRDNGIDGPRIPGSLHAAEHAAIGLLPLVASCDRGDIGGLSTAAGPEPA
FT                   GLPSVFVYDGHPGGAGFAERGFRRASTWLGATAAAIEACECPRGCPSCVQSPKCGNGND
FT                   PLDKAGAARVLRLVLAELDGGPR"
FT   gene            499954..500157
FT                   /locus_tag="MAV_0516"
FT   CDS_pept        499954..500157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0516"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF00313"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66764"
FT                   /db_xref="GOA:A0A0H2ZYB6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYB6"
FT                   /protein_id="ABK66764.1"
FT                   /translation="MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGTGFRTLEEN
FT                   QKVEFEIGHSPKGPQATGVRSL"
FT   gene            500346..500936
FT                   /locus_tag="MAV_0517"
FT   CDS_pept        500346..500936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66943"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZY48"
FT                   /protein_id="ABK66943.1"
FT                   /translation="MSQLSFFTAESVPPAVADLSGVLAASGQIVMVGTPEPHGARLSVV
FT                   VDHTWRAEALADMISEAGLVAEIGRTDEDTPLVRTAVDPALSPLAVEWTRGAVKTVPPR
FT                   WLPGPRELRAWTLAAGNPEGEHYVLALDPHAPDTHSPLASALMRVGIAPTLIGTRGGRP
FT                   ALRISGRRRLSRLVENVGEPPDSPEASAHWPRV"
FT   gene            501141..503939
FT                   /gene="topA"
FT                   /locus_tag="MAV_0519"
FT   CDS_pept        501141..503939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="MAV_0519"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="identified by match to protein family HMM PF01131;
FT                   match to protein family HMM PF01751; match to protein
FT                   family HMM TIGR01051"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65950"
FT                   /db_xref="GOA:A0A0H2ZW89"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW89"
FT                   /protein_id="ABK65950.1"
FT                   /translation="MADPKLKENTSGGNGSRRRLVIVESPTKARKLASYLGSRYIVESS
FT                   RGHIRDLPRAAADVPAKYKSEPWARLGVNVDADFEPLYIISPEKKHTVSELKGLLKDVD
FT                   ELYLATDGDREGEAIAWHLLETLKPNIPVKRMVFHEITEPAILEAAENPRDLDIDLVDA
FT                   QETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRIIVQRERDRMAFRSASYWDIV
FT                   AQLDASVSDPQASPPTFAARLTSVDGLRVATGRDFDSQGQLRKADEVIVLDEPQATELA
FT                   AGLQGAQLSVASVEEKPYTRRPYAPFMTSTLQQEAGRKLRFSAERTMSIAQRLYENGYI
FT                   TYMRTDSTTLSGSAINAARTQARQLYGEEYVSPSPRQYTRKVKNAQEAHEAIRPAGETF
FT                   ATPDAVRRELDGDEFRLYELIWQRTVASQMADARGTTLSLRIGGQAGDRQVVFSASGRT
FT                   ITFPGFLKAYVETVDELAGGEADDAESRLPQLTQGQRLDAIELTPDGHATNPPPRYTEA
FT                   SLVKALEELGIGRPSTYSSIIKTIQDRGYVHKKGSALVPSWVAFAVTGLLEQHFGRLVD
FT                   YDFTAAMEDELDAIASGQERRTDWLNNFYFGGEHGVADSIARSGGLKKLVGVNLEGIDA
FT                   REVNSIKLFDDEQGRPVYVRVGKNGPYLERMVTGDDGEPTPQRANLNDSLTPDELTLEV
FT                   AEQLFATPQEGRVLGVDPATGHEIVAKDGRYGPYVAEVLPEPPPDDDDGSGAPAKKGKK
FT                   PTGPKPRTASLLRTMDLQTVTLEDALRLLSLPRVVGVDPETGEEITAQNGRYGPYLKRG
FT                   NDSRSLATEEQLFDITLEEALKIYAEPKRRGRQGAAAPPLRELGADPATGKPMVIKDGR
FT                   FGPYVTDGETNASLRKGDDVMSLTDQRAAELLADRRARGPAKRTAKKTSRKAPAKKAAK
FT                   RG"
FT   gene            complement(503936..505540)
FT                   /locus_tag="MAV_0518"
FT   CDS_pept        complement(503936..505540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0518"
FT                   /product="adenylate cyclase, family protein 3"
FT                   /note="identified by match to protein family HMM PF00211;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67662"
FT                   /db_xref="GOA:A0A0H3A0W7"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0W7"
FT                   /protein_id="ABK67662.1"
FT                   /translation="MTTAAALPGRISAFARWVVRTPWPLFWLSMMQADIIGALFVLGFL
FT                   RYALPPEDRIQLQDLPVVNLAVFATSLVVLFLAASVVNLTLLMPVFRWQRRDNLLAESD
FT                   PAATELARIRALRMPFYRTVTSMVIWCIGGVVFIIASWSVARFAAPVVAVATGLGAAAT
FT                   AIIGYLQCERVLRPVAVAALRSGVPENVKAPGVILRQILTWMLSTAVPVLAIVLAVVAD
FT                   KTSLLHATPEKLFTPILLLAVAALGIGLVSTLLVAMSIADPLRQLRWALSEVQRGNYNA
FT                   HMQIYDASELGLLQAGFNDMVRDLSERQRLRDLFGRYVGEDVARRALERGTELGGQERD
FT                   VAVLFVDLVGSTQLAATRPPAEVVHLLNEFFRVVVETVGKHGGFVNKFQGDAALAIFGA
FT                   PIEHPDSPGGALAAARELHDALLPVIGSAEFGIGVSAGRAIAGHIGAQARFEYTVIGDP
FT                   VNEAARLTELAKLEPGHVLASAIAVSGALDSEALCWDVGEVVELRGRTAPTQLARPVKL
FT                   ATPEEVAPQEVSSEVSG"
FT   gene            505735..506901
FT                   /locus_tag="MAV_0520"
FT   CDS_pept        505735..506901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0520"
FT                   /product="DNA polymerase III subunit delta"
FT                   /note="identified by match to protein family HMM TIGR00678"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67997"
FT                   /db_xref="GOA:A0A0H2ZZ21"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZ21"
FT                   /protein_id="ABK67997.1"
FT                   /translation="MKAELLGAARAARGDAGHSDAGAGTMTHAWLITGPPGSGRSVAAL
FT                   CFAAALQCTADGEPGCGRCHACTTTLAGTHADVRRVVPEGLSIGVDGMRAIVQIAARRP
FT                   ATGNWQIVVIEDADRLTEGAANALLKVVEEPPPSTVFLLCAPSVDPEDVAITLRSRCRH
FT                   VALVTPSTEAIARVLVDSDGLTPETADWAASVSGGHVGRARRLATDPEARQRRERALGL
FT                   VRDAATPSRAYAAAEELVAAAEAEAVVLTAERAEAETEELRTALGAGGTGKGTAGAMRG
FT                   AAGAIKDLERRQKSRQTRASRDALDRALIDLATYFRDALMASSGAGAVRANHPDMAERV
FT                   AALAAHAPPERLLRCIEAVLECREALAVNVKPKFAVDAMVATIGQQLG"
FT   gene            506943..507018
FT                   /locus_tag="MAV_0521"
FT   tRNA            506943..507018
FT                   /locus_tag="MAV_0521"
FT                   /product="tRNA-Thr"
FT   gene            complement(507099..508841)
FT                   /locus_tag="MAV_0522"
FT   CDS_pept        complement(507099..508841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69423"
FT                   /db_xref="GOA:A0A0H3A659"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A659"
FT                   /protein_id="ABK69423.1"
FT                   /translation="MVQLAVRAVLAFGGYFYWDDLILIGKAGTHNLLAPSYLFDDHDGH
FT                   LMPGAFLLAGTIIRAAPLDWTWPAVSLLVLQLLASLALLRALHVILGWRPVLLIPFTFA
FT                   LFTPLAVPGFAWWAAALNSLPLLAALAWVCGDAILLVRTGNRRYALTGVLVYLGGLLFF
FT                   EKSAVIPFVAFAVAALLRHVAGDAGPGSALRAVWRAGLRLWVPSLALTAAWVGLYLAVV
FT                   NQRRWSSDVVMTGRLLVRSITHGIVPGLAGGPWHWDRWAPASPWATPPPLVMALGWLAL
FT                   AGVLAVSLLRKRRIGPVWLTAAGYAVACQVPIYLMRSSKQTALELAQTLRYLPDLVVVL
FT                   ALLAAVALCAPNRPAGPRWLDASPKRTIVACGLAALFLASSLYSTATFLTSWRDNPAQP
FT                   YLRNARAALAAAHAASDAPLLDQEVDPLVLQRVAAPENLASHLFALLRDRPEFASATTQ
FT                   LRMLDSSGRLIRARVTWVRTITPGPMPQCGYFAQPDRPARLVLDGPLLPADWTVELNYL
FT                   ANSDGSMTLSMTQGPPVKVPVHPGLNRVFARLPGAGDAITVRANTTALALCLASGPVGF
FT                   LAPA"
FT   gene            508882..509823
FT                   /locus_tag="MAV_0524"
FT   CDS_pept        508882..509823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0524"
FT                   /product="nucleoside-diphosphate-sugar epimerase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01073; match to protein
FT                   family HMM PF01370; match to protein family HMM PF04321;
FT                   match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68834"
FT                   /db_xref="GOA:A0A0H3A3K1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3K1"
FT                   /protein_id="ABK68834.1"
FT                   /translation="MRALVTGAAGFIGSTLVDRLLADGHTVVGLDNFASGRASNLEHLV
FT                   GNPAHVFVEADIVTADLEAILDEHRPEVVFHLAAQIDVRHSVADPQFDASVNVIGTVRL
FT                   AEAARRTGVRKIVHTSSGGSIYGTPPTYPTPETVPTDPASPYAAGKVAGEIYLNTFRHL
FT                   YGLDCSHIAPANVYGPRQDPHGEAGVVAIFAQALLSGKPTKVFGDGTNTRDYVFVDDVV
FT                   DAFVKASGDAGGGQRFNIGTGVETSDRQLHSAVAAAVGGPDDPEFHPPRLGDLKRSCLD
FT                   IGLAARVLGWQPKVGLQQGVARTVEYFRNQHN"
FT   gene            complement(509820..510161)
FT                   /locus_tag="MAV_0523"
FT   CDS_pept        complement(509820..510161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0523"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65108"
FT                   /db_xref="GOA:A0A0H2ZTX1"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTX1"
FT                   /protein_id="ABK65108.1"
FT                   /translation="MNWIQVLLIGSIVALLVYLLRSRRNARSRAWVKVGYVVFVLAGIY
FT                   AVLRPDDTTVVANWFGVRRGTDLMLYALVMAFCFTTLSTYMRFKDLELRYARLARAVAL
FT                   ESALPPDPN"
FT   gene            complement(510158..510823)
FT                   /locus_tag="MAV_0525"
FT   CDS_pept        complement(510158..510823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0525"
FT                   /product="glycosyl transferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64555"
FT                   /db_xref="GOA:A0A0H2ZQQ6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZQQ6"
FT                   /protein_id="ABK64555.1"
FT                   /translation="MIPAFNEAAVIGEVIADVRSVFDNVVCVDDGSTDDTGEIARRAGA
FT                   HLVRHPINLGQGAAIQTGVEYARRQPGAQVFATFDADGQHRVKDLAAMVNRLRVGDVDV
FT                   VIGTRFGTRQGARPPLVKRMVLQTAARLSRRGRRLGLTDTNNGLRVFNKKVADGLDITM
FT                   SGMSHANEFVMLIDENHWRVVEEPIEVLYTEYSRSKGQPLLNGVNIIFDGFLRGRIPR"
FT   gene            complement(510895..512145)
FT                   /locus_tag="MAV_0526"
FT   CDS_pept        complement(510895..512145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68950"
FT                   /db_xref="GOA:A0A0H3A2X4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2X4"
FT                   /protein_id="ABK68950.1"
FT                   /translation="MTEISASQGPVARGSMARVGTATAVTALCGYAVIYLAARDLAPSG
FT                   FSVFGVFWGAFGLVTGAANGLLQETTREVRVMPYLEVAPVKRTHPLRVAMLLGAAAAVV
FT                   IAGSSPLWSGRVFVEARPLSVLLLSVGLAGFCVHATLLGMLAGTNEWTRYGALMVTDAV
FT                   IRVMVAAATVVLGWRLVGFLWATVAGAVAWLILLAASPATRATARLLTPGGTATFLRGA
FT                   AHSITAAGASAILVMGFPVLLKLTSAELGAQGGVIILAVTLTRAPLLVPLTAMQGNLIA
FT                   HFVDERSDRVRALIGPAAIVGAIGAVGVLAAGVLGPWVLRVAFGPQYQAGSALLAWLTA
FT                   AAVAIAMLTLTGAAAVAAALHRAYALGWVGATVASGLLLALPLSLQTRTVVGLLCGPLV
FT                   GIGVHLVALSRAARLTG"
FT   gene            512273..513361
FT                   /locus_tag="MAV_0528"
FT   CDS_pept        512273..513361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0528"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF04332"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65753"
FT                   /db_xref="GOA:A0A0H2ZTS3"
FT                   /db_xref="InterPro:IPR007427"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTS3"
FT                   /protein_id="ABK65753.1"
FT                   /translation="MPALRTFGVSLLVTAAALVLGYAYGGPKSLYLLLVLAALEVSLSF
FT                   DNAVINAAVLKQMSRFWQRMFLTIGILVAVFGMRLLFPLLIVWATAGLDPVRALELALR
FT                   PPPHGALEFPDGSPSYQKLLTAAHPQIAAFGGIFLLMLFLDFLLIDRDIKWLKWIEVPF
FT                   ARIGRLGQVSVVLSGLTLVLVGTGLTHSSQEAVTVLTAGLLGMVAYLVVNGLSRAFRPS
FT                   GVGQPQPAGPATGWAGLSLFLYLEVLDAAFSFDGVTGAFAITSDPVVIVLGLGVVGAMF
FT                   VRSITIYLVHQETLDRYVYLEHGAHWAIGALAVIMLASIEPRLTVPEPVTASVGVFFIG
FT                   TAVGFSVLRRRRESGRASAPGP"
FT   gene            complement(513342..513830)
FT                   /gene="ppa"
FT                   /locus_tag="MAV_0527"
FT   CDS_pept        complement(513342..513830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="MAV_0527"
FT                   /product="inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="identified by match to protein family HMM PF00719"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67766"
FT                   /db_xref="GOA:A0A0H2ZYJ2"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYJ2"
FT                   /protein_id="ABK67766.1"
FT                   /translation="MEFDVTIEILKGQRNKYEVDHETGRLRLDRYLYTAMAYPTDYGFI
FT                   EDTLGEDGDPLDAMVLLPQSVFPGVIVEARPVGMFRMTDEKGGDDKVLCVPAGDHRWEH
FT                   IQDIGDVPEFELDVIKHFFVHYKDLEPGKFVKAADWVGRAEAEAEVQRSIERFKAQGH"
FT   gene            513985..515337
FT                   /gene="dacB"
FT                   /locus_tag="MAV_0529"
FT   CDS_pept        513985..515337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="MAV_0529"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="identified by match to protein family HMM PF02113;
FT                   match to protein family HMM TIGR00666"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66717"
FT                   /db_xref="GOA:A0A0H2ZXK5"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXK5"
FT                   /protein_id="ABK66717.1"
FT                   /translation="MFIGLGVLAFVAAVVVAATFFTTTGHGAGNAHAPIPAPHAPTVKP
FT                   GMLPVSDTAELPTGPGVSAALAPVAADPNLGRLGGRITDAITGKELWQVADDMPLVPAS
FT                   TNKVLTAAAALLTLDRQARISTRVVAGSQNAQGPVVLVGAGDPVLSAAPPGQPTWYRGA
FT                   ARISDLVEQIRRSGVTPTAVQVDTSAFSGPTMAQGWDPSDVDNGDIAPIESVMIDAGRI
FT                   QPTTVNSRRTRTPALDAGRELAKALGLDPNAVTVATAPSGARQLAVVQSAPLVQRLSEM
FT                   MDHSDNVLAECIAREVAAAINRPRSFAGAADAVTNRLSTAHVDTAGATLMDSSGLSVDD
FT                   RLTAKTLDGVLQAAAGPDQPALRALLDLLPIAAGSGTLGDRFTDASTNQGPAGWLRAKT
FT                   GSLTAINALAGVLTDRSGRVLTFAFISNDAGPNGRNAMDALATRLWFCGCS"
FT   gene            515334..516407
FT                   /locus_tag="MAV_0530"
FT   CDS_pept        515334..516407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65073"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTM8"
FT                   /protein_id="ABK65073.1"
FT                   /translation="MTPAPDLTLGTAVDWRFAATVGRRLARPGPPSTDYTRRQVIDELA
FT                   GAATKAEPLVRQVTGLLTDGADDGRVPAARIVDRPEWIAAAAESMRVMMNGTERPRGFL
FT                   TGRVTGAQTGAVLAYVSSGILGQYDPFATDRGAGAGCLLLVYPNVIAVERQLRIEPSDF
FT                   RLWVCLHEVTHRVQFTANPWLPGYMSQALALLTRDTGDDLGQVLSRLADYARNRGNTAS
FT                   QADANSTGILGLVRAVQSEPQRQALDQLLVLGTLLEGHADHVMDAVGPMAVPSVATIRR
FT                   RFDERRHRKQPPLQRLLRALLGLDAKLSQYTRGKAFVDQVVGRVGMARFNAVWTGPETL
FT                   PLPVEIEEPQRWIDRVL"
FT   gene            516386..517348
FT                   /gene="tilS"
FT                   /locus_tag="MAV_0531"
FT   CDS_pept        516386..517348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="MAV_0531"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /EC_number="6.-.-.-"
FT                   /note="identified by match to protein family HMM PF01171;
FT                   match to protein family HMM TIGR02432"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64605"
FT                   /db_xref="GOA:A0A0H2ZSJ1"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSJ1"
FT                   /protein_id="ABK64605.1"
FT                   /translation="MDRPGALDRLRTAVEAFSTAHLGAVERWCVALSGGPDSLALTAVA
FT                   ARLRPTTAVIVDHGLQPDSAAVAQTARAQAIALGCVAAQVISVHVDGEGGPEAAARRAR
FT                   YAALAAHRDGPVLLGHTLDDQAETVLLGLGRGSGVRSIAGMRPHDPPWCRPLLGQRRAV
FT                   THAACAELGLTAWQDPHNSDRRFTRARLRAEVLPLLEEVLGGGVAEALARTATALREDN
FT                   EVLDALAERALPAAQAGAGLQVAALAGLDAPVRRRVIRAWLLAGGATGLTDKQIRGVDN
FT                   LITAWRGQGGVAVGSSQPGERLFAGRRDGVLTLWREPVR"
FT   gene            517399..518010
FT                   /gene="hpt"
FT                   /locus_tag="MAV_0532"
FT   CDS_pept        517399..518010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="MAV_0532"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01203"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68679"
FT                   /db_xref="GOA:A0A0H3A268"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A268"
FT                   /protein_id="ABK68679.1"
FT                   /translation="MGVAQISSAITPAQPAELYPGDIKSVLLTAEQIQARIAELGREIG
FT                   DNYRDAAAETGQDLLLITVLKGAVIFVTDLARAIPLPTQFEFMAVSSYGSSTSSSGVVR
FT                   ILKDLDRDIQGRDVLIVEDVVDSGLTLSWLLRNLSTRHPRSLRVCTLLRKPDARGAHVD
FT                   IAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQQ"
FT   gene            complement(518018..518767)
FT                   /locus_tag="MAV_0533"
FT   CDS_pept        complement(518018..518767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0533"
FT                   /product="LpqG protein"
FT                   /note="identified by match to protein family HMM PF04402"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69286"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3L7"
FT                   /protein_id="ABK69286.1"
FT                   /translation="MPVATNAPKCVRSAIAAAAAGLAVVAISACDKHGPPPSGAAPRQV
FT                   TVVGSGQVQGVPDTLTADVGIEFTAPDVTTAMNQTNERQQAVINALVGAGIDHKDISTT
FT                   EVALTPQYSNPEAGGSAAITGYRASNAVAVKIHPPDAASRLLALILGTGGDATRIRSVS
FT                   YSIADDSQLVKDARTRAFNDAKSRAEQYAQLSGLHLGKVLSISEATGNAPPPGGPPPSP
FT                   RAMPMAVPLEPGQQTVKFTVTASWELD"
FT   gene            519084..519383
FT                   /locus_tag="MAV_0534"
FT   CDS_pept        519084..519383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0534"
FT                   /product="PE family protein"
FT                   /note="identified by match to protein family HMM PF00934"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67586"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZY58"
FT                   /protein_id="ABK67586.1"
FT                   /translation="MSFLMVRPEILDAAARELHGINAAVLQSNSAAVTPTTALAPAAAD
FT                   VVSLVTAARFSRHGLAFQEVSAQAAQLRDQFATTLGISAGSYAAAEIANTAAVG"
FT   gene            519393..520658
FT                   /locus_tag="MAV_0535"
FT   CDS_pept        519393..520658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0535"
FT                   /product="PPE family protein"
FT                   /note="identified by match to protein family HMM PF00823"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68184"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR022171"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A277"
FT                   /protein_id="ABK68184.1"
FT                   /translation="MLNFGQLDFAQLPPEINSGLMYSGPGAGPLLAAAAAWNGLAAELR
FT                   SAAASFGSVITGVGDAGWQGPAASSMMAAAAPQLAWLSGTAGRAELAAGQALAAVSAYE
FT                   TAFAETVPPPVIAANRALLLQLLATNFLGQNTPAIADVEAQYGEMWAQDAAAMYGYALA
FT                   SAAASTLPPFEPAKPATDPAGLARQAAATAQAAGTGAGDSAQGLGAAPQSMSTLAAGTN
FT                   NPPAANPGFSLGGISLNPEGDGLVIGGPLGDLLEGLTGSQTLDASTPFDAFIRLISPTR
FT                   LFTTSFKDIQGIAQGMMPAAKSAGEGVAKAAEAVLPAAVPGAGLGSLGSLGSIGGSVGK
FT                   AASIGGLSVPASWASAAPTPPSVAVALNGATTAGAAEHAASAVGGVPMMPAGAAGRGAG
FT                   AHFVVPRYGFKPTVIAQPPAGG"
FT   gene            complement(520668..522248)
FT                   /locus_tag="MAV_0536"
FT   CDS_pept        complement(520668..522248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01844;
FT                   match to protein family HMM PF02720"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68703"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A278"
FT                   /protein_id="ABK68703.1"
FT                   /translation="MFESSPDPAALVAVIESTHREESMLVARRFAAVAALLRHRVATAD
FT                   RPEPEYAEIDGFEQTAAEVAAAMNLSAAAASYLVSYAETLDTRLPEVAALLAEGRTDWR
FT                   TVRLIITRTSLVTDAELIAKLDRSLAARIGNWHGWSRQRIVNAVDAAVRTADPDAARER
FT                   RLAAEEDRHIGISAAENGMAEVHGSVAAAAATAFDRRLSQLAKQVCPADPRTLDQRRAD
FT                   ALAALAEGRRLPCACGQPDCPARTGNQNADDRTGARVVINVVASDRTVYADGAEPGYLE
FT                   GYGVIDADQVRRLAAAAHLLVANPATSPAAALRYQPSAALERAVRCRDLTCRFPGCSRP
FT                   AVICDLDHSVPFNHQNPVAGGWTVLENLKCLCRQHHRLKTFGGWRDRQLADGTVVWTSP
FT                   TGRAYRTSPAGADLFAQPRGPARAAPTPNRRSRSKQRNGRIMRARKHNREQRPINEARI
FT                   RLEQARQREIADRKFRNHMRDMLFLFKGAPSTSPFCAWVNDPREPEELPPDWVPDEPAY
FT                   QPLPDDPPF"
FT   gene            complement(522278..523291)
FT                   /locus_tag="MAV_0537"
FT   CDS_pept        complement(522278..523291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0537"
FT                   /product="zinc-binding dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67523"
FT                   /db_xref="GOA:A0A0H2ZZH1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZH1"
FT                   /protein_id="ABK67523.1"
FT                   /translation="MRAAVLRDGRMVYRDDVPEPIPETGQVLVGVRACGICGSDLHFAA
FT                   HGAQVLQMSDRVAGGAAGMRVDLDHDIFMGHEFSAEILEAGPDTETHPPGTLVTSLPVL
FT                   LSAKGVEPIVYSNTTIGGYAERMLLSAPLLLPIPNGLDVKHAALTEPMAVGLHAVNKSN
FT                   ITPAETALVLGCGPIGIAIIAALATRGVESIVASDFSPKRRQLATAMGAHRTLDPAQGS
FT                   PFDSVKPAVVFEAVGVPGIIDDVLLRARPGTRLVVAGVCMQPDTVHPFFAIAKEINVQF
FT                   VLAYTPEEFGDSLRALAEGDIDVAPLITGEVGLDGVGAAFDDLADPERHCKVLVTP"
FT   gene            complement(523291..524478)
FT                   /locus_tag="MAV_0538"
FT   CDS_pept        complement(523291..524478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0538"
FT                   /product="limonene 1,2-monooxygenase"
FT                   /EC_number="1.14.-.-"
FT                   /note="identified by match to protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68226"
FT                   /db_xref="GOA:A0A0H3A0T7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0T7"
FT                   /protein_id="ABK68226.1"
FT                   /translation="MSAPLRFGVFITPFHPVGQSPTVALEYDLERVVALDRLGFDEAWF
FT                   GEHHSGGYELIACPEVFIATAAERTKHIRLGTGVVSLPYHHPLMVADRWVLLDHLTRGR
FT                   VMFGTGPGALPSDAYMMGIDPVDQRHMMQESLEAILALFRAAPTERIDRHSDWFTLRDA
FT                   QLHIRPYTWPYPEISTAAMISPSGPRLAGALGTSLLSLSMSVPGGYAALETTWDVVREQ
FT                   AAKAGRDEPDRGDWRVLSIMHIADSREQAIDDCTYGLQDFANYFGAAGFVPLANSVEGT
FT                   QTPHEFVAEYAAKGNCCIGTPEDAIAHIEDLLDRSGGFGTLLMLGHDWASPEATYHCYD
FT                   LMARKVIPHFKRQLDASRASHDWAKGMRDQLLGRAGEAVVKAISEHVDEHKDAVH"
FT   gene            complement(524475..525404)
FT                   /locus_tag="MAV_0539"
FT   CDS_pept        complement(524475..525404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0539"
FT                   /product="hydrolase, alpha/beta fold family protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68615"
FT                   /db_xref="GOA:A0A0H3A3U8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3U8"
FT                   /protein_id="ABK68615.1"
FT                   /translation="MRLRVTEAGDRGAPVVILAHGFPELAYSWRHQIDVLADAGYHVLA
FT                   PDQRGYGGSDRPDAVEAYDIHQLTADLVGLLDDVGAQRAVWVGHDWGAAVVWNAPLLHP
FT                   DRVAAVAAMSVPVTPRPRLAPTQAWRKMFGENFFYILYFQEPGVADAELNADPAQVMRR
FT                   MMGSLRTDGDKAAGLRMVAPGPEGFLERLPEPDGLPEWISQDELDHYIAEFSRTGFTGG
FT                   LNWYRNFDRNWETTPELDGAKIAVPCLFIGGTADPVLSFTRADRAAEVISGPYRHVMID
FT                   GAGHWLQQERPAEVNAALLDFLNGLELR"
FT   gene            525544..525957
FT                   /locus_tag="MAV_0540"
FT   CDS_pept        525544..525957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0540"
FT                   /product="dioxygenase"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69371"
FT                   /db_xref="GOA:A0A0H3A615"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A615"
FT                   /protein_id="ABK69371.1"
FT                   /translation="MRLDHVVLWTRNPRVSMDFYTRVVGLEPVRFAEFEAGEAPFPSVR
FT                   ICADSIIDLMPLEMVSGAASSGVAEGSAGNPVNHVCIALSKAEYDALEARLQAEGVDTG
FT                   VRLSRSFGARGWSPHTYYFADPDGNVVEARYYE"
FT   gene            526099..526218
FT                   /locus_tag="MAV_0541"
FT   CDS_pept        526099..526218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0541"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65254"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUA1"
FT                   /protein_id="ABK65254.1"
FT                   /translation="MSTTAATRCAPALPELAIAAEHDGGDPLRPGSAGAGDRR"
FT   gene            526345..528744
FT                   /gene="hflB"
FT                   /locus_tag="MAV_0542"
FT   CDS_pept        526345..528744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflB"
FT                   /locus_tag="MAV_0542"
FT                   /product="ATP-dependent metallopeptidase HflB"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65963"
FT                   /db_xref="GOA:A0A0H2ZU28"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZU28"
FT                   /protein_id="ABK65963.1"
FT                   /translation="MNRKNVIRTITAIAVVVLLGWSFFYFSDDTRGYKPVDTSVAMAQI
FT                   NGDNVKSAQIDDREQQLRLTLKKGNGDTDNSDKVITKYPSGYAVDLFNALSAKNAKVST
FT                   VVNQGSILGELLVYVLPLLLLVGLFVMFSRMQGGARMGFGFGKSRAKQLSKDMPKTTFA
FT                   DVAGVDEAVEELYEIKDFLQNPGRYQALGAKIPKGVLLYGPPGTGKTLLARAVAGEAGV
FT                   PFFTISGSDFVEMFVGVGASRVRDLFDQAKQNNPCIIFVDEIDAVGRQRGAGLGGGHDE
FT                   REQTLNQLLVEMDGFDPRAGVILIAATNRPDILDPALLRPGRFDRQIPVSNPDLAGRRA
FT                   VLAVHSKGKPIAPDADLDGLAKRTVGMTGADLANVINEAALLTARENGTVITSAALEEA
FT                   VDRVIGGPRRKGRIISEQEKKITAYHEGGHTLAAWAMPDIEPIYKVTILARGRTGGHAV
FT                   AVPEEDKGLRTRSEMIAQLVFAMGGRAAEELVFREPTTGAVSDIEQATKIARAMVTEFG
FT                   MSSKLGAVKYGSEHGDPFLGRTMGTQADYSHEVARDIDDEIRKLIEAAHTEAWEILTEY
FT                   RDILDTLAGQLLEKETLHRAELESIFAGVEKRPRLTMFDDFGGRIPSDKPPIKTPGELA
FT                   IERGEPWPPPAPEPAFKAAIAKASEAAAAARLEADRNANGGNGSHANQGGNRQGPTQPD
FT                   YGAPAGWRAPGWPPQQSQQPNYWHPPAQPPYWQQPAHGYPGQQPYPGQQPYPGQPGGPA
FT                   QSGPPQARPPYPPYPPYPPPGQPAPEGGSPDRQDDDVSRSNPPAHG"
FT   gene            528761..529375
FT                   /gene="folE"
FT                   /locus_tag="MAV_0543"
FT   CDS_pept        528761..529375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="MAV_0543"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="identified by match to protein family HMM PF01227;
FT                   match to protein family HMM TIGR00063"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66473"
FT                   /db_xref="GOA:A0QA85"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QA85"
FT                   /protein_id="ABK66473.1"
FT                   /translation="MAGNGSAPDTATHQVRQFDQARAEAAVRELLFAIGENPDRHGLAE
FT                   TPARVARAYREMFAGLYTDPDSVLNTMFDEEHDELVLVKEIPLYSTCEHHLVSFHGVAH
FT                   VGYIPGNDGRVTGLSKIARLVDLYAKRPQVQERLTSQIADALVKKLNPRGVIVVVEAEH
FT                   LCMAMRGVRKPGAVTTTSAVRGLFKTNAASRAEALDLILRK"
FT   gene            529404..530198
FT                   /gene="folP"
FT                   /locus_tag="MAV_0544"
FT   CDS_pept        529404..530198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="MAV_0544"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67097"
FT                   /db_xref="GOA:A0A0H2ZYK7"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYK7"
FT                   /protein_id="ABK67097.1"
FT                   /translation="MNVTDDSFSDGGRYLDPDKAVAHGLALVAEGAGIVDVGGESTRPG
FT                   ATRIDPRVETSRVVPVVKALAAEGVTVSIDTMHADVARAALGSGARIVNDVSGGRADPA
FT                   MAPLLAEAKVPWVLMHWRSVSAERPHAAPQYRDVVAEVRAELLASVDAAVAAGVDSARL
FT                   MIDPGLGFAKTGQHNWALLHALPQLVATGIPVLLGASRKRFLGTLLAGPDGAPRPPDGR
FT                   ETATAVISALAALHGAWGVRVHDVRATVDALKVLGAWMGDDG"
FT   gene            530191..530592
FT                   /gene="folB"
FT                   /locus_tag="MAV_0545"
FT   CDS_pept        530191..530592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="MAV_0545"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="identified by match to protein family HMM PF02152;
FT                   match to protein family HMM TIGR00525; match to protein
FT                   family HMM TIGR00526"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68230"
FT                   /db_xref="GOA:A0A0H3A2J7"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2J7"
FT                   /protein_id="ABK68230.1"
FT                   /translation="MADRIELRGLRVRGQHGVFDHERVDGQDFVIDVTVWIDLVGAAAS
FT                   DELADTYDYAALAQLAADVVAGPARNLIETVGAQIADQVMDDERVHAVEVMVHKPQAPI
FT                   PQQFADVAVVVRRSRRGGRGSVVPAGGAL"
FT   gene            530589..531137
FT                   /gene="folK"
FT                   /locus_tag="MAV_0546"
FT   CDS_pept        530589..531137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="MAV_0546"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="identified by match to protein family HMM PF01288;
FT                   match to protein family HMM TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66559"
FT                   /db_xref="GOA:A0A0H2ZW16"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW16"
FT                   /protein_id="ABK66559.1"
FT                   /translation="MTRVVLSIGSNLGDRLARLQSVVDGLGGAVRAISPVYETQPWGRV
FT                   DQAPFLNAVLIADDPACDGQGWLRRAQEFERAAGRVRGERWGPRTLDVDLIACYGDGEV
FT                   ISRENNLTLPHPLAHLRAFVLIPWLAVDPDARLTVADGPQPVARLLAQLDQADRDGVRP
FT                   TGLTLTPPAGSSADSGAGS"
FT   gene            531137..531613
FT                   /locus_tag="MAV_0548"
FT   CDS_pept        531137..531613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65729"
FT                   /db_xref="GOA:A0A0H2ZVL3"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVL3"
FT                   /protein_id="ABK65729.1"
FT                   /translation="MGPTRKRDLTAAVVGAAVVGYLLVQGLYRWFPPITVWTGLSLLAV
FT                   AVIEALWARYVRTKINDGEIGSGPGWLHPLAVARSLMVAKASAWVGALMLGWWIGVLVY
FT                   FLPRRSWLRAASEDTSGAVVAAVSALALLVAALWLQHCCKSPPDSGEHGEGAET"
FT   gene            complement(531610..531816)
FT                   /locus_tag="MAV_0547"
FT   CDS_pept        complement(531610..531816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0547"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66386"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZX65"
FT                   /protein_id="ABK66386.1"
FT                   /translation="MKTNAELAPIARTSNAVKSTQPGLRPPRRTRAPRDRTVMAKLYLR
FT                   EVNQRVGRLRRFFAGCPRRGRVG"
FT   gene            531824..533089
FT                   /locus_tag="MAV_0549"
FT   CDS_pept        531824..533089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0549"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66262"
FT                   /db_xref="GOA:A0A0H2ZWR4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWR4"
FT                   /protein_id="ABK66262.1"
FT                   /translation="MELLKLAVILALWAAVAGAFVSVLYRRQSDADQSRVRDLKLVYDL
FT                   QLDREISARREYELTVESQLRRELASELRAQAADDLAELRAELSALRTSLEILFDTDLG
FT                   QRPALGAFEGEPQPERAYSEWERNGENPRDTPVDWVPSDRVTSAPQEHPPGRHDETAII
FT                   DVPEEPLMPPRPQQPAPPRRERPRYQEPPGPTEPRFEPRYQPPPAAAATPPPPETPPDP
FT                   PREPQPEPQPEPQPQPQGRDWQPVGAEGQWLPPGSPGSNWAGADAESTGGRRRARHSGA
FT                   DEAWDGMPVEPVPPPPYAESGRRARSRHSAEYRDYGVRNFAPGSEPPAGPAPAPPPPAA
FT                   ATPPPPAAPAPSGPAAGAPPPPRLAPPPAAEHTPRHGGEPEPADPRRARDASGTGGQSV
FT                   ADLLARLQVQPSEGGRRRRREG"
FT   gene            533205..534116
FT                   /locus_tag="MAV_0550"
FT   CDS_pept        533205..534116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0550"
FT                   /product="chalcone/stilbene synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65228"
FT                   /db_xref="GOA:A0A0H2ZS79"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZS79"
FT                   /protein_id="ABK65228.1"
FT                   /translation="MVQFDGLRPARLKVGIISAGRVGTALGVALERADHVVVACSAISH
FT                   ASRQRAQRRLPDTPVATPPEVAAGAELLLLAVPDSELAGLVSGLAATEAVRAGTIVAHT
FT                   SGANGVGILAPLTRQGCIPLAIHPAMTFTGSDEDISRLPDTCFGITAADEVGYAIAQSL
FT                   VLEMGGEPFSVAEDARVLYHAALAHASNHLVTVLSDALEALRAALRGSELLGQQTVDEQ
FT                   PGGIAERIVGPLARAALENTLQRGQAALTGPVARGDAAAVAGHLAALHRVAPELAQAYR
FT                   VNALRTAQRAHAPQEVVEVLAP"
FT   gene            534113..535039
FT                   /gene="panC"
FT                   /locus_tag="MAV_0551"
FT   CDS_pept        534113..535039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="MAV_0551"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="identified by match to protein family HMM PF02569;
FT                   match to protein family HMM TIGR00018"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64754"
FT                   /db_xref="GOA:A0QA93"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QA93"
FT                   /protein_id="ABK64754.1"
FT                   /translation="MKPAFTAGELNTYTSPGDVTAVSRALRHTGRRVMLVPTMGALHDG
FT                   HLALVRAAKRVPGSVVVVSIFVNPLQFSAGEDLDAYPRTLDDDLALLRSEGVEIAFTPT
FT                   AAAMYPNGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVCKLLQIVRPDRIFFGEKDYQQ
FT                   LVMIRQMVADLNIDVQVVGVPTVREADGLAMSSRNRYLDATQRELAVTLSAALTAGAHA
FT                   AHLGGAAALRAARAVLDAVPELTVDYLELRDAGLGPAPAHGSARLLVAARLGNTRLLDN
FT                   IEMQIETPAGTAGPDGDRQYAQSPWRN"
FT   gene            535039..535470
FT                   /gene="panD"
FT                   /locus_tag="MAV_0552"
FT   CDS_pept        535039..535470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="MAV_0552"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="identified by match to protein family HMM PF02261;
FT                   match to protein family HMM TIGR00223"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69136"
FT                   /db_xref="GOA:A0QA94"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QA94"
FT                   /protein_id="ABK69136.1"
FT                   /translation="MLRTMLKSKIHRATVTQADLHYVGSVTIDADLMDAADLLEGEQVT
FT                   IVDIDNGARLVTYAITGERGSGVIGINGAAAHLVHPGDLVILIAYGTMEEAEARAYQPR
FT                   IVFVDADNKPVDLGHDPAFVPDFEIAGAAELLDPRIVAR"
FT   gene            535473..536288
FT                   /locus_tag="MAV_0553"
FT   CDS_pept        535473..536288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0553"
FT                   /product="Bvg accessory factor family protein"
FT                   /note="similar to Bordetella pertussis Bvg accessory factor
FT                   family protein; identified by match to protein family HMM
FT                   PF03309; match to protein family HMM TIGR00671"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68483"
FT                   /db_xref="GOA:A0QA95"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QA95"
FT                   /protein_id="ABK68483.1"
FT                   /translation="MLLAIDVRNTHTVVGLISGSKEHAKVVQQWRIRTESEITADELAL
FT                   TIDGLIGDDSERLTGAAALSTVPSVLHEVRLMLDQYWPSVPHVLIEPGVRTGIPLLVDN
FT                   PKEVGADRIVNCLAAFHRFQSPAIVIDFGSSICVDVVSAKGEFLGGAIAPGLQVSSDAA
FT                   AARSAALRRVELARPRSVIGKNTVECMQAGAVFGFAGLVDGLVGRIREDVPGFGGDDVA
FT                   IVATGHTAPLLLPELDTVSHYDQHLTLHGLRLVFERNRDAQRGRLKTAR"
FT   gene            536335..537834
FT                   /gene="lysS"
FT                   /locus_tag="MAV_0554"
FT   CDS_pept        536335..537834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="MAV_0554"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67763"
FT                   /db_xref="GOA:A0A0H3A179"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A179"
FT                   /protein_id="ABK67763.1"
FT                   /translation="MSPAPDADIPEQYRIRRDKRARLLAEGHDPYPVAVERTHTLAQVR
FT                   AAHPDLPVDTATDDVVGVAGRVIFARNSGKLCFATLQEGDGTTLQVMVSLDKVGREALD
FT                   AWKADVDLGDIVSVHGTLISSRRGELSVLADSWRMASKSLRPLPVAHKEMSEEARVRQR
FT                   YVDLIVRPQARTVARQRIAVIRAIRNALERRGFLEVETPMLQTLAGGAAARPFVTHSNA
FT                   LDIDLYLRIAPELFLKRCVVGGFDKVFELNRVFRNEGADSTHSPEFSMLETYQAYGTYD
FT                   DSAVVTRELIQEVADEAIGTRQLPLPDGSVYDIDGEWASIEMYPSLSAALGEEITPQTT
FT                   VEKLLGIAERLGVEIPRDRGYGHGKIVEELWEHTVGDTLTAPTFVRDFPVETTPLTRQH
FT                   RSIDGVTEKWDLYVRGVELATGYSELTDPVVQRERFAAQARAAAAGDDEAMVLDEDFLA
FT                   ALEYGMPPCTGTGMGIDRLLMTLTGLSIRETVLFPIVRPHS"
FT   gene            537990..538316
FT                   /locus_tag="MAV_0555"
FT   CDS_pept        537990..538316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0555"
FT                   /product="Lsr2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67018"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZ67"
FT                   /protein_id="ABK67018.1"
FT                   /translation="MTVTLVDDFDGAGAADETVEFGLDGVTYEIDLSSKNAAKLRNDLK
FT                   QWVEAGRRVGGRRRGRSGSGRGRGAIDREQSAAIREWARRNGHNVSTRGRIPADVIDAF
FT                   HAAT"
FT   gene            538716..541184
FT                   /locus_tag="MAV_0556"
FT   CDS_pept        538716..541184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0556"
FT                   /product="negative regulator of genetic competence
FT                   ClpC/mecB"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02151; match to protein
FT                   family HMM PF02861; match to protein family HMM PF07724;
FT                   match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68618"
FT                   /db_xref="GOA:A0A0H3A236"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A236"
FT                   /protein_id="ABK68618.1"
FT                   /translation="MLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVRSQVEEI
FT                   IGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVAAQVLV
FT                   KLGAELTRVRQQVIQLLSGYQGKEAAEAGTGGRGGESGSPSTSLVLDQFGRNLTAAAME
FT                   GKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVHGQVPETLK
FT                   DKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEINTRGDIILFIDELHTLVGAGAAEGAI
FT                   DAASILKPKLARGELQTIGATTLDEYRKYIEKDAALERRFQPVQVGEPTVEHTIEILKG
FT                   LRDRYEAHHRVSITDSAMVAAATLADRYINDRYLPDKAIDLIDEAGARMRIRRMTAPPD
FT                   LREFDEKIAEARREKESAIDAQDFEKAASLRDREKQLVAQRAEREKQWRSGDLDVVAEV
FT                   DDEQIAEVLGNWTGIPVFKLTEAETTRLLRMEDELHKRIIGQEDAVKAVSKAIRRTRAG
FT                   LKDPKRPSGSFIFAGPSGVGKTELSKALANFLFGDDDALIQIDMGEFHDRFTASRLFGA
FT                   PPGYVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHQEIYNSLLQVLEDGRLTDGQGRTVD
FT                   FKNTVLIFTSNLGTSDISKPVGLGFTQGGGENNYERMKQKVNDELKKHFRPEFLNRIDD
FT                   IIVFHQLTRDEIIRMVDLMITRVAGQLKSKDMDLVLTDKAKALLAKRGFDPVLGARPLR
FT                   RTIQREIEDQLSEKILFEEVGPGQIVTVDVDNWDGESAGEDAVFTFTGTRKPPAEPDLA
FT                   KAGAHSADPQ"
FT   gene            541373..541588
FT                   /locus_tag="MAV_0557"
FT   CDS_pept        541373..541588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0557"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66384"
FT                   /db_xref="GOA:A0A0H2ZV61"
FT                   /db_xref="InterPro:IPR012667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZV61"
FT                   /protein_id="ABK66384.1"
FT                   /translation="MSHPQPTRSRTRSVDLSAAGTALFLAATVFFALLALYLVGVEQGA
FT                   VSLFGSDSHVHEFMHDARHLLGFPCH"
FT   gene            541604..542380
FT                   /locus_tag="MAV_0558"
FT   CDS_pept        541604..542380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64653"
FT                   /db_xref="GOA:A0A0H2ZQZ9"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZQZ9"
FT                   /protein_id="ABK64653.1"
FT                   /translation="MEKRLIGAGLLAGAVGAVLAFVFARLCAEPVIARAIAFEDGRADA
FT                   ENAHGVHEHGAELFSRGVQSGPGLGFGVLIFGLAMGALFAVLFSVVYARTESISPQALS
FT                   LLLAAGAFGAVYLVPFVKYPPNPPAVGQADTIGARTGWYLALVAASAALTIGVVWLARR
FT                   LEARLGPWNARLLSAAAYLVAIVAVAVLAPSVDETPAPLRDAAGAIVYPGFPADVLYEF
FT                   RLVSLAAQLVLWAGIGLVFAAVSGRLLGARAPRVPA"
FT   gene            542428..542925
FT                   /locus_tag="MAV_0559"
FT   CDS_pept        542428..542925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0559"
FT                   /product="phosphoglycerate mutase family protein, putative"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66364"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWT5"
FT                   /protein_id="ABK66364.1"
FT                   /translation="MADGRFPADEPLNELGRRQVQAITAQFGSAARYFVAPELRARQTA
FT                   GLLGCDGAAEPLLADLDCGRWRGRALQAVDQADLAAWLSDPAGAPHGGESIADLIERAS
FT                   RWLNALTANPLHTAAVTHPAVIRAAIAAALDADPASFWRVDVAPAAYVVMHHRGGRWTL
FT                   RL"
FT   gene            543119..544558
FT                   /locus_tag="MAV_0560"
FT   CDS_pept        543119..544558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0560"
FT                   /product="carotenoid oxygenase"
FT                   /note="identified by match to protein family HMM PF03055"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65798"
FT                   /db_xref="GOA:A0A0H2ZVC7"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVC7"
FT                   /protein_id="ABK65798.1"
FT                   /translation="MANRYLQGPFAPMHHEYTLTGLEVVGTIPDYLDGRYLRNGANPIG
FT                   DVDPERYHWFLGDGMVHGIRIRDGKAEWYRNRWVRSPATSKALGQPAPPGHFGFFPIGA
FT                   NTNVIGHAGKTLALIEGGIANYELTEELDTVGVCDFAGTLTGGYAAHPHRDPETGELHA
FT                   VSYNPYRGNRVQYSVIDVEGRARRTVDVTVGGSPMMHDFSLTERYVVFYDLPVTFDAAV
FT                   GAAMTAPRGLRPIARLMLSALIGRVAIPDPIAARLPAATTDRRMPYSWNPNYPARVGVM
FT                   PRDGEDADVRWFDVEPCYVFHPMNAYEEDGTIVLDVVRNPKMFDRDRTGPNEGPPTLDR
FT                   WVIDLAAGKVRESRIDDRGQEFPRIDERLVGKRHRYGYTPTVLEGIEGGDCLLKHDLIG
FT                   GSTQSRSLGPQKALGEFVFHPSSPTAAEDEGVLMGYVYDRATNRSELAILDAQTLEDVA
FT                   SIKLPHRVPAGFHGNWVPSTN"
FT   gene            complement(544571..545884)
FT                   /locus_tag="MAV_0561"
FT   CDS_pept        complement(544571..545884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0561"
FT                   /product="LpqF protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65201"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZS94"
FT                   /protein_id="ABK65201.1"
FT                   /translation="MLSAAAALVATLAPGCASSPSPQANAANPGRQIDTRTPPGIRAQQ
FT                   TLDMLNSDWPIGPVGVRTLAAADKVESVQTTLEALWWDRPFTLNGVDIGASVATLHLTS
FT                   SYGARQDIRIHTDDGGWVDRFDLDTRAPTVNSWHDVDAVLSKTGARYSYQAAKVDPQGR
FT                   CEPVAGTNTGESLPLASIFKLYVLHALAGAVTAGRVSWDDQLTVTDKSRAVGSSGLALP
FT                   AGAQVSVRTAAEKMIATSDNMATDLLIDKLGTHAIEEALATAGHHDPSSMTPFPTMYEL
FT                   FSVGWGRPDLRSQWEHGSPQVRARLLAQANSTPYDPDPMRAHSPASSYGAEWYGNAQDI
FT                   CRVHAALQADAVGKAAPVRDILSAVSGIQLDPAVWPYIGAKAGGLPGDLTFSWYAVDKT
FT                   HQPWVVSFQLNWPRDHGPTATGWMLQVAKQAFALIAPR"
FT   gene            complement(545913..546221)
FT                   /locus_tag="MAV_0562"
FT   CDS_pept        complement(545913..546221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0562"
FT                   /product="antibiotic biosynthesis monooxygenase domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03992"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64645"
FT                   /db_xref="GOA:A0A0H2ZS69"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZS69"
FT                   /protein_id="ABK64645.1"
FT                   /translation="MKINAIEVPADAGPELEKRFAHRAHAVENQPGFLGFQLLRPVQGE
FT                   DRYFVVTHWESDEAFQAWAKGPAIEAHAGHRANPVATGASLLEFEVVLDVAANKQAG"
FT   gene            546307..547050
FT                   /locus_tag="MAV_0564"
FT   CDS_pept        546307..547050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0564"
FT                   /product="hydrolase, alpha/beta hydrolase fold family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67493"
FT                   /db_xref="GOA:A0A0H3A0J6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0J6"
FT                   /protein_id="ABK67493.1"
FT                   /translation="MLTRHGGHGEPLVLVHGLMGRGSTWTRQLPWLTRLGTVYSYDAPW
FT                   HRGRDVEDPHPISTERFVADLADAVGTLDAPARMVGHSMGALHSWCLAAQHPKLVSALV
FT                   VEDMAPDFRGRTTGPWEPWLHALPVEFDSAEQVFAEFGPVAGQYFLEAFDRTETGWRLH
FT                   GHTSRWIEIAAEWGTRDYWAQWRAVRVPALLIEAGNSVTPPGQMLEMAERAVAATYLHV
FT                   PQAGHLVHDEAPEAYRQAVESFLAG"
FT   gene            complement(547033..547944)
FT                   /locus_tag="MAV_0563"
FT   CDS_pept        complement(547033..547944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0563"
FT                   /product="putative A/G-specific adenine glycosylase"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68202"
FT                   /db_xref="GOA:A0A0H3A0S3"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0S3"
FT                   /protein_id="ABK68202.1"
FT                   /translation="MADIMPQPPAVGSPLISVTDLLEWYRVARRDLPWRAPGVSAWQIL
FT                   VSEFMLQQTPVSRVLPIWPDWVRRWPTPSATAAASAADVLRAWGKLGYPRRAKRLHECA
FT                   TVIARDHGDVVPRDIDTLLTLPGVGGYTARAVACFAYRRPVPVVDTNVRRVVARAVHGQ
FT                   ADAGAPSAGRDHADVAALLPGDGSAPEFSVALMELGATVCTARAPRCGLCPLRRCAWRE
FT                   AGHPPPTGPARRVQTYAGTDRQVRGRLMDVLRGNDSPVTRAELDVAWLTDTAQRDRALY
FT                   SLLADGLVTQTADGRFALAGEE"
FT   gene            547943..548560
FT                   /locus_tag="MAV_0565"
FT   CDS_pept        547943..548560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0565"
FT                   /product="carbonic anhydrase"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66449"
FT                   /db_xref="GOA:A0A0H2ZVC1"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVC1"
FT                   /protein_id="ABK66449.1"
FT                   /translation="MPNTSPVTAWKSLKEGNERFVAGKPQHPSQSVEHRASLAAGQSPT
FT                   AVVFGCSDSRVAAELIFDQGLGDMFVVRTAGQAIDTAVLGSIEFAVSVLNVPLIVVLGH
FT                   DSCGAVKAALGAIEEGAIPGGFVRDVVERVAPSILMGRREGLSRVDEFEERHVRETVAQ
FT                   LVSRSTTIAERIGDGTVAVAGVTYHLADGRAALCDHVGDIGE"
FT   gene            548672..549505
FT                   /locus_tag="MAV_0566"
FT   CDS_pept        548672..549505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65701"
FT                   /db_xref="GOA:A0A0H2ZV36"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZV36"
FT                   /protein_id="ABK65701.1"
FT                   /translation="MTWAYAANVLDLEPRGPLPTEIYWRRRGLAVGIAVVVIGVVAAAV
FT                   IAFMGHSAGAKPANADKPNSAQSKPGSPAPQAPPPPGPEGPAPAVPPAQGQNPETPTPT
FT                   AAVQPPPVLKEGDDCPDSTLAVKGLTNAPQYFIGDQPKFTMVVTNIGLVACKRDVGAAV
FT                   LAAYVYSLDNKRLWSNLDCAPSNETLIKTFTPGEQVTTAVTWTGMGSAPHCPLPRPAIG
FT                   PGTYNLVVQLGNLRSQPVPFIMNQPPPPPGPVPGPGQPGAVPQPEAPPVPPPPAG"
FT   gene            complement(549533..550606)
FT                   /locus_tag="MAV_0567"
FT   CDS_pept        complement(549533..550606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0567"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF02457"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68252"
FT                   /db_xref="GOA:A0QAA9"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QAA9"
FT                   /protein_id="ABK68252.1"
FT                   /translation="MTRPTLRETVARLAPGTGLRDGLERILRGRTGALIVLGNDENVEA
FT                   ICDGGFALDVRYAPTRLRELAKMDGAVVLSTDGSRIVRANVQLVPDPSIATDESGTRHR
FT                   SAERAAIQTGYPVISVSHSMNIVTVYVGGERHVVADSATILSRANQAIATLERYKIRLD
FT                   EVSRQLSRAEIEDFVTLRDVLTVVQRLELVRRIGQVIDNDVVELGTDGRQLRLQLDELL
FT                   GGNDNARELIVRDYHASPEPLSEAQMTATLDELDALSDTELLDFTALAKVFGYPTTTEA
FT                   QDSAVSPRGYRALAGIPRLQFAHADLLVRSFGTLQNVLAASASDLQSIDGIGAMWARHV
FT                   REGLSQLAESTITDSLS"
FT   gene            complement(550603..551982)
FT                   /gene="radA"
FT                   /locus_tag="MAV_0568"
FT   CDS_pept        complement(550603..551982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="MAV_0568"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by match to protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67675"
FT                   /db_xref="GOA:A0A0H2ZZA8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZA8"
FT                   /protein_id="ABK67675.1"
FT                   /translation="MTAKWVGRCLECGTWGTVDEVPALSAVAGRRPRLTAASQAVPITS
FT                   IKPDASRHRSTGVDELDRVLGGGVVPGSVTLLAGDPGVGKSTLLLEVAHRWAQSGRRAL
FT                   YISGEESAGQIRLRADRIGCGGDQVYLAAESDLHTVLEHVATVKPALVIVDSVQTMSTT
FT                   EADGVAGGVTQVRAVTAALTAAAKANGVALILVGHVTKDGAIAGPRSLEHLVDVVLHFE
FT                   GDRNGSLRMVRGIKNRFGAADEVGCFLLHDNGIAGVTDPSNLFLDQRSAPVPGTAITVT
FT                   LDGKRPLIGEVQALLASPSGGSPRRAVSGIDHSRAAMITAVLEKHGKLPVAVNDIYLST
FT                   VGGMRLTDPSSDLAVAIALASALSELPLPTTAVMIGEVGLAGDLRRVSGMARRLSEAAR
FT                   QGFSIALIPDGDDPRREIVPSGMRALRAPTIGAALQHMVDIAEPRKGWTHRALGPQNDT
FT                   L"
FT   gene            complement(552077..552643)
FT                   /locus_tag="MAV_0569"
FT   CDS_pept        complement(552077..552643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0569"
FT                   /product="LpqE protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVA7"
FT                   /protein_id="ABK65777.1"
FT                   /translation="MNRFKIRLGLPARAVRVALAGAVAVPAVLLSGCGAGQVSQMAVQE
FT                   PAINGNKVTFNNVALRDIRIQAVQTGDFLQPGRAVELVAVAVNQSPNTPDKLVGITTDI
FT                   GTVTLSGDTRLPAGGMLFIGTPEGQKVAPGPIGSNTAAKATVTLAKPITNGLTYNFTFS
FT                   FEKAGQASVLVPISAGVAPQPDHAG"
FT   gene            552922..553410
FT                   /locus_tag="MAV_0570"
FT   CDS_pept        552922..553410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0570"
FT                   /product="transcriptional regulator, CarD family protein"
FT                   /note="identified by match to protein family HMM PF02559"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66207"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUQ0"
FT                   /protein_id="ABK66207.1"
FT                   /translation="MIFKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLT
FT                   VRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKV
FT                   AEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAAAS"
FT   gene            553445..554134
FT                   /gene="ispD"
FT                   /locus_tag="MAV_0571"
FT   CDS_pept        553445..554134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="MAV_0571"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /note="identified by match to protein family HMM PF01128;
FT                   match to protein family HMM TIGR00453"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66925"
FT                   /db_xref="GOA:A0A0H2ZWH9"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWH9"
FT                   /protein_id="ABK66925.1"
FT                   /translation="MAPETGSSGAVAAVVPAAGSGERLAAGIPKAFCEIDGASMLARAV
FT                   AGLLDSKVVDHVVVAVPADRVDEAKRLLAAQATVVAGGADRTASVRLALAAVPGNPAFV
FT                   LVHDAARALTPPALIARVVQALRDGHRAVVPALPLHDTVKAVDANGVVLGTPERDGLRA
FT                   VQTPQGFATDLLLRAYAAGAGTAGFTDDASLVEHVGGQVQVVDGDPLAFKITTQLDLLL
FT                   AETIVRR"
FT   gene            554131..554610
FT                   /gene="ispF"
FT                   /locus_tag="MAV_0572"
FT   CDS_pept        554131..554610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="MAV_0572"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="identified by match to protein family HMM PF02542;
FT                   match to protein family HMM TIGR00151"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65471"
FT                   /db_xref="GOA:A0QAB4"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QAB4"
FT                   /protein_id="ABK65471.1"
FT                   /translation="MNTTPRIGLGVDVHPIQPGRPCRLLGLLFDDADGCAGHSDGDVGA
FT                   HALCDAVLSAAGLGDVGAVFGVDDPRWAGVSGADMLRHVADLTARHGFRVGNAAVQVIG
FT                   NRPKVGPRRAEAQRVLSELLGAPVSVAATTTDGLGLTGRGEGLAAIATALVVPTG"
FT   gene            554659..556065
FT                   /gene="cysS"
FT                   /locus_tag="MAV_0573"
FT   CDS_pept        554659..556065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="MAV_0573"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="identified by match to protein family HMM PF01406;
FT                   match to protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68575"
FT                   /db_xref="GOA:A0QAB5"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QAB5"
FT                   /protein_id="ABK68575.1"
FT                   /translation="MTDRPRLRLHDTAAGAVRDFVPLRDGHVSIYLCGATVQGLPHIGH
FT                   VRSGVAFDILRRWLIALGYDVAFIRNVTDIDDKILNKAAAAGRPWWEWAATYERAFSAA
FT                   YDALDVLPPSAEPRATGHITQMVELIERLIEKGHAYTGDGDVYFDVLSYPEYGQLSGHR
FT                   IDDVHQGEGVASGKRDQRDFTLWKGAKPGEPSWPTPWGRGRPGWHTECVAMAHEYLGPE
FT                   FDIHCGGMDLVFPHHENEIAQSRAAGDGFARYWLHNGWVTMGGEKMSKSLGNVLAIPAM
FT                   LQRVRPAELRYYLGSAHYRSMLEFSDTALQDAVKAYVGVEEFLHRVRVRVGAVEPGEPT
FT                   PRFADALNDDLAVPAALAEVHQARAEGNRALDSGDHEGALRQARSIRAMMGILGCDPLH
FT                   ERWETRDESSAALAAVDVLVRAELQNREKAREQRNWALADEIRNRLKQAGIEVTDTADG
FT                   PQWTLGGDGK"
FT   gene            556066..556995
FT                   /locus_tag="MAV_0574"
FT   CDS_pept        556066..556995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0574"
FT                   /product="RNA methyltransferase, TrmH family protein, group
FT                   3"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032; match to protein
FT                   family HMM TIGR00186"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67417"
FT                   /db_xref="GOA:A0QAB6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QAB6"
FT                   /protein_id="ABK67417.1"
FT                   /translation="MAGNSRRRGAVRKAGTKKGPTVGSGGQRRRGLEGRGPTPPAHLRP
FT                   NHPAAKRAQSPPRRPAKRTEETETVLGRNPVLECLRAGVPATALYVALGTEADERLTES
FT                   VSRAADSGISILEVPRADLDRMTGNHLHQGIALQVPPYIYAHPDDLLEAAAGSPPALLV
FT                   ALDNISDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVAWRTSAGAAARIPVARATNL
FT                   TRTLQDWADRGLRVIGLDAGGDTTLDDLDGSDPLVVVVGSEGKGLSRLVRQNCDEVVSI
FT                   PMAGSAESLNASVAAGVVLAEISRQRRG"
FT   gene            556992..557936
FT                   /locus_tag="MAV_0576"
FT   CDS_pept        556992..557936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0576"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69282"
FT                   /db_xref="GOA:A0A0H3A4J6"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A4J6"
FT                   /protein_id="ABK69282.1"
FT                   /translation="MSSLGSRWAVAAAVALLMAVLLSAAPVYGQPATFDLQAHRGGRGE
FT                   TTEESLRAFAKAIQTGVSTLELDIVVTRDGQPLVWHDPTIQADKCSDTGPAFPGDPGYP
FT                   YVGKLVHQLTVAQIHTLDCGHRLKEFPDAEVVRGNKIATLPEVFAVADSHRADAIRYNI
FT                   ETKVEPDDTGASAPPQEFVDVILAAVRSADKLARVEIQSFDWRTLPLVRRAEPSIPLVA
FT                   LYDERAAGDPVLGARAAGADIVSPDYRLVTGKPYVDRAHALGLKVIPWTVDDAENMRRQ
FT                   IDYGVDGLITDFPTLARGVLAELGVPLPPAVPG"
FT   gene            complement(557840..559273)
FT                   /locus_tag="MAV_0575"
FT   CDS_pept        complement(557840..559273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0575"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65821"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVE9"
FT                   /protein_id="ABK65821.1"
FT                   /translation="MTTKVGEHAVVLGASMGGLLAGRSLADFFDRVTVVERDPLPDAHG
FT                   ARRGVPQGRHLHALLCRGAQAIEELFPGVLDQMVRDGAQYFDGQDLSQLYYNIGGHLMT
FT                   RSGAAPGLTAYSATRPFLEDHVRGRLRGIPNVTLRDEHCVTRLVSTADRRRVVGAWVAD
FT                   GRTGETTAMPADLVVDATGRAAHTPTWLDSLGYDRPREDRVTVQLTYASQALRMTGEAP
FT                   RELGLLIGIVPGRPRGCGLLHCEHDTWLLTVMGVGGEEPATLDLATLCDFIADCAPAHL
FT                   LAAVRGAEPVGEPVRHRMPCSRWRRYDKLRRFPDGLLVTGDAICSFNPIYGQGMSVAAL
FT                   EALALRDCLSSGTTDLARRFFRAAAAPIRQAWQLSTNPDLALPEIEGTPPLIARAFNKY
FT                   VDRVLTAAETDTVALNQFIRVTSLVDPATRLLRPSIMWRAARARGADHPGTAGGSGTPS
FT                   SASTPRANVGKSVMSPSTP"
FT   gene            559452..562085
FT                   /locus_tag="MAV_0578"
FT   CDS_pept        559452..562085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0578"
FT                   /product="transcriptional regulator, LuxR family protein"
FT                   /note="identified by match to protein family HMM PF00196;
FT                   match to protein family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68970"
FT                   /db_xref="GOA:A0A0H3A2Z8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2Z8"
FT                   /protein_id="ABK68970.1"
FT                   /translation="MIGGELLIGRDSELAAIRRALNGADHHRGVVIAGAAGVGKTWLAR
FT                   AALRRAGASGEQIKWIVGTQSAQALPLGAFIGLLGDAMSEPLTSVRRVIETFVARQRRG
FT                   RVVVGVDDAHLLDGLSALVVHQLAQSGGVRLVVTVRTGSHQPDAVTALWKDDLLTRLDL
FT                   EPLSAAATREVIESTLGGPVDARCAARFRRLTGGNTLFLRQLLSDQMAAGRMRRVAGVW
FT                   MWDGDVAVSASLSDTVGRQLGRLTPPLALVVDTLSQCEPLPVDLLCDLASREDLVAAEA
FT                   MGLVTVERTPRALMARLAHPLFGELRRAGAGEMYLSTIRGRLATRLAQDQDADMQATVR
FT                   RALLTLESDLDPQPELYLESARHAMTLLDLDLADRLANAAARAGAPGAAGVRAMNLVLL
FT                   GRGEQAEEALRAITDGADGDASDRHYWATVRAANLVWMLGRPADAALVLDGLAARPETP
FT                   AQAAARCAVQACLDAVAARCQLAAERARAALDSESLPDFHAMMASLALIMAMGALGQVD
FT                   DLTAVAEQALRRATTSFEASHMRFWFGAVYGRACRLTGRIDEFVSTARRLADSARDVPG
FT                   LAYANLALLLGNAELARGAAAEAARLVQEALAGAQIHEVTSGLRPASYFALAEAHGRLG
FT                   HPAQANEAIAGARSCVPPDFLFMHTGLALATGWALAAGGQLREAVATAQAAARLARDRG
FT                   QPTHELACIQAAAQWGDAAGAVRARALADALSLPLADAIACHAEALRAGNGEALLTVAA
FT                   AYRAIGDAAAAADAAAQASAAFVEGQQHQRGRYAAALAGELAEECGGLCTPALRTPAGL
FT                   KLSGRQRDVIELAVAGLSNRQIAERLVMSVRTVEGHIYRACQRVGAQSRDELATIIRSR
FT                   PAGRES"
FT   gene            complement(562082..563323)
FT                   /locus_tag="MAV_0577"
FT   CDS_pept        complement(562082..563323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0577"
FT                   /product="Arsenical pump membrane protein"
FT                   /note="identified by match to protein family HMM PF02040;
FT                   match to protein family HMM PF03600"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68426"
FT                   /db_xref="GOA:A0A0H3A2R7"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2R7"
FT                   /protein_id="ABK68426.1"
FT                   /translation="MALTVALVLLAVVLGFAVARPRGWPEAVAAVPAALLLVGVGAIPV
FT                   AAAEQQIADLSGVVAFLGAVLVLAKLCDDEGLFEAAGAAIARGRVGSAGMLRRVFVIAS
FT                   AITAVLSLDAAVVLLTPVVLAAVRRQRTAVRPYAYATAHLANGASLLLPVSNLTNLLAF
FT                   HTAQLSFTRFTLLMAAPWLAAVATLYAVFRGFFAKDLRVQPDPAALGAPPRPPVFVLVV
FT                   VALTLAGFAVAQSVGIAPAWVALCGASVLAVRSLARGHTTVTEIARSVHVSFLVFVLAL
FT                   GVVVQAVMRNGMDRAMSALLPSGSGLPALLAIAATAAVLANVVNNLPATLVLLPLVAPA
FT                   GPVAVLAVLIGVNIGPNLTYVGSLSNLLWRRVLRQHGVDAGVGEYTRLGVCTVPVSLLV
FT                   AVLALWASARLLGG"
FT   gene            complement(563334..564251)
FT                   /locus_tag="MAV_0579"
FT   CDS_pept        complement(563334..564251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0579"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67808"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYM7"
FT                   /protein_id="ABK67808.1"
FT                   /translation="MRLRLGRPDITRYADRFDVPAAGPGGLSVTWLGVASLLIDDGSSA
FT                   LLTDGYFSRPGLARVVAGKVSPSPPRVDGCLARAKVSRLEAVIPVHTHFDHALDSALVA
FT                   DRTGALLVGGESAANVGRGYGLPEDRIVVAADGEPIRLGAFDVTLVKSHHCPPDRFPGV
FT                   IAEPLIPPARASAYRCGESWSTLVRHRPTGRRLLICGSAGFVPGALAGQRAGAAYLSVG
FT                   QLGLRPRSYLDEYWDQTVRTVGARRVILIHWDDFFRPLSKPLRALPYAGDDLDSSIRVL
FT                   DELAERDGVALHLPSVWRREDPWA"
FT   gene            complement(564251..565009)
FT                   /locus_tag="MAV_0580"
FT   CDS_pept        complement(564251..565009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0580"
FT                   /product="LamB/YcsF family protein"
FT                   /note="identified by match to protein family HMM PF03746"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67254"
FT                   /db_xref="GOA:A0QAC2"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QAC2"
FT                   /protein_id="ABK67254.1"
FT                   /translation="MAGIDLNADLGEGFGVWRLGDDDAMLGIVSSANVACGFHAGDPAG
FT                   LLRVCRSAAERGVRVGAQVSYRDLAGFGRRFIDVAADELLADVVYQIGALQAIAHAAGS
FT                   SVCYVKPHGALYNTIVTHPAQAAAVAEAVRLVDPGLPVLGMAGSVFFDEAARRGLRVVA
FT                   EAFADRAYRPDGRLVSRREPGAVLADPAAIAERVLAMVETGAVTAVDGTRLALSVESVC
FT                   VHGDSPGAVQIATAVRDRLRAAGVEIRAFC"
FT   gene            complement(565019..565879)
FT                   /locus_tag="MAV_0581"
FT   CDS_pept        complement(565019..565879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0581"
FT                   /product="ABC-type Mn2+/Zn2+ transport system, permease
FT                   component"
FT                   /note="identified by match to protein family HMM PF00950;
FT                   match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64663"
FT                   /db_xref="GOA:A0A0H2ZS82"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZS82"
FT                   /protein_id="ABK64663.1"
FT                   /translation="MEHRLADMADHLFSFDITVHLLGHDFVQQALVAAALLGLVAGLIG
FT                   PFIVMRQMSFAVHGSSELSLTGAAFALLVGIGVGVGALIGSALAAALFGVLGRRARERD
FT                   SVIGVVLAFGLGLAVLFIHLYPGRTATSFALLTGQIVGVGYTGLTMLALVCLLVIAVLA
FT                   TCYRPLLFATVDPDVAAARGVPVHALGIVFAALVGVVAAQAVQIVGALLVMSLLITPAA
FT                   AAARVVASPGAAMLASVAFAEVSALGGIVLSLAPGVPVSVFVATISFLIYLACWLIGRR
FT                   REAAT"
FT   gene            complement(565879..566700)
FT                   /locus_tag="MAV_0582"
FT   CDS_pept        complement(565879..566700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0582"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66040"
FT                   /db_xref="GOA:A0A0H2ZW41"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW41"
FT                   /protein_id="ABK66040.1"
FT                   /translation="MSLQAAAAVDHDADTVSLRGARLAFGDRVLWEDLDLSVSRGEFVA
FT                   VLGPNGSGKTSLLKVLLGQLPLSAGVGLVDGKPITSGSGRIGYVPQHRPMERDVMLRGR
FT                   DLVRLGLDGGRWGAAPLRPRERARRRATVDQALRQVNGEHLADVRAGVMSGGELQRMRV
FT                   AQALVSDPLLLLCDEPLLTLDPANAKLVSALLERRRRDAATTVIVVTHEINPILPYVDR
FT                   VLYLVDGRFRIGTVEQVMNSETLSALYRADIQVVKVKGGYVVAGEHTDGHG"
FT   gene            complement(566697..567632)
FT                   /locus_tag="MAV_0583"
FT   CDS_pept        complement(566697..567632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0583"
FT                   /product="periplasmic solute binding protein family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01297"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65512"
FT                   /db_xref="GOA:A0A0H2ZUS2"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUS2"
FT                   /protein_id="ABK65512.1"
FT                   /translation="MGTALTRDATRVGRTTRWLATVLAVTGWAALTGCTGPAHPHATAV
FT                   VASTDVWGSVARAVAGGHVAVASILSGSDQDPHSYEASPSDAAAIADAGLVVFNGGGYD
FT                   GWVDDVLAHHPGVARVDAYALLPDAGRPRNEHVFYHLGVAKAVAAAVADRLAAIDPGNA
FT                   ADYRRNAAAFGRDADAIAGIEHTIAAAHPGGSVVATEPVAFYLLEASGLVNRTPPALEA
FT                   AVENETDPAPADLARALDLLDRRQVSALVVNPQTSASAVNGLREAARRAGVPVVEVRET
FT                   LPDGADYLSWQRNTVGQLQTALQPVRSLQP"
FT   gene            567755..568834
FT                   /locus_tag="MAV_0585"
FT   CDS_pept        567755..568834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0585"
FT                   /product="transcriptional regulator, LacI family protein"
FT                   /note="identified by match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64877"
FT                   /db_xref="GOA:A0A0H2ZT82"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZT82"
FT                   /protein_id="ABK64877.1"
FT                   /translation="MSPTPRRRATLASLADELKVSRTTVSNAFNRPDQLSADLRERVLA
FT                   TAKRLGYPGPDPVARSLRTRKAGAVGLVMAEPLTYFFSDPAARDFVTGVAQSCEALGQG
FT                   LLLVAVGPSRSLDEGTAAVLSAGVDGFVVYSVCDDDPYLQAVLQRRLPVVVVDQPKGLT
FT                   GVSRVGIDDRAAMRELADYVLGLGHREIGLLTMRLGRDRRQGLVDAERLRSPAFDVQRE
FT                   RITGVWEAMTAAGVDPDSLTVVESYEHLPESGGAAAKVALEANPRITALMCTADILALS
FT                   AMDYLRAHGVYVPGQLTVTGFDGVPDAISRGLTTVSQSSLHKGRRAGELLLKPARSGLP
FT                   VVELLDTELIRGRTAGPPA"
FT   gene            complement(568831..569424)
FT                   /locus_tag="MAV_0584"
FT   CDS_pept        complement(568831..569424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0584"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67612"
FT                   /db_xref="GOA:A0A0H2ZZR9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZR9"
FT                   /protein_id="ABK67612.1"
FT                   /translation="MAVLAESELGSEAQRERRKRILDATMAIASKGGYEAVQMRAVADR
FT                   ADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRAALTGGTPFQRLNFMVGKLNRAM
FT                   QRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMADGEPTEDQYHIARVISDV
FT                   WLSNLLAWLTRRASATDVSKRLDLAVRLLLGEHG"
FT   gene            569792..571915
FT                   /locus_tag="MAV_0587"
FT   CDS_pept        569792..571915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0587"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF02771; match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68027"
FT                   /db_xref="GOA:A0A0H3A1Y8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1Y8"
FT                   /protein_id="ABK68027.1"
FT                   /translation="MVATVTDEQFAARALVRDWARNASTGPGGTAAIRDVEQGNPDAWR
FT                   PVFARLAELGIFGVAVPEEAGGAGGSVEDLCAMVEEAAKALIPGPVATTALATLVLSDA
FT                   ELLAALAAGERFAGLALQGDITFDGAASTASGTLPFVLGAADGGVLLLPADGRWLVVDT
FT                   ASDGVHIEPLAATDFSRPLARVVLDSAPATVLAQTPERVEELAATVLAAEAAGITRWSL
FT                   QTAVDYAKVREQFGKPIGSFQAIKHLCAEMLCRAEQAEVAAADAARAAAEDDPAQFSLA
FT                   AALAAATAITAVKANVKDCIQVLGGIGCTWEHDAHLYLRRAHAIGRFLGGAERWLRRIT
FT                   ALTQAGVRRRLGIDLTEVEDQRPQIAEAVARIAALPAEQRQAALAEAGLQAPHWPAPYG
FT                   RGASPAEQLLIDQELAAAGVARPDLVIGWWAAPTILEHGTPEQIERFVPGTLRGEFLWC
FT                   QLFSEPGAGSDLASLRTKAVRTDGGWLLTGQKVWTSAAHKARWGVCLARTDPDAPKHKG
FT                   ITYFLVDMSAPGIEIRPLREITGDSLFNEVFLDNVFVPDEMVVGEVNDGWRLARTTLAN
FT                   ERVAMASGTALGNPMEELLELLSTLPLDSAQQDRLGRLIVTAQTGALLDQRIAQLAVGG
FT                   QDPGAQSSVRKLIGVRYRQALAEYTMDVSEGGGLVHNRAVYDFLNTRCLTIAGGTEQIL
FT                   LTVAAERLLGLPR"
FT   gene            complement(571912..572484)
FT                   /locus_tag="MAV_0586"
FT   CDS_pept        complement(571912..572484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0586"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65851"
FT                   /db_xref="GOA:A0A0H2ZU15"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZU15"
FT                   /protein_id="ABK65851.1"
FT                   /translation="MARWEPDARARLVAAALDLFNERGYDQTTVAEIAERAGLTKSTFF
FT                   RHFPDKRDVLAAGQDAIAQLLREGIAAAPADATPLALVCSGLKSAAAAFTPFNKELAPR
FT                   LRAAIAASAELQERNALKQIGLALAVSEALQARGVPEPAAALAAELGALAFKTAYARWA
FT                   EPDESGDLGDMACQALRELHAAAADLG"
FT   gene            572569..573450
FT                   /locus_tag="MAV_0588"
FT   CDS_pept        572569..573450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0588"
FT                   /product="oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01370;
FT                   match to protein family HMM PF04321; match to protein
FT                   family HMM PF05368; match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66095"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUF6"
FT                   /protein_id="ABK66095.1"
FT                   /translation="MRVLVTGASGGIGSAVVKELLAAGHHVIGLARSEASAATVSGLGA
FT                   EPLRGDIADLDVLQKAAVDTDGVAYLAFSHDFSDVGDAIADEARAIDALGAALADTGKP
FT                   LVLASGTPARPGSVSTEDDPFIADGPLAGRGRTGQAVVELAGRGVRSAVVRLPRAVHDA
FT                   GGRYGLAGILIQLARQRGVSSFAGDGTQRWPAVHRDDAAALFRLALEQAPAGSVLHAVG
FT                   DEGVPLRAIAEVIGRRLGVPVESAPADAFGPLGQVFAVDQPSSSALTQRRFGWQPVGPG
FT                   LLDDLETGVYPE"
FT   gene            complement(573452..573985)
FT                   /locus_tag="MAV_0589"
FT   CDS_pept        complement(573452..573985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0589"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69361"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A605"
FT                   /protein_id="ABK69361.1"
FT                   /translation="MMRLVSGFAVAAALPMFLPAGVCAAASNTATTLFPLDGPNQLETR
FT                   ALLNCFKSDGHCDFTAGADMLTPDGVTGFPPGLWARQTSEIRSSNRLAYLDAHADGQYE
FT                   RVHKSMGSDEITTIYMGEGPPDKYETHGRIDSTDWQTGQPKTDNNVILCTHIQVVYSGV
FT                   NITSPSTCAVTTFS"
FT   gene            complement(574032..575126)
FT                   /locus_tag="MAV_0590"
FT   CDS_pept        complement(574032..575126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0590"
FT                   /product="oxidoreductase, electron transfer component"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM PF00175; match to protein
FT                   family HMM PF00970"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67531"
FT                   /db_xref="GOA:A0A0H3A0J0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0J0"
FT                   /protein_id="ABK67531.1"
FT                   /translation="MTEADSAQALDEPLGDHVLELQIAEVIAETDDARSLVFAVPDDDG
FT                   DPDIPPERLRYAPGQFLTLRVPSERTGSVARCYSLCSSPFTDDALTVTVKRTADGYASN
FT                   WLCDNARPGMRIHVLAPSGNFVPKTLGDDFLLMAAGSGITPIMSIAKSALSEGSGRVTL
FT                   LYANRDERSVIFADALRELSAKYPDRLTVLHWLESLQGLPSVTALAQLAAPYTDRPVYI
FT                   CGPGAFMDSAREALETLKVPAAQIHIEVFKSLDSDPFAAVKIEDTAEGDEPPATAVVEL
FT                   DGETHTVSWPRNAKLLDVLLAKGLDAPFSCREGHCGACACTLRKGQVSMEVNDVLEQQD
FT                   LDEGLILACQSHPESDSVEVTYDD"
FT   gene            575339..576523
FT                   /locus_tag="MAV_0591"
FT   CDS_pept        575339..576523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0591"
FT                   /product="pigment production hydroxylase"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68801"
FT                   /db_xref="GOA:A0A0H3A158"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A158"
FT                   /protein_id="ABK68801.1"
FT                   /translation="MTSIQQRDAQSVLAGIDDLLPRIRERAQATEDLRRLPDETVADLQ
FT                   DVGFFTLLQPEQWGGLQCDPTLFYEAVRRLASACGSTGWVSSIIGVHNWHLALFDQQAQ
FT                   EEVWGEDPNVRISSSYAPMGAGVVTDGGYLVNGSWNWSSGCDHATWAFLGGPVIKDGRP
FT                   VDFGSFLIPRSEYRIDDVWHVVGLRGTGSNTVVVKDVFVPRHRFLSYKAMNDGTAGGYE
FT                   TNTAPVYKMPWGTMHPTTISAPIVGMAYGAYAAHVEHQGKRVRAAFAGEKAKDDPFAKV
FT                   RIAEAASDIDAAWRQLSGNVADEYALLSAGKEIPFELRARARRDQVRATGRAIASIDRL
FT                   FEASGATALANDQPVQRFWRDAHAGRVHAANDPERAYQIFGNHEFGLPPGDTMV"
FT   gene            576520..577401
FT                   /locus_tag="MAV_0592"
FT   CDS_pept        576520..577401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0592"
FT                   /product="2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate
FT                   hydrolase"
FT                   /EC_number="3.7.1.-"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69499"
FT                   /db_xref="GOA:A0A0H3A405"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A405"
FT                   /protein_id="ABK69499.1"
FT                   /translation="MTATEELTFESTSRFAEVDVDGPLKLHYHEAGLSFKGTGRTVVLL
FT                   HGGGPGAASWTNFGRNIPVLARHFHVLAVDQPGYGLSDKRAEHGQFNRYAARALNGLFE
FT                   QLELGRVPLVGNSLGGGTAVRFALDYPDKAGRLVLMGPGGLSINLFAPDPTEGVKRLGK
FT                   FSAEPTRENLEAFLRVMVYDQKLITDELIDERFALASTPESLAATRAMGMSFAGADFEL
FT                   GMMWREVHRLRQPVLLIWGREDRVNPLDGALVALKTIARAQLHVFGQCGHWAQVEKFDE
FT                   FNKLTIDFLGGA"
FT   gene            577401..578312
FT                   /locus_tag="MAV_0593"
FT   CDS_pept        577401..578312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0593"
FT                   /product="extradiol ring-cleavage dioxygenase"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64506"
FT                   /db_xref="GOA:A0A0H2ZQM4"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZQM4"
FT                   /protein_id="ABK64506.1"
FT                   /translation="MSNGAIRSLGYLRIEATDMAAWRDYGLKVLGMVEGKGDTEGALYL
FT                   RMDDFPARLVIVPGERDHLLEAGWECANAEGLQEIRDRLDMEGVPYKEATAAQLADRRV
FT                   VEMIRFSDPSGNCLEVFHGVALEHRRVVSPYGHKFVTGEQGLGHVVLSTRDDEESLHFY
FT                   RDVLGFKLRDSMRMPPQVVGRPADGAPAWLRFFGCNPRHHSLAFLPLPTPSGIVHLMLE
FT                   VENADDVGLCLDRALRRKVPMSATLGRHVNDLMLSFYMKTPGGFDVEFGCEGRQVEDDD
FT                   WVARESTAVSLWGHDFTVGMRG"
FT   gene            578315..578878
FT                   /locus_tag="MAV_0594"
FT   CDS_pept        578315..578878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0594"
FT                   /product="putative flavin reductase"
FT                   /note="identified by match to protein family HMM PF01613"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65227"
FT                   /db_xref="GOA:A0A0H2ZSB9"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSB9"
FT                   /protein_id="ABK65227.1"
FT                   /translation="MAAPIDPRTFRQVLGQFCTGITIITTVHDEVPVGFACQSFAALSL
FT                   DPPLVLFCPTKVSRSWKAIEATGRFCVNVLTEKQKHVSARFGSKEPDKFAGIDWHPSEL
FT                   GSPIIDGALAHIDCTVASVHEGGDHFVVFGAVQSLSEAPKIKPRPLLFYRGEYTGIEPD
FT                   KTTPAQWRDDLEAFLTTTTQDTWL"
FT   gene            578904..579734
FT                   /locus_tag="MAV_0595"
FT   CDS_pept        578904..579734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0595"
FT                   /product="arylamine N-acetyltransferase"
FT                   /EC_number="2.3.1.5"
FT                   /note="identified by match to protein family HMM PF00797"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67810"
FT                   /db_xref="GOA:A0A0H3A1C1"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1C1"
FT                   /protein_id="ABK67810.1"
FT                   /translation="MTLDLGAYFDRIGYGGKAAPNLEVLRALMAAHTGSIPFENLDPLM
FT                   GVPVDDLSPAALTDKLVHRRRGGYCYEQNGLLGYALAEIGFRVRRLAGRVVWMQPPDTP
FT                   PRAQTHTVLAVTFPGSQGAYLVDVGFGGQTLPSPIRFETGNSQQTTHEPYRLDDRGEGL
FT                   VLQALVRDEWQPLYVFGTRTVPQIDLLVGSWYVSTHPSSMFVTGLMVALTTADARWNLA
FT                   GRELTVHRAQGSEKIRLDDADAVLDVLGERFGIDVDGIGQRGALLARIEQVLDA"
FT   gene            complement(579748..580914)
FT                   /locus_tag="MAV_0596"
FT   CDS_pept        complement(579748..580914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0596"
FT                   /product="aspartate aminotransferase"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67341"
FT                   /db_xref="GOA:A0A0H2ZZZ5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZZ5"
FT                   /protein_id="ABK67341.1"
FT                   /translation="MTDRVSLRAGIPPFYVMDVWLAAAERQRSHGDLVNLSAGQPSVGA
FT                   PEPVRAAAAAAVHSNELGYSVSLGTPELRAAIAADYRRQHGLEVEPDAVVITTGSSGGF
FT                   LLTFLACFDVGDRVAVASPGYPCYRNILSALGCEVVEIPCGPQTRFQPTAAMLAELDPP
FT                   VQGVIVASPANPTGTVIAPEELAAIASWCEASGARLVSDEVYHGLVYEGAPPTSCAWQT
FT                   SRNAVVVNSFSKYYAMTGWRLGWLLVPVELRRAVECLTGNFTICPPVLSQLAAVAAFTP
FT                   EATAEADGHLHHYAKNRALLLDGLRGIGITRLAPTDGAFYVYADVSDFTDNSMEFCSKL
FT                   LEQTGVAIAPGIDFDTTRGNSFVRLSFAGPTTDIEEAVRRLGSWLRAR"
FT   gene            complement(580911..581870)
FT                   /locus_tag="MAV_0597"
FT   CDS_pept        complement(580911..581870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0597"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02771; match to protein
FT                   family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65052"
FT                   /db_xref="GOA:A0A0H2ZTL0"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTL0"
FT                   /protein_id="ABK65052.1"
FT                   /translation="MSAISEERQMLRETVAALVAKHAGPAAVRTAMESERGYDESLWRL
FT                   LCEQVGAAALVIPEELGGAGGELADAATVLQELGRALVPSPLLGTTLAELALLGAAEPD
FT                   TAALQALAEGSAIGALVLDPDYVVNGDIADVVIGVEDGRLSRWTGVTAQPVTTMDPTRR
FT                   LARVRAQQTEPIGTDPGLADTAAVLLAAEQIGAAEQCLARTVEYAKDRVQFGRPIGSFQ
FT                   ALKHRMADLYVTVAAAKAVVDEACLDPSPTNAATARLAATEALNVVAAEGIQLHGGIAI
FT                   TWEHDMHLYFKRAHGSAHLLDTPQQLLTRLEPEVLATP"
FT   gene            complement(581867..582811)
FT                   /locus_tag="MAV_0598"
FT   CDS_pept        complement(581867..582811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0598"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64542"
FT                   /db_xref="GOA:A0A0H2ZQR3"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZQR3"
FT                   /protein_id="ABK64542.1"
FT                   /translation="MKFALDEQQRDFAASIDAALGAADLPAAVRAWAVGDTAPGRKVWE
FT                   QLANLGVTALAVPEKFDGIEAEPIDLVVAIERLGRWCVPGPVVESIAVAPVLLAGDEHA
FT                   ERCAALASGELIATVALPPQVPRAVDAEEAGLVLLADQDGVAEAAAGRQHASVDPSRRL
FT                   YDVEPTGDRWQADVGRGYEFGALATAAQLVGAAEALRDAAVDYAKQRTQFGRVIGSYQA
FT                   IKHKLADVHIAIELARPLVYGAALTLQPRDVSAAKAAASDAALLAARSALQTHGAIGFT
FT                   QEHDLSLLLLRVQAVRSAWGPPQVHRRRVLEAL"
FT   gene            complement(582808..583953)
FT                   /locus_tag="MAV_0599"
FT   CDS_pept        complement(582808..583953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0599"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF02771"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69412"
FT                   /db_xref="GOA:A0A0H3A4U5"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A4U5"
FT                   /protein_id="ABK69412.1"
FT                   /translation="MDLDLDEGTLAFRDEVRQFLSANAEAIPTKSYDNAEGFEQHRRWD
FT                   RVLYDAGLSVITWPKKYGGRDAPLLHWVVFEEEYFRAGAPGRASANGTSMLAPTLFAHG
FT                   TEEQRDRILPKMASGEEIWAQAWSEPESGSDLASLRSTATPTDGGWLLNGQKIWSSRAP
FT                   FAERGFGLFRSDPSAERHHGLTYFMFDLKAEGVTVRPIVQLGGDTGFGEIFLDDVFVPD
FT                   RDVIGTPHQGWRAAMSTSSNERGMSLRSPARFLATAERVVRLWQDRGSPAEFADRVADG
FT                   WIKAQAYRLQTFGTVTRLAAGGELGAESSVTKVFWSDLDVELHQTALDILAADGELAGP
FT                   WTEGLLFALGGPIYAGTNEIQRNIISERLLGLPREKSGSKK"
FT   gene            complement(583953..585482)
FT                   /gene="fadD"
FT                   /locus_tag="MAV_0600"
FT   CDS_pept        complement(583953..585482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="MAV_0600"
FT                   /product="probable fatty-acid-coa ligase fadd3
FT                   (fatty-acid-coa synthetase)"
FT                   /EC_number="6.2.1.-"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68863"
FT                   /db_xref="GOA:A0A0H3A4K2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A4K2"
FT                   /protein_id="ABK68863.1"
FT                   /translation="MTTDPRTVPAALDRLARRLPDHDALITEDRSFTAAALRDEVHRAA
FT                   AALIELGVRAGDRVAIWSPNTWHWVVACLAIHHAGAAMVPLNTRYTAAEAGDILARVGA
FT                   PVLFGMGRFLGHDRLADLDRAALPALRHIVRIPIETDDPVPGSWDEFIAHGTDLGAVAE
FT                   RAAAVTSDDVSDILFTSGTTGRSKGVLCAHRQSLSASASWAANGKITSDDRYLCINPFF
FT                   HNFGYKAGILACLQTGATLIPHLTFDPLRALQAIEQHRITVLPGPPTIYQTLLDHPARR
FT                   DYDLSSLRFAVTGAATVPVVLVERMQSELDIDIVLTAYGLTEANGMGTMCRADDDAVTV
FT                   ATTCGRPFADFELRIDDSGEVLLRGPNVMLGYLDDPDATAAAIDADGWLHTGDIGVLDE
FT                   AGNLRITDRLKDMYICGGFNVYPAEVEQVLARMEGVADAAVIGVPDERLGEVGRAFVVP
FT                   RPGAQLDEQSVIAYTRDHLANFKAPRSVRFVDALPRNSGGKVVKPQLRELD"
FT   gene            585542..586690
FT                   /locus_tag="MAV_0601"
FT   CDS_pept        585542..586690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0601"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67616"
FT                   /db_xref="GOA:A0A0H2ZZ60"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZ60"
FT                   /protein_id="ABK67616.1"
FT                   /translation="MQDVEEFRAEVRSWLADNLVGEFAALKGLGGPGREHEAFEERRAW
FT                   NQHLAKAGLTCLGWPVEHGGRGLSTAHRVAFYEEYARADAPDKVNHFGEELLGPTLIAF
FT                   GTPEQQQRFLPRILDVTELWCQGYSEPGAGSDLANVSTTAELDGDQWVINGQKVWTSLA
FT                   HLSQWCFVVARTEKGSKRHAGLSYLLVPLDQPGVQIRPIVQITGTAEFNEVFFDDARTD
FT                   ASMVVGQPGDGWRVAMGTLTFERGVSTLGQQIRYARELSNLAELARRNGAADDPFIRER
FT                   LTRAWTGLRAMRSYALATMDVEQPGQDNVSKLLWANWHRALGELAMDVIGKPGMTMPDG
FT                   EFDEWQRLFLFTRADTIYGGSNEIQRNIIAERVLGLPREVKG"
FT   gene            586687..587475
FT                   /locus_tag="MAV_0602"
FT   CDS_pept        586687..587475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0602"
FT                   /product="short chain dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69263"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A422"
FT                   /protein_id="ABK69263.1"
FT                   /translation="MSLSEAPKEIAGHGLLEGKVVIVTAAAGTGIGSATAKRALAEGAD
FT                   VVISDHHERRLGETADQLAALGQGRVESVLCDVTSTAQVDALFASAHARMGRIDVLVNN
FT                   AGLGGQTPVVDMTDDEWDRVLDVTLTSVFRATRAALRYFRDAPHGGVIVNNASVLGWRA
FT                   QHSQSHYAAAKAGVMALTRCSAIEAAEYDVRINAVSPSIARHKFLEKTSSADLLDRLSA
FT                   GEAFGRAAEPWEVAATIAFLASDYSSYLTGEVISVSSQHP"
FT   gene            587556..588155
FT                   /locus_tag="MAV_0603"
FT   CDS_pept        587556..588155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0603"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66541"
FT                   /db_xref="GOA:A0A0H2ZX74"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZX74"
FT                   /protein_id="ABK66541.1"
FT                   /translation="MTGPANSRRDELLELAAAMFAERGLRATTVRDIADSAGILSGSLY
FT                   HHFSSKEEMVDEVLRSFLDWLFARYREIIDSESNPLERLKGLFMASFEAIEHRHAQVVI
FT                   YQDEAKRLLSQPRFSYIEDMNRQQRKMWLEVLNQGVDEGYFRPDLDVDLVYRFIRDTTW
FT                   VSVRWYQPGGPLTAEQVGQQYLAIVLGGITVDAKKD"
FT   gene            588171..589331
FT                   /locus_tag="MAV_0604"
FT   CDS_pept        588171..589331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0604"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65946"
FT                   /db_xref="GOA:A0A0H2ZUB1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUB1"
FT                   /protein_id="ABK65946.1"
FT                   /translation="MPEAYVIDAVRTAVGKRGGSLAGIHPVDLGALGWRGLLDRVDVDP
FT                   AAVDDVIAGCVDAIGAQAGNIARLSWLAAGYPEEVPGVTVDRQCGSSQQAISFGAQAIM
FT                   SGTADLIVAGGVQNMSQIPISSAMTVGEQFGFTSPTNESKQWLHRYGDQEISQFRGSEL
FT                   IAEKWNLSREEMERYALTSHERAFAAIRGGHFDNEIITVETESGPFRVDEGPRESSLEK
FT                   MAGLKPLVEGGRLTAAMASQISDGASAVLLASERAVKDHGLQPRARIHHISARAADPVF
FT                   MLTGPIPATRYALDKTGLSIDDIDTVEINEAFAPVVLAWLKEIKADPEKVNPNGGAIAL
FT                   GHPLGATGAKLFATMLNELERIGGRYGLQTMCEGGGTANVTIIERL"
FT   gene            complement(589424..590164)
FT                   /locus_tag="MAV_0605"
FT   CDS_pept        complement(589424..590164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68152"
FT                   /db_xref="GOA:A0A0H3A101"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A101"
FT                   /protein_id="ABK68152.1"
FT                   /translation="MSAVAVLLTALGVADLCRRAVAAAWVPLAAGPIVVAACAALGGLW
FT                   RGADIALLALAAVAVVAWEWLCARSELSGAQQAAPVAVLAAALMLLTVLSGWSSPVAGA
FT                   ISRWSAWAHLPLSHVPPTRALMVVGVVLVQFATANQLVRLVLGSVGAVRPAGQPQPSDR
FT                   LKGGRLLGPMERLLILSLGVGGQLAAAGAVVAAKGIIRFPELNAQKGQNGDVGIDEVTE
FT                   YFLVGSFTSWLLALGGIGLVLATR"
FT   gene            complement(590161..590769)
FT                   /locus_tag="MAV_0606"
FT   CDS_pept        complement(590161..590769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0606"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67188"
FT                   /db_xref="InterPro:IPR032580"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXT1"
FT                   /protein_id="ABK67188.1"
FT                   /translation="MIGDVVGSRRAADRPALHRRVAAALREVADGAIDPPAFTVGDEFQ
FT                   GSYPSVGAAIDAALTVRLLLAPEIDVRFGLGWGAVTVLDAAAGIQDGPGWWTARAAIQQ
FT                   TAHAQRQPGLALVRTTFRADDGTRADADAVNAALICRDHLLGSLDERSLRIVRGLMTGR
FT                   SKRELAAAEGISPSAVSQRAGRDGLDLIVLASQYLRELP"
FT   gene            complement(590889..591965)
FT                   /locus_tag="MAV_0607"
FT   CDS_pept        complement(590889..591965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0607"
FT                   /product="oxidoreductase, 2-nitropropane dioxygenase family
FT                   protein"
FT                   /note="identified by similarity to GB:AAF98273.1; match to
FT                   protein family HMM PF03060"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65102"
FT                   /db_xref="GOA:A0A0H2ZTG7"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTG7"
FT                   /protein_id="ABK65102.1"
FT                   /translation="MDMRLRTPLTELVGVEHPVVQTGMGWVAGARLVSATANAGGLGIL
FT                   ASATMTLDELATAIAKVKAATDKPFGVNIRADAADAADRVDLMIREGVKVASFALAPKQ
FT                   ELIARLKEAGAVVIPSIGAAKHARKVAGWGADAMIVQGGEGGGHTGPVATTLLLPSVLD
FT                   AVRGTGIPVIAAGGFFDGRGLAAALSYGAAGVAMGTRFLLTSDSTVPDAVKKRYLEAAL
FT                   DGTVVTTRVDGMPHRVLRTGLVEKLESGSPVRGLTAAVRNAAKFKHMSKMTWRSMISDG
FT                   LAMRHGKEMTWSQVVMAANTPMLLKAGLVEGNTEAGVLASGQVAGILEDLPSCAELIDS
FT                   IVRDAIAHLRSASGLIEE"
FT   gene            complement(592012..592755)
FT                   /locus_tag="MAV_0608"
FT   CDS_pept        complement(592012..592755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0608"
FT                   /product="coenzyme A transferase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64503"
FT                   /db_xref="GOA:A0A0H2ZRT8"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZRT8"
FT                   /protein_id="ABK64503.1"
FT                   /translation="MTSTRAEICAVACAELFREAGEIMVSPMTNMASVGARLARLTFSP
FT                   DILLTDGEAQLLADTPALGAAGAVEGWMPFGRVFETLSWGRRHVVMGANQVDRFGNQNI
FT                   SAFGPLQQPTRQMFGVRGAPGNAINHATSYWVGNHSKRVFCEKVDVVCGIGWDNVDSDN
FT                   PAFRFANTHRVVSNLGVFDFGGPDRTMRAVSLHPGVSPQDVREATSFEIHGLDEADETR
FT                   LPTDDELRLIREVIDPKSLRDREIR"
FT   gene            complement(592752..593633)
FT                   /locus_tag="MAV_0609"
FT   CDS_pept        complement(592752..593633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0609"
FT                   /product="coenzyme A transferase, subunit A"
FT                   /note="identified by match to protein family HMM PF01144"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66590"
FT                   /db_xref="GOA:A0A0H2ZW40"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW40"
FT                   /protein_id="ABK66590.1"
FT                   /translation="MADKRTSLDEAVAQLRSGMTIGIGGWGSRRKPMAFVRALLRTDVT
FT                   DLTVVTYGGPDLGLLCSAGKVKRVYYGFVSLDSPPFYDPWFAKARTSGAIQAREMDEGM
FT                   LRCGLQAAANRLPFLPIRAGLGSSVPDFWEGELQTVTSPYPTDGAHETLIAMPALRLDA
FT                   AFVHLNLGDAQGNAAYTGIDPYFDDLFLMAADKRFLSVERVVSTQELVKAVPPQALLVN
FT                   RMMVDAVVEAPNGAHFTTAAPDYGRDEKFQRHYAEAASTEEGWRQFVQTYLPGNEDDYQ
FT                   AAVRAFAEEAAK"
FT   gene            complement(593633..594388)
FT                   /locus_tag="MAV_0610"
FT   CDS_pept        complement(593633..594388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0610"
FT                   /product="enoyl-CoA hydratase"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66000"
FT                   /db_xref="GOA:A0A0H2ZUH0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUH0"
FT                   /protein_id="ABK66000.1"
FT                   /translation="MPITSKTIEPGIVAVTVDFPPVNAIPSRGWFDLADTVTAAGQDPE
FT                   THVVILRAEGRGFNAGVDIKEMQRTEGFTALIDANRGCFAAFRAVYECAVPVVAAVNGF
FT                   CVGGGIGLVGNSDVIVASDDATFGLPEVERGALGAATHLSRLVPQHLMRRLFFTAATVD
FT                   AATLHHFGSVHEVVPRGELDDAALRVAREIAAKDTRVIRAAKEALNFIDVQRVNSSYRM
FT                   EQGFTFELNLAGVSDEHRDAFAGTQKGKK"
FT   gene            594511..595245
FT                   /locus_tag="MAV_0611"
FT   CDS_pept        594511..595245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0611"
FT                   /product="short chain dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67969"
FT                   /db_xref="GOA:A0A0H3A1Q3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1Q3"
FT                   /protein_id="ABK67969.1"
FT                   /translation="MVLVTGGVRGVGAGISSVFAAQGATVVTCARRAVEGLPYEFHSCD
FT                   VRDDDAVKALIDTIADRHGRLDVVVNNAGGSPYVLTAESSAKFNRKIIELNLIGALSVS
FT                   QHANAHMQKQAQGGSIVNICSLSGRRPSPGTGAYGAAKAGLESLTQTLAVEWGPKVRVN
FT                   ACVVGMVETEQSELFYGDADSIAAISKNVPLGRLAKPADIGWAAAFLASDAACYISGAS
FT                   LEVHGGGEPPHYLATTNASAIK"
FT   gene            595260..596165
FT                   /locus_tag="MAV_0612"
FT   CDS_pept        595260..596165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0612"
FT                   /product="short chain dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66589"
FT                   /db_xref="GOA:A0A0H2ZY59"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3QLJ"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZY59"
FT                   /protein_id="ABK66589.1"
FT                   /translation="MGVVDGRVVIVTGAGGGIGRAHALAFAAEGARVVVNDIGVGLDGS
FT                   PASGGSAAQSVVDEITAAGGEAVADGSNVADWDQAAGLIQTAVETFGGLDVLVNNAGIV
FT                   RDRMIANTSEEEFDAVIAVHLKGHFATMRHAAAYWRGLSKAGKAVDGRIINTSSGAGLQ
FT                   GSVGQGNYSAAKAGIATLTLVGAAEMGRYGVTVNAIAPSARTRMTETVFAEMMATQDQD
FT                   FDAMAPENVSPLVVWLGSAEARDVTGKVFEVEGGKIRVAEGWAHGPQIDKGARWDPAEL
FT                   GPVVADLLGKARPPVPVYGA"
FT   gene            complement(596303..596731)
FT                   /locus_tag="MAV_0613"
FT   CDS_pept        complement(596303..596731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0613"
FT                   /product="AclJ protein"
FT                   /note="identified by match to protein family HMM PF04075;
FT                   match to protein family HMM TIGR00026"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69399"
FT                   /db_xref="GOA:A0A0H3A2X9"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2X9"
FT                   /protein_id="ABK69399.1"
FT                   /translation="MNSPMTGFFIKWMSRVNTWMYRVSRGKWGGTFQKRPVALLTTTGR
FT                   KTGQPRVSPLLYLREGDRVILVASQGGRDKHPLWYLNLKANPKVSVQIKDEVLQLQARD
FT                   ATPEEREQYWPKLVAMYPSFDDYQSWTDRVIPVVICDP"
FT   gene            complement(596754..597155)
FT                   /locus_tag="MAV_0614"
FT   CDS_pept        complement(596754..597155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0614"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68825"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A4H0"
FT                   /protein_id="ABK68825.1"
FT                   /translation="MVSVSDESRIAAAQAYIDALVSHDGDAVPFAPGCTRVEQGIKNGF
FT                   SGNHLRRSLNRGPQYRLLAHTTTPDYRIDGDRVHASYQVLTKAALGGRRLAAHVTETFL
FT                   IPAESPSGRAEIQHIKVRFQPFIQTRGRQ"
FT   gene            complement(597174..598334)
FT                   /locus_tag="MAV_0615"
FT   CDS_pept        complement(597174..598334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0615"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68749"
FT                   /db_xref="GOA:A0A0H3A3F0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3F0"
FT                   /protein_id="ABK68749.1"
FT                   /translation="MGNPVIVAATRSPIGKRNGWLSGLHATELLGAVQKAVVEKAGIDA
FT                   GDVEQVIGGCVTQYAEQSNNISRTAWLTAGLPDHVGATTVDCQCGSGQQANHLIAGLIA
FT                   TGAIDVGIACGIEAMSRVGLGANAGPDHNWRAESWDIDMPNQFEAAERIAKRRGITRED
FT                   IDEFGLASQAKAKQAWDEGRFDREISPIVAPALDENKQPTAERVTISRDQGLRETTLSG
FT                   LSALKPVIEGGIHTAGTSSQISDGAAAVLWMDEDKAKALGLRPRARIISQALVGAEPYY
FT                   HLDGPVQSTAKVLEKAGMKMGDIDITEINEAFASVVLSWARVHEPDMARVNVNGGAIAL
FT                   GHPVGCTGSRLITTALHELERSDQTTALITMCAGGALSTGTIIERI"
FT   gene            598494..599744
FT                   /locus_tag="MAV_0616"
FT   CDS_pept        598494..599744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0616"
FT                   /product="putative cytochrome P450 124"
FT                   /EC_number="1.14.-.-"
FT                   /note="identified by match to protein family HMM PF00067"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65730"
FT                   /db_xref="GOA:A0A0H2ZTQ2"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTQ2"
FT                   /protein_id="ABK65730.1"
FT                   /translation="MPSPNLPPGFDLLDPDVCVKGLPVAELAELRKSAPIYWMDVPGGT
FT                   GGFGDKGYWAITKHKDVKEISVRSDIFSSQQDCAIPVWPKEMTREQIDLQRNVMLNMDA
FT                   PHHTRLRKIISRGFTPRAVGRLRDELDARAQNIAKTAAAAGAGDFVEQVSCELPLQAIA
FT                   GLLGVPQEDRDKIFRWSNEMTGNEDPEYAHIDPAMSSAELIMYAMKMAEERAKNPGDDI
FT                   VTQLIQADLDGEKLSDDEFGFFVVMLAVAGNETTRNSITHGMIAFADNPDQWELFKKER
FT                   PETAPDEIVRWATPVTAFQRTALEDYELSGVQIKKGQRVVMFYRSANFDEEVFEDPHRF
FT                   NILRNPNPHVGFGGTGAHYCIGANLARMTISLIFNAVADHMPDLKPLSAPERLRSGWLN
FT                   GIKHWQVDYTGKCPVAH"
FT   gene            599746..600834
FT                   /locus_tag="MAV_0617"
FT   CDS_pept        599746..600834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0617"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68162"
FT                   /db_xref="GOA:A0A0H3A111"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A111"
FT                   /protein_id="ABK68162.1"
FT                   /translation="MASETTMDFDPSPTQQAVADVVTSVLDRELSWEALVDGGVTALPV
FT                   PERLGGDGVGLPEVATVLTEVGRRGAITPALATLGFAVLPLLELASEEQQDRFLAGVAR
FT                   GGVLTAALNEPGTPLPDRPATTFADGRLSGTKIGVGYAAQADWMIVTADSAVVVVSPKA
FT                   DGVQVVQTPTSNGSDEYTVSFTGVAVADSDVLAGATAARVNQLALAAVGAYADGLVSGA
FT                   LRLTADYVANRKQFGKPLSTFQTVAAQLAEVYIASRTIDLVAKSVVWGLSEGRDVDHDL
FT                   GVLGYWVASQAPPAMQLCHHLHGGMGMDITYPMHRYYSTIKDLTRLLGGPSHRLDLVAI
FT                   ASTAQPGAAGRHADDLVGAQCS"
FT   gene            600825..601988
FT                   /locus_tag="MAV_0618"
FT   CDS_pept        600825..601988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0618"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF02771"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65414"
FT                   /db_xref="GOA:A0A0H2ZSP2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSP2"
FT                   /protein_id="ABK65414.1"
FT                   /translation="MFIDLTPEQRQLQAELREYFSNLISSDEMKAMEQDRHNEAYRAVI
FT                   RRMGRDGKLGVGWPKEFGGLGFGPIEQSIFVNEAHRADVPLPAVTLQTVGPTLQQFGSE
FT                   MQKKKFLPAILAGEVHFAIGYTEPEAGTDLASLRTTAVRQGDEYIVNGQKIFTTGAHDA
FT                   DYIWLACRTDPEAVKHKGISILIVDTKDPGYSWTPIILSDGAHHTNATYYNDVRVPADM
FT                   LVGEENGGWKLITTQLNNERVMLGPAGRTAGIYDRVREWASKPGSDGVTPIDHADVQRA
FT                   LGEIYAMWRINELLNWQVAAAGEDINVADAASTKVFGTERIQYIGRLAEEVVGKYGNPA
FT                   DPETGELLRWLDSQTKRNLVITFGGGVNEVMREMIAAAGLKVPRVPR"
FT   gene            601985..602938
FT                   /locus_tag="MAV_0619"
FT   CDS_pept        601985..602938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0619"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01796"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65315"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039375"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZU87"
FT                   /protein_id="ABK65315.1"
FT                   /translation="MTDIAEAIAEIKAAGGPKPRAGRDPVNQPMINNWVEAIGDRNPIY
FT                   VDEAAARAVGHPGIVAPPAMIQVWTMFGLGGERPKDDPMGPIMELFDNAGYVGVVATNC
FT                   EQTYHRYLRPGEQVSITSEMGDVIGPKQTALGEGWFINQHIIWRVGDEDVAEMNWRILK
FT                   FRPRESDAAASPVPDDLDPATMMRPASSRDTAFFWEGVKAHELRIQRRPDGSLQHPPVP
FT                   AVWQDKTAPIDYVVASGKGTVYSFVVHHAPKVPGRTLPFVIALVELAEGVRMLGELRGI
FT                   DPARVRIGLPVRATYLDFPADDNGPEWSLYAWEPDA"
FT   gene            602935..603336
FT                   /locus_tag="MAV_0620"
FT   CDS_pept        602935..603336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67431"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A082"
FT                   /protein_id="ABK67431.1"
FT                   /translation="MSAPVIEVGTTLPELKLYGDPTFIISTALATRDFQDVHHDRDKAQ
FT                   AKGSKDIFVNILTDTGLVQRYVTDWAGPSALIKSIGLRLGVPWYAYDTVTFSGEVTAVQ
FT                   DGLVTLKVFGRNSLGDHVIATVTLTMGDA"
FT   gene            603336..604505
FT                   /locus_tag="MAV_0621"
FT   CDS_pept        603336..604505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0621"
FT                   /product="lipid-transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69447"
FT                   /db_xref="GOA:A0A0H3A329"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A329"
FT                   /protein_id="ABK69447.1"
FT                   /translation="MLSRKAAIVGIGATDFSKDSGRSELRLAAEAVLDALDDAGLSPAD
FT                   VDGLTTFTMDTNNETAVARAVGIGDLKFFSQIGYGGGAACATVQQAAIAVATGVADVVV
FT                   AYRAFNERSGMRFGQVQTRLAGDARAQADSTAADNSFSYPHGLSTPAAQVAMIARRYMH
FT                   LSGATSRDFGAISVADRKHAAKNPKAYFYEKPITIEDHQNSRWIAEPLRLLDCCQETDG
FT                   AVAIVVTSVERARDLKQRPAVIEAAAQGSSPDQYTMVSYYRSELGLPEMGVVGRQLWQQ
FT                   SGLKPTDIQTAVLYDHFTPFTLIQLEELGFCGKGEAKDFIADGAIEIGGRLPINTHGGQ
FT                   LGEAYIHGMNGIAEGVRQLRGTSVNPVPDVEHVLVTAGTGVPTSGLILG"
FT   gene            604792..605460
FT                   /locus_tag="MAV_0622"
FT   CDS_pept        604792..605460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0622"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67711"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A136"
FT                   /protein_id="ABK67711.1"
FT                   /translation="MVAGFSAAALHGSKWVDAMTVVDLIHHNRHRQPGIRVHEERIEED
FT                   EIAVLDGILVTSASRTALDLGCWYPTTAAVAGIDALARETRIKAADVELLAQRYPGRRG
FT                   IVRAREAIALFDGGSQSPKESWLRVVLTQAGLPPPQTQIRVVDDLGDPVAYLDMGWEDL
FT                   KVAVEYDGDHHRSDRRQYGWDIRRSEMLQRLGWIVVRVVAGDRPADIIARVREARARRA
FT                   "
FT   gene            complement(605543..606403)
FT                   /locus_tag="MAV_0623"
FT   CDS_pept        complement(605543..606403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0623"
FT                   /product="MaoC like domain protein"
FT                   /note="identified by match to protein family HMM PF01575"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67134"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYN4"
FT                   /protein_id="ABK67134.1"
FT                   /translation="MPIDVDVALNAELDPIEFSWTSSDVQLYHLALGAGSDPMDPRELR
FT                   YLVDDTPQVLPTFGNVAATFHATKPPTVQFPGIDIELGKVLHASERVEVPAPLPPSGSA
FT                   RAVTRFTDIWDKGKAAVIWSETKVTAPDGTLLWTQKRSIFARGEGGFGGERGPSGGDAA
FT                   PERAPDLEVDVPILPQQALLYRLCGDRNPLHSDPEFAAAAGFSQPILHGLCTYGMTCKA
FT                   IVDALLDSDAGAVAAYGARFAGVAFPGETLKVGIWKEGGRFLASVVAPSRDNAVVLSGV
FT                   ELVPA"
FT   gene            complement(606405..608096)
FT                   /locus_tag="MAV_0624"
FT   CDS_pept        complement(606405..608096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0624"
FT                   /product="3-ketosteroid-delta-1-dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00890;
FT                   match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66882"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWW7"
FT                   /protein_id="ABK66882.1"
FT                   /translation="MFYMSAQEYDVVVVGSGGAGMVAALTAAHRGLSTIVIEKAPHFGG
FT                   STARSGGGVWIPNNEVLKRDGVKDTPEAARTYLHGIIGDVVEPERIDTYLERGPEMLSF
FT                   VLKHTPLKMCWVPRYSDYYPESPGGRAEGRSIEPKPFNARKLGPDEAGLEPAYGKVPLN
FT                   VVVMQQDYVRLNQLKRHPRGVLRSLKVGARTMWAKATGKNLVGMGRALIGPLRIGLQRA
FT                   GVPVVLNTALTDLYLEDGVVRGVYVRDSQAAESAEPRLIRARRGVILASGGFEHNEQMR
FT                   VKYQRAPITTEWTVGAKANTGDGILAAEKLGAALELMEDAWWGPTVPLVGAPWFALSER
FT                   NSPGSIIVNMSGKRFMNESMPYVEACHHMYGGEYGQGPGPGENIPAWLVFDQQYRDRYI
FT                   FAGLQPGQRIPRKWLESGVIIQAETLEELASKAGLPVDEFLATVQRFNGFARTGIDEDY
FT                   HRGESAYDRYYGDPTNKPNPNLGEISHPPYYAAKMVPGDLGTKGGIRTDIHGRALRDDG
FT                   SIIEGLYAAGNVSAPVMGHTYPGPGGTIGPAMTFGYLAALHIAGEN"
FT   gene            608161..608946
FT                   /locus_tag="MAV_0625"
FT   CDS_pept        608161..608946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0625"
FT                   /product="2-keto-4-pentenoate hydratase"
FT                   /note="identified by match to protein family HMM PF01689"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66297"
FT                   /db_xref="GOA:A0A0H2ZUY0"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUY0"
FT                   /protein_id="ABK66297.1"
FT                   /translation="MLSVATRDELAAELAQAERSGEPIPPLTAAYPEIDVVDAYEIQLI
FT                   NIRQRVAEGARVLGHKVGLSSLAIQQMMGVDEPDYGHLLDDMQLFEDTPVKTNRYLYPR
FT                   VEVEVGFILNADLPGAGCTEDDVMAATEAFVPAIELIDTRITDWKIELCDTIADNASSA
FT                   GFVLGAARVSPQDIDIKGIDAVLRRNGEVVAEGRTDAVLGNPVTAVAWLARKVDGFGVR
FT                   LRKGDVVLPGSCTKAIDAHPGDEFVADFAGLGSVRLSFE"
FT   gene            609016..609912
FT                   /locus_tag="MAV_0626"
FT   CDS_pept        609016..609912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0626"
FT                   /product="acetaldehyde dehydrogenase"
FT                   /note="identified by match to protein family HMM PF01118"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65233"
FT                   /db_xref="GOA:A0QAG8"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QAG8"
FT                   /protein_id="ABK65233.1"
FT                   /translation="MAIVGSGNISTDLLYKLLRSDWLEPRWMVGIDPQSEGLARARKLG
FT                   LETTHEGVDWLLAQPEKPDLVFEATSAYVHRDAAPKYEAAGIRAIDLTPAAVGPAVIPP
FT                   ANLRQHLDAPNVNMITCGGQATIPIVYAVSRVVEVPYAEIVASVASVSAGPGTRANIDE
FT                   FTKTTSRGVETIGGAKRGKAIIILNPADPPMIMRDTIFCAIPEDADRDAIAQSIHDVVK
FT                   EVQSYVPGYRLLNEPQFDDPSLNSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATK
FT                   VGEEIAKETLSVAGGTR"
FT   gene            609909..610967
FT                   /locus_tag="MAV_0627"
FT   CDS_pept        609909..610967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0627"
FT                   /product="4-hydroxy-2-oxovalerate aldolase"
FT                   /EC_number="4.1.3.-"
FT                   /note="identified by match to protein family HMM PF00682;
FT                   match to protein family HMM PF07836"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64511"
FT                   /db_xref="GOA:A0QAG9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QAG9"
FT                   /protein_id="ABK64511.1"
FT                   /translation="MTTDIFFNPMWDVRLTDTSLRDGSHHKRHQFTKDEVQAIVAALDV
FT                   AGVPVIEVTHGDGLGGSSFNYGFSKTPEQELIKLAAETAKEAKIAFLMLPGVGTKEDIK
FT                   EAQNNGGSICRIATHCTEADVSIQHFGLARELGLETVGFLMMSHTIPPEKLAQQARIMA
FT                   DAGCQCVYVVDSAGALVLEGVRDRVAALVAELGDDAQVGFHGHENLGLGVANSVEAVRA
FT                   GAKQIDGSCRRFGAGAGNAPVEALIGVFDKIGVKTGIDFFDIADAAEEVVAPAMPAECL
FT                   LDRNALIMGYSGVYSSFLKHAIRQSERYGVPAHQLLHRAGQRKLIGGQEDQLIDIALEI
FT                   KREQESGAAAAR"
FT   gene            611020..611325
FT                   /locus_tag="MAV_0628"
FT   CDS_pept        611020..611325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0628"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68906"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR038378"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3P4"
FT                   /protein_id="ABK68906.1"
FT                   /translation="MSTSNTVGARRRGLYGLLAEGLLTAAAATVIALPVAGVAHAECNQ
FT                   DVGQSIDSYLQKHPDLHQQLQQRSQAEGGNGNVIDYLNRHPDVRQHLIDLSHSCPP"
FT   gene            611415..612542
FT                   /locus_tag="MAV_0629"
FT   CDS_pept        611415..612542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A160"
FT                   /protein_id="ABK68346.1"
FT                   /translation="MFSDPLTSAIAEAENLVAAAPHIETEADLLEGLQYLAGCISACIH
FT                   LAVDYERDHPFLQSGTGPFTKMGLDNPDTLYFGTRVHAGYDYVVTGRRGTTTDLSFQLL
FT                   GGEYTDDNVPASQAAFDDRELDIAPDGSFEWRVRPTSNGQLVIREVYGDWAAQRGTLAI
FT                   AREDTAGTAPPPLTRETIEKRYATAGKQLVNRVKTWLQFPQWFYFNIPVNTMVAPRLTP
FT                   GGLATQYSSAGHYELRPDQALLITIPVTDAPYLGFQLGSLWYISLDYINHQTSLNNTQA
FT                   QADPDGKVRIVVAEQNPGVTNWVETVGHRKGFLQFRWQRVSRQLTEADGPTVELVDFDA
FT                   VPAKLPYYEHNKISDDEWRARIALRQQQIAARMLG"
FT   gene            612554..613327
FT                   /locus_tag="MAV_0630"
FT   CDS_pept        612554..613327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0630"
FT                   /product="short chain dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67784"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A053"
FT                   /protein_id="ABK67784.1"
FT                   /translation="MLDGKVVVISGVGPGLGTTLAHRCADSGADLVLAARTAERLEKVA
FT                   KQVNDGGHRALAVRTDITDDDEVAYLVETTMATYGRADVLINNAFRVPSMKPLAGTSFQ
FT                   HIRDAIELSALGALRLIQAFTPALETAHGSIVNVNSMVLRHSQAKYGAYKMAKSALLSM
FT                   SQSLATELGEKGIRVNSVAPGYIWGDTLQAYFEHQAGKYGTTVEQIYAATAANSDLKRL
FT                   PTEDEVASAIMFLASDLSSGITGQTLDVNCGEYHT"
FT   gene            613324..614469
FT                   /locus_tag="MAV_0631"
FT   CDS_pept        613324..614469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67288"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A003"
FT                   /protein_id="ABK67288.1"
FT                   /translation="MSDRTDIGTVEELHASATKLTGLDDFGTDDDNYLQALEVLLDSYR
FT                   REAGLTVLGSKMNRFFLRGALVARLLSESAWKQYPQYADVAIQRPIFVTGLVRTGTTAL
FT                   HRLLGADPAHQGLHMWLAEFPQPRPPRETWESNPLYRQLDAQFTQHHRDNPGYTGLHFM
FT                   AAYELEECWQLLRQSLHSVSYETLAHVPSYAQWLSEQDWTPSYQRHRRNLQLIGLNDAD
FT                   KRWVLKNPSHLFALDALMATYPDALVIQTHRPVETIMASMCSLAQHTAEGWSTTFVGAQ
FT                   IGADAMDTWSRGLERFNTARAKYNPAQFYDVDYKELIADPLGTVADIYRHFGLTLTEEA
FT                   KAAMAKTHADSQSGERAPKHSYSLADYGLSVETVKERFAGL"
FT   gene            complement(614482..614919)
FT                   /locus_tag="MAV_0632"
FT   CDS_pept        complement(614482..614919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0632"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67073"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXI7"
FT                   /protein_id="ABK67073.1"
FT                   /translation="MTDDQPAVPDVDRLARSMLLLHGDHHDHDERPAASPANGGSWSKS
FT                   RDFTDDPQRAAAVAEASRADRERYLNSGLLPVDCRFCHARVAVRRLGPGHTAVQWNTEA
FT                   WQRCAYFTEVRQAGGDTARTKSCPKLGDSIEHAVAEGYLDD"
FT   gene            complement(614925..616082)
FT                   /locus_tag="MAV_0633"
FT   CDS_pept        complement(614925..616082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0633"
FT                   /product="Rieske [2Fe-2S] domain protein"
FT                   /note="identified by match to protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64838"
FT                   /db_xref="GOA:A0A0H2ZSY8"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSY8"
FT                   /protein_id="ABK64838.1"
FT                   /translation="MATDTKPVGIREIDPGALPTRYARGWHCLGVAKDFQDGKPHSIEA
FT                   FGTKLVVFADSHGDIHVLDGYCRHMGGDLSEGTIKGDEVACPFHDWRWGGDGRCKLVPY
FT                   AKRTPKTARTRSWTTDVRGGLLFVWHDHENNPPDPAVRIPEIPEAHSDEWTDWRWNRIL
FT                   IEGSNCRDIIDNVTDMAHFFYIHFGLPTYFKNVFEGHIASQYLHNVGRPDVNDLGTSYG
FT                   EAHLDSEASYFGPSFMINWLHNSYGDYKAESILINCHYPVTQNSFVLQWGVIVEKPKGM
FT                   DEEMTDKLSRVFTEGVSKGFLQDVEIWKHKTRIDNPLLVEEDGAVYQLRRWYQQFYVDV
FT                   ADIEPEMVERFEIEVDTTRANEYWNAEVAQNLKAKESEDVPAEQH"
FT   gene            616209..616733
FT                   /locus_tag="MAV_0634"
FT   CDS_pept        616209..616733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0634"
FT                   /product="carnitine operon protein CaiE"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66876"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYU7"
FT                   /protein_id="ABK66876.1"
FT                   /translation="MPLFAFEGRSPRVDPTAFVAPTATLIGDVVVEAGASVWFNAVLRG
FT                   DYGPIVVREGANVQDGSVLHAPPGIPVDIGPGATVAHLCVIHGAHVGPEALIANHATVL
FT                   DGAVIGAGSLVAAHSLVTAGTQIPAGMLAMGAPAQIKGPVAGTDAQLWVKLNPQAYRDL
FT                   AQRHLAGLEPI"
FT   gene            complement(616744..617151)
FT                   /locus_tag="MAV_0635"
FT   CDS_pept        complement(616744..617151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0635"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67594"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0R5"
FT                   /protein_id="ABK67594.1"
FT                   /translation="MHPAHEAGRRSREAVTARDKDAWLAVFADDAVVEDPIGPSVFDPE
FT                   GKGHRGRAAISAFWDKAIAPTTKIEFVFRDTYQCGNEEANVGHILITTGDYQTTAEGVF
FT                   TYKADDEGKLVALRAYWEMDRAAANTKKISG"
FT   gene            complement(617154..618347)
FT                   /locus_tag="MAV_0636"
FT   CDS_pept        complement(617154..618347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0636"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68932"
FT                   /db_xref="GOA:A0A0H3A2U8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2U8"
FT                   /protein_id="ABK68932.1"
FT                   /translation="MAGAGPNIAAVLGTGQTKYVAKRQDVSMNGLVREAIDRALADSGC
FT                   TFDDIDAVVVGKAPDFFEGVMMPELFMADAVGATGKPLIRVHTAGSVGGSTGVVAASLV
FT                   QSGKYRRVLAMAWEKQSESNAMWALSIPVPFIKPVGAGAGGYFAPHVRAYIRRSGAPTH
FT                   IGAMVAVKDRLNGCRNPLAHLHQPDITLEKVMESPMLWDPIRYDETCPSSDGACAVVIG
FT                   NEEAAEARLAQGNPVAWIHATALRTEPLAYAGRDQVSPQAGRDAAAALWKAAGIKSPID
FT                   EIDAAEIYVPFSWFEPMWLENLGFAPEGEGWKLTEAGETKIGGRLPVNPSGGVLSSNPI
FT                   GASGLIRFAEAAIQVMGKGGDHQVPGARKALGHAYGGGSQYYSMWVVGADKPAAEKV"
FT   gene            complement(618347..619411)
FT                   /locus_tag="MAV_0637"
FT   CDS_pept        complement(618347..619411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0637"
FT                   /product="lipid-transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68424"
FT                   /db_xref="GOA:A0A0H3A058"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A058"
FT                   /protein_id="ABK68424.1"
FT                   /translation="MSARNVAVVGFAHAPHVRRTDGTTNGVEMLMPCFAQLYQDLGITK
FT                   ADIGFWCSGSSDYLAGRAFSFISAIDSIGAVPPINESHVEMDAAWALYEAYIKLLTGEV
FT                   DTALVYGFGKSSAGVLRQILSRQTDPYTVAPLWPDSISMAGLQARMGLDTGKWTEEQMA
FT                   RVAFDSFANARRVDNVEGSITVAELLERPFFAEPLRRHDIAPITDGAAAIVLAAGDRAR
FT                   ELRENPAWITGIEHRIESPALGVRDLTESPSTKAAAEIATGGRTDNLDVVEICAPFTHQ
FT                   HLIIAEAIRIPGPTKVNPSGGALAANPMFVAGLERIGFAAQHIWDGSAERVLAHATSGP
FT                   ALQQNLVAVMEGKN"
FT   gene            complement(619428..620396)
FT                   /locus_tag="MAV_0638"
FT   CDS_pept        complement(619428..620396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0638"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01796"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65612"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZT51"
FT                   /protein_id="ABK65612.1"
FT                   /translation="MTDHPEPPLSAPLTLSFDYTRSVGPTLSKFFTALRERRVLGVRGS
FT                   DGRVHVPPPEYDPVTYEPLGEMVPVSPVGTVVSWAWQPDPIEGQPLDRPFAWALIKLDG
FT                   ADTPLLHAVDAGEPKAIKSGTRVHVHWADEPVGAITDIAYFALGEDPEPVAEQPDADKD
FT                   PVSMIVTPISLTIQHTASHEESAYLRAIAQGKLLGARTGKNGKVYFPPHGADPATGQPT
FT                   TEFVELPDKGTVTTFAIINIPFQGQRIKPPYVAAYVLLDGADIPFLHLVADVDAHEVRM
FT                   GMRVEAVWKPREQWGFGIDNIEYFRPTGEPDADYDTYKHHL"
FT   gene            620490..621521
FT                   /locus_tag="MAV_0639"
FT   CDS_pept        620490..621521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0639"
FT                   /product="FMN-dependent monooxygenase"
FT                   /note="identified by match to protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68741"
FT                   /db_xref="GOA:A0A0H3A106"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019951"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A106"
FT                   /protein_id="ABK68741.1"
FT                   /translation="MKLGLQLGYWGAGPPENHGELVAAAEEAGYDAVFTAEAWGSDAYT
FT                   PLAWWGSSTSRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQVVEGW
FT                   YGQRFPKPLARTREYIDIIRQVWAREKPVTSDGPHYPLPLTGTGTTGLGKALKPITHPL
FT                   RADIPIFLGAEGPKNVALAAEICDGWLPIFYTPRLADMYNEWLDEGFARPGARRSRADF
FT                   EICATANIVITEDRGAAFAAMKPYIALYMGGMGAEDTNFHADVYRRMGYAEVVDDVTKL
FT                   FRSGRKDEAAKIIPDEVIDDAAIVGDVDYVRKQIKAWEAAGVTMMVVSGRSTEQVRELA
FT                   TLI"
FT   gene            complement(621620..622300)
FT                   /locus_tag="MAV_0640"
FT   CDS_pept        complement(621620..622300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65035"
FT                   /db_xref="GOA:A0A0H2ZTJ5"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTJ5"
FT                   /protein_id="ABK65035.1"
FT                   /translation="MPVRIRKADVHTAMFSVDAQAAQRLIDYSGLKVCQHRPGRAVVNL
FT                   MLARYIDGDLGQYHEFGTCVMVNPPGSTARGWRALGEAAAFIHHLPVDQSFTLEAGRSI
FT                   WGFPKIMADFTVREQGRFGFDVSADGAHIAGIDFAPGLPVPSLFTSRPQVLKTYTFAEG
FT                   TTREVPWEMRVRGLRGRPGGATLRLGTHPYAQELASLGLPTRAMISGSVGHVEMTFGDA
FT                   HPLG"
FT   gene            622385..623605
FT                   /locus_tag="MAV_0641"
FT   CDS_pept        622385..623605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0641"
FT                   /product="P450 heme-thiolate protein"
FT                   /note="identified by match to protein family HMM PF00067"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65448"
FT                   /db_xref="GOA:A0A0H2ZUV4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUV4"
FT                   /protein_id="ABK65448.1"
FT                   /translation="MTSTIPEAIANIDLADGNFYADRRASREAYRWMRANQPVFRDRNG
FT                   LAGATTYQAIQDAERNPELFSSTGGIRPDQPGMPYMIDMDDPAHLLRRKLVNAGFTRKR
FT                   VKEKEPSIGTLCDTLIDAVCERGECDFVRDIAAPLPMAVIGDMLGVLPTERGMLLKWSD
FT                   DLVCGLSSHIDPTSAEFQTVMDAFAAYTAFTMDIIAKRRAEPTDDLFSILVNAEVEGQR
FT                   MSDDEIVMETLLILIGGDETTRHTLSGGTEQLLRHRDQWDALVRDPSLLPGAIEEMLRW
FT                   TSPVKNMCRTLTADTEFHGTELRAGEKIMLLFESGNFDESVFDDPDSFDIRRNPNSHMA
FT                   FGFGTHFCLGNQLARLELSMMTERVLKRLPDLRLADDGDLPLRPANFVSGLEAMPVVFT
FT                   PSAPLLR"
FT   gene            complement(623732..624604)
FT                   /locus_tag="MAV_0642"
FT   CDS_pept        complement(623732..624604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0642"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66044"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUB5"
FT                   /protein_id="ABK66044.1"
FT                   /translation="MAEPFIGSEAVASGLVTPYALRSRFVRVHPDVYVPAGTALSAGLR
FT                   ARSAWLWSRRRGVVAGRSAAALYGTKWIDDRAPAQLLYPYRRPPDGIQTWSDRLVGDEI
FT                   QTIGGMPVTTPARTALDIACRSPVDKAVAAIDALARATELKVLEIELLADRYRGRRGIT
FT                   RARNVLPLVDAGAESPRETWLRLLLLRAGFPRPRTQLPVRQYGALIACLDMGWEDIKLA
FT                   VEYDGDQHRTDRRQFTKDIRRAEVLAELGWTVVRVTAEDTPAGIIARVPTAWTRRACTG
FT                   SEKPARNSR"
FT   gene            complement(624808..625620)
FT                   /locus_tag="MAV_0643"
FT   CDS_pept        complement(624808..625620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0643"
FT                   /product="enoyl-CoA hydratase"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66602"
FT                   /db_xref="GOA:A0A0H2ZVR7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVR7"
FT                   /protein_id="ABK66602.1"
FT                   /translation="MAEASANEKTGPDALVEQRGHTLIVTLNRPHARNALSTEMMEIMV
FT                   QAWDRVDNDDDIRCCILTGAGGYFCAGMDLKAATKKPPGESFKDGSYDPSRIDALLKGR
FT                   RLTKPLIAAVEGPAIAGGTEILQGTDIRVAGESAKFGISEAKWSLYPMGGSAVRLVRQI
FT                   PYTVACDLLLTGRHITAAEAKEMGLIGHVVPDGQALAKALEIAEVIENNGPLAVQAILR
FT                   AIRETEGMHENEAFKIDTQIGIKVFLSEDAKEGPRAFAEKRKPNFQNR"
FT   gene            625685..627325
FT                   /locus_tag="MAV_0644"
FT   CDS_pept        625685..627325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0644"
FT                   /product="acyl-CoA synthase"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68933"
FT                   /db_xref="GOA:A0A0H3A3Q9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3Q9"
FT                   /protein_id="ABK68933.1"
FT                   /translation="MAVALNIADLAEHAIDAVPDRVALICGDEKLTYAELEEKANRLAH
FT                   YLLDQGVKKDDKVGLYCRNRNEIVIAMLGIVKAGAILVNVNYRYVEGELRYLFDNSDMV
FT                   ALVHERQYSDRVANVLPDTPNVKTILVVEDGSDKDYQRYGGVEFYSALEKGSPERDFGP
FT                   RSADDIYLLYTGGTTGFPKGVMWRHEDIYRVLFGGTDFATGEFVKDEYDLAKAAAENPP
FT                   MIRYPIPPMIHGATQSATWMSIFSGQTTVLAPEFNADEVWRTIHEHKVNLVFFTGDAMA
FT                   RPLLDALNKDHDYDLSSLFLLASTAALFSPSIKERLLELLPNRVITDSIGSSETGFGGT
FT                   SIVAKDAPHAGGPRVTIDHRTVVLDEEGNEVKPGSGVRGLIAKKGNIPVGYYKDEKKTA
FT                   ETFKTFNGVRYAIPGDYALVEEDGTVTMLGRGSVSINSGGEKIYPEEVEGALKGHPDVF
FT                   DALVVGVPDPRYGQHVAAVVQPRPGTRPSLAELDRFVRSEIAGYKVPRSLWLVDEVKRS
FT                   PAGKPDYRWAKEQTEARPADDVHAAHVSA"
FT   gene            627335..628102
FT                   /locus_tag="MAV_0645"
FT   CDS_pept        627335..628102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0645"
FT                   /product="phosphotransferase enzyme family protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01636;
FT                   match to protein family HMM PF03881"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67144"
FT                   /db_xref="GOA:A0A0H2ZXP0"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016477"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXP0"
FT                   /protein_id="ABK67144.1"
FT                   /translation="MTDFVKQHPRPPEGFFGWEAAGLRWLSSVDGGVPCARVVAVDATS
FT                   LTLRRLQSVPAGRDAAHEFGRRLAVTHDAGAAAFGAGPDGWDGPGYFGPLSQPLPMSLR
FT                   RHRHWGSFYAEERLVPMAERAAPRLAASTRDAIGAVAARCRAGDFDDDDGPARLHGDLW
FT                   SGNVMWTPDGVVLIDPAAHGGHRETDLAMLALFGCPHYDAVLAGYQQVRALKPGWRNRI
FT                   GLHQLYPLLAHVVLFGGGYAGQTDAAARAALAA"
FT   gene            628125..628952
FT                   /locus_tag="MAV_0646"
FT   CDS_pept        628125..628952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0646"
FT                   /product="amidohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF04909"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64891"
FT                   /db_xref="GOA:A0A0H2ZSW1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSW1"
FT                   /protein_id="ABK64891.1"
FT                   /translation="MTIDVWMQHPTVRFLRSDMLASLRRWTGGSIPDTDIPIEATLASM
FT                   DAAGVGYGLLSAWRGPNGQDLVSNDEVAQWVAAHPNRFAGLAAVDLDRPMEAVRELRCR
FT                   IADGGFVGLRVVPWLWNAPPTDRRYYPLFAACVEAGVPFCTQVGHTGPLRPSETGRPIP
FT                   YIDQVALDFPELVIVCGHVGYPWTEEMVAVARKHENVYIDTSAYTIERLPDELVRFIKT
FT                   GTGQRKVLFGTNYPMITAEHALAGLDGLGLSDEARRDFLHGNAERVFRLEAAT"
FT   gene            628949..630499
FT                   /locus_tag="MAV_0648"
FT   CDS_pept        628949..630499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0648"
FT                   /product="thiamine pyrophosphate enzyme"
FT                   /note="identified by match to protein family HMM PF02775;
FT                   match to protein family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69396"
FT                   /db_xref="GOA:A0A0H3A4T5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A4T5"
FT                   /protein_id="ABK69396.1"
FT                   /translation="MNGAQALIRTLVDGGVDVCFANPGTSEMHFVAALDSVPRMRGVLA
FT                   LFEGVATGAADGYARIADRPAAVLLHLGPGLGNGLANLHNARRARVPMVVVVGDHATYH
FT                   KKYDAPLESDIDALAGSVSGWVRRTSDASQVSADAVEGIAASRWGSQISTLILPADVSW
FT                   SDGAQLFSTMDARPAGADPLLAPEVVEVLRSGEPTVILVGGDATRRAGLAAAARIAAAT
FT                   GARVLCETFPTRLERGAGIPAVERLAYFAEAAAAQLDGAKHLVLAGAKSPVSFFAYPGM
FT                   PSDLVPAGCEVHVLAGHTGAADALSALADQLAPGTAAPVAAASRPALPTGPLTSVSAAD
FT                   VIGALLPERAIVVDESNTSGVLLAQATAGAPAHDWLTLTGGAIGYGIPAAVGAAVAAPD
FT                   RPVLCLESDGSAMYTISGLWTQARENLNVTTVLYDNSAYDILRIELQRVGAGSAPGPEA
FT                   LSLLDLSDPAMDFVKISEGMGVPARRVSTAEEFADALRAALAEPGPHLIDAVVPSIAG"
FT   gene            complement(630485..631198)
FT                   /locus_tag="MAV_0647"
FT   CDS_pept        complement(630485..631198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65694"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTB8"
FT                   /protein_id="ABK65694.1"
FT                   /translation="MTSRPLELALEASFDQLAATVPAKVGVAVARPDRTFSLGSWWSGV
FT                   AWSTIKVPLAIAALRKDWLGARELATKAVTESDNRASEQLWSQLGEPAEAARQVQAVVA
FT                   EGGDTATVVESRRLRRGFTAFGQTQWSLQRQARFAAELSTIPDAAEVIDMMQRLSPTQR
FT                   WGLAAKGLAAKGGWGPGGRGEYLVRQFGVVPTPTGNWGVALAADTHDGVFETGVDVLDT
FT                   LTDWLLSRLPSLARY"
FT   gene            complement(631326..631607)
FT                   /locus_tag="MAV_0649"
FT   CDS_pept        complement(631326..631607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0649"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64830"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZT40"
FT                   /protein_id="ABK64830.1"
FT                   /translation="MEDRPLTRRRRIRFGRNEKGLGRMTKVHKLIAGSLLVGSLAGGLG
FT                   LGAGRAAADPPPPPPMPPPPPLVWAPPTPESEPPEAPPAAELPPPPSG"
FT   gene            complement(631589..633100)
FT                   /locus_tag="MAV_0650"
FT   CDS_pept        complement(631589..633100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0650"
FT                   /product="acyl-CoA synthase"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68961"
FT                   /db_xref="GOA:A0A0H3A1K5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR030310"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1K5"
FT                   /protein_id="ABK68961.1"
FT                   /translation="MELSDDLTVTELLVPLTEIDDRGVYFEDSFTSWRDHLQHGAAIAA
FT                   ALRARLDPARPPHVGVLLENTPFFSAVLVAAGMSGIVPVGLNPVRRGDALRRDIARADC
FT                   QLVLADANSAGTLGDIEHLNVDSAAWADEVAAHRGAPIVFRSASPADLFMLIFTSGTSG
FT                   EPKAVKCSHGKAAIAGVTMTQRFGLGRDDVCYVSMPLFHSNAVLVGWAVAAACQGSMAL
FT                   RRKFSASGFLPDVRRYGATYANYVGKPLSYVLATPERPDDAQNPLRAVYGNEGVPADIE
FT                   RFARRFGCVVQDGFGSTEGGVAIARTPDTPPGSLGPLPAGIDIVDPDTGASCPPGVVGE
FT                   LVNTAGPGRFEGYYNDEAAEAERMAGGVYHSGDLAYRDEAGYAYFAGRLGDWMRVDGEN
FT                   LGAAPIERVLLRHPDVTEVAVYPVPDPTVGDQVMAALVLAPGAEFDDEKFRAFLAEQPD
FT                   LGPKQWPSYVRISTELPRTVTFKVLKRQLAAQGVDCGDPVWKIGR"
FT   gene            complement(633106..634203)
FT                   /locus_tag="MAV_0651"
FT   CDS_pept        complement(633106..634203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0651"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64706"
FT                   /db_xref="GOA:A0A0H2ZSS8"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSS8"
FT                   /protein_id="ABK64706.1"
FT                   /translation="MDFTTTEAAHDLGNLVDTIVDSVCTPEHQRELDGLDQRFDRDLWA
FT                   KLIDAGILSSASATSLGGDGFGALEQIAILVALGHQLAAVPYLESVVLGAGALARFGTE
FT                   ELQQGWGVPAVSGEKTLTVALDPEMGEGPVQAVSAGAGYRLTGTRTQVGFGPVADAFLV
FT                   PAETDSGTAVFLVAADDPGVTVTALETTGLGSVGHLALDGTQVDGTRQVGGAEVAAWLG
FT                   TLGTLGRAAFQLGVLERGLQMTAEYARTREQFDRPIGSFQAVSQRLADGYIDVKGLRLT
FT                   LTQAAWRVSEDLPAEVDVATAAFWAADAGHRVAHTIVHVHGGVGVDTDHPVHRYFLAAK
FT                   QAEFALGGATGQLRRIGRELAETPA"
FT   gene            complement(634233..635411)
FT                   /locus_tag="MAV_0652"
FT   CDS_pept        complement(634233..635411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0652"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF02771; match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67884"
FT                   /db_xref="GOA:A0A0H3A0D6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0D6"
FT                   /protein_id="ABK67884.1"
FT                   /translation="MRISYTPEQEDLRRELRSYFTKLMTPERREALSSTQGEYGVGNVY
FT                   RETVAQMGKDGWLTLNWPKEYGGQDRSPMDSLIFTDEAAIAGAPVPFLTINSVAPTIMA
FT                   FGTDEQKKYFLPKIAAGELHFSIGYSEPGAGTDLANLRTTAVRDGDDYVINGQKMWTSL
FT                   IAYADWVWLAVRTNPEAKKHRGISMLVVPTTAEGFSWTPVHTMAGPDTSATYYSDVRVP
FT                   VTNLVGEENGGWKLVTNQLNHERVALVSPAPIYLALREVREWAQNTKDASGARLIDSEW
FT                   VQINLARVHAKAEVLKLINWELASSDGHALGPADASAAKVYGTELATEAYRLLMEVLGT
FT                   GATVRQDSPGALLRGRVERMHRACLILTFGGGTNEVQRDIIGMVALGLPRNR"
FT   gene            635625..635816
FT                   /locus_tag="MAV_0653"
FT   CDS_pept        635625..635816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0653"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68293"
FT                   /db_xref="GOA:A0A0H2ZZR8"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZR8"
FT                   /protein_id="ABK68293.1"
FT                   /translation="MRVIVDRDRCEGNAVCLGIAPDIFDLDDEDYAVVKLDPIPADQEQ
FT                   LAEQAIAECPRAALSRGD"
FT   gene            635898..636767
FT                   /locus_tag="MAV_0654"
FT   CDS_pept        635898..636767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0654"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family protein"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67452"
FT                   /db_xref="GOA:A0A0H2ZYI7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZYI7"
FT                   /protein_id="ABK67452.1"
FT                   /translation="MVTGAAAGLGRAEALGLARLGATVVVNDIATALDASDVIDEINAA
FT                   GSKAVAVAGDISERATADELVAQADGLGGLDIVVNNAGITRDRMLFNMSDEEWDLVIAV
FT                   HLRGHFLLTRNAAAYWRSRAKEAGGRIFGRIVNTASEAGLVGPVGQANYGAAKAGIISL
FT                   TLTAARALGRYGVCANAICPRARTAMTADVFGDAPEVPAGGVDPLSPEHVVNLVTFLSS
FT                   PAAAEVNGQVFIVYGPQVTLVAAPTAEHKFSAQGPAWDPAELSATLQDYFAGRDPEHNF
FT                   SASALMEQ"
FT   gene            637004..637768
FT                   /locus_tag="MAV_0655"
FT   CDS_pept        637004..637768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0655"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02405"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67847"
FT                   /db_xref="GOA:A0A0H3A1F6"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A1F6"
FT                   /protein_id="ABK67847.1"
FT                   /translation="MIEQLAVPARAVGGFFEMMIDTGRAAFRRPFQFGEFLDQTWMIAR
FT                   VSLVPTLLVSIPFTVLVAFTLNILLREIGAADLSGAGTAFGTITQLGPVVTVLVVAGAG
FT                   ATAICADLGARTIREEIDAMRVLGIDPIHRLVVPRVLASTVVALLLNGLVCAIGLSGGY
FT                   VFSVFLQGVNPGAFINGLTVLTGLRELVLAEVKALLFGVMAGMVGCYRGLTVKGGPKGV
FT                   GNAVNETVVYAFICLFVINVVMTAIGVRISAK"
FT   gene            637788..638630
FT                   /locus_tag="MAV_0656"
FT   CDS_pept        637788..638630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0656"
FT                   /product="ABC-transporter integral membrane protein"
FT                   /note="identified by match to protein family HMM PF02405"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66018"
FT                   /db_xref="GOA:A0A0H2ZW09"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW09"
FT                   /protein_id="ABK66018.1"
FT                   /translation="MSYDATLRFRRWFSRLQEPVDDFGEQALFYGQTMRYVPNALTRYR
FT                   KETIRLIAEMTMGAGALVMIGGTVGVAAFLTLASGGVIAVQGYSSLGNIGIEALTGFLS
FT                   AFLNVRVVAPVIAGIALAATIGAGATAQLGAMRVSEEIDAVECMAVHSVSYLVSTRLIA
FT                   GLIAIVPLYSLSVLAAFFAARFTTVYINGQSKGLYDHYFNTFLIPSDLLWSFLQAIVMS
FT                   IAVMLVHTYYGYNAHGGPVGVGIAVGQAVRTSLIVVVVITLFISLAVYGASGNFNLSG"
FT   gene            638700..639854
FT                   /locus_tag="MAV_0657"
FT   CDS_pept        638700..639854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0657"
FT                   /product="virulence factor Mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66905"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWF9"
FT                   /protein_id="ABK66905.1"
FT                   /translation="MLAGLMVAFAVLTYLSYTAAFAPIDTVTVSAPRAGLVMEQGAKVK
FT                   YRGIQIGKVEAIEYSGDQARLTLGINSKDMHFIPSNATVHIAGNTIFGAKAVEFIPPQT
FT                   PSPTSLRPDAHVAATSVQLEVNTLFQSLIDLLHKIDPVELNGTLSAFSEGLRGHGDDLG
FT                   GILSGLNTLTRQANPKLPALQEDFRRTAVVSNVYADAAPDLNTVFDNLPTINKTVVDQQ
FT                   KNLDTTLLATIGLANNAYDTLAPAEQDFIDTINRVRAPLKVAADYSPEFGCLFAGIERG
FT                   IKEFAPLLGVRKAGLFTSSSFVLGAPSYTYPESLPIVNASGGPNCRGLPDIPTKQTGGS
FT                   FYRAPFLVTDNANIPYEPFTELQVDAPSTLQFLFHGAFAERDDF"
FT   gene            639854..640906
FT                   /locus_tag="MAV_0658"
FT   CDS_pept        639854..640906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0658"
FT                   /product="virulence factor Mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65632"
FT                   /db_xref="GOA:A0A0H2ZVC5"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVC5"
FT                   /protein_id="ABK65632.1"
FT                   /translation="MAGSGMPSHRSMVIKVSIFAAAMLLVSAGLVVVFGDFRFGPESTY
FT                   HATFVDVSRLKAGQKVRIAGVPVGAVEAVKLNRDNTIDVTFGVDKRYTLYSSTRAVIRY
FT                   ENLVGDRYLEITSGPGELRKLPAGGTINSQHTQPALDLDALLGGLRPVLKGLDADKVNT
FT                   ISSAVIQLLQGQGGALSNVLADTSAFTSALGQRDQLIGDVINNLNTVLTTVDQRSAQFS
FT                   ASVDQLQQLITGLAKHKDDIAGAIPPLASTTTDLTELLQNSRRPLQGVLENTRPLATEL
FT                   DNRKAEVNNDVEQLGEDYLRLAALGAYGSFFNIYFCSVTIKINGPAGSDILLPLGGQVD
FT                   PSKGRCAFVK"
FT   gene            640896..641960
FT                   /locus_tag="MAV_0659"
FT   CDS_pept        640896..641960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0659"
FT                   /product="virulence factor Mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66354"
FT                   /db_xref="GOA:A0A0H2ZXG7"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXG7"
FT                   /protein_id="ABK66354.1"
FT                   /translation="MSSNAPRERDPLRTGIFGVVLVVCVVLIAFGYAGLPFWPQGKIYD
FT                   AYFTDAGGINPGNAVYVSGLKVGKVTDVGLAGDSAKISFSVDRHVAVGDQSLAAIRTDT
FT                   ILGERSIAVTPAGGGKATTIPLSRTTTPYTLAGALEDLGSNASNLNKPQFEQALHVLTD
FT                   TLHDATPELRGALDGVTSLSRALDRRDEALQSLLVHAKSVTGVLSQRAEQVNKLVDDGN
FT                   ELFAALDERRAALGRLISGIQGLSAQISGFVADNRKEFGPALNKLNDVLANLNERRDYI
FT                   TEALKRLPTYATELGEVVGSGPGFNVNVYGVIPAPLLATMFDFFYQPGKMPASLADYLR
FT                   GLIQERWIIRPKSP"
FT   gene            641957..643384
FT                   /locus_tag="MAV_0660"
FT   CDS_pept        641957..643384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0660"
FT                   /product="virulence factor mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64637"
FT                   /db_xref="GOA:A0A0H2ZQY8"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZQY8"
FT                   /protein_id="ABK64637.1"
FT                   /translation="MMQRLAGSRGLRYTTIIALVAVLVGGVYVLTSQAKTRKIVGYFTS
FT                   AVGLYPGDQVRVLGVPVGTIDTIDPRPTDVKITMSVSQDVKVPKDAKAIIMSPNLVAAR
FT                   FIQLTPAYTGGPVLADGASIGLDRTAVPVEWDEVKQSLTQLAVQLGPTAGSMQGPLGAA
FT                   INQAADTFDGKGESFHSALRELSQAAGRLGDSRGDIFGTVKNLQILVNALSSSNEQIVQ
FT                   FAGNVASVSQVLADSSRHLDTTLGTLNKALSDIRGFLHENNSTIVDTVNNLNDFAKTLS
FT                   DQSDNIEQVLHVAGPGIANFYNIYDPAQGTLNGLLSIPEFANPVQFICGGSFETAGGPR
FT                   APDYYKRAELCRERLGPVLRRLTVNYPPLMFHPLNTITAYKGQIIYDTPETQAKSATPV
FT                   PQLTWIPAKGAQTPPAVQNPADLQALLVPTAPQSGPAPAGGAPAPGPAPGSAFGPRPGP
FT                   PPGQAPGGLGADLGGGG"
FT   gene            643390..644535
FT                   /locus_tag="MAV_0661"
FT   CDS_pept        643390..644535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0661"
FT                   /product="virulence factor Mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66524"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVY4"
FT                   /protein_id="ABK66524.1"
FT                   /translation="MWLRAGGLATGSMLLAGCQFGGLNSLAMPGTAGHGSGAYSITVEL
FT                   PDVATLPQNSPVMVDDVTVGSVAGISAEQRSDGSFYAAVKLALDKNVVLPANSTATVAQ
FT                   TSLLGSMHIDLNRPKDRPAVGRLTDGSKIAEANTGRYPTTEEVLSALGVVVNKGNVGAL
FT                   EEITDETYRAVAGRQDQFVDLVPRLAELTSGLNRQVNDIIDAVDGLNRFSASLARDKDN
FT                   LGRALDTLPEAIRVLNKNRDHIVEAFSALHKLADVTSHILAKTKVDFAADLKDLYAAVK
FT                   ALNDNRRNFVTSLQLLLTFPFPNFGIKQAVRGDYLNVFTTFDLTLRRLGETFFTTAYFD
FT                   PNMAHMNEILNPPDFLVGEMANLSGQAADPFKIPPGTASGQ"
FT   gene            644548..646153
FT                   /pseudo
FT                   /locus_tag="MAV_0662"
FT                   /note="virulence factor mce family protein, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   RF:NP_854269.1"
FT   gene            646286..647017
FT                   /locus_tag="MAV_0663"
FT   CDS_pept        646286..647017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0663"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65364"
FT                   /db_xref="GOA:A0A0H2ZSJ9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZSJ9"
FT                   /protein_id="ABK65364.1"
FT                   /translation="MDPAGADAAAADQPTSRPRARRRASRAAGPAKSESTQAVTVATEV
FT                   AAPAPAPKPSAKSGKTLKSLKPPPRRQPHRTLVAWISFAAAVLAVGALAGGVAVLFVQQ
FT                   RDAQAKQSRDQRFVDTATQTVVNMFSYKQDNIDESVNRFVNGTSGPLRGMLSANNNVEN
FT                   LKGLFRSTNATSEAVVNGAALEGVDAVTDNASVLVSVRVTVADIDGVNKPSMPYRLRVI
FT                   VHEDDAGRMTGYDLKYPDGGN"
FT   gene            647017..647508
FT                   /locus_tag="MAV_0664"
FT   CDS_pept        647017..647508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0664"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68917"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3P9"
FT                   /protein_id="ABK68917.1"
FT                   /translation="MRWRRRLLVAAGYLLAVAFVGLSAVAGAMYWDRVQTRGEQAARAV
FT                   LPGLAAKEIPEVFAYDYQTVERSLSAAYPLLTPDYRAEFQKSVNNQIIPEAKKREVVVQ
FT                   ANVVGVGVMSAQRDSASVMVYMNRTVTDKSRQPLYDGSRLRVDFKKIGKQWLIAYITPI
FT                   "
FT   gene            complement(647521..648099)
FT                   /locus_tag="MAV_0665"
FT   CDS_pept        complement(647521..648099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0665"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69461"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A680"
FT                   /protein_id="ABK69461.1"
FT                   /translation="MKLRHGLAAGAAVVMAVGTGLAVQSGQPAKAVGPPADGTYNYNEA
FT                   GVSGVTWTISALCDQPSGTRNMNDYSDPIVFAFNCALNIVSSTPEQISAADKLQNFSGR
FT                   ARMSSMLWTFKVQKDNGVSCPGGGTAPTTETYAFSDETMSGTHTTLHGAVCGLQPEMKK
FT                   QPFSLQMTGPPPSPIERYPLYCNGIAMCY"
FT   gene            complement(648192..649670)
FT                   /gene="otsA"
FT                   /locus_tag="MAV_0666"
FT   CDS_pept        complement(648192..649670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsA"
FT                   /locus_tag="MAV_0666"
FT                   /product="UDP-forming alpha,alpha-trehalose-phosphate
FT                   synthase"
FT                   /EC_number="2.4.1.15"
FT                   /note="identified by match to protein family HMM PF00534;
FT                   match to protein family HMM PF00982"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67904"
FT                   /db_xref="GOA:A0QAK7"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QAK7"
FT                   /protein_id="ABK67904.1"
FT                   /translation="MAPGGGRGSKTASYGNSDFVVVANRLPVDQERLPDGSTAWKRSPG
FT                   GLVTALEPLLRRQRGAWVGWPGIVDEDVDHEDDPIVQDDLELRPVKLSADDVAEYYEGF
FT                   SNATLWPLYHDVIVKPIYHREWWDRYVAVNRRFAEATSRAAARGATVWVQDYQLQLVPA
FT                   MLRELRPDLTIGFFLHIPFPPVELFMQLPWRTEIVKGLLGADLVGFHLTGGAQNFLFLS
FT                   RRLIGANTSRGAVGVRSRYGEVELESRVVRVGAFPISIDSTALDQTARHRDIRRRAREI
FT                   RAELGNPRKVLLGVDRLDYTKGIDVRLKAFSELLAEGRAKRDDTVLVQLATPSRERVDS
FT                   YQQLRNDIERQVGHINGEYGEVGHPVVHYLHRPVPRNELIAFFVAADVMLVTPLRDGMN
FT                   LVAKEYVACRSDLGGALVLSEFTGAAAELRQAYLVNPHDLEGVKDTVEAALNQSVEEGR
FT                   RRMRSLRRQVLAHDVDRWARSFLDALAESGPRDG"
FT   gene            complement(649671..649835)
FT                   /locus_tag="MAV_0667"
FT   CDS_pept        complement(649671..649835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0667"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67214"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZZM5"
FT                   /protein_id="ABK67214.1"
FT                   /translation="MPTKSDPGEIGDVEPVADSTASQARRVVAAYANDADECRVFLSML
FT                   GIGPAKLDT"
FT   gene            649968..650672
FT                   /gene="pstB"
FT                   /locus_tag="MAV_0668"
FT   CDS_pept        649968..650672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="MAV_0668"
FT                   /product="ABC transporter, ATP-binding protein PstB"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65904"
FT                   /db_xref="GOA:A0A0H2ZTW9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZTW9"
FT                   /protein_id="ABK65904.1"
FT                   /translation="MLQDERVTAEEPVFEFVDVVVERRGLRALDGLTAAIPGRGVTAVF
FT                   GPSGSGKSTLLRLCNRLELPTSGRVSFYGSDIAGLDPLWLRRRVGMCFQRPTPFPGTVA
FT                   DNLRVADPDADEARMRETLDRVALTGAWLDRDVLALSGGEAQRVCLARTLMARPQVLLL
FT                   DEPTSAVDAEAAEVIERAVRELAADGTPALWVTHDAAQVTRAADRVLRLERGRSLGLSQ
FT                   VGGGPDDGAVPR"
FT   gene            650669..651451
FT                   /locus_tag="MAV_0669"
FT   CDS_pept        650669..651451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0669"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03649;
FT                   match to protein family HMM TIGR00245"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65226"
FT                   /db_xref="GOA:A0A0H2ZU76"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZU76"
FT                   /protein_id="ABK65226.1"
FT                   /translation="MNGQVGWLGLATSLILVAFAGAISLWRRLGLERQLLWAASRALVQ
FT                   LLLVGGALTLLFEPGRSLWWSWAWVAGMVGYAGDVARRRAPEVPRFAPLAVAAFAAAAV
FT                   VTLGVLFGLRVFPLQGRTLVPVAGMMIGNSMTAMVLVARRLVDELRDKRDEVEARLALG
FT                   QPSGQAASPYLRIALRSAISPQIETTKATGLVFLPGAMTGLILAGVPPLQAVLVQAVVM
FT                   FLILGSVAATTVVVALGIVRLVFTRDHRLRPLDQRPPD"
FT   gene            651534..652469
FT                   /locus_tag="MAV_0670"
FT   CDS_pept        651534..652469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0670"
FT                   /product="enoyl-CoA hydratase"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67110"
FT                   /db_xref="GOA:A0A0H2ZXL2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZXL2"
FT                   /protein_id="ABK67110.1"
FT                   /translation="MTLSEQAGAQPGARPAEELVTYETLDEGRIARIWLNRPDAHNAQS
FT                   RGLLVQLDEAFVRAEADDAVRVVILAARGKNFSAGHDLGSELALAERQPGPGQHPTFRF
FT                   NGATRDPIAEKTYLQEWHYFFQNTCRWRDLRKITIAQVQGNAISAGLMLIWACDLIVAA
FT                   DNAKFSDVVGVRMGMPGVEYYAHPWEFGPRKAKELLLTGDALDADEAYRLGMVSKVFPA
FT                   DELADKTLEFARRIAERPTMAALLIKDSVNAASDAMGFTEALRHAFHIHELGHAHWAAH
FT                   NENRYPVGLPPDVEDWRNAKPTRLARRDTP"
FT   gene            652560..653405
FT                   /locus_tag="MAV_0671"
FT   CDS_pept        652560..653405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0671"
FT                   /product="short chain dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66370"
FT                   /db_xref="GOA:A0A0H2ZX47"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZX47"
FT                   /protein_id="ABK66370.1"
FT                   /translation="MQLSFQDRTYLITGGGSGIGKGVAAGLVSAGASVMIVGRNPDRLA
FT                   GAVEEIAPLADRAGNGGAIRYEPTDVTNEDEVVRAVDAATAWHGRLHGAVHCAGGSLTV
FT                   GPITHTDSEAWRNTVDLNVNGTMYVLKHVGRELVRGGGGSFIGISSIAASNTHRWFGPY
FT                   GVTKSAIDHMMMLAADELGESWVRVNSIRPGLIRTDLVDASVIQSPEISADYAQCTPLP
FT                   RVGEVEDVANLAMFLLSDAAGWITGQCINVDGGHMLRRGPDYSSMMVQMFGQDALRGVV
FT                   "
FT   gene            653420..654211
FT                   /locus_tag="MAV_0672"
FT   CDS_pept        653420..654211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0672"
FT                   /product="oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68218"
FT                   /db_xref="GOA:A0A0H3A297"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A297"
FT                   /protein_id="ABK68218.1"
FT                   /translation="MKRLEGKRILVTGAASGIGQATALRLLDEGAAVAASDVAVDGLER
FT                   TRDRAAQAGTAERLVTVTMDVGREDAVVDGVRVAVEQLGGLDSLVNAAGMLRAAHTHQT
FT                   SLQLWNQIIGVNLTGTFLVVREALPALLDNARSAVVNFSSTSASFAHPYMAAYAASKGG
FT                   IQAFTHSLALEYARRGLRAVCVAPGSIKSGITDATGGYIPEDADWSLFSRLLPVLPTTV
FT                   ESSGTGMAEPTAVAGVIAMLVSDDGAFITGTEIRIDGGTHA"
FT   gene            complement(654216..655781)
FT                   /locus_tag="MAV_0673"
FT   CDS_pept        complement(654216..655781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0673"
FT                   /product="cell envelope-related function transcriptional
FT                   attenuator domain protein"
FT                   /note="identified by match to protein family HMM PF03816;
FT                   match to protein family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67514"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0L2"
FT                   /protein_id="ABK67514.1"
FT                   /translation="MMARSGGAHRRHRAVRQPSRFRKGLTRTLGALVSVAAIGLTGAGY
FT                   YVAHGALGGITVSNALQPDDPRSSGDNMNILLIGLDSRKDQDGNDLPYSILKHLHAGDS
FT                   DDGGYNTNTLILVHVSADNKVVAFSIPRDDWVPFSGVPGYNHIKIKEAYGLTKQYVAQK
FT                   LANQGTSSQKELETKGREAGRAATLRAVRNLTGVPIDYFAEVNLAGFYDLAQTLGGVEV
FT                   CLNHPVYDSYSGADFPAGRQRLDASEALSFVRQRHGLDNGDLDRTHRQQAFISSVMQEL
FT                   QAAGTFTNIDKLKNLMAVARKDVVLSAGWTDDMIQRLGGLAGGNIEFRTLPVVRYDNID
FT                   GQDVNIVDPAAIKAEVAAAIGADAPTSAPTSTSVAPDPSTVVDVVNSGSMSGLASEVSH
FT                   ALKKRGYTTGQVRDRESGDPAATTIEYGAGAQNDARNLANLLSLDAPNQPSPSIAPGHI
FT                   RLTVDTNFTMPTTDDTQLDDTTSTSSTTTSSKAKTYYYNGTTTTYPTPDQGKPIDGGGV
FT                   PCVN"
FT   gene            complement(656090..656332)
FT                   /locus_tag="MAV_0674"
FT   CDS_pept        complement(656090..656332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0674"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A2T8"
FT                   /protein_id="ABK68317.1"
FT                   /translation="MHRIPLTIGIAVVVLLAALAAPIKQRCGAPGLSCASTLDTEGNAH
FT                   YYYEVEPVGVYLAEIVTGSNIALFYQSGEDLVKAR"
FT   gene            656510..656686
FT                   /locus_tag="MAV_0675"
FT   CDS_pept        656510..656686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0675"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65582"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUX9"
FT                   /protein_id="ABK65582.1"
FT                   /translation="MRAEEGDESVKDYAKESRETLGRIKASQHGGGRLGAIARRFARLW
FT                   RGPRGPEDAGPAR"
FT   gene            complement(656711..658189)
FT                   /locus_tag="MAV_0676"
FT   CDS_pept        complement(656711..658189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0676"
FT                   /product="6-aminohexanoate-cyclic-dimer hydrolase"
FT                   /note="identified by match to protein family HMM PF01425"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64983"
FT                   /db_xref="GOA:A0A0H2ZT69"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZT69"
FT                   /protein_id="ABK64983.1"
FT                   /translation="MALDATALAGLVADKQVTPAELLALARQRADAVNPRLNAIVCRLD
FT                   DVADRQAADPNLSGPFAGVPFLLKDLGQEYRGFPTSCGSRSLANDVADRHALVTQRFLD
FT                   AGLVIFGKTNTPEFGAKGVTEPDYWGPARNPWDTERTPGGSSGGSGAAVAAGIVPAAGA
FT                   NDGGGSIRIPAACNGLVGLKPSRGLAPYGPQTGELMLGMATQGVVTRTVRDSAALLDAI
FT                   IGHHPDASYRVALPDKPFAQQITRPPGPLTIGYSARSALNPRPDREAVAAVENSAALLS
FT                   ALGHRVREVAPPYDDAALGRDFLTIWFAQLHQQVADIRRRTGARDNDFEADTLAISELG
FT                   RSGGVLPVMSALENRNTYIQSLAAFHEGYDFFLTPTLATPPLVVGATSTSAALQRAARL
FT                   VSRVRGGKLMRLSGILDDLIRESLGWVPYTQLANLTGRPAISVPLHWTDDGLPLGVQFV
FT                   GKLGADGDLLQLAAQLEQARPWAQRHPAPVTPPN"
FT   gene            658269..659138
FT                   /locus_tag="MAV_0677"
FT   CDS_pept        658269..659138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0677"
FT                   /product="hydrolase, alpha/beta fold family protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66698"
FT                   /db_xref="GOA:A0A0H2ZY39"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZY39"
FT                   /protein_id="ABK66698.1"
FT                   /translation="MAAEPFTIRGPGGVQIVADRLGDPRARAVVFLHGGGQTRRSWGKA
FT                   AAAVAARGWQAVTVDLRGHGESDWSGDGDYRVVSFAADVQAVLGTLPPKPVLVGASLGG
FT                   FTSMLLAGELSPGIASAVVLVDIVPNMDQSGANRIHAFMADRVDSGFASLDEVADAIAE
FT                   YNPHRPRPTDLEGLTTNLRRRGDRWYWHWDPQFISGTAAFPPFEVTDPDRMHAAVEAIL
FT                   RDGVPILMIRGQMSDLVSQERADEFLARFPQVEFTDVRGAGHMVAGDRNDVFADAVLDF
FT                   LARHLDVE"
FT   gene            659221..659889
FT                   /locus_tag="MAV_0678"
FT   CDS_pept        659221..659889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0678"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66147"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUV3"
FT                   /protein_id="ABK66147.1"
FT                   /translation="MTVSWLRGSGLVGAVLVAATAVAKTAGAAPPPALPAPPPSPGIGV
FT                   DHENGRCTAGFAAQGSDGSYYLMTSGHCDAHDGAEWTYGNDAPLGRISASEHEGDKRDA
FT                   AIIRLEPSVGMPVGDVGGRYQVRDVLSRPQIQVGMPFCKIGAVTGETCGAIKGVDGDVV
FT                   EASVFSLDGDSGSPGFVMNPDGSVSAVGLLMSSPDGDDYTTYFMLVNPLLDRWGLRILP
FT                   "
FT   gene            660045..660491
FT                   /locus_tag="MAV_0679"
FT   CDS_pept        660045..660491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0679"
FT                   /product="lipoprotein LpqH"
FT                   /note="identified by match to protein family HMM PF05481"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66326"
FT                   /db_xref="GOA:A0A0H2ZWY1"
FT                   /db_xref="InterPro:IPR008691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWY1"
FT                   /protein_id="ABK66326.1"
FT                   /translation="MAGVALVIGASAGCSSNKSNTGASGSSGAPVAAAPQLIVDGQTQN
FT                   VSGQVTCTTNGDKTTIGIGDPTAGLGAVVSNGNPPLVHSVGLGTVNGVALGFSDAAPNQ
FT                   GGNAGAAVNGKTWAIKGTATGVDMSNPQQPQQVTKSFELDATCP"
FT   gene            660541..661500
FT                   /locus_tag="MAV_0680"
FT   CDS_pept        660541..661500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZS80"
FT                   /protein_id="ABK64479.1"
FT                   /translation="MVGAAAVAAGLGISAASLNAGSAYSAPLDPPPPCPNCHGGGGNPG
FT                   GPGGGPGGQPAGPGGGAGGQHGGNTPPQGGQNNPPQNGPNNAPQNGPNNAPQSGPNNPS
FT                   QGGPNNAPQNGPNNPPQGGQNEPGGQYPPNQHGQNPPQNGQNQPPYDHDQNPPTPGGPT
FT                   NAPANTQNPPPPPERQRYAALNPPNTQPPHPPYVPRHDVVTASAQIGGPAGADVQFSIV
FT                   GRGAPPPPREHGYGWNDGPPPHHPPPNWYGPPPPGGWDGPPPPGGWNRPWDGPPRDVAV
FT                   ARADFGPFSYNTFTVIPVFNWQYGGWGYWFFGVWVPLY"
FT   gene            complement(661507..662448)
FT                   /locus_tag="MAV_0681"
FT   CDS_pept        complement(661507..662448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0681"
FT                   /product="transglycosylase SLT domain protein"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65241"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZU26"
FT                   /protein_id="ABK65241.1"
FT                   /translation="MSNRRTAPLVAAAVLVALAGCSPSHPSAAPRPTATRTAAPSAPAS
FT                   RMVPADADTPGGAQPRLASDPAQLGDDLVADERALRDPGTSEPALTAAAHREQAAYRAI
FT                   ARHPEWEAAARGRIPAELIDVYDRNVDARRQLTALTPVRNTLPAWRIEPPAPADELLGY
FT                   YHQAEAESGVGWNYLAAINFIETRFGSIVGASTAGAQGPMQFLPSTFAGYGQGGDIHSP
FT                   RDSILAAGRYLAANGFAADRDHAIYAYNHASEYVRAVDQYAALMAADPATFAAYYRWDV
FT                   YCFTTAGDVLLPIGYDASSPIPAADYVAAHPQ"
FT   gene            662589..663338
FT                   /locus_tag="MAV_0682"
FT   CDS_pept        662589..663338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0682"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05305"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68386"
FT                   /db_xref="GOA:A0A0H3A312"
FT                   /db_xref="InterPro:IPR007969"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A312"
FT                   /protein_id="ABK68386.1"
FT                   /translation="MRDRETIDAELRRIALARRSIHRQGGQPSSREVDELLDELLAHSA
FT                   GQAVPDQAASQETAAAATPRRHGGALHRAGLLAALPLSLIAVAAAAVMIFFVHQRDSTA
FT                   PATEPAPSAAPPKAAAPKPPAPRIEMADMAFIAALKHEGVPVPSQDYVMKQGHAVCDFL
FT                   AQQHNFADAIGFVQRSSIWNAEQSAEVTAGAIVAYCPQSQATAADLTGPAYQNTLSDLQ
FT                   AIEGKLQGIEGDLQGIQRDLDNIPGHR"
FT   gene            663446..665344
FT                   /locus_tag="MAV_0683"
FT   CDS_pept        663446..665344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0683"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69293"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A5U1"
FT                   /protein_id="ABK69293.1"
FT                   /translation="MFDAVRWRLSAGAMAVAVTVAACCAPSEPADPCMVASGAADESQG
FT                   MDAMAMATEACPLVRLTENDPDPPLYPYLGSAHWHVPWAQEYFDQGLRFYFGFNNREAY
FT                   RAFKKAARDAEDNDIACSACYWAQALVLGVDLNMPRELEPDRDAANNALRRAARQKPNG
FT                   EDDKIIAALTGRYRDCPKTDDPRKCQAGRNQAYYDGMKAVVDEFGRDDPNVITLFADAA
FT                   MNMTPWAYWKDGNPVSPRTTQAREYLEKALELSQYPPNEGPIHWYIHLMEQSRTPGAAG
FT                   KYADRLAALAPNSGHLVHMPSHIYYRMGDMPKAIRANKEAIDADERYFATEPHLYRPDG
FT                   DRYRYGYYLHNIHFVIAAAALSGDDDEHDVNRYADKLLQWLPDNASGFRADVYRSAYYL
FT                   AKINFSSTADIRGFDPPSPFNQQPLATIAYDFARLMADIWDKNNSPHWLDTLDGDVARY
FT                   RQHATASGKQNADCDPRLELPKPELCLAAILRDLGHARASAAKADWGAAADVANEAVDI
FT                   QDKLPYDEPPLWPYPVRQTLASILIRRAIAAGNPMERVLHLAAAKELLLKSLNEGKGDD
FT                   PEQTPIGTYPGNGWAYYGLLEIATRDGSPPEVVKAADAELARHWFGGTGYRNLDRL"
FT   gene            665979..666155
FT                   /locus_tag="MAV_0684"
FT   CDS_pept        665979..666155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0684"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0N3"
FT                   /protein_id="ABK68025.1"
FT                   /translation="MYVRGWQRLNGSIEREIVVHELHADHGLTIQHARQVARALIAAAD
FT                   EAEAAAALDGGAR"
FT   gene            666235..666525
FT                   /locus_tag="MAV_0685"
FT   CDS_pept        666235..666525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0685"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0X4"
FT                   /protein_id="ABK68691.1"
FT                   /translation="MCDDETMIVPTPTAAAPELAWSRDDGNVWAYPAAPWWDKLRQRIT
FT                   DFFHPFPDEARVAEMDDYDDTVGDADDADDDVSSRSRFPMRRGRLACRGLT"
FT   gene            666932..667069
FT                   /locus_tag="MAV_0686"
FT   CDS_pept        666932..667069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0686"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68134"
FT                   /db_xref="InterPro:IPR007969"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A294"
FT                   /protein_id="ABK68134.1"
FT                   /translation="MCGYLEAGHSRDEATQQVLANDPTFTPWQASGMVNASTAAYCPDQ
FT                   "
FT   gene            complement(667197..667901)
FT                   /locus_tag="MAV_0687"
FT   CDS_pept        complement(667197..667901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0687"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66112"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZWB7"
FT                   /protein_id="ABK66112.1"
FT                   /translation="MRLAYVDETYTDDQFWVIALVIPESGAKELEVALNAVVQRAHTRF
FT                   DEVDSAAELHGYPLDAGTHDWAPLRGKSQARVDIFKEAITAICGVDDVYLFRACVDLAK
FT                   LSWGKNHDAHDWALKFLFEKIDREFHGKELVLAVCDDVGQREKYREAFSRFKRDGTGGN
FT                   QPRTLEAFLDALHFVPSHHSRLVQAVDLASYVFRRAFIAVPSHARSAKFYKDLWNQLDN
FT                   SVTHRYRIWPYS"
FT   gene            668425..668691
FT                   /locus_tag="MAV_0688"
FT   CDS_pept        668425..668691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0688"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABK65735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZVL7"
FT                   /protein_id="ABK65735.1"
FT                   /translation="MIKKLSGTGEDGIVDVGSLLSQQQETLARELVGVFVLQAWHTSGS
FT                   ATYLSVHATEGGAEQRATQVATAWGVDLDQLDYTVTQRPVEQP"
FT   gene            668925..669836
FT                   /locus_tag="MAV_0689"
FT   CDS_pept        668925..669836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0689"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69428"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A4V6"
FT                   /protein_id="ABK69428.1"
FT                   /translation="MTPEMVSESEYMSIEFPPSAPNAPSIQFLLKITERIVNLSRETLS
FT                   FTTVPVEDTIHPRPLPFEPPLQQYSNGDTKGFRHHWEKLDYVFGLPDPYVFPTIPLLED
FT                   DQVAVERYIRMCRRLAGFSVINHGSTLSVGSDADGVWHVHVVDPPSDESFLGTSAAFRQ
FT                   LHNDGEPASFINASNALFKAMKTLPEDQQTAIRGTVKQWRSARSKLQKHTLQTLTALKA
FT                   GNATLDNPVSYGNINPEELIRTFNYGDSLHFGSERSQLDDLLVDPRHEAYYRYAALSSI
FT                   IGLSHLYFGFAVLVDSAIGGMA"
FT   gene            complement(670093..670209)
FT                   /locus_tag="MAV_0690"
FT   CDS_pept        complement(670093..670209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0690"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABK64995"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZRR0"
FT                   /protein_id="ABK64995.1"
FT                   /translation="MSRAVEAGEDTVAGPLEMGATLHDGRPIDRQLDQPPRQ"
FT   gene            670441..670653
FT                   /locus_tag="MAV_0691"
FT   CDS_pept        670441..670653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0691"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66011"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZUH8"
FT                   /protein_id="ABK66011.1"
FT                   /translation="MGAPPAPGQSFQATTAAVNAVNAAIGVAAASFTARTQATVGGVTQ
FT                   AAGGYTAQEATAAGQMSNITGVTVV"
FT   gene            670654..671424
FT                   /locus_tag="MAV_0692"
FT   CDS_pept        670654..671424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0692"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A0B9"
FT                   /protein_id="ABK67862.1"
FT                   /translation="MPATLSQIQAWSTEHLIDAAAYWTQTADRWEDAFLTMRNQAQSIT
FT                   WHGAGGDALRQRTGADVSVVSGKADQLRQAAGIARNGASEISAAQRRVLYGVEDAQNAG
FT                   FTVGEDLSVTDTRSTSPAERAARQAQAEAFAADLRLRAEQLEAADTKAAGQITATAGDV
FT                   GNATFTPAHNGNGVQLVDFKQDGGPVCDDPDYNDRFFRKFMGRVGAGAAIGGLAGAPEA
FT                   GVGAIPGAIIGGAAGGIEAFIEGATESEPPKCGK"
FT   gene            671667..671786
FT                   /locus_tag="MAV_0693"
FT   CDS_pept        671667..671786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0693"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67356"
FT                   /db_xref="GOA:A0A0H3A070"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A070"
FT                   /protein_id="ABK67356.1"
FT                   /translation="MVNVIHGTWLGLICTGGLAELMGYNAYRAWFAKRHQSRQ"
FT   gene            672096..672372
FT                   /pseudo
FT                   /locus_tag="MAV_0694"
FT                   /note="transposase; this gene contains a frame shift which
FT                   is not the result of sequencing error"
FT   gene            672372..673288
FT                   /pseudo
FT                   /locus_tag="MAV_0695"
FT                   /note="transposase; this gene contains a frame shift which
FT                   is not the result of sequencing error"
FT   gene            complement(673526..673723)
FT                   /locus_tag="MAV_0696"
FT   CDS_pept        complement(673526..673723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0696"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF05930"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABK66020"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZW14"
FT                   /protein_id="ABK66020.1"
FT                   /translation="MSEISGLLSIPRTCEKLGDLGRSTVYDLINDGQLTKVNIGRRAFI
FT                   TADSVTAYLDRITLAAVTTA"
FT   gene            674161..674538
FT                   /locus_tag="MAV_0697"
FT   CDS_pept        674161..674538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0697"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ABK67815"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A079"
FT                   /protein_id="ABK67815.1"
FT                   /translation="MVAKPQGRGVRPADLRSIDLTNWIENVFSECIWHVDDSRQPQPQP
FT                   GSAIGRKAIRDAVKPGRQRISRELLELAADIYRKHIDGQPLKAVERELCVPQRTAARYI
FT                   EMCRADEYQILPPTTKGKRKA"
FT   gene            674613..675725
FT                   /locus_tag="MAV_0698"
FT   CDS_pept        674613..675725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAV_0698"
FT                   /product="site-specific recombinase, phage integrase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:MAV_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ABK68851"
FT                   /db_xref="GOA:A0A0H3A3L0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3A3L0"
FT                   /protein_id="ABK68851.1"
FT                   /translation="MRYQVTVDAGKAADGRRRQVRRRYRTENEAREGLAKITGGVVEGS
FT                   FVARSALTVEQACRDWLAGMHDIEPTTRAAYTHALKPLRERHGDMAVQQLTKSHLDQLV
FT                   TDLTTGKLDGQKRAWTANSINPMLNLVSRVLADLVRQGALARDVAAFVKRLKRPESKLT
FT                   TFTEEEVRQLLKHVENDRLGHAWHLALAGLRRGEICGLEWADVQLDDDRDAGTLTVAHN
FT                   RVSVGGRVHEKAPKTVRSARTLPLTPTLARMLKRAKALQAAERLRLGPHYLGDGVRVVV
FT                   DDSGRPYHPDTLSDFWRELCGDAKVRRIRLHDARHSCASLMHAQGVPIAVISAWLGHAD
FT                   PAFTMRTYVHAENDALNLAAASLQKVVTPS"
FT   gene            complement(675799..675873)
FT                   /locus_tag="MAV_0699"
FT   tRNA            c