(data stored in ACNUC7421 zone)

EMBL: CP000480

ID   CP000480; SV 1; circular; genomic DNA; STD; PRO; 6988209 BP.
XX
AC   CP000480;
XX
PR   Project:PRJNA92;
XX
DT   21-NOV-2006 (Rel. 89, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Mycobacterium smegmatis str. MC2 155, complete genome.
XX
KW   .
XX
OS   Mycolicibacterium smegmatis MC2 155
OC   Bacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae;
OC   Mycolicibacterium.
XX
RN   [1]
RP   1-6988209
RA   Fleischmann R.D., Dodson R.J., Haft D.H., Merkel J.S., Nelson W.C.,
RA   Fraser C.M.;
RT   ;
RL   Submitted (19-OCT-2006) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
DR   MD5; 1ffd47d1254607149948865204639198.
DR   BioSample; SAMN02603982.
DR   EnsemblGenomes-Gn; EBG00000994442.
DR   EnsemblGenomes-Gn; EBG00000994444.
DR   EnsemblGenomes-Gn; EBG00000994446.
DR   EnsemblGenomes-Gn; EBG00000994448.
DR   EnsemblGenomes-Gn; EBG00000994450.
DR   EnsemblGenomes-Gn; EBG00000994451.
DR   EnsemblGenomes-Gn; EBG00000994453.
DR   EnsemblGenomes-Gn; EBG00000994455.
DR   EnsemblGenomes-Gn; EBG00000994457.
DR   EnsemblGenomes-Gn; EBG00000994459.
DR   EnsemblGenomes-Gn; EBG00000994462.
DR   EnsemblGenomes-Gn; EBG00000994463.
DR   EnsemblGenomes-Gn; EBG00000994464.
DR   EnsemblGenomes-Gn; EBG00000994466.
DR   EnsemblGenomes-Gn; EBG00000994468.
DR   EnsemblGenomes-Gn; EBG00000994470.
DR   EnsemblGenomes-Gn; EBG00000994472.
DR   EnsemblGenomes-Gn; EBG00000994473.
DR   EnsemblGenomes-Gn; EBG00000994474.
DR   EnsemblGenomes-Gn; EBG00000994475.
DR   EnsemblGenomes-Gn; EBG00000994476.
DR   EnsemblGenomes-Gn; EBG00000994477.
DR   EnsemblGenomes-Gn; EBG00000994479.
DR   EnsemblGenomes-Gn; EBG00000994480.
DR   EnsemblGenomes-Gn; EBG00000994482.
DR   EnsemblGenomes-Gn; EBG00000994484.
DR   EnsemblGenomes-Gn; EBG00000994487.
DR   EnsemblGenomes-Gn; EBG00000994489.
DR   EnsemblGenomes-Gn; EBG00000994492.
DR   EnsemblGenomes-Gn; EBG00000994494.
DR   EnsemblGenomes-Gn; EBG00000994498.
DR   EnsemblGenomes-Gn; EBG00000994501.
DR   EnsemblGenomes-Gn; EBG00000994504.
DR   EnsemblGenomes-Gn; EBG00000994506.
DR   EnsemblGenomes-Gn; EBG00000994509.
DR   EnsemblGenomes-Gn; EBG00000994512.
DR   EnsemblGenomes-Gn; EBG00000994515.
DR   EnsemblGenomes-Gn; EBG00000994517.
DR   EnsemblGenomes-Gn; EBG00000994520.
DR   EnsemblGenomes-Gn; EBG00000994522.
DR   EnsemblGenomes-Gn; EBG00000994524.
DR   EnsemblGenomes-Gn; EBG00000994525.
DR   EnsemblGenomes-Gn; EBG00000994527.
DR   EnsemblGenomes-Gn; EBG00000994530.
DR   EnsemblGenomes-Gn; EBG00000994532.
DR   EnsemblGenomes-Gn; EBG00000994534.
DR   EnsemblGenomes-Gn; EBG00000994537.
DR   EnsemblGenomes-Gn; EBG00000994540.
DR   EnsemblGenomes-Gn; EBG00000994542.
DR   EnsemblGenomes-Gn; EBG00000994544.
DR   EnsemblGenomes-Gn; EBG00000994546.
DR   EnsemblGenomes-Gn; EBG00000994548.
DR   EnsemblGenomes-Gn; EBG00000994549.
DR   EnsemblGenomes-Gn; EBG00000994550.
DR   EnsemblGenomes-Gn; EBG00000994554.
DR   EnsemblGenomes-Gn; EBG00000994556.
DR   EnsemblGenomes-Gn; EBG00000994558.
DR   EnsemblGenomes-Gn; EBG00000994560.
DR   EnsemblGenomes-Gn; EBG00000994562.
DR   EnsemblGenomes-Gn; EBG00000994564.
DR   EnsemblGenomes-Gn; EBG00000994566.
DR   EnsemblGenomes-Gn; EBG00000994569.
DR   EnsemblGenomes-Gn; EBG00000994572.
DR   EnsemblGenomes-Gn; EBG00000994575.
DR   EnsemblGenomes-Gn; EBG00000994578.
DR   EnsemblGenomes-Gn; EBG00000994581.
DR   EnsemblGenomes-Gn; EBG00000994585.
DR   EnsemblGenomes-Gn; EBG00000994589.
DR   EnsemblGenomes-Gn; EBG00000994592.
DR   EnsemblGenomes-Gn; EBG00000994594.
DR   EnsemblGenomes-Gn; EBG00000994598.
DR   EnsemblGenomes-Gn; EBG00000994604.
DR   EnsemblGenomes-Gn; EBG00000994608.
DR   EnsemblGenomes-Gn; EBG00000994612.
DR   EnsemblGenomes-Gn; EBG00000994616.
DR   EnsemblGenomes-Gn; EBG00000994619.
DR   EnsemblGenomes-Gn; EBG00000994622.
DR   EnsemblGenomes-Gn; EBG00000994625.
DR   EnsemblGenomes-Gn; EBG00000994631.
DR   EnsemblGenomes-Gn; EBG00000994635.
DR   EnsemblGenomes-Gn; EBG00000994638.
DR   EnsemblGenomes-Gn; EBG00000994641.
DR   EnsemblGenomes-Gn; EBG00000994644.
DR   EnsemblGenomes-Gn; EBG00000994647.
DR   EnsemblGenomes-Gn; MSMEG_0008.
DR   EnsemblGenomes-Gn; MSMEG_0010.
DR   EnsemblGenomes-Gn; MSMEG_0037.
DR   EnsemblGenomes-Gn; MSMEG_0677.
DR   EnsemblGenomes-Gn; MSMEG_1166.
DR   EnsemblGenomes-Gn; MSMEG_1337.
DR   EnsemblGenomes-Gn; MSMEG_1338.
DR   EnsemblGenomes-Gn; MSMEG_1343.
DR   EnsemblGenomes-Gn; MSMEG_1851.
DR   EnsemblGenomes-Gn; MSMEG_1965.
DR   EnsemblGenomes-Gn; MSMEG_2138.
DR   EnsemblGenomes-Gn; MSMEG_2384.
DR   EnsemblGenomes-Gn; MSMEG_2385.
DR   EnsemblGenomes-Gn; MSMEG_2833.
DR   EnsemblGenomes-Gn; MSMEG_2834.
DR   EnsemblGenomes-Gn; MSMEG_2835.
DR   EnsemblGenomes-Gn; MSMEG_2836.
DR   EnsemblGenomes-Gn; MSMEG_3245.
DR   EnsemblGenomes-Gn; MSMEG_3734.
DR   EnsemblGenomes-Gn; MSMEG_3755.
DR   EnsemblGenomes-Gn; MSMEG_3756.
DR   EnsemblGenomes-Gn; MSMEG_3757.
DR   EnsemblGenomes-Gn; MSMEG_3814.
DR   EnsemblGenomes-Gn; MSMEG_4201.
DR   EnsemblGenomes-Gn; MSMEG_4319.
DR   EnsemblGenomes-Gn; MSMEG_4452.
DR   EnsemblGenomes-Gn; MSMEG_4478.
DR   EnsemblGenomes-Gn; MSMEG_4675.
DR   EnsemblGenomes-Gn; MSMEG_4676.
DR   EnsemblGenomes-Gn; MSMEG_4706.
DR   EnsemblGenomes-Gn; MSMEG_4725.
DR   EnsemblGenomes-Gn; MSMEG_4746.
DR   EnsemblGenomes-Gn; MSMEG_4897.
DR   EnsemblGenomes-Gn; MSMEG_4929.
DR   EnsemblGenomes-Gn; MSMEG_4930.
DR   EnsemblGenomes-Gn; MSMEG_4931.
DR   EnsemblGenomes-Gn; MSMEG_4960.
DR   EnsemblGenomes-Gn; MSMEG_5380.
DR   EnsemblGenomes-Gn; MSMEG_5425.
DR   EnsemblGenomes-Gn; MSMEG_5467.
DR   EnsemblGenomes-Gn; MSMEG_5598.
DR   EnsemblGenomes-Gn; MSMEG_5755.
DR   EnsemblGenomes-Gn; MSMEG_5756.
DR   EnsemblGenomes-Gn; MSMEG_5757.
DR   EnsemblGenomes-Gn; MSMEG_5758.
DR   EnsemblGenomes-Gn; MSMEG_5874.
DR   EnsemblGenomes-Gn; MSMEG_6152.
DR   EnsemblGenomes-Gn; MSMEG_6204.
DR   EnsemblGenomes-Gn; MSMEG_6287.
DR   EnsemblGenomes-Gn; MSMEG_6326.
DR   EnsemblGenomes-Gn; MSMEG_6349.
DR   EnsemblGenomes-Gn; MSMEG_6350.
DR   EnsemblGenomes-Gn; MSMEG_6360.
DR   EnsemblGenomes-Tr; EBT00001522647.
DR   EnsemblGenomes-Tr; EBT00001522648.
DR   EnsemblGenomes-Tr; EBT00001522649.
DR   EnsemblGenomes-Tr; EBT00001522650.
DR   EnsemblGenomes-Tr; EBT00001522651.
DR   EnsemblGenomes-Tr; EBT00001522652.
DR   EnsemblGenomes-Tr; EBT00001522653.
DR   EnsemblGenomes-Tr; EBT00001522654.
DR   EnsemblGenomes-Tr; EBT00001522655.
DR   EnsemblGenomes-Tr; EBT00001522656.
DR   EnsemblGenomes-Tr; EBT00001522657.
DR   EnsemblGenomes-Tr; EBT00001522658.
DR   EnsemblGenomes-Tr; EBT00001522659.
DR   EnsemblGenomes-Tr; EBT00001522660.
DR   EnsemblGenomes-Tr; EBT00001522661.
DR   EnsemblGenomes-Tr; EBT00001522662.
DR   EnsemblGenomes-Tr; EBT00001522663.
DR   EnsemblGenomes-Tr; EBT00001522664.
DR   EnsemblGenomes-Tr; EBT00001522665.
DR   EnsemblGenomes-Tr; EBT00001522666.
DR   EnsemblGenomes-Tr; EBT00001522667.
DR   EnsemblGenomes-Tr; EBT00001522668.
DR   EnsemblGenomes-Tr; EBT00001522669.
DR   EnsemblGenomes-Tr; EBT00001522670.
DR   EnsemblGenomes-Tr; EBT00001522671.
DR   EnsemblGenomes-Tr; EBT00001522672.
DR   EnsemblGenomes-Tr; EBT00001522673.
DR   EnsemblGenomes-Tr; EBT00001522674.
DR   EnsemblGenomes-Tr; EBT00001522675.
DR   EnsemblGenomes-Tr; EBT00001522676.
DR   EnsemblGenomes-Tr; EBT00001522677.
DR   EnsemblGenomes-Tr; EBT00001522678.
DR   EnsemblGenomes-Tr; EBT00001522679.
DR   EnsemblGenomes-Tr; EBT00001522680.
DR   EnsemblGenomes-Tr; EBT00001522681.
DR   EnsemblGenomes-Tr; EBT00001522682.
DR   EnsemblGenomes-Tr; EBT00001522683.
DR   EnsemblGenomes-Tr; EBT00001522684.
DR   EnsemblGenomes-Tr; EBT00001522685.
DR   EnsemblGenomes-Tr; EBT00001522686.
DR   EnsemblGenomes-Tr; EBT00001522687.
DR   EnsemblGenomes-Tr; EBT00001522688.
DR   EnsemblGenomes-Tr; EBT00001522689.
DR   EnsemblGenomes-Tr; EBT00001522690.
DR   EnsemblGenomes-Tr; EBT00001522691.
DR   EnsemblGenomes-Tr; EBT00001522692.
DR   EnsemblGenomes-Tr; EBT00001522693.
DR   EnsemblGenomes-Tr; EBT00001522694.
DR   EnsemblGenomes-Tr; EBT00001522695.
DR   EnsemblGenomes-Tr; EBT00001522696.
DR   EnsemblGenomes-Tr; EBT00001522697.
DR   EnsemblGenomes-Tr; EBT00001522698.
DR   EnsemblGenomes-Tr; EBT00001522699.
DR   EnsemblGenomes-Tr; EBT00001522700.
DR   EnsemblGenomes-Tr; EBT00001522701.
DR   EnsemblGenomes-Tr; EBT00001522702.
DR   EnsemblGenomes-Tr; EBT00001522703.
DR   EnsemblGenomes-Tr; EBT00001522704.
DR   EnsemblGenomes-Tr; EBT00001522705.
DR   EnsemblGenomes-Tr; EBT00001522706.
DR   EnsemblGenomes-Tr; EBT00001522707.
DR   EnsemblGenomes-Tr; EBT00001522708.
DR   EnsemblGenomes-Tr; EBT00001522709.
DR   EnsemblGenomes-Tr; EBT00001522710.
DR   EnsemblGenomes-Tr; EBT00001522711.
DR   EnsemblGenomes-Tr; EBT00001522712.
DR   EnsemblGenomes-Tr; EBT00001522713.
DR   EnsemblGenomes-Tr; EBT00001522714.
DR   EnsemblGenomes-Tr; EBT00001522715.
DR   EnsemblGenomes-Tr; EBT00001522716.
DR   EnsemblGenomes-Tr; EBT00001522717.
DR   EnsemblGenomes-Tr; EBT00001522718.
DR   EnsemblGenomes-Tr; EBT00001522719.
DR   EnsemblGenomes-Tr; EBT00001522720.
DR   EnsemblGenomes-Tr; EBT00001522721.
DR   EnsemblGenomes-Tr; EBT00001522722.
DR   EnsemblGenomes-Tr; EBT00001522723.
DR   EnsemblGenomes-Tr; EBT00001522724.
DR   EnsemblGenomes-Tr; EBT00001522725.
DR   EnsemblGenomes-Tr; EBT00001522726.
DR   EnsemblGenomes-Tr; EBT00001522727.
DR   EnsemblGenomes-Tr; EBT00001522728.
DR   EnsemblGenomes-Tr; EBT00001522729.
DR   EnsemblGenomes-Tr; EBT00001522730.
DR   EnsemblGenomes-Tr; MSMEG_0008-1.
DR   EnsemblGenomes-Tr; MSMEG_0010-1.
DR   EnsemblGenomes-Tr; MSMEG_0037-1.
DR   EnsemblGenomes-Tr; MSMEG_0677-1.
DR   EnsemblGenomes-Tr; MSMEG_1166-1.
DR   EnsemblGenomes-Tr; MSMEG_1337-1.
DR   EnsemblGenomes-Tr; MSMEG_1338-1.
DR   EnsemblGenomes-Tr; MSMEG_1343-1.
DR   EnsemblGenomes-Tr; MSMEG_1851-1.
DR   EnsemblGenomes-Tr; MSMEG_1965-1.
DR   EnsemblGenomes-Tr; MSMEG_2138-1.
DR   EnsemblGenomes-Tr; MSMEG_2384-1.
DR   EnsemblGenomes-Tr; MSMEG_2385-1.
DR   EnsemblGenomes-Tr; MSMEG_2833-1.
DR   EnsemblGenomes-Tr; MSMEG_2834-1.
DR   EnsemblGenomes-Tr; MSMEG_2835-1.
DR   EnsemblGenomes-Tr; MSMEG_2836-1.
DR   EnsemblGenomes-Tr; MSMEG_3245-1.
DR   EnsemblGenomes-Tr; MSMEG_3734-1.
DR   EnsemblGenomes-Tr; MSMEG_3755-1.
DR   EnsemblGenomes-Tr; MSMEG_3756-1.
DR   EnsemblGenomes-Tr; MSMEG_3757-1.
DR   EnsemblGenomes-Tr; MSMEG_3814-1.
DR   EnsemblGenomes-Tr; MSMEG_4201-1.
DR   EnsemblGenomes-Tr; MSMEG_4319-1.
DR   EnsemblGenomes-Tr; MSMEG_4452-1.
DR   EnsemblGenomes-Tr; MSMEG_4478-1.
DR   EnsemblGenomes-Tr; MSMEG_4675-1.
DR   EnsemblGenomes-Tr; MSMEG_4676-1.
DR   EnsemblGenomes-Tr; MSMEG_4706-1.
DR   EnsemblGenomes-Tr; MSMEG_4725-1.
DR   EnsemblGenomes-Tr; MSMEG_4746-1.
DR   EnsemblGenomes-Tr; MSMEG_4897-1.
DR   EnsemblGenomes-Tr; MSMEG_4929-1.
DR   EnsemblGenomes-Tr; MSMEG_4930-1.
DR   EnsemblGenomes-Tr; MSMEG_4931-1.
DR   EnsemblGenomes-Tr; MSMEG_4960-1.
DR   EnsemblGenomes-Tr; MSMEG_5380-1.
DR   EnsemblGenomes-Tr; MSMEG_5425-1.
DR   EnsemblGenomes-Tr; MSMEG_5467-1.
DR   EnsemblGenomes-Tr; MSMEG_5598-1.
DR   EnsemblGenomes-Tr; MSMEG_5755-1.
DR   EnsemblGenomes-Tr; MSMEG_5756-1.
DR   EnsemblGenomes-Tr; MSMEG_5757-1.
DR   EnsemblGenomes-Tr; MSMEG_5758-1.
DR   EnsemblGenomes-Tr; MSMEG_5874-1.
DR   EnsemblGenomes-Tr; MSMEG_6152-1.
DR   EnsemblGenomes-Tr; MSMEG_6204-1.
DR   EnsemblGenomes-Tr; MSMEG_6287-1.
DR   EnsemblGenomes-Tr; MSMEG_6326-1.
DR   EnsemblGenomes-Tr; MSMEG_6349-1.
DR   EnsemblGenomes-Tr; MSMEG_6350-1.
DR   EnsemblGenomes-Tr; MSMEG_6360-1.
DR   EuropePMC; PMC1951914; 17601781.
DR   EuropePMC; PMC2238217; 18083811.
DR   EuropePMC; PMC2660348; 19257911.
DR   EuropePMC; PMC2689228; 19442300.
DR   EuropePMC; PMC2737943; 19617365.
DR   EuropePMC; PMC3028759; 21115799.
DR   EuropePMC; PMC3273814; 21976733.
DR   EuropePMC; PMC3318355; 22252831.
DR   EuropePMC; PMC3366916; 22675536.
DR   EuropePMC; PMC3490692; 22586066.
DR   EuropePMC; PMC3501073; 23014988.
DR   EuropePMC; PMC3526308; 23047950.
DR   EuropePMC; PMC3527728; 23169799.
DR   EuropePMC; PMC3537567; 22726990.
DR   EuropePMC; PMC3561532; 23250743.
DR   EuropePMC; PMC3706393; 23874149.
DR   EuropePMC; PMC3814751; 24019530.
DR   EuropePMC; PMC3993855; 24713321.
DR   EuropePMC; PMC4103549; 22673307.
DR   EuropePMC; PMC4143341; 25153492.
DR   EuropePMC; PMC4219376; 24299240.
DR   EuropePMC; PMC4222082; 24266988.
DR   EuropePMC; PMC4365248; 25609722.
DR   EuropePMC; PMC4609117; 26474554.
DR   EuropePMC; PMC4633059; 26536359.
DR   EuropePMC; PMC4821088; 27092112.
DR   EuropePMC; PMC4895335; 27271013.
DR   EuropePMC; PMC5282893; 28163825.
DR   EuropePMC; PMC5430705; 28446771.
DR   EuropePMC; PMC6211224; 30381350.
DR   GOA; A4ZHR8.
DR   GOA; A4ZHT6.
DR   GOA; I7FA35.
DR   InterPro; IPR000043; Adenosylhomocysteinase-like.
DR   InterPro; IPR003430; Phenol_Hydrox.
DR   InterPro; IPR012078; MP_mOase_hydro.
DR   InterPro; IPR015878; Ado_hCys_hydrolase_NAD-bd.
DR   InterPro; IPR017813; Mycothiol_AcTrfase.
DR   InterPro; IPR020082; S-Ado-L-homoCys_hydrolase_CS.
DR   InterPro; IPR034373; Adenosylhomocysteinase.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000480.
DR   SILVA-SSU; CP000480.
DR   StrainInfo; 117498; 0.
DR   UniProtKB/Swiss-Prot; A4ZHR8; SAHH_MYCS2.
DR   UniProtKB/Swiss-Prot; A4ZHT6; MSHD_MYCS2.
DR   UniProtKB/Swiss-Prot; I7FA35; MIMC_MYCS2.
XX
CC   Source DNA/bacteria is available from William R. Jacobs, Jr., Ph.D.
CC   email: jacobsw@hhmi.org.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6988209
FT                   /organism="Mycolicibacterium smegmatis MC2 155"
FT                   /strain="MC2 155"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:246196"
FT   gene            499..1692
FT                   /gene="dnaN"
FT                   /locus_tag="MSMEG_0001"
FT   CDS_pept        499..1692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="MSMEG_0001"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70300"
FT                   /db_xref="GOA:A0QND6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="PDB:5AH2"
FT                   /db_xref="PDB:5AH4"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QND6"
FT                   /protein_id="ABK70300.1"
FT                   /translation="MATTTAGLTDLKFRVVREDFADAVAWVARSLPTRPTIPVLAGVLL
FT                   TGTDEGLTISGFDYEVSAEVKVSAEIASAGSVLVSGRLLSDITKALPAKPVEVSVEGTR
FT                   VSLTCGSARFSLPTLAVEDYPALPALPEETGVIASDLFAEAIGQVAVAAGRDDTLPMLT
FT                   GIRVEISGESVVLAATDRFRLAVRELTWVTTAGDVEAAVLVPAKTLAEAAKAGTDGNQV
FT                   HLALGSGASVGKDGLLGIRSEGKRSTTRLLDAEFPKFRQLLPAEHTAVATIGVAELTEA
FT                   IKRVALVADRGAQIRMEFSDDTLKLSAGADDVGRAEEDLPVDFAGEPLTIAFNPTYLTD
FT                   GLGSLHSERVTFGFTTPSRPAVLRPAGEDDGANGGSGPFPAAKTDYVYLLMPVRLPG"
FT   gene            1721..2614
FT                   /locus_tag="MSMEG_0002"
FT   CDS_pept        1721..2614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0002"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /EC_number="1.1.1.44"
FT                   /note="identified by match to protein family HMM PF00393;
FT                   match to protein family HMM PF03446; match to protein
FT                   family HMM TIGR00872"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74137"
FT                   /db_xref="GOA:A0QND7"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QND7"
FT                   /protein_id="ABK74137.1"
FT                   /translation="MQLGLIGLGKMGFNMRERLREAGHEVIGYDPRPEVSDVANLEELA
FT                   GALSAPRVVWVMVPSGTITHSTIVELAGVLSPGDLVIDGGNSRYTEDGPHAELLGEKGI
FT                   SFIDAGVSGGIWGLTEGYGLMVGGSDDDVARAMPIFDALRPPGDVADGFVHAGPVGAGH
FT                   YAKMVHNGIEYGLMHAYAEGYELLAAEELIKDPQAVIQAWSNGTVVRSWLQSLLAKALK
FT                   EDPGFAEISGYTEDSGEGRWTVEEAIAHRVPMPVIAASLFARFASRQEDSPTMKAVSAL
FT                   RNQFGGHAVKRISESG"
FT   gene            2624..3778
FT                   /locus_tag="MSMEG_0003"
FT   CDS_pept        2624..3778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70100"
FT                   /db_xref="GOA:A0QND8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QND8"
FT                   /protein_id="ABK70100.1"
FT                   /translation="MFARHLGLTDFRSWARVDLDLEPGRTVFVGPNGFGKTNLVEALWY
FT                   SATLGSHRVATDAPLIRAGAERAIVSTIVVNEGRELAVDLEITSGRANKARLNRSPVRS
FT                   AREILGVLRAVLFSPEDLSLVRGDPGDRRRYLDELATTRRPALAGVRADYDKVVRQRTA
FT                   LLKTAAGARYRGDRSVIDTLEVWDGHLAAHGAALVASRVKLVEELQPEVEKAYQLLAPA
FT                   SRPAAIRYRSSVEAIEDAPGPESVEFYEAALLDALARRRDAELERGVCLVGPHRDDLEL
FT                   RLGDQPAKGFASHGESWSMALALRLGAYELLCSDGVEPVLLLDDVFAELDTSRRRALAT
FT                   VAGSAEQVLVTAAVGEDIPEDWDARRVEIRMVEDDGGRVSMVAS"
FT   gene            3775..4359
FT                   /locus_tag="MSMEG_0004"
FT   CDS_pept        3775..4359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0004"
FT                   /product="hypothetical protein"
FT                   /note="RecF-gyrB intergenic region protein; identified by
FT                   match to protein family HMM PF05258"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73076"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR023007"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QND9"
FT                   /protein_id="ABK73076.1"
FT                   /translation="MTGPFDDDGPEEDAPVPAPPDHLAGLRGIDLVRRTLEEARGAARS
FT                   QGKDVGRGRSGPARRVGGNRRRRTWSGPGPDARDPQLLGAVTQDLAKSRGWSARVAEGS
FT                   VIGRWRAVVGDQIADHATPTALNEGVLTVTAESTAWATQLRMVQSQLLAKIAAVVGDGV
FT                   VTTLKIVGPAGPSWRKGRYHVSGRGPRDTYG"
FT   gene            4591..6618
FT                   /gene="gyrB"
FT                   /locus_tag="MSMEG_0005"
FT   CDS_pept        4591..6618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="MSMEG_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72750"
FT                   /db_xref="GOA:A0QNE0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="PDB:4B6C"
FT                   /db_xref="PDB:4BAE"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNE0"
FT                   /protein_id="ABK72750.1"
FT                   /translation="MAAQKNNAPKEYGADSITILEGLEAVRKRPGMYIGSTGERGLHHL
FT                   IWEVVDNAVDEAMAGFATRVDVKIHADGSVEVRDDGRGIPVEMHATGMPTIDVVMTQLH
FT                   AGGKFDGETYAVSGGLHGVGVSVVNALSTRLEATVLRDGYEWFQYYDRSVPGKLKQGGE
FT                   TKETGTTIRFWADPEIFETTDYNFETVARRLQEMAFLNKGLTIELTDERVTAEEVVDDV
FT                   VKDTAEAPKTADEKAAEATGPSKVKHRVFHYPGGLVDYVKHINRTKTPIQQSIIDFDGK
FT                   GPGHEVEIAMQWNAGYSESVHTFANTINTHEGGTHEEGFRAALTSVVNRYAKDKKLLKD
FT                   KDPNLTGDDIREGLAAVISVKVAEPQFEGQTKTKLGNTEVKSFVQKICNEQLQHWFEAN
FT                   PAEAKTVVNKAVSSAQARIAARKARELVRRKSATDIGGLPGKLADCRSTDPSKSELYVV
FT                   EGDSAGGSAKSGRDSMFQAILPLRGKIINVEKARIDRVLKNTEVQSIITALGTGIHDEF
FT                   DISKLRYHKIVLMADADVDGQHISTLLLTLLFRFMKPLVENGHIFLAQPPLYKLKWQRS
FT                   EPEFAYSDRERDGLLEAGRAAGKKINVDDGIQRYKGLGEMDAKELWETTMDPSVRVLRQ
FT                   VTLDDAAAADELFSILMGEDVEARRSFITRNAKDVRFLDV"
FT   gene            6648..9176
FT                   /gene="gyrA"
FT                   /locus_tag="MSMEG_0006"
FT   CDS_pept        6648..9176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="MSMEG_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989; match to protein
FT                   family HMM TIGR01063"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69994"
FT                   /db_xref="GOA:P48354"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48354"
FT                   /protein_id="ABK69994.1"
FT                   /translation="MTDTTLPPEGEAHDRIEPVDIQQEMQRSYIDYAMSVIVGRALPEV
FT                   RDGLKPVHRRVLYAMYDSGFRPDRSHAKSARSVAETMGNYHPHGDASIYDTLVRMAQPW
FT                   SLRYPLVDGQGNFGSPGNDPPAAMRYTEARLTPLAMEMLREIDEETVDFIPNYDGRVQE
FT                   PTVLPSRFPNLLANGSGGIAVGMATNIPPHNLGELAEAVYWCLENYEADEEATCEAVME
FT                   RVKGPDFPTSGLIVGTQGIEDTYKTGRGSIKMRGVVEIEEDSRGRTSIVITELPYQVNH
FT                   DNFITSIAEQVRDGKLAGISNIEDQSSDRVGLRIVVELKRDAVAKVVLNNLYKHTQLQT
FT                   SFGANMLSIVDGVPRTLRLDQLIRLYVDHQLDVIVRRTRYRLRKANERAHILRGLVKAL
FT                   DALDEVIALIRASQTVDIARAGLIELLDIDDIQAQAILDMQLRRLAALERQKIVDDLAK
FT                   IEAEIADLEDILAKPERQRGIVRDELKEIVDKHGDARRTRIVPADGEVSDEDLIAREDV
FT                   VVTITETGYAKRTKTDLYRSQKRGGKGVQGAGLKQDDMVNHFFVCSTHDWILFFTTQGR
FT                   VYRAKAYELPEASRTARGQHVANLLAFQPEERIAQVIQIKSYEDAPYLVLATRNGLVKK
FT                   SKLSDFDSNRSGGIVAINLREGDELVGAVLCSAEDDLLLVSANGQSIRFSATDEALRPM
FT                   GRATSGVQGMRFNEDDRLLSLNVVRPDTYLLVATSGGYAKRTSIDEYSVQGRGGKGILT
FT                   IQYDRKRGSLVGALIVDDDTELYAITSTGGVIRTAARQVRKAGRQTKGVRLMNLAEGDT
FT                   LIAIARNADEDEAAESISESDADTAESPEA"
FT   gene            9229..10011
FT                   /locus_tag="MSMEG_0007"
FT   CDS_pept        9229..10011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72925"
FT                   /db_xref="GOA:A0QNE2"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNE2"
FT                   /protein_id="ABK72925.1"
FT                   /translation="MSSPNEPGYPRAGDRPGATNGTGPGGDSGALSSNSTRATGHITDS
FT                   GDVPPWQRGVSRTAQQPGQPLGDTEQQPRPAPRPEPRETRQEPRPEHRTEAYASELPDL
FT                   SGPVPRSPQRKTGADAPRASAPTTRIQVANRPQPSGPVRASMQIRRVDPWTVLKVSLVL
FT                   SVVLFFVWMIAVAFLYLVLGGMGVWSKLNSNVGDLLTSASGSSGGELVSSGTIFGGAAL
FT                   IGLVNIVVLSAMATVGAFIYNLTTDLVGGIEVTLADRD"
FT   gene            10072..10148
FT                   /locus_tag="MSMEG_0008"
FT   tRNA            10072..10148
FT                   /locus_tag="MSMEG_0008"
FT                   /product="tRNA-Ile"
FT   gene            10184..10276
FT                   /locus_tag="MSMEG_0009"
FT   CDS_pept        10184..10276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0009"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75462"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNE3"
FT                   /protein_id="ABK75462.1"
FT                   /translation="MRFVVLAVVAAVAVIVWRSRHGQEVWHQAG"
FT   gene            10293..10368
FT                   /locus_tag="MSMEG_0010"
FT   tRNA            10293..10368
FT                   /locus_tag="MSMEG_0010"
FT                   /product="tRNA-Ala"
FT   gene            10411..11211
FT                   /locus_tag="MSMEG_0011"
FT   CDS_pept        10411..11211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0011"
FT                   /product="FAD-binding 9, siderophore-interacting"
FT                   /note="identified by match to protein family HMM PF04954;
FT                   match to protein family HMM PF08021"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72739"
FT                   /db_xref="GOA:A0QNE4"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNE4"
FT                   /protein_id="ABK72739.1"
FT                   /translation="MSFSYASVIETKALNPRMVRITLQVEDPASLDVQQAADSAVAVFM
FT                   PGTDEGRNYSVRRQRGDLLDLDVVLHARGVGTDWAARTRPGDRVGLDHARSWYRPDPAA
FT                   QWQLLITDLSGLPATARILEELSPEVPVTVIAEVAEAQDLDYLPAHPQARLVTSIGTGN
FT                   GNAPSELATLVRELALPRDRGYCWFAGEAAESRAVRKYLRGLGYQNEQLDITGYWRFDS
FT                   ETWDAAFALVESDVLAVYERALAEGKGDKVAFEEFDEACERIGL"
FT   gene            11215..12246
FT                   /locus_tag="MSMEG_0012"
FT   CDS_pept        11215..12246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0012"
FT                   /product="ferric enterobactin transport system permease
FT                   protein FepD"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70092"
FT                   /db_xref="GOA:A0QNE5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNE5"
FT                   /protein_id="ABK70092.1"
FT                   /translation="MITQAPLAPPRAARNHRAVGLAVATVVLVAMCIASLAIGTQNVSL
FT                   STVWQAVTDYRDIGDQWIVHDLRIPRTVLGLLVGLALGLSGTLIQAVGRNPLADSEILG
FT                   INSGAALFVVAAIAFLGFSGIWTYIGFAFLGALFAMLMVYLIGMTGRATVTPVRVLLAG
FT                   VAIGAVMDGFGFVIRLQNPRAFDNMRFWDAGALDGRPLEVAGAIAPFIAVGAVLCLVVS
FT                   RSLNITALGDDLAKSMGSNVVRTQVLSLTAVTLLAGAATAGAGPIGFVGLMVPHAVRRF
FT                   TGPDWRWVLAYATVVAPSLMLAADIVGRVVIRPSELPAGIVTAFLGAPVLIWLIRRSKA
FT                   DRA"
FT   gene            12272..13301
FT                   /pseudo
FT                   /locus_tag="MSMEG_0013"
FT                   /note="ferric enterobactin transport system permease
FT                   protein FepG; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by match to
FT                   protein family HMM PF01032"
FT   gene            13310..14140
FT                   /locus_tag="MSMEG_0015"
FT   CDS_pept        13310..14140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0015"
FT                   /product="ferric enterobactin transport ATP-binding protein
FT                   FepC"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73737"
FT                   /db_xref="GOA:A0QNE6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNE6"
FT                   /protein_id="ABK73737.1"
FT                   /translation="MTHTPENAVPDRLGAVDVSIGYDDRTIIDGLTVQVPADRVTAIVG
FT                   PNACGKSTLLRGFARLLTPSAGRVILDGHDIATMHTKDVARRLGLLPQTSIAPEGITVA
FT                   DLVSRGRFPHQKVFRQWSRDDAAAVADAMRHTGVTELSARLVDELSGGQRQRVWVAMVL
FT                   AQQTPLILLDEPTTYLDIAHQVELLDLFAMLNREHGRTVVAVLHDLNQACRYADELIVM
FT                   KAGRIVAQGDPDVVMSADLVRDVYGLECQIIDDPQTGTPLIVPRASRHARVVKR"
FT   gene            complement(14130..15098)
FT                   /locus_tag="MSMEG_0014"
FT   CDS_pept        complement(14130..15098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0014"
FT                   /product="Formyl transferase"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM PF02911"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72876"
FT                   /db_xref="GOA:A0QNE7"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNE7"
FT                   /protein_id="ABK72876.1"
FT                   /translation="MFPVRVVMFGYQTWGHRTLQALLKSRHEVCLVVTHPTSDHAYESI
FT                   WADSVEDLARGAGIEVLLAKRPTPELVERVRELAPDVGVANNWRTRLPRELFSIPKYGT
FT                   VNLHDSLLPKFTGFSPVIWSLISGAGQTGLTAHFMDDELDTGDILLQRSVEITPTSTGT
FT                   SLVYDTLDLIPDVLEDALDAIENGTATPVPQDLSQRTFFHKRSDRDSLVDWSWPAADIE
FT                   RFIRALSDPYPNAYTYFRGERLRLISAHVSRCTYGGTPGRVFIEENGGMVIVAGADAFR
FT                   GRSPGLVLDVVRTDDGIDHSALDYFGHGGGYLTATPEFATV"
FT   gene            15256..15522
FT                   /locus_tag="MSMEG_0016"
FT   CDS_pept        15256..15522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0016"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF03621"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71911"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNE8"
FT                   /protein_id="ABK71911.1"
FT                   /translation="MAENLGGRKRLSTNPFDDTDGRFVVLVNDEGQHSLWPVFAGVPAG
FT                   WTVAFGGAGGADRGSALRFVDENWNDLRPRSLREATDNTATLA"
FT   gene            15525..17252
FT                   /locus_tag="MSMEG_0017"
FT   CDS_pept        15525..17252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0017"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74529"
FT                   /db_xref="GOA:A0QNE9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNE9"
FT                   /protein_id="ABK74529.1"
FT                   /translation="MADTTRTDLSWTGVRVLRRTVSRNLKWLTSGTTLIALHQLCEVSV
FT                   PVLIGIIVDRAVATGSVEAILRWIAVLAALFVVLTVVYRFGARLLMFAIARESHLLRVE
FT                   SSAKILDPLGIETDYKVGELLSISSDDADEVSYLLDYVPRIVGAVVGTVVCGAVLLSIH
FT                   LPLGLMVLIGVPVVVFGLQLTAPMIARRVEDQQAEIGRATALATDLISGQRPLQGIGAQ
FT                   ANAAARYRVASRRALTATLRAARIQSIHSGAAAAAGALAAMAVAVVAAYFAIRGSMTVG
FT                   QLITVIGLAQFLIEPFSLLAVVPSWVAEARASANRVARVLSAPTRHSPVFAADPRDAAA
FT                   RLSVRNATHAGLKNLSFDVEPGEFVAVLTSDVRDAGALIDLLSGYQRAEDKGTVLVGGR
FT                   RLDQIPLKERREHLLVEHHLSSLFSGTLETNLNVTGTDPRRGRVSVDDALQASCAVDVV
FT                   DLHPDGLAHAVVERGASLSGGQRQRWTLARALLADPAVLVLHDPTTAIDTVTEQVIADG
FT                   IRRLRTRAGRTTVVLTSSPALLAAADRVLLVIDGRLDSEGTHRDLVDAHSDYRDLVTR"
FT   gene            17249..19018
FT                   /locus_tag="MSMEG_0018"
FT   CDS_pept        17249..19018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0018"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75067"
FT                   /db_xref="GOA:A0QNF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNF0"
FT                   /protein_id="ABK75067.1"
FT                   /translation="MISDEPVTPPVLPVATARRSGAWLIADLRGRRTALAAVVTVGLAA
FT                   AAASVVPIYLLGMLVDRVEHGDGTRGLVALGTVIALAAVAGGLGTGLSTYLTSRLGEQM
FT                   LADLRERVLERALNLPATLIEESGRGDLLSRVGPDVAVVARTVAQVLPVILNGFFLGVV
FT                   TLVGMTTLDWRLGLAGALAIPAYIAGLHWYLPRSAPMYADERIAIANRAQVTVESIQGA
FT                   RTIDAYEIHDRHLADIDRASGRARDISIAVFTFFTRLVGRVNRAEFIGLAATLVVGFLL
FT                   VRSGETTVGQVTAAALMFHRLFNPVGELMYNFDEIQSASASLARLVGVIDLDAPGPDAR
FT                   RTAPARPHGADISVENVSFGYGTGPEVVHGVSLHVPAGTRCALVGTTGAGKTTLAAIVA
FT                   GLLTPTSGHARIGGVPVTEIADLRRWVATITQEVHVFSGPLIDDLRLVAPQASVDDVWT
FT                   ALETVGASTWVRALDDGLDTVVGEHGHELTAAQAQHVAMARLVLADPEVVVLDEATAEA
FT                   GSAHAAELEDAASAATAGRTTLIVAHRLTQAAQADQVAVMADGRIVENGTHAELIALGG
FT                   RYARLWQAWIRHN"
FT   gene            19052..41623
FT                   /locus_tag="MSMEG_0019"
FT   CDS_pept        19052..41623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0019"
FT                   /product="amino acid adenylation"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM PF00550; match to protein
FT                   family HMM PF00668; match to protein family HMM PF00975;
FT                   match to protein family HMM TIGR01720; match to protein
FT                   family HMM TIGR01733"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72398"
FT                   /db_xref="GOA:A0QNF1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNF1"
FT                   /protein_id="ABK72398.1"
FT                   /translation="MTADSLDIAELLELWNNHSTPERTSTVPTLFAAQCALTPDEVAVV
FT                   DGERRLTYRHLETHVAQLAHAVRVAAGEGPEPIVAIGVPRSAEMVVCVLAAMMAGVAFV
FT                   PLDPSWPAHRRRQVLADSGAVATFITREDESDWGVPGLRVDLGAWQFTAESPVLPQADV
FT                   HPAQLAYVIFTSGSTGKPKGAMIRHDAIAERLQWQRDHILHFGKHDHTDASLFKAPLSF
FT                   DISVNEILLPLVSGGRVVVAVPDGEKDPEYLLELIRTEQVTFVYLVSSMLDTLLELDRL
FT                   ATADGAPSSLASLRHVWCGGEVLTPGLFARFRKQLTTTLYHGYGPAEATIGVSHVIYRD
FT                   TAERIATSIGRPNPHTQLYVLDEYLRPVPPGVGGELYAAGFLLGRGYVNAPSLTASRFV
FT                   ANPFDGNGSRMYRTGDLARWTEDGSLEFLGRADNQVKIGGRRVELEEIESQLADHPAVR
FT                   HAVVDVHRQGGADVLVGYLVAADGVRNDAAWHAEVADWARTRLPEYMVPKAFVALDQVP
FT                   LTANGKTDRRALPAPDLERSGTVKPPRTPRETVLCQVFADALDIDAVGVDEDFFALGGD
FT                   SIVAIRVVSRLRAAGYTLRPRDMFAHRTVEALAPLLGDSDVRDTGPAVDPTGAATPTPI
FT                   LRWLDEVGTAGSVLNGFHQGMSLVTPADADENTLRAAIAATVRRHHVLWAPPGRTASDI
FT                   DIPGTPPETRLLIADASDGIPAQAEKVARQLVSLLDTARIAFGWIRRPAAPGRLVVIAD
FT                   HTVIDGVSLRILAEDIATAYGLIAEGRAVELPTPHTSWRAWAQRLADTAAAGGFDADLE
FT                   HWQQVCATTETPWGDRALDPAIDTVATESRLTVELPSAVTDAILTTVPDRIHGHVNDAL
FT                   VAALYLALRRWLHTRGVGADTLLVEMEGHGREGHLVDSDTAGLDLSNTVGWFTTLYPVA
FT                   LRDAEFDWQAAVSGGPQLGAAVRSVKDQLRSVPSHGFSYGALRYLRDGTSGLEAAPQVL
FT                   FNYLGRFGTADRPWALANDTTAVLEDRDPGMPLPRLLEVNAEAVTTADGSVLRATFSWP
FT                   AHAVAEVDVRTLAGMWTDLLTAIASSDDVRGHSASDFDRVSVTADDVAELERRYPGLTD
FT                   LLPLTPTQQGIYFHSTFSRDRDPYVVQQIVDITGPLDTERFQRATESVAARHRALGAVF
FT                   TTLSDGTPVAVHAATVAPDFDVLDARHAADPSTVVAQRARWERERRFDLAAAPLTRYTL
FT                   VRRRDDLHTMIETVHHIVADGWSVPIVLDDLLTAYAGDDFDGPAPEFARFVDWLEQRDT
FT                   DSDRAAWAPALEDITEPTRLAAADGARGRTTGSGFGTRTVTLQSRSAVADAANGAAVTV
FT                   GTLLHTAWGLALGRLTGRDDVVFGTVVSGRGADVHGIESMVGLLVNTVPVRVAWSADDT
FT                   GADVAGRLAAVESTLLEHHHLPLTEAHRLAGVGELFDTLVVIENLGATTHTRGDLTLGD
FT                   IGVIEAPHYPLTLMISVRDTITVTVTNDREHVSDVLADTAVAAFTEVLTALTADPGVSP
FT                   GDIALPAPQATAPPTQAPQTVTDLIAAAIAEHRDDIALVVGETEWTYGQLGARAGELAA
FT                   ALAEAGVRRGDIVALATARSADLVAAIWAIIAAGAAYLPVDLAYPRTRIEYMLRHARPT
FT                   AVIADGVGAHVVSGALPADTIVVSTTATHAAVPFTPVPVDGADAVSVLYTSGSTGEPKA
FT                   VVGTHAALANRLAWAVEAWPAATRIAKSPLSFIDGTTELLAGLAAGARTVLAGDETARD
FT                   GRRLAQLVAAHGVEQLLAVPSLAAVLADERTEDVAELNRWIVSGEALEPRHLHALRTAC
FT                   PTAEIVNSYGSSEVAGDVLAGVQDDAGITLGAAVPGAGIRILDSRLRQLPAGVIGEIYV
FT                   TGGQLARGYLGRPGQTATRFVAAPGGERMYRTGDLGALLPGGRVVFAGRADDQLKINGH
FT                   RVEPGEIESVLARQPGVREAAVIGTGTQLAAFVVLESDAPGAGDLLTAVSAELPGHLVP
FT                   SSLRPVDAIPLLPNGKRDNNALRSLLVPGESTGTAPTNDVERAVLDVMTGVLGRDPLGA
FT                   DDDFFAVGGDSISAIRVTSRLARAGYHIATEDVFRGRTAAGVAALVDTVESLAHDAAIE
FT                   PFATVRLSPQTIDRIRESGQVEDIWAMSPLQLGVYYQSTLADAGPTYIAQNVFEFDRRI
FT                   DVDAMRRAFTALLRRHPQLRAGFRTVEHAEPEPAPDATPVVQVVVTDPPSDLTVVDLTD
FT                   QDDPAAAQHIVDTDRTAPFDVATPPLLRLTVIRLPGGRDRMLFTYHFLLFDGWSRELVL
FT                   RDLFALYDSDAQHGAIAPHGDLVVRHLQWLATDGDPQASGARDAWRDLLAGLTEPTLAS
FT                   GVSPDHPDARPGTEPGRIVVRVPEDVTTQLHTCATAHGATLNSVVTAAVALVTGYHAGT
FT                   TDVVIGTTVAGRPGHLVGIDETIGLFLNTVPVRVDMSPTRSVAAAMASIGEQRVAMMRH
FT                   DHLGLGQIQRAAGDSGSALFDSLLVLQNFLDDDTFTDLESRHGIVDVSYHDTTHFPLTW
FT                   VLTPGRELAIKLEHRVVDDARATEMVEQLVTVLRTIAAEPDTAVGAVDLIGADRRAQLE
FT                   RRWSSTERPLEPVTIAELLARRAEQNPDDVALVFGAQSVTYREFDDRVSQFARHLRARG
FT                   AAPETFVALALPRSIDMVVALFAVLRAGAAYLPLELDLPIDRLRTIIDNAEPVLLVTTT
FT                   DRTELIGHARARGADVIALDDAETAATLADTPAHPLTAGELGAFASDSTRLNHPAYLIY
FT                   TSGSTGRPKGVLTGYAGLTNMYFNHREAIFAPTVARAGSAEQLRIAHTVSFSFDMSWEE
FT                   LFWLVEGHQVHVCDEELRRDAPALVAYCHRHRIDVINVTPTYAHHLFDAGLLDDGAHTP
FT                   PLVLLGGEAVGDGVWSALRDHPDSAGYNLYGPTEYTINTLGGGTDDSDTPTVGQPIWNT
FT                   RGYILDAALRPVPDGAVGELYIAGTGLALGYHRRAGLTAATMVADPYVPGGRMYRTGDL
FT                   VRRRPGSAELLDYLGRVDDQVKIRGYRVELGEIESVLTRADGVARCAVVARATGANPPV
FT                   KTLAAYVIPDRWPAEDAAFITGLRDHLARVLPGYMVPTRYGIVDTLPLTINGKLDVAAL
FT                   PEPIAATSGTGRTPRTDREATLLEIVASVLGIDGIGVDDDFFTLGGDSISSISVCGRAR
FT                   KAGLNITPRDVFRRRTIAALAASADTTQTPESGPDTGTGAITATPMLAETAQANTPLTN
FT                   FYQAMVLATPAGITAHEVQRVLQTVVDAHAMLRARLVTTATGWTLTVPDQTAAIGLTVR
FT                   SGALTSDCVEAEKAAAAAELDPRAGNMVRAVWFDAPEASGQLLLVIHHLVIDGVSWRIL
FT                   SEDLSRAWNDLAAGRDVAADAVPTSFHTWANALAQRTFDDESEYWADVLATPDPDLGSR
FT                   PPDPAIDTADTVRSHEVTLASDVTEALLTSVPAAMHGGVNDVLLTGLAVALAQWRADRG
FT                   HSQNTAAVISLEGHGRESDLVAADLDLSRTVGWFTSIYPVRIDPGPLEWDTVRSAGAEL
FT                   AAAAKAVKEQLRAVPNRGLGYGVLRHLHGALDGTPPQILFNYLGRFTGGSGNDWRPVAG
FT                   IGALTEGVDPSNPAMSLEINALAEERPDGTVLSMTLAWPGGLLDADDVSELGSMWADVL
FT                   VALTRCDALRGHTPSDFGLVTVSQDDIDGWDRLGEVEEVLPLLPLQEGMYFHSMFGDPA
FT                   TDTYRVQQIAQLSGPVDPEVLRTSLTVVMRRHQALRASFNELTDGRVAQVIWSDVPVQL
FT                   TVVDTDDLESIAAEELARPFNLAEAPLVRYMLVRLGDDDHRLVQTMHHIIADGWSYPVL
FT                   FGDIVDHYNAAIGVGSAPQPITVTLRDHIETVTDRDRGAARQAWEQALAGAEPTALVPR
FT                   PDGAPVGEHRSVVRRLDSARTAAVGRAARVHGVTVGTVLHGAWGLMLGRLLGRNRVVFG
FT                   STVSGRGGDLAGTESIVGLLINTIPVPMSWEPHATLASALIDLQDQQSALLDAQQMGLA
FT                   ELARLAGVREFFDTMVIVENFPSTSSAEHTDPRAVAFRGFTGTDSPHYPVSFVAYADDQ
FT                   LTVEIKYDAGVVTPEQAERYAERVERILTAFAETPDLPVSRIDLRTNAERQFTAGHASR
FT                   PGPGRTLGASFAEVAATYPDAVAVSCGDTRLTYRELDDRAAAVAATLAERGVGAESRVA
FT                   IALPRSADLIVAVLAVIKAGGTYVPIDIGAPAARVQHILADSAPVCLLTDTAERFTGVP
FT                   HVILAEAAQNPARPQAPTVSPDHAAYVIYTSGSTGVPKGVEVTHRNVAALFAGTTSGLY
FT                   DFGPDDVWTMFHSAAFDFSVWELWGPLLHGGRLVVVEHDVARDPERFVDLLARERVTVL
FT                   NQTPSAFYPLLEADARLRRQLALRYVIFGGEALDVRRLAPWYANHESHSPRLVNMYGIT
FT                   ETCVHVSHRALDTADTGAAGSVIGGPLPGLRIHLLDNNLQPVPAGVVGEMYIAGGQVAR
FT                   GYTGRPGLTATRFVANPFDGAGERLYRSGDLAMWTDAGELVYLGRSDAQVKVRGYRIEL
FT                   GEVEAALVTLPGVTNAAADVRHDDTGRARLIGYVVGDALDIGALRSTLAERLPDYMVPS
FT                   VLLRLDVLPLTVNGKLDRAALPDPEPVEQAPAPVAGTGTASLLAGLCTEILGTTVGVED
FT                   DFFTAGGDSIIAIQLVNRARREGVRITPQQVFVHRTPAALASVLDTGSVAAPDATPDED
FT                   AGPDLGEVMLTPIVQRLAELGGTVTRFNQSELLRTPAGATVARLETAINAVIARHDALR
FT                   IRLHRPAPMLWSLETTAAAPVSITRIDAHGFDDEQLRTVIATESDAAADRLDPENGVVV
FT                   VAVWFDRGTDTQGRLLLVVHHLAVDGVSWRILLDDLAEAYRQALSGQRVAPAPVTTSLR
FT                   QYARTVNENAQHSSRLTEFEHWTEVLAPGGELVATADVVTLTVGATRDHEIRLSTEDTA
FT                   PLLTTVPAAANADVTETLVAALHLAVSRWRAARGEAADAPLVLSLERHGRDGWPDDVDL
FT                   SRTVGWFTSIAPVRLPAPGEDLLNTLKAVKESLRAAPDGGLGFGQLRYCNPRTSAVLAR
FT                   LGTPQLLFNYLGRWAADACDDWASAPEVDALRTEPNPDLGTPYLVEVNAICDDTVDGPR
FT                   LRATLTYADGELDEPSVAELGELWVAALRELGSLATGGDAALTPSDLPLVTLTQEHIDR
FT                   VTGAVPGNVETIWPLSPLQEGVYLQARYATAAVYIVQNVFDFAEPVDTTALRTAYSAVM
FT                   ARNPVLRSAFWADDLPQPVAAIVADPVCEPRVVDLGGLPATQVERRVEEITADDRQQTF
FT                   DLAAAPLARMTVLRTPDRDRLIFSYHFLLLDGWSREQLLRELFAEYTAARGGAVAQLPA
FT                   PTADFTDYLRWLARQDRDVSAREWSEALRDLEAPTLLVPDAVGTDPTLALRLEFLLSEA
FT                   DTAALTAAARSAGVTLNALISTALAMVLAYETGRDDVVFGSTVAGRPTDLDGIDSVIGL
FT                   FLNTVPTRVRLAPHRTVADTMRAVQSDRLRLMDHEYLGLGDIQRAVSTGGGPLFDSLYV
FT                   LQNFLDDDTFTDMEAQYGIVGHDSIDASHYPLTWVASPGRRLWMKLEYRPDVVERDRAQ
FT                   GLLDRLRQVLLQVGTGVERPSAALTLPLPAEADHKRTRDAATEHDLPHASVLDLLAERA
FT                   VQSGDLTALVCGGEFVDYAELLARVNRLAWVLRSRGIGPEDTVALAVPRSIDAVVALFA
FT                   VLRAGAAYLPLELDYPDERLAVMLGDAEPVRVLVTGATAQRIARVASAPLTVLDAPDTC
FT                   DELARARSDWDGYSPHPDQPAYVIYTSGSTGKPKGVVTPHRGLTNMHLNHREAIFAPTI
FT                   ARAHGRRLKIAHTVSFSFDMSWEELLWLIEGHEVHICDEVLRRDATSLVRYCHDHRIDV
FT                   INVTPTYAALLFEEGLLEQAGHPPVLVLLGGEAVSTTVWNRLRDSERWYGYNLYGPTEY
FT                   TINTLGGGTDDSATPTVGTPIWNTRAHILDNWLRPVPDGVPGELYIAGAGLARGYLGQP
FT                   GLTASRFVANPFEPGRMYRTGDLVVRRADDNIDFLGRTDDQVKIRGYRVELGDIEAALV
FT                   SHPGVSQAAVIARPDTAGSSRLVAYVVPTTENPDVLDDLRMHLTATLPAYMVPTAMATL
FT                   TEIPLTDNGKLDTRALPDVAPIGRHGAGRAPQGAVEATLCSVFAEVLGLDGPDGLSVDD
FT                   DFFDLGGHSLLTIRLISRIRSELGAELTLGDVFNSRTVAALARHVTADEGDNRRPRLVA
FT                   GPRPQHIPASPAQRRMLMLDRLGETGSAYNYPLVFRVRGALDVDALRDALTAVVDRHEA
FT                   LRTVFDDRDGVYHQRILPRGTQPPLHVSDCPEHELATRADALVEHRFDLTGEIPLRVDV
FT                   LRSGPEDHTVVMLLHHIAIDEWSDAVFLADLDAAYAAHRAGTAAPLPEPVVQYADHTLW
FT                   QRDVLAQLGDRQREFWRTALAGAPDELALPADRPRPARPTGAGGTLDVEITAETASALR
FT                   RLAADKQVSMLMVLHAAVAVLIHRLGAGDDIVVGTPVAGRDDAALDDVVGLFVNTVVLR
FT                   ADLAGNPTFTELLDRVRTADLAAFAHQDLPFDHLVEELNPPRVAGRNPLFNLFVGYHLR
FT                   SGTDSDMFGLPTEWTEPAVSAAMFDLGFTLVDHGGDESASITAEYAADLFDASTVHTLA
FT                   RRLVALLDHVVADAETRIGALDLLAPGEHDTLVVEHNATEHPLEPITLGALVSRQATST
FT                   PHATALRYEESELSYRDLDGWSDRLAAHLSARGAAPGTVVGVSLPRSVELVVALVAVAK
FT                   SGAAFLPLDPEYPRERLEYMVSDARPITVLDDPDAVRRSRGEPDGELPRIDPAAWAYVL
FT                   YTSGSTGRPKGVAVAHAGIVNRIACLQHAYPLGTDDRMLVKTPISFDTSVWEVFWPLSV
FT                   GATLVVARPGGHREPAYLAAMIAEQCVTAVDFVPSMLEVFLDEVAGTCASLTRVTVGGE
FT                   ALTTELAARFAEAFPGVPLHNLYGPTEAAVDVLGWTADGGPVALGVPGWNVRAYVLDDY
FT                   LNPVPAGAPGELYLAGIQLADGYLHRGALTAARFVASPFDQGARMYRTGDVVRWRADGQ
FT                   LEYLGRSDDQIKLRGVRIEPGEIETVLATHPAVSSVRVIARGGRLMAYYVPAGVEASAG
FT                   ELRDELREHAAAALPSHMVPSGFVALTEFPLTPSGKLDRRALPEFAGATAGVPGRAPTT
FT                   ERQHRLCELFSDVLGLEVTGIDDDFFVLGGHSLLLVRLAAALRREFSVDVPVADLMVSP
FT                   TVADIDQRLDAAGSSVDSLAPVLPFRASGTDAPLFCVHPASGLSWQFAGLKRHLPRQIP
FT                   IYGLQSPLFTGTPLPESIAELTARYADTIVAVAPSGPVRLLGWSFGGSMALLIAQELSR
FT                   RGREVTFVGMLDARTDTADPNAGFDPEAVLAGLLREMGFGVDPQARMTVADAVALVRDT
FT                   DDAITVLDDEQIALVIENYVAAERLTADADYGRYDGDVFFVDATILEMDLAGVASRGWH
FT                   DHVGGRLKVAELDCRHSELMDAEVLERLGPLIAAELRGGDVASG"
FT   gene            complement(41689..42636)
FT                   /locus_tag="MSMEG_0020"
FT   CDS_pept        complement(41689..42636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0020"
FT                   /product="Periplasmic binding protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71242"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNF2"
FT                   /protein_id="ABK71242.1"
FT                   /translation="MAPIFAAAVAIGMVSACGSESEPAAESGATTISHKFGETTVPENP
FT                   SRVVTVGWTDQDFVLPFGVVPVSAREFSENYNDLPWVQEATGGKGIPTWGSDSIDFEAI
FT                   AAQKPDLILAIYETIDQQTYDRLSQIAPTVIQSADYADEETPWDVQLLTTGKALGKEAE
FT                   AKELLDEVQGKIDEARRNNPEFEGKTLVVDFGPADGGHYLLGENDPRRSLFTALGFQTQ
FT                   DVVGDVSEEKLDLLDRDVLFVNGATKDELITSPAFERLGVVRDGRTLYTTFESKLSDAL
FT                   TYSGPDSLQYALDVLTPQLANALNGRPVADLSNA"
FT   gene            42944..43354
FT                   /gene="panD"
FT                   /locus_tag="MSMEG_0021"
FT   CDS_pept        42944..43354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="MSMEG_0021"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="identified by match to protein family HMM PF02261;
FT                   match to protein family HMM TIGR00223"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75859"
FT                   /db_xref="GOA:A0QNF3"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNF3"
FT                   /protein_id="ABK75859.1"
FT                   /translation="MQRVLLASKIHRATVTQADLHYVGSITIDAELMAAADIVEGEQVH
FT                   VVDITSGARLVTYAITGTPGSGVIGINGAAAHLISPGNLVIIMSFVHLDEAERADHRAN
FT                   VVHVDADNHIVTIGSDPAQPVPGAADQLVGRV"
FT   gene            43366..44688
FT                   /locus_tag="MSMEG_0022"
FT   CDS_pept        43366..44688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0022"
FT                   /product="L-ornithine 5-monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73576"
FT                   /db_xref="GOA:A0QNF4"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNF4"
FT                   /protein_id="ABK73576.1"
FT                   /translation="MQSIDHLNGRNGDSPVLDVVGVGFGPSNLALAIAIREYNETHAEA
FT                   INAEFVEVKPEFGWHTGMLIPGATMQVSFLKDLATQRNPTSEFTFLNYLTERRRLTEFI
FT                   NFKTFFPTRLEFHDYLSWAADKVGATVHYGSRVVSVRDTDGAFDVTVTGATEGILRARN
FT                   VVVAGGLQPLLPPGVQRTRRQIHNHGLLHDLAAMPDPRHNRYVVVGAGQSAAEVCAYLH
FT                   DLSPDNEVHGVFAKYGYSPADDSPFANRVFDPDAVDDFFVADPAVRRRLINYHRSTNYS
FT                   AVDLELIEELYAREYAERVAGRRRLFVRGASSVQHTDEDDAGVRVHIRHHPSGTVEELD
FT                   CDAVIYATGFMPARLDGILGDLYHDLVLEDGNPVVSRDYRLATVPPTAGGLYIQGNTEH
FT                   THGLTSSLLSNIAVRSGEILESVITHTRTGTHRLSPVGSDA"
FT   gene            complement(44692..45102)
FT                   /locus_tag="MSMEG_0023"
FT   CDS_pept        complement(44692..45102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0023"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75126"
FT                   /db_xref="GOA:A0QNF5"
FT                   /db_xref="InterPro:IPR024245"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNF5"
FT                   /protein_id="ABK75126.1"
FT                   /translation="MPARADVRLAPRQRLTRGLKYTAVGPVDITRGVLGIGADTAQATA
FT                   AELRRRYASGKLQRQLAAAAEAVAALPETIQEAVQEVVSPPKKRRRRPLLIAAVAVTVL
FT                   GGGAAAFSIVRRRSRPQEPPTLAPSVEVAPKP"
FT   gene            45223..45750
FT                   /locus_tag="MSMEG_0024"
FT   CDS_pept        45223..45750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0024"
FT                   /product="peptidyl-prolyl cis-trans isomerase B"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00160"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70605"
FT                   /db_xref="GOA:A0QNF6"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNF6"
FT                   /protein_id="ABK70605.1"
FT                   /translation="MTSPIQTATATLHTNRGDIKIALFGNHAPKTVNNFVGLAQGTKDY
FT                   STENASGGTSGPFYDGAVFHRVIDGFMIQGGDPTGTGRGGPGYKFEDEFHPELQFDKPY
FT                   LLAMANAGPGTNGSQFFITVGKTPHLNRRHTIFGEVVDEESQKVVDAIASTPTDRSDRP
FT                   TEPVVIESITIA"
FT   gene            complement(45854..46261)
FT                   /locus_tag="MSMEG_0025"
FT   CDS_pept        complement(45854..46261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72068"
FT                   /db_xref="GOA:A0QNF7"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNF7"
FT                   /protein_id="ABK72068.1"
FT                   /translation="MQQTQWSPSTAGIAGCGIAGLMMAIAAVTVITDPPGRVLAGIAAV
FT                   GLLTFASFSLRSRPKLAITDDGLVVRGWARTRTFRHDEIDTIRITEFRRLARKVRMLEI
FT                   DAHDGRLVVFTRWDLGTDPLDVLDALKAAGY"
FT   gene            complement(46417..46701)
FT                   /locus_tag="MSMEG_0026"
FT   CDS_pept        complement(46417..46701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0026"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF06781"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73698"
FT                   /db_xref="GOA:A0QNF8"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNF8"
FT                   /protein_id="ABK73698.1"
FT                   /translation="MPKSKVRKKNDFTSRPVSRTPVKVKAGPSSVWFVALFIGLMLFGL
FT                   IWLLVFQLAATNPIDTPSFLQWMADLGPWNYAIAFAFMITGLLLTMRWR"
FT   gene            46797..47546
FT                   /locus_tag="MSMEG_0027"
FT   CDS_pept        46797..47546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05949"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71385"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNF9"
FT                   /protein_id="ABK71385.1"
FT                   /translation="MDQPSRSRWRLGVPVICLLAGLLLAATHGVSGGDEIRRSDSPRLV
FT                   DLVREAQQSVDRLAAQRDALALEVDSHHGGSPSSHAALDAITARTAQLAVDAGMDPMRG
FT                   PGLVVTLNDAQRDAEGRFPRDAAPDDLVVHQQDIQAVLNALWSAGAEGIQMQDQRIIAT
FT                   SAPRCVGNTLLLNGRTYSPPYVITAIGDAAAMQAALAEAPLVTLYKQYVLRFGLGYTEE
FT                   PKAEVTLAGHTEPVRMRYAKPAGPLGY"
FT   gene            47564..48238
FT                   /locus_tag="MSMEG_0029"
FT   CDS_pept        47564..48238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0029"
FT                   /product="anthranilate synthase component 2"
FT                   /EC_number="4.1.3.27"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM TIGR00566"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69759"
FT                   /db_xref="GOA:A0QNG0"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNG0"
FT                   /protein_id="ABK69759.1"
FT                   /translation="MQVLVVDNYDSFVFNLVQYLGQLGVHAQVWRNDDARLATEDAIAQ
FT                   AAADFDGVLLSPGPGTPERAGASIALVKACAAAGTPLLGVCLGHQAIGVAFGGTVDRAP
FT                   ELLHGKTSVVHHNDSGVLKGLPDPFTATRYHSLTILPETLPAALEVVGQTDNGIIMAVR
FT                   HTELPIHGVQFHPESILTQGGHRMLANWLGFCGAAPDETLVRRLEDEVARAVAAATQRS
FT                   SA"
FT   gene            complement(48216..50093)
FT                   /locus_tag="MSMEG_0028"
FT   CDS_pept        complement(48216..50093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0028"
FT                   /product="serine-threonine protein kinase"
FT                   /note="identified by match to protein family HMM PF00069;
FT                   match to protein family HMM PF03793"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74027"
FT                   /db_xref="GOA:A0QNG1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNG1"
FT                   /protein_id="ABK74027.1"
FT                   /translation="MTTPQHLSDRYELGEILGFGGMSEVHLARDLRLHRDVAVKVLRAD
FT                   LARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPNGPLPYIVMEYVDGVTLRDIV
FT                   HTDGPIAPRRAIEIIADACQALNFSHQHGIIHRDVKPANIMISKNNAVKVMDFGIARAL
FT                   ADTGNSVTQTAAVIGTAQYLSPEQARGETVDARSDVYSLGCVLYEILTGEPPFIGDSPV
FT                   AVAYQHVREDPVPPSRRHADVTPELDAVVLKALAKNPDNRYQTAAEMRADLIRVHEGQA
FT                   PDAPKVLTDAERTSMLAAPPADRAGAATQDMPVPRPAGYSKQRSTSVARWLIAVAVLAV
FT                   LTVVVTVAINMVGGNPRNVQVPDVAEQSADDAQAALQNRGFKTVIDRQPDNEVPPGLVI
FT                   GTDPEAGSELGAGEQVTINVSTGPEQALVPDVAGLTPTQARQKLKDAGFEKFRESPSPS
FT                   TPEQKGRVLATNPQANQTAAIINEITIVVGAGPEDAPVLSCAGQNAESCKAILAAGGFT
FT                   NTVVVEVDNPAAAGQVVGTEPADGQSVPKDTVIQIRVSKGNQFVMPDLVGQFWSDAYPR
FT                   LTALGWTGVLDKGPDVRDSGQRTNAVVTQSPSAGTPVNKDAKITLSFAA"
FT   gene            complement(50090..51349)
FT                   /gene="pknA"
FT                   /locus_tag="MSMEG_0030"
FT   CDS_pept        complement(50090..51349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknA"
FT                   /locus_tag="MSMEG_0030"
FT                   /product="serine/threonine protein kinase PknA"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75101"
FT                   /db_xref="GOA:A0QNG2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNG2"
FT                   /protein_id="ABK75101.1"
FT                   /translation="MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDSRLGRRVAVKVLK
FT                   AEFSTDAEFVERFRAEARTVAMLNHPGIASVYDYGETELDGEGRTAYLVMELINGEPLN
FT                   SVLKRTGRLSLRHALDMLEQTGRALQVAHTAGLVHRDVKPGNILITPTGQVKLTDFGIA
FT                   KAVDAAPVTQTGMVMGTAQYIAPEQALGHDATAASDVYSLGVVGYESVSGKRPFTGDGA
FT                   LTVAMKHIKETPPPLPADLPPNVRELIEITLVKNPGMRYKSGGPFADAVAAVRAGRRPP
FT                   RPNQAPTLGRAAPAAVPSAAQARASADLTGRAPVTAARARPTATAAHRTPPPRRTFSSG
FT                   QRALLWAAGVLGALAIVIAILIVLNAQDRKDREQSPPPTVTDTVTETTPYEETPAAMPD
FT                   LMIMLRAAQPEPPPSEQIQR"
FT   gene            complement(51381..52856)
FT                   /locus_tag="MSMEG_0031"
FT   CDS_pept        complement(51381..52856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0031"
FT                   /product="Penicillin binding protein transpeptidase domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00905"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71213"
FT                   /db_xref="GOA:A0QNG3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNG3"
FT                   /protein_id="ABK71213.1"
FT                   /translation="MNTSLRRVAVAIMVLIVLLLANATVTQVFAADGLRADPRNQRVLL
FT                   DEYSRQRGQITAGGQLLAYSVSTDGRFRYLRVYPNPQAYAPVTGFYSLGYSSTGLERAE
FT                   DAVLNGSDERLFGRRLADFFTGRDPRGGNVDTTIKPQVQQAAWDAMQNGCDGPCRGSVV
FT                   ALEPSTGKILAMVSAPSYDPNLLATHDLAAQADAWEKLRDDPQSPLLNRAISETYPPGS
FT                   TFKVITTAAALQAGARPQTQLTSAPRTPLPDSTATLENFGGAPCGPGPTVSLQEAFAKS
FT                   CNTAFVELGLSTGTDKLKAMAQAFGLDTPPPAIPLQVAESTTGPIVDAAALGMSSIGQR
FT                   DVALTPLQNAQVAATIANDGIAMRPYLVESLKGPDLATISTTTPEQERRAVSPQVAATL
FT                   TDLMVAAEQVTQQKGAIAGVQIASKTGTAEHGTDPRNTPPHAWYIAFAPAQDPKVAVAV
FT                   LVEDGGDRLSATGGALAAPIGRATIAAALREGS"
FT   gene            complement(52853..54268)
FT                   /locus_tag="MSMEG_0032"
FT   CDS_pept        complement(52853..54268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0032"
FT                   /product="cell cycle protein, FtsW/RodA/SpoVE family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01098"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71056"
FT                   /db_xref="GOA:A0QNG4"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNG4"
FT                   /protein_id="ABK71056.1"
FT                   /translation="MTTQPQSPVTVTPPLPNRRNAELLLLGFAALITTVALLIVEANQE
FT                   QGVTWDLAHYMVGYLALFGAAHLAVRRFAPYADPLLLPVVAVLNGLGLVMIHRLDLAEG
FT                   ELTADGLGGSANQQMLWTLVGVVAFALVVVFLKDHRMLSRYGYVFGLTGLVLLVIPALL
FT                   PAKYSEQYGAKIWIQFPGFSIQPAEFSKILLLIFFSAVLVSKRSLFTSAGKHVLGVDLP
FT                   RPRDLAPLLVAWAASVGIMIFEKDLGTSLLLYASFLVLLYVATERISWVVIGLALFAAG
FT                   SVVAYNIFDHVQVRVQTWLDPFADPEGAGYQMVQSLFSFATGGIFGTGLGNGQPGTVPA
FT                   AATDFITAAIGEELGLVGLAGVLMLYTILIIRGLRTAIAVRDSFGKLLAAGLASTLAIQ
FT                   LFIVVGGVTRLIPLTGLTTPWMSYGGSSLLANYVLLAILVVISHAARRPITTSRPPNAT
FT                   PIAAASTEVIEKV"
FT   gene            complement(54265..55803)
FT                   /locus_tag="MSMEG_0033"
FT   CDS_pept        complement(54265..55803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0033"
FT                   /product="protein phosphatase 2C"
FT                   /note="identified by match to protein family HMM PF00481"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72306"
FT                   /db_xref="GOA:A0QNG5"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNG5"
FT                   /protein_id="ABK72306.1"
FT                   /translation="MTLVLRYAARSDRGLVRANNEDSVYAGARLLALADGMGGHAAGEV
FT                   ASQLVIAALAHLDDDEPGGDLLSKLHQAVAEGNAAIAAHVEADPELDGMGTTLTAILFA
FT                   GNRLGLVHIGDSRGYLLRDGELTQITKDDTFVQTLVDEGRITAEEAHSHPQRSLIMRAL
FT                   TGHEVEPTLIMREAKAGDRYLLCSDGLSDPVSQETIKEALQIEDVAESADRLIELALRG
FT                   GGPDNVTVVVADVVDYDYGQTQPILAGAVSGDDDQTAPPDTAAGRASAFNPRRNEPKRV
FT                   IPQPAEPARKPRSRRRMIIAAVLVVLVVVAGLAIGREILRNNYYVAEHDGTVSIMRGVQ
FT                   GSFLGISLQEPYRLGCLNARNELSLIGANENRDNLGCRLMAVNDMRPSERAQVVAGLPG
FT                   GTLDEAFAQIGELARSSLLPVCAPPRPTTTTRAPAPPPAPPSSPAPGASGRGAGESPVP
FT                   PSPSPTTTAAPAPSGAPGSPNPPPPASPSPTPSPTVTALPPPPPQPGTNCRAVS"
FT   gene            complement(55826..56293)
FT                   /locus_tag="MSMEG_0034"
FT   CDS_pept        complement(55826..56293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0034"
FT                   /product="FHA domain protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74891"
FT                   /db_xref="GOA:A0QNG6"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNG6"
FT                   /protein_id="ABK74891.1"
FT                   /translation="MQGLVLQLTRVGFLLLLWLFIWSVLRILRTDIYAPTGAVMVRRGL
FT                   ALRGSLLPNRQRRHVARQLVVTEGALAGTRITLGNQPVLIGRADDSTLVLTDDYASTRH
FT                   ARLSPRGSEWYVEDLGSTNGTYLDRAKVTTAVKVPIGAPVRIGKTVIELRP"
FT   gene            complement(56429..57892)
FT                   /locus_tag="MSMEG_0035"
FT   CDS_pept        complement(56429..57892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0035"
FT                   /product="FHA domain protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73969"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNG7"
FT                   /protein_id="ABK73969.1"
FT                   /translation="MKAGDVMGLVDRIERKLESTVGDAFARVFGGSIVPQEVEVALRRE
FT                   AETRARTVAGGQVLAPNDYVITLSGTDYQKVRADTDLTSTTFAKHLKGYIHDQGWQTYG
FT                   EVVVRFEQSPNLHTGQFRARGAVNPDSTAGESARAPRDHAFTAESGEPPMTDNPNYRGG
FT                   QGPARPGDEYYDERYGRQDDPRGGQYPPEQGGYPPQDQGGYPPRGGGYPDQGGYPDQGG
FT                   YPDQGGYPDQGGYPPQSYEQRPPAGYGPPPQGGGYDRGYGQPAGGYPPAGPPAGPPPGG
FT                   QPGYGGADYDYGRQAPRHDDYGRPDPRQGYPEQGGYPEQGGYGGQAYGRPDYGQPDYGQ
FT                   QPGRGYPEQGGYPEQGGYGEPAGRDYEYGGDYGAPAGQGGYGGGYGADYPAGGTTVTLQ
FT                   LDDGSGRTYQLREGANVIGRGQDAQFRLPDTGVSRRHLEIRWDGQVALLSDLNSTNGTT
FT                   VNNAPVQEWQLADGDVIRLGHSEIIVRVH"
FT   gene            complement(58033..58140)
FT                   /locus_tag="MSMEG_0036"
FT   CDS_pept        complement(58033..58140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0036"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70036"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNG8"
FT                   /protein_id="ABK70036.1"
FT                   /translation="MTEAAYHCARPDPKPAAQARVDLAAEQLASSRSCH"
FT   gene            58144..58226
FT                   /locus_tag="MSMEG_0037"
FT   tRNA            58144..58226
FT                   /locus_tag="MSMEG_0037"
FT                   /product="tRNA-Leu"
FT   gene            58186..58648
FT                   /pseudo
FT                   /locus_tag="MSMEG_0038"
FT                   /note="putative glucose-methanol-choline oxidoreductase;
FT                   this region contains one or more premature stops and/or
FT                   frameshifts which are not the result of sequencing error"
FT   gene            complement(58655..59029)
FT                   /locus_tag="MSMEG_0039"
FT   CDS_pept        complement(58655..59029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0039"
FT                   /product="small membrane hydrophobic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71288"
FT                   /db_xref="InterPro:IPR025363"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNG9"
FT                   /protein_id="ABK71288.1"
FT                   /translation="MTTAAYILSGLIAAAIIVIGARFLVAPRVAAAGYGVVPDLAQRST
FT                   GAYLGVKGVRDIASGLIVIVLMVAGATHLLGWVLLAATVIPLADTAIVLTNGGTKATAW
FT                   GVHFATAVVMAVTAVLLLVA"
FT   gene            complement(59041..59346)
FT                   /locus_tag="MSMEG_0040"
FT   CDS_pept        complement(59041..59346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71871"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNH0"
FT                   /protein_id="ABK71871.1"
FT                   /translation="MFQLRIYTLCSPAALHQYATVHWARHVDTFATFGITTHGVWTDRD
FT                   ANRLVALIHYPTDPGELTHRVMSSREFASDMDGFDVTEILDVQAIPLDPTAFSPIH"
FT   gene            complement(59348..59824)
FT                   /locus_tag="MSMEG_0041"
FT   CDS_pept        complement(59348..59824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70750"
FT                   /db_xref="GOA:A0QNH1"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNH1"
FT                   /protein_id="ABK70750.1"
FT                   /translation="MNLDLLIQASAVLAVLGTAVVYGTDVFCAAVLRPALESVDDGALV
FT                   SVMGHVHRFGDHRMPVPGVIGIVASAACVALAAVTAHWAQVFAAVTALALLLAWLALYL
FT                   RVSAPVNRQLTAAADAGRSLVNGRALQEKWDHVIGARAVLQGAAVAALCVVLAV"
FT   gene            59900..60463
FT                   /locus_tag="MSMEG_0042"
FT   CDS_pept        59900..60463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0042"
FT                   /product="TetR-family protein transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69743"
FT                   /db_xref="GOA:A0QNH2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNH2"
FT                   /protein_id="ABK69743.1"
FT                   /translation="MAMEERRERERAARRDLIISTARRLAEAEGWQAVTTRRLSAEIEY
FT                   SQPVLYKHFAGMEELADAVALDGFGELAEAMRQARRGDDHPDHAVTRIAQAYLDFARAN
FT                   PAVYDAMFARATNLRFAADDTPSPLTEAFAQLRDAVGRNEDADTLTEVLWAALHGLVML
FT                   GRTGRLRPDHETERLQLLVDRMSR"
FT   gene            complement(60479..61303)
FT                   /locus_tag="MSMEG_0043"
FT   CDS_pept        complement(60479..61303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0043"
FT                   /product="extradiol ring-cleavage dioxygenase, class III
FT                   enzyme, subunit B"
FT                   /note="identified by match to protein family HMM PF02900"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75926"
FT                   /db_xref="GOA:A0QNH3"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNH3"
FT                   /protein_id="ABK75926.1"
FT                   /translation="MDQWSTTRPSLEDVPSVMPAAFVGHGSPLNAIESNRYTAAWKRFG
FT                   QAVPRPRAILVVSAHWYINATAVTAMPHPRAIHDFYGFPRELFDVEYPAPGLPELAEEV
FT                   SDLVHPTWVGADVDSWGIDHGTWSVLVHAFPDASIPVVQLAINANEPADYHLRLGAELA
FT                   GLRERGVLVVASGNIVHNLRGMDPRLSDSGYDWAQRFDEAAAARLLDSPAEVATLDAHR
FT                   DYALAVPTPDHFIPFLYFAGIASASTDSVDTLVSGYTYGSLSMTAYTLGLSA"
FT   gene            61470..63548
FT                   /locus_tag="MSMEG_0044"
FT   CDS_pept        61470..63548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0044"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72207"
FT                   /db_xref="GOA:A0QNH4"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNH4"
FT                   /protein_id="ABK72207.1"
FT                   /translation="MGERGELVSDLHPSDDHDADPRLAPLLAWRQQLVDSGAVAPRSFK
FT                   EAHLRLVLRSGRTDVEQIRAMLPGSVAEHAEEMARILAELTPAAPEPDPPPVPEPQPEP
FT                   EPGPGKHRSPETDEPPVATTTEIPIPTTGFAPFQFSSQQVALHDITVQRTDAAVELSWP
FT                   PYEAPEDEAAQDISVVMYRVVSSDDQAPYSPDPAHLVALTEEPKATDERQQVSPVRHYQ
FT                   VWVNVGASEAAARKTQPVLYATAVLVRPVTGFEIREDAGWVIGQWTAPPGVTAVHVFRV
FT                   PIDEVDRDEAQYRILTAGENLAGFVDTEPVRGQRYRYRARCAVNVDGVVRLSEAAEADV
FT                   ELAAALMPVTDLVVETAADGASCDLSWTPPAGGQVAIYRSQNGPSADAEAIELPQGALE
FT                   QVGLTPELRVTQDLTEETGSDGRRRARLTGVTWPSEWSRAYFTPVTLMGERAMLGRTLS
FT                   SVRTGTIRDIELAEYCNKQVLTFDWPDGAASVIVYLAPKGHDPRSGLNGRSFEISLEEY
FT                   ERYGGMHLTGQLPVGGCSLHLAPVAFAGGRRVVGAFSSIEYRGLLRLQYAVRIGRDPNG
FT                   FPTTATIALRAEQNVPGSPGFVLVNNPQRLPLSVHDGHPVDVAPLDARGQLADHPSKEL
FT                   RWSALTTSGDGELWAANLSGLQGWIRLFVNIGSPAQLRVIALLDPPVETLRLTAATL"
FT   gene            63545..66013
FT                   /locus_tag="MSMEG_0045"
FT   CDS_pept        63545..66013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0045"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71610"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNH5"
FT                   /protein_id="ABK71610.1"
FT                   /translation="MTSRFGQLTYTSFDAVGTVGGWQVKETSDALTPEETQLMLAGVRT
FT                   VFRTVEPMPDYPTPEQLEAAPRRLAYSRVGETYAALWHTVPAGADSTGRPGNVFAHVLL
FT                   DRTPDVAPRHRAIQWWRSPHWLCPYGATAVSRAALAEPGAEPGRVVTKDSVVAFALDTT
FT                   TWRLATLFGLLDAVAAALDGGPPVVLGVESPDNAAQWIGLLSFLMSPGTAAQLSFSTFD
FT                   RADQLNPHSGQMLSAVPLEDLSAVPAGMVAISEAETLSLGELGGEPHRTAGGYAIDVTP
FT                   WSAMAQVVVLDPGSARRLLDDIDAVAEQVRDSGLHPAWPMAMAVAGRAEFADAEEEAHE
FT                   VIAAHSPPGVAVGSAAARTISGVLSAAVGTTTADAWRAVQELPTGPGAVFADTTYLCRA
FT                   VTDDEWLSENSPIPLGPRMFHGKPIPPPLRTAIGRALDPGRGPQRLLQVADLLVRAGVE
FT                   DPRIRTTLVEDVVPRLGDAEVRERVGADARLTLGAVLLNDGDANGTAIDDGLLDWLADT
FT                   APLPPPDELAQATPWDRTWTIAALRGVRARRRGTGGAGQDAGALLWWLRATGSADFEQT
FT                   ATASAWNPEDLLLAIGADPLPGAAAVRTLVAAADSPALNRLAAKVIDENGDTLAVACAA
FT                   VRTIEPTVWLQQRYVETHQHAYVPLWDEVLSVVDPADVHPDFSTRLLAFALLGLFTGHP
FT                   YPRACSGFAASDRLGGEAIERLMPLVGEGQLAPHAVVAIGLLRAAAPPDPAHPDVTLDE
FT                   LAGHLAEQVATGMAGDDNDVDGVVAVMAQLSGDSAEPALRGYRKMVTKLLARRGDSPSL
FT                   TARLRGGRQA"
FT   gene            66010..67167
FT                   /locus_tag="MSMEG_0046"
FT   CDS_pept        66010..67167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70450"
FT                   /db_xref="GOA:A0QNH6"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNH6"
FT                   /protein_id="ABK70450.1"
FT                   /translation="MSKCPRCFTALNPNQYLWTLPEQSGGTRYRDEVATAYSGAPADCG
FT                   PLYTWSRSPGYNGPPPPTSEATRALQAPAVEICPVCHFTLPEGWREGHAICIALAGARA
FT                   TGKSLYIAVLVKQLELLCERFGVSMQPVTRGTAQAYATNYETPLYVQRGLIPPTPTVRT
FT                   QTSDHREPLMFSLGIWHGVRRFLVLRDVAGEDMESGDLHAPPFRFFAHADAVFFMFDPL
FT                   RVKTIRDQLHDLLPAQVVSGGDPRTVLTNVLTAVSPGQPKLAVILSKFDVLRALRDVEG
FT                   SEWGLIMSNGGAAYLRDTSDGQQYDETDGQLLHEEVRSLLLRLHGGSILAAVENPATGV
FT                   RLQSRNFVVSALGHPPSGNRLHARGIAPFRCVDPIRWVTSGFGVL"
FT   gene            complement(67182..68117)
FT                   /locus_tag="MSMEG_0047"
FT   CDS_pept        complement(67182..68117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0047"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69659"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNH7"
FT                   /protein_id="ABK69659.1"
FT                   /translation="MTGPPPPPPPWPPGGQYPGQHPGQYPGWGGPGWSGYGEAPPAHQP
FT                   PKPNKTPWILAALAGVVIIALVAGGLVWKFTSGGDDDTDAAGTTTSTSAAPDTPDTAGA
FT                   QAPTTTAKPACEGRVAARTPDTPPQWIPVESPRGLNYAVPPDWTVNSCTSLVGWEKPCP
FT                   EGPFGFCPVRSMSGSAMLPNKQCPDHARVLTGVPGASKTDDIDEAVQLESQLVDDIFTS
FT                   KNGVVPQVSLSDPREFTIDGQPAVQIVATVTGIETDECVAPEALHSMVATKVDGQPGSV
FT                   MFIVSMEQGFPGAPSPSLIDEILETVHHAN"
FT   gene            68264..68767
FT                   /locus_tag="MSMEG_0048"
FT   CDS_pept        68264..68767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0048"
FT                   /product="pyridoxamine 5'-phosphate oxidase family protein"
FT                   /note="identified by match to protein family HMM PF01243"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73917"
FT                   /db_xref="GOA:A0QNH8"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNH8"
FT                   /protein_id="ABK73917.1"
FT                   /translation="MGKNERTKIVMSDEEIAEFVERSRTATMATVLPDGRPHLVAMWYA
FT                   VVDGEIWFETKAKSQKAVNLRRDPTVTVLIEDGHTYDTLRGVSIDGTAEIVDDPETLLR
FT                   VGISVWERYTGPYTDEMRPFVDQMMNNRIAVRVVPGRTRSWDHRKLGMPAMPLGGSTAQ
FT                   YLNS"
FT   gene            complement(68769..69734)
FT                   /locus_tag="MSMEG_0049"
FT   CDS_pept        complement(68769..69734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0049"
FT                   /product="pirin domain protein"
FT                   /note="identified by match to protein family HMM PF02678;
FT                   match to protein family HMM PF05726"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71091"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNH9"
FT                   /protein_id="ABK71091.1"
FT                   /translation="MSNTDVAPSEVTCGPSRFTGVLHAREVPLGGPRAIAVRRTLPQRD
FT                   RTLIGAWCFADHYGPHDVRSGPGMDVPPHPHTGLQTVSWLFAGEIEHRDSGGVHAMVRP
FT                   GELNLMTAGAGICHSEVSTKAASVLHGVQLWVALPAAARDTDRDFAHYAPTPRVIGSST
FT                   LRVFLGELGDSRSPVHTFTPLLGAQIDLAPGAELTLDVDATFEHGVLLDRGAVEVAGTP
FT                   LAVADLAYQRPGCHELHLANTGTGPARVILLGGLPFGEELVMWWNFVGRSHDDIAAYRE
FT                   LWQDHDARFGAVSGYTGTLSRLPAPPLPNGRLKPRPNPAG"
FT   gene            69779..70045
FT                   /locus_tag="MSMEG_0050"
FT   CDS_pept        69779..70045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70929"
FT                   /db_xref="GOA:A0QNI0"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNI0"
FT                   /protein_id="ABK70929.1"
FT                   /translation="MSAMSRVVSADDVRTVEFAKPPIGKRGYDKKSVDDFLQLVARRLE
FT                   GRGHLSADDVRNIAFPKPPVFQRGYSEDEVDALLDDVVATLER"
FT   gene            complement(70234..70527)
FT                   /locus_tag="MSMEG_0051"
FT   CDS_pept        complement(70234..70527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0051"
FT                   /product="transcription factor WhiB family protein"
FT                   /note="identified by match to protein family HMM PF02467"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75225"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNI1"
FT                   /protein_id="ABK75225.1"
FT                   /translation="MTALMTNGIPLGVCTSDPERWTSAPDAQAKVICRECPRRWLCARE
FT                   ACELPRAEGLWAGIMVPESGRGRTFALKQLRSLAERNGYPVRKTKLIFPDAA"
FT   gene            70911..71690
FT                   /locus_tag="MSMEG_0052"
FT   CDS_pept        70911..71690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0052"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69854"
FT                   /db_xref="GOA:A0QNI2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNI2"
FT                   /protein_id="ABK69854.1"
FT                   /translation="MTDAEFDLATGEFDVGLVRAGAAAAARRRELDISQRSLAADGIIN
FT                   AGALIAFEKGRSWPRERTRLKLEEVLRWPPGTIARLRQGGSVPTTSAPVAPPPPPEPPA
FT                   AAPAPVTSVPAADEVPLIAQAVLTAVHTLETTINAMPPESDPDFVPRVTAILGDLRQLE
FT                   AVASRAARISMVTPPLIKALSAVRRQIDELTMRAANAPGATLGQRLYAARRQANLTVAE
FT                   TAQAAGVSEDAIARTEAEYPVDAAAVHAIEALIDSLR"
FT   gene            71738..72823
FT                   /locus_tag="MSMEG_0054"
FT   CDS_pept        71738..72823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0054"
FT                   /product="ISMsm2, transposase"
FT                   /note="identified by similarity to GB:CAD18826.1"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74688"
FT                   /db_xref="GOA:A0QNI3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNI3"
FT                   /protein_id="ABK74688.1"
FT                   /translation="MPTPHAAEIVLSADERAELEGWARRRTSAAGLAMRARIVLAAADG
FT                   GSNTELADRLELSIGTVRRWRNRFAELRLDGLVDEPRPGRPRVVGDEQIEALITATLET
FT                   TPPDATHWSTRSMAAHLGLSQSMVSRVWRAFGLAPHKQDSWKLSKDPLFVAKVRDVVGL
FT                   YLNPPERALVLCVDEKTQIQALNRTQPVFPMLPGTPARASHDYVRHGTSSLYAALDLTT
FT                   GKVIGALHSRHRATEFLAFLKKIDVEVPDDLDVHLVLDNASTHKTPAVKRWLTGHPRFV
FT                   LHFTPTSSSWLNLVERWFAELTTKKLRRSTHTSVRQLNADIRAWIDTWNDNPKPYVWTK
FT                   TADQILASIANYCARINDSGH"
FT   gene            complement(72820..74208)
FT                   /locus_tag="MSMEG_0053"
FT   CDS_pept        complement(72820..74208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73862"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNI4"
FT                   /protein_id="ABK73862.1"
FT                   /translation="MADPDDTLRRELGWTGPEEDDFEPDTGPTRPTLRPEPPSIPGRPP
FT                   VSPTPPNPVNPDAEDRVPADPDAERARTTFREPTQPSPPQQPSQPPPPPPPSALHPRPD
FT                   PWEQRVPGWNAPQYGPPPGNQPWPQAGGFGGGPGQPPHVPPGPPQSYADRIRASDLVPP
FT                   KRQPPSGGWRLLVYRATFGLVNPGPSAEELRQAELEAKIRGVLRGHYKIGVMGKGGVGK
FT                   TTVSATIGSIFAHLRQDDRVVAIDADTSFGKLGSRVDPRAHGSYWELTSDKNLETFADV
FT                   RSRVGNNSAGLFVLAGESTPARRRVLDAAIYREAVTRLDKHFSISVVDCSSTMDSPVTQ
FT                   EVLRDLDALIVVSSPWVDGAATAGQTLDWLSANGMTRLLQRTVVVLNDSDGHADKRTRS
FT                   ILLNQFAGQGQAVVEIPFDGHLRPGGVVDIQEMSPKVRRKFLEVAAALADHFPTSDDHT
FT                   RERS"
FT   gene            74600..76177
FT                   /locus_tag="MSMEG_0055"
FT   CDS_pept        74600..76177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0055"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71412"
FT                   /db_xref="GOA:A0QNI5"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNI5"
FT                   /protein_id="ABK71412.1"
FT                   /translation="MGVLSDVADFGKDVIDDRDKWADRFKKVGHFIERNAKGDRLERVA
FT                   KFGRALGDFSGKFTDFFESNLGKRMVKAARSPILAAGQHVITGMKLTTGVGDPENGRRF
FT                   GEGADHMSAAGRTLDSAYPTSDWDSAASDAYLSQNNGQVTRAEALVHADQVVAAVLSRE
FT                   AEQIATTREVLDSEADWLGDMSLVTMATGLIPYVGRAAQTAAEIAMVTKAVGASTDQFM
FT                   MMRDKADENAAEVRDAIGKYEAVAGDADDTTADDTAGDAPESEPTAAEDSSETSKEDGQ
FT                   SRHENPVAAPSGGGGGATSGGGGGAPSSASSAGPAGTPQVPSPPGFGAANTPTDAQPGA
FT                   AAASDAAGMLGSVMGAMLGPLGGIVGGVVQAAGQALQAATQAGAQAAQLAGQAAAAPDV
FT                   DRADTDEDTDKDPDAEGDKDSDKRDGEGKEDGTAPRDRESTDAMGADDDDRNAHPQAGS
FT                   GTDSAGEDDKKPAMTLPPDLQAASALDTGAGSAPVHVGADFEHSQLRTVAAATLDHGIP
FT                   GSAAARGA"
FT   gene            76213..76530
FT                   /locus_tag="MSMEG_0056"
FT   CDS_pept        76213..76530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0056"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72095"
FT                   /db_xref="GOA:A0QNI6"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNI6"
FT                   /protein_id="ABK72095.1"
FT                   /translation="MSDDLRVTTAHLRELSAKQGRAAAELATATAVVDGVDTALRFTHG
FT                   PISWGTAAAVEAVQHARRAAGTGMVKVSQELETKLDTAAGRYHRTDSTMGDALDETIQP
FT                   R"
FT   gene            76535..77383
FT                   /locus_tag="MSMEG_0057"
FT   CDS_pept        76535..77383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75056"
FT                   /db_xref="GOA:A0QNI7"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNI7"
FT                   /protein_id="ABK75056.1"
FT                   /translation="MTAPFTAETGDAHIDDVVGVEVTIDGMLVIADKLGLTDFPPSMGI
FT                   RLNIPQPDLRKVVWEQVERDLSAQGVLDVYGNPHPEVAAMVDTLARADRTLECRWWRRD
FT                   AGGKMIRFVVCRKGGRHVVAARDNDLLVLQRVAPQIGLAGMVMTVLGEGSPANVEPLTG
FT                   VADRLAQCRTAEELTGYGIPPTSARAYASIISEPDGWVEIVANERHPGGTTSQVDVAAG
FT                   VLDAKQGRIVSIPRRVNGELYGSFLSGTKDNLERALEGLVEFLPSKTWFDKTDADNAYQ
FT                   H"
FT   gene            77398..77925
FT                   /locus_tag="MSMEG_0058"
FT   CDS_pept        77398..77925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72886"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNI8"
FT                   /protein_id="ABK72886.1"
FT                   /translation="MGDGSPYDPEYDDDHDSLAALDFPGTDDEPESSLDVFDVFDVGAP
FT                   ADEPWDAATSADGDGEDETPAPVFTVTNPPGTVTVAAYLDGRVHQIALSPKVVNMTERE
FT                   LADEIRVIADLAGEQARSAQYSFMLEGMREHGHDDAATRDFLTRDLNLPTPEQADANQA
FT                   QVFSTRYGGDHG"
FT   gene            77918..79642
FT                   /locus_tag="MSMEG_0059"
FT   CDS_pept        77918..79642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0059"
FT                   /product="ATPase, AAA family protein"
FT                   /note="identified by match to protein family HMM PF00004"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74506"
FT                   /db_xref="GOA:A0QNI9"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023835"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNI9"
FT                   /protein_id="ABK74506.1"
FT                   /translation="MVNHLAGMFGSAVGMMSNSRARALEIFTEITNYDESACDAWVGRI
FT                   GCGDTDRVTLFRAWYSRSNFGQLAGAAEISMNGVGARIPIGGIYSRDITYPINSPLAIT
FT                   MGFAVHEASEGNYTDAMEALEDAPAAGSEHLVSWVRAVIYGAGQRWTEVIDQVRGAERW
FT                   PDKFLAAAAGVAHGVAAANLGLFTEADRRLTEANDTPVAQACAPVIAWYLAMARRSQGN
FT                   EESAQVLLEWLQANFPEPKVTAALRDPAYRLETTTAEKIAARSDPWDPSSVVADTSARD
FT                   KLLVEAQAELDRQIGLGRVKEQIEAYRAATQMARIRAARGMKVAQTSKHMIFAGPPGTG
FT                   KTTIARVVANILAGLGVIAEPKLIETSRKDFVAEYEGQSAVKTSKTIDRALGGVLFIDE
FT                   AYTLVQERNGQTDPFGAEALDTLLARMENDRDRLVVIIAGYSNDIDRLLEVNDGLRSRF
FT                   ATRIEFDSYSPDEIVEISKVIATANDSRLDDTAAKRVLEAATTLSQRSLNGKPALDIAG
FT                   NGRYARQLVEAGEQNRDMRLARSLDFDSLGVDQLSEINGDDMAAAIASVHSRLNIGE"
FT   gene            79650..81089
FT                   /locus_tag="MSMEG_0060"
FT   CDS_pept        79650..81089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05108"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72695"
FT                   /db_xref="GOA:A0QNJ0"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="PDB:5CYU"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNJ0"
FT                   /protein_id="ABK72695.1"
FT                   /translation="MAGFRLTTKVQVSGWRFLLRRVEHAIVRRDTRMFDDPLQFYSRAV
FT                   FAGVVVSVLICLGAALMAYFKPLGKQGSDQLLVDRTTNQLYVMLPGSNQLRPVYNLTSA
FT                   RLVLGNASNPVAVKSEELNRISKGQSIGIPGAPYATPTGTPASQWTLCDTVAKPDSSAP
FT                   KVETSILIRTLAIDSGVGPIRADQGMLVSYEGANWLITEGGRHSIDLADRAVTSAVGIP
FT                   VTAKPTPISQGLFNALPNRGPWQLPQIPAAGAPNSVGLPENLVIGSVFRTATESDPQHY
FT                   VVLPDGVARVNNTTAAALRATNSYGLMQPPAVEASVVAKIPEQVYVSPLPDQPLDVLLR
FT                   QDSPVLCWSWQREPGDQAPKTTVIAGRRLPLPANAIGTGIDQIGGDSTVYIEGGQFVRL
FT                   QSPDPRVGESMYYIDPQGVRYGIANDDAAKNLGLAGPVNAPWQVVGLLVDGPVLSKEAA
FT                   LIEHDTLPADPNPRKVASGEG"
FT   gene            81089..83317
FT                   /locus_tag="MSMEG_0061"
FT   CDS_pept        81089..83317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0061"
FT                   /product="ftsk/spoiiie family protein"
FT                   /note="identified by match to protein family HMM PF01580"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74495"
FT                   /db_xref="GOA:A0QNJ1"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNJ1"
FT                   /protein_id="ABK74495.1"
FT                   /translation="MTTKKFTPTIKRGPRLTPGEINVAPPDDLGIDIPPSGMQKALPWV
FT                   MGGCMLGMIAIMVFTGVRQLSPYMLMMPLMMIMGTVGFMAGGGSGGKKVPEINADRKEY
FT                   LRYLAGLRTRVTSSASAQVAFFAYHAPHPDDLLSIIGTHRQWARQANSEFFAATRIGIG
FT                   AEIAVDRLLKPNTSGELAGGQAAPAPHLEPVSHMWVTKFLRTHGLIHDCPKLVQLRTFP
FT                   TVAVGGDPEAAEGLLTSMICHLAVFHPPDLVQIRVLTDNPEDPKWSWLKWLPHTQHQTD
FT                   TDAAGPTRLVYTRPDGLSDLTARGPHTADAAPGGPYVVVVDLTGGKAGFPPDGRAGVTV
FT                   ITLGAQRQAAYKLKVEKDGKAEDRLPNQPWREVTRVADRMTPGQAGRIARKLAGWSITG
FT                   TIIDKNVRVQKKVSNEWHHLVGAQSVEEVTPARWRMYADTDRDRLKIPFGHELKTGEIM
FT                   YLDIKEGAEFGAGPHGMLIGTTGSGKSEFLRTLILSLVATHHPDQINLLLTDFKGGSTF
FT                   LGMEKLPHTAAVVTNMEEEAELVSRMGEVLTGELDRRQSILRQAGMQVGAAGALSGVAE
FT                   YEKHRERGADLPPLPTLFVVVDEFAELLQNHPDFINLFDRICRVGRSLRVHLLLATQSL
FT                   NTGGVRIDKLEPNLTYRIALRTTSSAESKAVIGTPEAQYITNKESGVGFLRVGMEDPVK
FT                   FRSVYTGNNYVPAAPESSDREAKPKAQRQSQVRIHQFTTTPIFDTAVS"
FT   gene            83318..85099
FT                   /locus_tag="MSMEG_0062"
FT   CDS_pept        83318..85099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0062"
FT                   /product="ftsk/spoiiie family protein"
FT                   /note="identified by match to protein family HMM PF01580"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71362"
FT                   /db_xref="GOA:A0QNJ2"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNJ2"
FT                   /protein_id="ABK71362.1"
FT                   /translation="MSTEAEPRVLREVVLSQLATGESRAYKMWLPPLTDPTPVNELVER
FT                   DYQRRPLRFGLGIMDEPRRHRQEVWGVDVSAAGGNIAVGGAPQTGKSTFLQTLVVSAAA
FT                   THTPRQVQFYCVDLGGGGLMYLEDLPHVGGVATRAEPDRVNRVVAEVKAVLRAREQVFK
FT                   QYRVGSIASYREMRDDPNNPASQDPFGDVFLVIDGWPAFVAEFPDLEPAVQDIAGQGLA
FT                   YGVHVIITTPRWTELKSRVRDYLGTKIEFRLGDVNETQIDRITREIPANRPGRAVSLEK
FT                   HHLMMGVPRLDGVHSADNIVEAISSAVQQIADRHTDQAPQVRVLPERIYLHQLDPNPPG
FT                   PDSDYRTRWQVPLGVRESDLTVAYNQMHLTPHLLIFGAPKSGKTRIAHAVAQAICKRNS
FT                   PQQVRFMLADYRSGLLDAVPQSHLLDAGAINRNSATLEEAIKALAVNLKKRLPPPDLTT
FT                   AQLRARSWWSGPDVVLLVDDWHMVTAAAGMVSPMAPLGPLLPAAADIGLHVIVTCQMSM
FT                   AHRATMDKFVGAAYGAGSPTLFLSGEKNDFPSRDIIVKKRPPGQAFLVGPDGKEVIQAA
FT                   YVDPPEEEVFSPPSEGS"
FT   gene            85248..85541
FT                   /locus_tag="MSMEG_0063"
FT   CDS_pept        85248..85541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0063"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69830"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNJ3"
FT                   /protein_id="ABK69830.1"
FT                   /translation="MQPMTHNPGAEAVAAQVIANAARGLAGGTTASAAVTALVPAGADE
FT                   VSALAAVAFASEGVEALAANAFAQEELTRAGAAFAEIAGIYNAVDAANAATM"
FT   gene            85616..86911
FT                   /locus_tag="MSMEG_0064"
FT   CDS_pept        85616..86911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0064"
FT                   /product="ppe family protein"
FT                   /note="identified by match to protein family HMM PF00823"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70762"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNJ4"
FT                   /protein_id="ABK70762.1"
FT                   /translation="MWIALPPEINTARLMVGAGPAPMLQAAAGWEGLAVLLETQAAELA
FT                   AALTNLTSVWTGAASERAVAATMPMITWLQTTAAQAQKRALQASAQASSYSLALATTPP
FT                   LPEIEQNHITHGVLEATNFLGINTVPIALNEMDYFVRMWNQAAGAMDVYHAETTVNLLF
FT                   EPIMPMKPIVLPGVGETTAAAALAQTAPRVAEGVMRNAVIEGVSAIATIESVGLAAGHA
FT                   AAQANFAEQRGQGAAQKGENAGQEAGRESGKNMQQGMQMVMQMGSQAAQAPAQLASMFQ
FT                   SGVQTMTQPLQQATQMVSQFASMGGSERAMQVGLMGASPFSNHPMLGGSGPSTGAGLVR
FT                   AMSLPGAGGTAPRTPLLSNLLGISGEMKAAPAGAGSAAAGGLAPVGAGAGGGAGAPVAH
FT                   AGQNSKSGGKKDGLVAPTPLTYDLSEDEDDEW"
FT   gene            86997..87299
FT                   /locus_tag="MSMEG_0065"
FT   CDS_pept        86997..87299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75930"
FT                   /db_xref="GOA:A0QNJ5"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNJ5"
FT                   /protein_id="ABK75930.1"
FT                   /translation="MAAMNTDAAVLAKEAANFERISGELKGVIAQVESTGSALAAQMVG
FT                   QAGTAAQAALARFHEAAAKQVQELNEISANIHTSGTQYTSTDEDQAGTLASSMNI"
FT   gene            87331..87618
FT                   /locus_tag="MSMEG_0066"
FT   CDS_pept        87331..87618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0066"
FT                   /product="early secretory antigenic target, 6 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75559"
FT                   /db_xref="GOA:A0QNJ6"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNJ6"
FT                   /protein_id="ABK75559.1"
FT                   /translation="MTEQVWNFAGIEGGASEIHGAVSTTAGLLDEGKASLTTLASAWGG
FT                   TGSEAYQAVQARWDSTSNELNLALQNLAQTISEAGQTMAQTEAGVTGMFA"
FT   gene            87738..89162
FT                   /locus_tag="MSMEG_0067"
FT   CDS_pept        87738..89162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0067"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74525"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNJ7"
FT                   /protein_id="ABK74525.1"
FT                   /translation="MSADYDRLFHSSEPGKPVDDATITVDRDAILKATAATPRVPAGEK
FT                   PPADAPSGAMPVAPTQTQSAATPSRTAEPQVPPPMPPPPATAPQWPQNSMLRAPQQQQF
FT                   GPGARHEQPATLPPPAQRLAPGPAPSQLSDIDPEISGAWRAGQAVPAPAQPGPTSAASM
FT                   GNHRAIDALSHVGVKTNVKMPSQRGWRHWLYVMTRINLGLSPDEIYELDLHNRIRRNAR
FT                   DSYQIGVFGLKGGVGKTAVTVSLGSAMAKIRGDRILAIDADPDGGNLADRAGRQSAATI
FT                   ADLLADQELSRYNDIRAYTSMNSSNLEVLSSEDYSGAQREFNDDDWKGATAVVSRYYNL
FT                   VLADCGAGLFQKATRGVLSTISGLVIVASASIDGARQAAVTMDWLRQNGYQDLLGRSCV
FT                   VINHVTPGKPNVDVEDLVQQFERHVPPGRVIVLPYDKHIAAGTEIQLDLLSDTFQRRIT
FT                   ELAAALSDDFDRLERR"
FT   gene            89159..90691
FT                   /locus_tag="MSMEG_0068"
FT   CDS_pept        89159..90691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0068"
FT                   /product="probable conserved transmembrane protein"
FT                   /note="identified by match to protein family HMM PF04600;
FT                   match to protein family HMM TIGR02958"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABK76080"
FT                   /db_xref="GOA:A0QNJ8"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNJ8"
FT                   /protein_id="ABK76080.1"
FT                   /translation="MTSTAAAADTSSVTPGRPSTTRVTILTGKRMTDLVLPATAPIETY
FT                   IDETVSFLAELLEDAPKDVLAGFNFGEQGVWAFARPGAPPLKADESLDDAGVVDGSLLT
FT                   LVSVSRTERYRPLVEDVIDAIAVLDESPVFDRTALKHFVAIALPIVATIITVATLIAWT
FT                   RSGHGWWWAVALGVLGLGLLGGSMAAKSRYNSLDMSESLLLAATPALAGAVGLAVPLPR
FT                   GVDGLGAPQLAGAAAVVLLLTLATRGGPRKRAEVASFVAVTSIAVTAAAIAFGYGWQEW
FT                   VPAGAIAFGLIVVTNAAKLTVAVARIALPPIPAPGEHVSNDELLDPVVTPDSIDDASPT
FT                   WQAIIASVPESAARLQERSQLTRQLLIGFLSAGALILTVGAIAVVVQGHFFVHSMIVAS
FT                   LVTVICGFRSRLYAERWCAWALLAATVAVPTGLMIKLSMWWPDSAWIVMGIYTMLALIA
FT                   LIVVGATDGVRRVSPVTKRILELFDGAAIAAVIPLLLWIAGVYDLLRNLRLH"
FT   gene            91173..91874
FT                   /locus_tag="MSMEG_0069"
FT   CDS_pept        91173..91874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0069"
FT                   /product="translation initiation factor IF-2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70889"
FT                   /db_xref="GOA:A0QNJ9"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNJ9"
FT                   /protein_id="ABK70889.1"
FT                   /translation="MEASARAIPEPPDPFKTEGTDPLSKALADKTWQVEAPFIEGIGKT
FT                   KAEAQETARRIQEAADKYEQSDRTIAENLQSSTGRFDASTGTEGTSQGGLQGLEQLQQM
FT                   MQMPMQAVQMAAQVPTQMAQMAAQVPQTVMQGVQQIGQMSGGTGQDSAGPAAPQTDSPV
FT                   GKSKGGRERDDQQEQHEGAAADPAFTQQAPVTSQVPGAAASEPEAGHSEGRPRANGTVP
FT                   RPVPSDPAIVL"
FT   gene            92737..93072
FT                   /locus_tag="MSMEG_0070"
FT   CDS_pept        92737..93072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0070"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70287"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNK0"
FT                   /protein_id="ABK70287.1"
FT                   /translation="MCADLASAVVAFDEQTRAWQALDPKLPAAEWSPDHRAVMDDVAPV
FT                   MSANADNLERLGRASDNAIVEDFTVLAAQYQRGYVEAIPTYSSADNVLWQVVASLVKAV
FT                   NSGCKAS"
FT   gene            93072..95339
FT                   /locus_tag="MSMEG_0071"
FT   CDS_pept        93072..95339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69833"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNK1"
FT                   /protein_id="ABK69833.1"
FT                   /translation="MMGLGKLEKPKGGHFDRMVGPGAWPETEESEFSNRQAEILGIRQR
FT                   LTGAKESWQTHQSYLDSEATWAGTSARAANARVEQHTKSMVAHEHQLEKVEKWCGEAIG
FT                   LIGTVKEAIIGTVNSAVEAINEAAADADKNETDASSKIEKIKDLAYDFNKSIVQWGADT
FT                   VQGKEDIPSEPPKLPKDIFKNVEPATGSQDGEIRDGQADVLFMNSSLGGDASDVRASVK
FT                   PSRPVDTWEQDNVGLGEDASGVRPTPAIEPPVEQVEPVNSGLGGEQPDIRPAPPIPQPV
FT                   LGRPPSAPAPTAGGPSGPGSAISPSAPTPVSSSGPPTGGGGGTSIAPSSPLSSGSSLGG
FT                   SGAEQAADASAAALGQNPVGRAPVDPLQQFTQSFSDSAGTPVHAASTGGGSVPPPPLTP
FT                   PPTVPAGESMGPASAHSTPTSLNSAPAAPVQPPAAGGPMGAASGMPVAPPPLGPPPTPP
FT                   PAAPVAAPPPAAAPPPAQPNAAGGGAQVAPIPVSAARAERDLAQRAVRRSGVDPMETAR
FT                   RIAAALNAPGMTNVEDFKFFWVTGLTADGKIVVANNYGIAYIPQQVHLPEQVHMASADE
FT                   SISPAERARWVNEPIVAVQRWAEHHGKNLRAVIATEDQLKNSDAGVHHEVLRPEDIPEG
FT                   GKMAGRDRLQVIAPDVSAQLARVSDTDLVKILPPAPADANPPEDRRKLLWDNVWKPLAS
FT                   RSTKRGERHLAAFVAYAAHAQEHALYAAHTAALPDDQRQAIREFIYWQHVGQLTADALS
FT                   PA"
FT   gene            complement(95440..96300)
FT                   /pseudo
FT                   /locus_tag="MSMEG_0072"
FT                   /note="This gene is disrupted by an IS1549 element.;
FT                   IS1549, transposase, interruption-C; identified by
FT                   similarity to GB:AAC38260.1"
FT   gene            96469..97935
FT                   /locus_tag="MSMEG_0074"
FT   CDS_pept        96469..97935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0074"
FT                   /product="IS1549, transposase"
FT                   /note="identified by similarity to GP:2935133; match to
FT                   protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74418"
FT                   /db_xref="GOA:A0QNK2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNK2"
FT                   /protein_id="ABK74418.1"
FT                   /translation="MQIVWSTRRGSRNIEHVGSAHDEAELAALKASAAERLAANQAVLD
FT                   LEVSPPAGSEPLPITSSQMTHLWDGLCSAYRILGFDSAAEGDNVFRDLVLARIIEPSSK
FT                   ADAGRVLTEVGVEPASYATVKRRLPIYAQPQWRQSLAAASARRAGLGPASLVLFDVSTL
FT                   YFETDAGDGFREPGFSKERRLEPQITLGLLTDAAGFPLTVEAFEGNRAETATMLPVINA
FT                   FKAAHQLTDVTVVADAGMISEANQVALQSAGLSYILGAKIPFLPDVVREWRDKHPDEAI
FT                   PDGLVLTQPWPATSSEKARGIPDRVIHYQFRHDRARRTLRGIDEQVAKAQRAVDGHAPV
FT                   KRNRYIQLTGATKSVNRTLEAKTRALAGWKGYTTNLVGQPASFVIDAYHQLWHIEKAFR
FT                   MSKHDLQARPIYHHLRESIEAHLSIVVAAMAVSHFIETQTGWSIKKFVRTARRYRTVKI
FT                   KAGTQTLTAADPLPEDLRAVLIKIRADGAH"
FT   gene            complement(97891..99105)
FT                   /pseudo
FT                   /locus_tag="MSMEG_0073"
FT                   /note="This gene is disrupted by an IS1549 element.;
FT                   IS1549, transposase, interruption-N; identified by
FT                   similarity to GP:2935133; match to protein family HMM
FT                   PF01609"
FT   gene            99229..99585
FT                   /locus_tag="MSMEG_0075"
FT   CDS_pept        99229..99585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0075"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73809"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNK3"
FT                   /protein_id="ABK73809.1"
FT                   /translation="MAGRDRLQVIAPDVSAQLARVSDTDLVKILPPAPADANPPEDRRK
FT                   LLWDNVWKPLASRSTKRGERHLAAFVAYAAHAQEHALYAAHTAALPDDQRQAIREFIYW
FT                   QHVGQLTADALSPA"
FT   gene            99798..101360
FT                   /locus_tag="MSMEG_0076"
FT   CDS_pept        99798..101360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0076"
FT                   /product="antigen MTB48"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABK76212"
FT                   /db_xref="GOA:A0QNK4"
FT                   /db_xref="PDB:4WJ1"
FT                   /db_xref="PDB:4WJ2"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNK4"
FT                   /protein_id="ABK76212.1"
FT                   /translation="MSEELQYELPGLERKAHECESTRPEGPGDATKPDELATTASVYSK
FT                   LMASAAKLKATFAAGDREGERIAAAIRAAAGAYQKIEEQKAAELSRQMNGSDAPPPAAE
FT                   AVVPDMSGIPGPLAIPSMEYPSAAAAADEMDWEAAARIIHSGDTQALSMKYFRDQWRDY
FT                   QSTLEGHGRHFANPAEGWAGAAAETCAEAQRRLSTWWADMGAECGRLAQEATTFVDAHD
FT                   KLVANHPTLENVREFEETEWASEWDRQNAWAMLQEQSEDALEAYANGSQIQEIRPGKPP
FT                   SIGGLPAVNDGDVQASPTSAPGGPGGPGSGTPGGGGAGGGGGTPEMPELPSTDPSMSPM
FT                   SANSAGEEQSSGSPSSGGSPSGSPSGGSPSGGGAPSGAGMPDGGLPSDLPGGPDIPGLD
FT                   DPSLKPASAGGGGGGGVGGGGGGMPAAPLGPAVGADSVSPSPSSTRGGGVGVPGGPGGG
FT                   AGGMMGGGMGGMGAGHGQGQGKEKKRDPKLAPDEDLYTEDRAHTEGVIGHRARREKDSG
FT                   KQQ"
FT   gene            complement(101776..102093)
FT                   /locus_tag="MSMEG_0077"
FT   CDS_pept        complement(101776..102093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0077"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72283"
FT                   /db_xref="GOA:A0QNK5"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNK5"
FT                   /protein_id="ABK72283.1"
FT                   /translation="MSGDLKVTAAELRELSERQRQIVENIATAAQATNNTTALVTVTHG
FT                   PVCAPTIAAIGAAGFSRDAAAAAMQGVSTSLAEKLDEAATNYERTDAAKAGDLDGEMHG
FT                   S"
FT   gene            complement(102127..102702)
FT                   /locus_tag="MSMEG_0078"
FT   CDS_pept        complement(102127..102702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0078"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75780"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNK6"
FT                   /protein_id="ABK75780.1"
FT                   /translation="MGDTKLAAAAATPIIAFGLRTMTIMSNLTGVEGPEHGDRYGQGAE
FT                   AFSGVSSGLDGTRSPDSWEGSSSDAYSDRNREQKERAALMAETDRVVKEVLDKEAGEIE
FT                   DTRRQIDHQMTELTWLIPAAIAAKFWNAPPGSGEIASQIIQWGGVAKTLPIATQRMYRM
FT                   IADSSENATLIRRAGATYDRIAAEAQAQ"
FT   gene            complement(102936..103682)
FT                   /locus_tag="MSMEG_0079"
FT   CDS_pept        complement(102936..103682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0079"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70015"
FT                   /db_xref="GOA:A0QNK7"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNK7"
FT                   /protein_id="ABK70015.1"
FT                   /translation="MLLTCLGIIEAALLTWAVVTFLRGSYVTALLCVGIAAWWTIPAVA
FT                   QFIMPTLMPRVTCANGELTIRPDRRLDRMMLIATLGGAPLLGLTAVLSALGRMDLPTQS
FT                   LGSEGGVFAWVPMICGGLAGVFTVFFVLIVKFGGIGYLRLGPEGFERAEAFRKTAKRHW
FT                   DEVTDVSDTAPDRPQAIYPLVITTDDGEQHSIDNSAMYTREGRTLYEFVRFYWLHPELR
FT                   VELADDRAVERFHEMQAAQRERDSRS"
FT   gene            complement(103713..104243)
FT                   /locus_tag="MSMEG_0080"
FT   CDS_pept        complement(103713..104243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71366"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNK8"
FT                   /protein_id="ABK71366.1"
FT                   /translation="MADHNTPFSSSDDDWGDDSAAFDSAPDASELGVFGEYLPTEGDAE
FT                   SSLDALDAVASAPISEVDEPDPGPLFSATNPPGTITVTAYLSGWLQRIDLAPSVVNMTE
FT                   SQLAREIADLAQIATKKAGAGQYVFLLYSTLQQVGDSPGVRSMLKETLGLPTPEEAAEA
FT                   EAAYTARYTRERN"
FT   gene            complement(104251..104583)
FT                   /locus_tag="MSMEG_0081"
FT   CDS_pept        complement(104251..104583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70644"
FT                   /db_xref="GOA:A0QNK9"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNK9"
FT                   /protein_id="ABK70644.1"
FT                   /translation="MSDDDIHPQVAAVLRQAQRLQSVMDDQLHKMNTETFTAADETDTV
FT                   EVTLNGHHHLTSVYIEDGLLRLGAETVEHRLNEALQKATAAATASIEADRERLDALVAD
FT                   ITAEDV"
FT   gene            complement(104594..105988)
FT                   /locus_tag="MSMEG_0082"
FT   CDS_pept        complement(104594..105988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70621"
FT                   /db_xref="GOA:A0QNL0"
FT                   /db_xref="InterPro:IPR021368"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNL0"
FT                   /protein_id="ABK70621.1"
FT                   /translation="MNFLRQFGFRFTTGHGIWAATLIPACIAICMHFDLLWLGITLGAL
FT                   IALFSVLTIRGLRITGWVRAIFSWRRRHRSTPDIASEPAVGSTVMPGDHVAVRWQGDYL
FT                   IAVIELVPRPFTPTVIVNGSAMTDDVVNTKLVERLLEAHCPDLEADVVSAGYRVGKTAP
FT                   ASLIALYEQVVGPYPAPANRRTWIVLRADPEKTQRSAHRRDSGVSGLARYLVASATRIA
FT                   DQLASNGVDARCCRSFDDYEKATEISYERETWSSIKGRSTFTAAYTAPGGPDMWWSARA
FT                   DHTITRVRVRPGAAPSSAILLTTLANPTTPRGFSCLFGGQRAALQGIVPVSDKHYDLPI
FT                   GSAGVLVGETADRYPVYMPFDNVDVSINLGDARLFTQFVIRSAAAGAVVTLGPQFREFA
FT                   TMINGRVGRTPRIGWPNATTYLGPHQGVGRVILRPNFIDTPRHRQLPIQLINPREESRY
FT                   QMALEQ"
FT   gene            complement(105985..107334)
FT                   /locus_tag="MSMEG_0083"
FT   CDS_pept        complement(105985..107334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0083"
FT                   /product="membrane-anchored mycosin mycp1"
FT                   /note="identified by match to protein family HMM PF00082"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70081"
FT                   /db_xref="GOA:A0QNL1"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="PDB:4J94"
FT                   /db_xref="PDB:4KB5"
FT                   /db_xref="PDB:4KPG"
FT                   /db_xref="PDB:4M1Z"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNL1"
FT                   /protein_id="ABK70081.1"
FT                   /translation="MQRVAVMVLAVLLALFSAPPAWAIDPPVIDAGAVPPDETGPDQPT
FT                   EQRKICATPTVMPNSNFADRPWANDYLRIQEAQKFATGAGVTVAVIDTGVNGSPRVPAE
FT                   PGGDFVDAAGNGMSDCDAHGTMTAAIIGGRPSPTDGFVGMAPDVRLLSLRQTSVAFQPK
FT                   GARQDPNDPNTTQTAGSIRSLARSVVHAANLGAQVINISEAACYKVTRRIDETSLGAAI
FT                   NYAVNVKGAVIVVAAGNTGQDCSQNPPPDPSVPSDPRGWREVQTIVSPAWYDPLVLTVG
FT                   SIGQNGQPSNFSMSGPWVGAAAPGENLTSLGYDGQPVNATPGEDGPVPLNGTSFSAAYV
FT                   SGLAALVKQRFPDLTPAQIINRITATARHPGGGVDNYVGAGVIDPVAALTWEIPDGPEK
FT                   APFRVKEVPPPVYIPPPDRGPITAVVIAGATLAFALGIGALARRALRRKQ"
FT   gene            complement(107565..107822)
FT                   /locus_tag="MSMEG_0084"
FT   CDS_pept        complement(107565..107822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0084"
FT                   /product="phosphocarrier protein hpr"
FT                   /note="identified by match to protein family HMM PF00381;
FT                   match to protein family HMM TIGR01003"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69765"
FT                   /db_xref="GOA:A0QNL2"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNL2"
FT                   /protein_id="ABK69765.1"
FT                   /translation="MPSKTVTVGSAVGLHARPAAIIAEAVVNAGVPVSLSMDGGEPVDA
FT                   GSALMIMTLGAEKGAQVTVSSDDADVLAKVAELVEQDLDA"
FT   gene            complement(107834..109849)
FT                   /locus_tag="MSMEG_0085"
FT   CDS_pept        complement(107834..109849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0085"
FT                   /product="PTS system, Fru family protein, IIABC components"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM PF02379; match to protein family HMM TIGR00829;
FT                   match to protein family HMM TIGR00848; match to protein
FT                   family HMM TIGR01427"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70442"
FT                   /db_xref="GOA:A0QNL3"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNL3"
FT                   /protein_id="ABK70442.1"
FT                   /translation="MTQPIITDDLVLLDVDAGSDKEAVIARLAGALGGAGRASDTAGLV
FT                   GAAMAREAQSATGLPGGIAIPHCRSPYVDTATIGFARLDPKVDFGAPDGPADLAFLIAA
FT                   PESGGSEHMKLLSSLARALVRKDFVESLRSASSTQEVVELVNSAVKPAAAPPASAPKPA
FT                   AEPKPAADKSVSIVAVTSCPTGIAHTYMAADALKAAAEKAGVACTVETQGSAGSTPLSA
FT                   ETIAAADAVIFATDVGVKDRQRFAGKPVIASGVKRAINEPDKMVAEAISAASDPGAPWV
FT                   AGQAAESASAPAGDVGWGTRIRQILLTGVSYMIPFVAAGGLLIALGFLLAGYEIGNTPD
FT                   GETQSLGNIIATHNSLTNLPSGGVAQYLGAVLFTLGGLAFSFLVPALAGYIAFAIADRP
FT                   GIAPGFTAGAVAVFVGGGFIGGIVGGLIAGFAALWISRIGVPQWARGLMPVVVIPLFAS
FT                   MVVGLLMFLLLGRPLAALTSGLTNWLGGLSGGSAIALGVILGLMMCFDLGGPVNKAAYA
FT                   FATASLVNPTQANLQIMAAVMAAGMVPPLAMALATVIRPRLFSEPERENGRAAWLLGAS
FT                   FITEGAIPFAAADPLRVIPSMMVGGAVTGATVMAAAVTLRAPHGGIFVFFAIGNLLWFV
FT                   IAVALGTVVSALTVIAAKQFTKRPVTAPEAPALATT"
FT   gene            complement(109846..110829)
FT                   /locus_tag="MSMEG_0086"
FT   CDS_pept        complement(109846..110829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0086"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74819"
FT                   /db_xref="GOA:A0QNL4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNL4"
FT                   /protein_id="ABK74819.1"
FT                   /translation="MIVTVTLNPSLDRTVTLTAPLTRGAVQRVDSVTVEAGGKGINVAK
FT                   ALTSAGVDALALLPAATDDPLLTALRCADVPFAAVPIAEPVRTNIAITENDGTTTKLNE
FT                   RGATLDAAALDAITRCVVDEAQHAAWVVLSGSLPPGVPPQWYADLVAKLAPLPCRVAVD
FT                   TSDAPLAALASKLSTASPELMKPNVEELASISGVAEADLETTVAEGDLSLVVAAAVKLV
FT                   ERGVGAVLATLGAAGAVLVDGTGAWFAAPPPITARSTVGAGDASLAGYLRAEVGGAEPS
FT                   QRLRMAVAYGSAAAALPGSALPVPAQLDVDAVRVTGLITTNREVLQ"
FT   gene            complement(110826..111593)
FT                   /locus_tag="MSMEG_0087"
FT   CDS_pept        complement(110826..111593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0087"
FT                   /product="glucitol operon repressor"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70972"
FT                   /db_xref="GOA:A0QNL5"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNL5"
FT                   /protein_id="ABK70972.1"
FT                   /translation="MYAEERQQAIAALVLSRGRASVAELAQAYDVTTETVRRDLAVLDR
FT                   AGVVRRVHGGAVPVRTLHLVEAGVGERDSTRAEQKDAIAAAAAEFFPPTGSSVLLDAGT
FT                   TTARVAAHLPTDRELTIVTNSVPIASRVAAMPNVTLQLLGGRVRGLTQAAVGEQALRVL
FT                   DALRVDIAFIGTNAISLRHGLSTPDTDEAAVKRAMVSAANYVVVVADSSKMGQEDLIRF
FT                   APIDCVDTLITDAEIDPADRDGLTEQGVEVVIA"
FT   gene            111735..113369
FT                   /gene="ptsI"
FT                   /locus_tag="MSMEG_0088"
FT   CDS_pept        111735..113369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /locus_tag="MSMEG_0088"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="identified by match to protein family HMM PF00391;
FT                   match to protein family HMM PF02896; match to protein
FT                   family HMM PF05524; match to protein family HMM TIGR01417"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75256"
FT                   /db_xref="GOA:A0QNL6"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNL6"
FT                   /protein_id="ABK75256.1"
FT                   /translation="MVPGVRYAPVIRPGRLPVIELPDTEVAEPDRAAEAGRFRAAATAV
FT                   TERLRARADRATGAAAEVLGATATLAQDRAWLGAADKRIAAGAPAVRAVSEAVDQFIDM
FT                   FTKMGGLMAERVTDLRDIRDRVVAELSGYPEPGVPLPELPSILCATDLAPADTAGLDPE
FT                   LVVGLATTLGGPTSHTAIIARQLGIPCVVAVSGLDDIEAGRMVLLDGTAGTVTADPDPS
FT                   EAATAVDAARRSAATARNWHGPGATGDGHAVAIMANVADGAAARAARETPAEGIGLFRT
FT                   ELCFLNRDTEPTVAEQAAIYGEVLDAFSGAKVVIRTLDAGSDKPLKFAGHPPEEANPAL
FT                   GVRGIRIAEANPGLLEHQLDAIADAAENTRSAPWVMAPMIATPDEAKRFAAQVRSRGLT
FT                   PGVMVEVPAAALLAEQILDHVDFLSIGTNDLAQYTMAADRMSAELAALTDPWQPAVLAL
FT                   VGTAARAGAAADKPVGVCGEAAADPLLACVLVGLGVTSLSAAAAAIPSVGAKLATVTVQ
FT                   QCREAARAVLATAGPAEARAAALGILT"
FT   gene            113433..114407
FT                   /locus_tag="MSMEG_0089"
FT   CDS_pept        113433..114407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0089"
FT                   /product="chromosome condensation protein"
FT                   /note="identified by match to protein family HMM PF02678;
FT                   match to protein family HMM PF05726"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74968"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNL7"
FT                   /protein_id="ABK74968.1"
FT                   /translation="MPAITADTLTLPRIAAPSAADTERPVRSITTGPRGYEGEGFPVVR
FT                   AFAGVSAADLDPFVHMDQMGEVEYEPGEPRGTDWHPHRGFETVTYMIDGRFAHQDSHGG
FT                   GGLITDGATQWMTAGSGILHIETPPAELVESGGVFHGIQLWVNLPRKDKFASPRYQAIE
FT                   GGQVKLLSSSDGGALVRIIAGEIGGEQGPGSTYTPITMAHSTIEPGAQLNLPWNRDFNA
FT                   LVYVLSGRGSVGPVGHPIRQGQLAVFGPGDRITITADASQDSNRPALEVLLLGGKPIRE
FT                   PVFHYGPFVMNSKSELIQALEDYQAGRFGQIPANALMPHRPLD"
FT   gene            complement(114447..116594)
FT                   /locus_tag="MSMEG_0090"
FT   CDS_pept        complement(114447..116594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73376"
FT                   /db_xref="GOA:A0QNL8"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNL8"
FT                   /protein_id="ABK73376.1"
FT                   /translation="MLLTPAKLWRRAAERLRERDPEYDALRRAARAGVVLPIAAAIGFA
FT                   VGGGSQTPLFSIFGAVSLLITADFPGNRPARALAFAGLAFNGAVLIVLGTLIAPHVWLS
FT                   VVSMFVIGVVVSFSGVLSEVVAAGQRATLLLFVLPLCTPVGPIADRLLGWVIALVVCVP
FT                   AALFLFPPRHHDELRRTAARVCRVLAYRLEGSASARDVNRAMNELYESFLGADYRPVAL
FT                   TAGSRALVRVVDDLGWISDRVTDSTGEILGEMRDPVVRVLRDSAALLRIHDPARRAERS
FT                   ADLRAALEELRTVSQGTYREGIAAILGTPDDADAVEVGKALLVRRTIAATVAVTGRVIR
FT                   NAALADARPVWARVLGRRLPETGSADWIMPETTAVAEIAKGFLSTRAVVLRNSLRTGLG
FT                   LALAVAVTHVFPVEHGFWVVLGAMSVLRSSALTTGTRVVRAVAGTALGFVIGAVLIELV
FT                   GVQPVVLWILLPIVAFGSAYVPEVASFIAGQAAFTMMVLINFNLIAPTGWQVGLIRIED
FT                   VVVGALVGIVVSILLWPRGARASVTKAIDAARAAGAELLEAAVLRVTRGASEEATDRVI
FT                   ALSHSALEASRTLDDTVRHYLSESGGPSDQRAPIVRSATRAIRVRAAAELIADVVPPPL
FT                   EAYQETRKTIEAHARIICARLTGEDTTSVFVPIGETFVLALRAEATGGDLAVSAALPLV
FT                   TVAAHIGELELLYPQPVESVH"
FT   gene            complement(116600..117193)
FT                   /locus_tag="MSMEG_0091"
FT   CDS_pept        complement(116600..117193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0091"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74135"
FT                   /db_xref="GOA:A0QNL9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNL9"
FT                   /protein_id="ABK74135.1"
FT                   /translation="MTSMASVVSRESYFDTGMDVLSDLGYGGLKLAEVCNRLGVTTGSF
FT                   YHYFPNWSAYTRELIEHWREARTLRVVEAVRADPDPHRRVETLIREALALPHGAEAAIR
FT                   VWSSLDPDVYTVQSVVDRLRYDILFEAAREIIGDDRNAGYFAAWGVYVIVGYEQSTLPR
FT                   DGDALGWIAFQLRDALSTGRFAPSSDPTHGNTLN"
FT   gene            117306..117941
FT                   /locus_tag="MSMEG_0092"
FT   CDS_pept        117306..117941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0092"
FT                   /product="probable transcriptional regulatory protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71501"
FT                   /db_xref="GOA:A0QNM0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNM0"
FT                   /protein_id="ABK71501.1"
FT                   /translation="MAHIASRGPGRPPAAKAAETRERILSAAREVFSELGYDAATFQAI
FT                   AIRADLTRPAINHYFGSKRVLYREVVEQTNATVIAAGVARAREATSLLGRLSAFFAAAM
FT                   DAESADRSSAAFLVTSVLESQRHPDLVSEEQDALLNSRKFVAWAVNDAIERGELTTDTD
FT                   IPAIVEMLVAVMWGMGFYAGYVGRSEELAAIVDKFEMLMANKLWQLRD"
FT   gene            118003..118965
FT                   /locus_tag="MSMEG_0093"
FT   CDS_pept        118003..118965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0093"
FT                   /product="methyltransferase"
FT                   /note="identified by match to protein family HMM PF02409;
FT                   match to protein family HMM TIGR00027"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70224"
FT                   /db_xref="GOA:A0QNM1"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNM1"
FT                   /protein_id="ABK70224.1"
FT                   /translation="MTDVRETPSVRSARDSWGITESVGATALGVAAARAAETAQADPLI
FT                   RDEFAFLLVSAAGPTWAQMAVSDPHWLGADADARRIHEISRNYQAVRTHYFDEYFSDVA
FT                   HAGIRQVVILAAGLDSRAFRLDWPAGTTVFEIDQPKVLEYKTATLDAHGAVAKARYVPV
FT                   PADLRDDWPAALVEAGFDPAQPTAWLAEGLLPYLPADAQDRLFELVGVNSAPGSRIAVE
FT                   AFNMSPERYTEERRAQRRARGEQMRKQLDLDIDVDALMYTADDRADAAQWLSEHGWQVE
FT                   AVPSADEMARLGRPAAEADLAEFGMDGVLMRARLDGERL"
FT   gene            118962..119897
FT                   /locus_tag="MSMEG_0095"
FT   CDS_pept        118962..119897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0095"
FT                   /product="methyltransferase"
FT                   /note="identified by match to protein family HMM PF02409;
FT                   match to protein family HMM TIGR00027"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69783"
FT                   /db_xref="GOA:A0QNM2"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNM2"
FT                   /protein_id="ABK69783.1"
FT                   /translation="MSSLRTDDDTWDIATSVGSTAVMVAAARAGETERDDALIRDPYAK
FT                   ILVAGAGTGVWETVLDSEFAAKIENLDPEAAAIFAHMGNYQAVRTHFFDAYYREAADAG
FT                   IRQIVILASGLDSRAYRLDWPAGTTVYEIDQPKVLEYKSATLREHGIEPVAQRREVPVD
FT                   LRFDWPTALHDAGFDASLPTAWLAEGLLMYLPAEAQDRLFELVTELSAPGSRIAVETAG
FT                   VAATDRREAMRERFKKFADQLNLSSALDIQELVYDDPDRADVAEWLDAHGWRARGVHAL
FT                   DEMRRLDRLVELPDDPDRAAFSTFVTAQRL"
FT   gene            complement(119878..120057)
FT                   /locus_tag="MSMEG_0094"
FT   CDS_pept        complement(119878..120057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0094"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74636"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNM3"
FT                   /protein_id="ABK74636.1"
FT                   /translation="MRKFGVATGMAVAGGLVAAVVGLPNPASADPGDQPWVNTLGPNVT
FT                   VLKVSNSVSRASER"
FT   gene            120261..121115
FT                   /locus_tag="MSMEG_0096"
FT   CDS_pept        120261..121115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0096"
FT                   /product="peroxisomal hydratase-dehydrogenase-epimerase"
FT                   /EC_number="4.2.1.-"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72402"
FT                   /db_xref="GOA:A0QNM4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNM4"
FT                   /protein_id="ABK72402.1"
FT                   /translation="MQDRVVVTGAGGGLGREYALTLAREGASVVVNDLGGARDGTGSGS
FT                   AMADQVVAEIKEAGGRAVANYDSVAESEGAENIIKTAIDEFGKIDGVVSNAGILRDGTF
FT                   HKMTYDNWDAVLKVHLYGGYNVIRAAWPHFREQSFGRVVVATSTSGLFGNFGQANYGAA
FT                   KLGLVGLINTLAQEGAKYNIKTNAIAPIAATRMTQDILPPEVFEKLTPEYVAPVVAYLM
FT                   TEELEDTDSVFIVGGGKIQRTALFQNEGVTFSDGVPTVDDIAAKWNEITDLSAAQLASF
FT                   KLG"
FT   gene            121119..122084
FT                   /locus_tag="MSMEG_0097"
FT   CDS_pept        121119..122084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0097"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69988"
FT                   /db_xref="GOA:A0QNM5"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNM5"
FT                   /protein_id="ABK69988.1"
FT                   /translation="MKALVAQALTGTSGLAYADVDEPVSGDAVIIDVGAAGVCFPDLLL
FT                   LRGEYQMRLDPPFIPGMEVAGTVRSAPESSGFAPGQRVSAFTMIGGYAEQVAALPDNVI
FT                   PTPENLDDASAAALLGNYYTTQFALARRGALVPGETVLVLGSAGGIGTASIQLAKAHGA
FT                   GVIAMVHRAGAEDFVSGLGADVVLPLTDGWRDAVLAATDGRGVDLVVDPIGGPAFDDAV
FT                   RVLAPEGRLLVIGFAAGAGIPTVKVNRLLLRNVSVVGVGWGEFVRRNPGAQAAVGAELG
FT                   KLVADGLRPPPPVRYRLADGAAALDAMAAGEVRGKLVLEP"
FT   gene            122105..122818
FT                   /locus_tag="MSMEG_0098"
FT   CDS_pept        122105..122818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0098"
FT                   /product="methyltransferase"
FT                   /note="identified by match to protein family HMM PF01209"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74306"
FT                   /db_xref="GOA:A0QNM6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNM6"
FT                   /protein_id="ABK74306.1"
FT                   /translation="MDTALRRAMDLLIDPPAEPDFSKGYLDLLGRGDSTAPKNTGLIQK
FT                   AWASPLGSKLYDRAQLLNRRLVASTRPPVEWLRIPPGGTVLDIGCGPGNITAQLARAAG
FT                   LDGLALGVDISEPMLARAVAAEAGRQVGFVRADAQQLPFRDEVFDAATSLAVFQLIPDP
FT                   VAAVSEIVRVLKPGGRVAIMVPTAGAVKPVTFLARGGARIFGDDELGDIFENVGLVGVR
FT                   VKTHGFIQWVRGTKL"
FT   gene            122829..123314
FT                   /locus_tag="MSMEG_0099"
FT   CDS_pept        122829..123314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0099"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72076"
FT                   /db_xref="GOA:A0QNM7"
FT                   /db_xref="InterPro:IPR007403"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNM7"
FT                   /protein_id="ABK72076.1"
FT                   /translation="MSTVGIVLVAFAIAVGLIGIVVPILPGGLLVFGAIAVWAIVERTA
FT                   AAWVVLGVAAAVFVAAEVIKYLWPVRRMRAAEVGTWSLVAGGVLGVIGFFVIPVIGLVI
FT                   GFVAGVYLAELAARHEHRRAWVSTVHALKGVALSVGVELTGALLATIAWVVGVVVTN"
FT   gene            123311..123865
FT                   /locus_tag="MSMEG_0101"
FT   CDS_pept        123311..123865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74977"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNM8"
FT                   /protein_id="ABK74977.1"
FT                   /translation="MNDNATWTLSASDGELLLHTGVTGTAARVGHRLTIAMRSWEATVF
FT                   WEGDGAGAEPVKAELTIDIDSLEVVGSEGGMTPLSGAEKTLIRNNALKLLRARRFPQAR
FT                   FVSSDIERDGDIVRMHGAFELFGKVRDHVLEVRIDDGVISGQTVVRHSDYGIKQYSMLI
FT                   GAMKVADDVRVTFTATHRAAR"
FT   gene            complement(123837..124643)
FT                   /locus_tag="MSMEG_0100"
FT   CDS_pept        complement(123837..124643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0100"
FT                   /product="phosphotyrosine protein phosphatase ptpb"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73175"
FT                   /db_xref="GOA:A0QNM9"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNM9"
FT                   /protein_id="ABK73175.1"
FT                   /translation="MTGPDGTSLELGGAWNFRDVAQETGIRPGVLYRSSELSKLSDDGR
FT                   AVFKRLGITDVADLRSHQEVQRRGPGQVPDGVAVHLLPFHPDDTSGQDAPHESTFQRVM
FT                   SESPDGEDVTESARRYMTEVYEEFPTLPGAHNAVRQVVSLLAAGRPVIAHCFAGKDRTG
FT                   FTVATVLDAAGVDRDDIFADFLRSNEAITPLRNRIMDSVRARSGDEPEIITFAEARLTD
FT                   EVLGVREEYLAAAWKRLEEAYGSLSGFMTAAGISPEELTALRDALR"
FT   gene            complement(124640..125875)
FT                   /locus_tag="MSMEG_0102"
FT   CDS_pept        complement(124640..125875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0102"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72733"
FT                   /db_xref="GOA:A0QNN0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNN0"
FT                   /protein_id="ABK72733.1"
FT                   /translation="MAGMDFAMSAKAADYHKRLTDFMVEFVFPAEAEYHAYREEKGPKD
FT                   HTVPPVVEELKVKAKDRGLWNLFLPAESGLTNLEYAPLAEITGWSMEIAPEALNCQAPD
FT                   TGNMETLHLFANEAQRKQWLEPLLAGEIRSAFAMTEPAVASSDARNIETTMLRDGDHYV
FT                   INGRKWWITGAADPRCKILIVMGRTNPDAAAHQQQSMILVPVDTPGVDIQRSLPVFGWQ
FT                   DQHGHCEIVFNDVRVPAENLLDVEGSGFAIAQARLGPGRIHHCMRAIGAAERALTLMVD
FT                   RVQKRVAFGKPLAEQGVVREAIAKSRNEIDQARLLCEKAAWTIDLQGNKAAHVLVSQIK
FT                   SVAPQVACNVLDRAIQVHGAAGVGDDFPLARLYAWHRAMRLFDGPDEVHMRTIARSELG
FT                   REKSPLALAVTK"
FT   gene            complement(125900..127099)
FT                   /locus_tag="MSMEG_0103"
FT   CDS_pept        complement(125900..127099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0103"
FT                   /product="major facilitator family protein transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71320"
FT                   /db_xref="GOA:A0QNN1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNN1"
FT                   /protein_id="ABK71320.1"
FT                   /translation="MVTAQPEPAVWQGHTRGSSDYRRLLAALFCAGVATFAQLYSPQAV
FT                   LPLIASDLGTGAAHAALAISAATIGLAFGVLPWAALADRVGRVQVITVSVVVATVLGLL
FT                   VPFAPTYALLLCGRFVEGLALAGVPAVAVAYLTEEINAGHAARAAGTYVAGTTIGGLAG
FT                   RLVTGPVAEFAGWRVGVLTVALLCGMAALAFVKLAPAAQGFTPARTHWDLGRRLLTNLR
FT                   SPRQLALFAQGFLLMGGFVAVYNFLGFRLSAAPFNLPQTVVSLVFLAYLAGTWASARAG
FT                   AEATRFGRKPVLLVSIATMIAGVAVTMSTNAVVVLVGLVIATAGFFGAHAIASGWVGAE
FT                   AGDSKAQASALYNLFYYGGSSAVGWLGGLAFDAAGWSAVAGTVMGLAALAGLIAFALAR
FT                   "
FT   gene            complement(127143..128024)
FT                   /locus_tag="MSMEG_0104"
FT   CDS_pept        complement(127143..128024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0104"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69807"
FT                   /db_xref="GOA:A0QNN2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNN2"
FT                   /protein_id="ABK69807.1"
FT                   /translation="MHLDELSWFVVLAETEHVTDAAAELGISQPTLSRALARLEDEVGV
FT                   PLFDRVNRRLQLNAYGEILLEHARRTITEMRSATERIAAMRDPDTGLVRLAFLHSQAGS
FT                   FVPDLLRRFRAHAPHVQFSLTQGAAHDLLERLAGGQVDLAITSPRPEGFQWRGLYVERL
FT                   CLAVPRGHRLASRSRITLADAGDEPFVGLAPGFGLRQLTEELCAEAGITPHVVFEATEI
FT                   PTMEGLVAAGFGVAVVPVPHAGRAEPGAEYIALAQASAKRQLGLAWPADRPLPPAAERF
FT                   AQFVIRTTHDVE"
FT   gene            128084..128734
FT                   /locus_tag="MSMEG_0105"
FT   CDS_pept        128084..128734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0105"
FT                   /product="DNA-binding response regulator, LuxR family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74061"
FT                   /db_xref="GOA:A0QNN3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNN3"
FT                   /protein_id="ABK74061.1"
FT                   /translation="MLTRMSDKVRVVVGDDHPMFREGVVRALTSSGDIDVVAEADNGAD
FT                   ALELIKVHRPAVALLDYRMPQLDGAQVAAAVVRDELPTRVLLVSAHDESAIVYSALQQG
FT                   AAGFLSKESTRSELVSAVLSCAKGRDVITPHLAAGLAGEIRRRNEPDVPVLSPREREVL
FT                   NLIAQGRSIPAMAKELYLAPSTVKTHVQRLYEKLGVSDRAAAVAEAMRRHLLD"
FT   gene            128750..129916
FT                   /locus_tag="MSMEG_0106"
FT   CDS_pept        128750..129916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0106"
FT                   /product="sensory histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74001"
FT                   /db_xref="GOA:A0QNN4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNN4"
FT                   /protein_id="ABK74001.1"
FT                   /translation="MISGRIVEFFASQPVRVSAVLRLPLIGLIFVLVMVWEVDHWLPGL
FT                   YAVILGLYAAAAVLWLVVVIRGPMPRWAEWASTAVDGLVLLALCAVSGGATAALLPVFF
FT                   LLPISVAFQDRPLLTAMLGTATATGYLGAWIFYSKRDDTVGLPNVVYMQVGFLLWLAVA
FT                   TTALSLVLVRRSARVRALLDVRRRLVQESARADELRDAELAEALHDGPLQTLLAARLEL
FT                   DELRERNPDPALDVVHAALQQTATGLRSTVTALHPQVLAQLGLAPAVRELLRQYENRGD
FT                   LVIRANIADVGQPEAQALLYRAARELLANVHKHARAATVTVRLFRQGERTVLTVVDDGV
FT                   GFDPDIVAQSVAEGHIGLASLQVRIEAMGGAMTISSEEGFGTQVTVIL"
FT   gene            complement(129926..131527)
FT                   /locus_tag="MSMEG_0107"
FT   CDS_pept        complement(129926..131527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0107"
FT                   /product="cell envelope-related function transcriptional
FT                   attenuator common domain"
FT                   /note="identified by match to protein family HMM PF03816;
FT                   match to protein family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75496"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNN5"
FT                   /protein_id="ABK75496.1"
FT                   /translation="MNSPAHALTKPRRRTPRRAVRLARRALVGLTAAAILAGTGMGWVT
FT                   YHGALDGITTSNALAGESGSVGDTENILIMGLDSRLDQHGNPLPEDVYQALHAGDETVG
FT                   GYNANVLIVVHLPGDGGPATAFSIPRDDYVDLAGCPSGICKGKVKQAYGFAYQAEMEAT
FT                   ESEEEDPATREQKAREAGRKAEIATVRNLLGIPIDHFVEVTLGAFFEIAKAVAPITVCL
FT                   NDDTSDPYSGADFRKGVQQIDAAQAMAFVRQRRDINDENFTDLDRTRRQQAFLAALVSA
FT                   LRQSGALSSPSKLRGLLDVTKQNVALDAGFDLASFTKRASALTDAPPTLYTLPIKEFGQ
FT                   NAYGEDINIIDVPTIRKIVHDLVSKDDPATTTATPDKPELNGHGATLDVINGSTYTGLA
FT                   AKLQTTFAADNFTEGQIGDAEALEPATTIDYGPGADAAAHSLATELGVTATPSDWVLAD
FT                   TVRLTIGTDFPGTDYLGADMFTSTTSGASESESYGPSETAELTPITTVAATATGTYTPA
FT                   PTDLSQMTASGIPCVK"
FT   gene            complement(131570..132709)
FT                   /locus_tag="MSMEG_0108"
FT   CDS_pept        complement(131570..132709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0108"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF02771; match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70360"
FT                   /db_xref="GOA:A0QNN6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNN6"
FT                   /protein_id="ABK70360.1"
FT                   /translation="MSVDRLLPSEEARDLIALTREVADKVLDPIVDEHERNETYPEGVF
FT                   AQLGAAGLLSLPQPEQWGGGGQPYEVYLQVLEEIAARWAAVAVAVSVHSLSSHPLLAFG
FT                   TDEQKQRWLPGMLSGEQIGAYSLSEPQAGSDAAALRCAARRDGDGFVLNGSKAWITHGG
FT                   RADFYTLFARTGEGSKGVSCFLVPGDLPGLSFGKPEEKMGLHAVPTTSAFYDNARIDAD
FT                   RLIGTEGQGLSIAFSALDSGRLGIAAVAVGIAQAALDEAVRYAHERTTFGRKIIDHQGL
FT                   GFLLADMAAAVVSARATYLDAARRRDAGLPYSSQASVAKLVATDAAMKVTTDAVQVLGG
FT                   VGYTRDFRVERYMREAKITQIFEGTNQIQRLVISRGLGT"
FT   gene            complement(132711..134153)
FT                   /gene="pntB"
FT                   /locus_tag="MSMEG_0109"
FT   CDS_pept        complement(132711..134153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="MSMEG_0109"
FT                   /product="NAD(P) transhydrogenase, beta subunit"
FT                   /EC_number="1.6.1.1"
FT                   /note="identified by similarity to SP:P07002; match to
FT                   protein family HMM PF02233"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73265"
FT                   /db_xref="GOA:A0QNN7"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNN7"
FT                   /protein_id="ABK73265.1"
FT                   /translation="MFRLENVATAAYVVAALLFILALAGLSKHETSRAGNTFGIAGMAV
FT                   ALIATIVLAIHGQIEPLGLGLLVVAMIVGALIGLWRAKVVEMTGMPELIALLHSFVGLA
FT                   AVLVGWNGYLHVEADPGSDEALKLAAEGMSGIHSAEVFIGVFIGAVTFTGSIVANLKLS
FT                   ARIKSAPLMLPGKNLLNIGALIVFAVLTVWFVIDPQLWLLVVVTVLALLLGWHLVASIG
FT                   GGDMPVVVSMLNSYSGWAAAASGFLLGNDLLIITGALVGSSGAYLSYIMCKAMNRSFIS
FT                   VIAGGFGIENTGAGSDVDYGEHREINAEGVAELLAHANSVIITPGYGMAVAQAQYGVAD
FT                   LTRKLRERGVNVRFGIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFDGTDVVLV
FT                   IGANDTVNPAAAEDPGSPIAGMPVLQVWNADNVIVFKRSMASGYAGVQNPLFFRDNTQM
FT                   LFGDARDRVNDILAALPAPERV"
FT   gene            complement(134172..135713)
FT                   /gene="pntA"
FT                   /locus_tag="MSMEG_0110"
FT   CDS_pept        complement(134172..135713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntA"
FT                   /locus_tag="MSMEG_0110"
FT                   /product="NAD(P) transhydrogenase, alpha subunit"
FT                   /EC_number="1.6.1.1"
FT                   /note="identified by similarity to SP:P07001; match to
FT                   protein family HMM PF01262; match to protein family HMM
FT                   PF05222; match to protein family HMM TIGR00561"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74959"
FT                   /db_xref="GOA:A0QNN8"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNN8"
FT                   /protein_id="ABK74959.1"
FT                   /translation="MIIGIPRESQPGETRVAATPQTVGQILKLGYSVVVESGAGAAASF
FT                   SDAAYADAGAQIGSADAVWSADVVMKVNAPSEGEIAALRDGATLISLISPALRPDLVEQ
FT                   LGTRNITVLAMDAVPRISRAQSLDVLSSMANIAGYRAVVEAAHAFSRFFTGQVTAAGKV
FT                   PPAKVLVVGAGVAGLAAIGAAGSLGAIVRATDPRPEVADQVASLGGEYLAVDDSGEVAE
FT                   VSKTGYAKEMGEDYKAREAALYAEQCKDVDIIITTALIPGRPAPRIITAEMVASMKAGS
FT                   VIVDMAAANGGNVEGTVKDQAIVTDNGVTIIGYTDLAGRLPAQSSQLYGTNLVNLLKLL
FT                   TPEKDGKVVLDFDDVVQRSITVVRDGEITWPPPPVQVSAAPAAQPAAAAPGVKEEKQPM
FT                   STGRRLAVAFAAAAVLFALIALSPAALQVHLVVFALAIVIGYYVIGNVHHALHTPLMSV
FT                   TNAISGIIVVGALLQIGHHNTAITALAFVAILLASINVFGGFAVTRRMLAMFSRS"
FT   gene            complement(135783..136787)
FT                   /locus_tag="MSMEG_0111"
FT   CDS_pept        complement(135783..136787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0111"
FT                   /product="putative magnesium transport protein"
FT                   /note="identified by match to protein family HMM PF01544"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73477"
FT                   /db_xref="GOA:A0QNN9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNN9"
FT                   /protein_id="ABK73477.1"
FT                   /translation="MAQVNGRVWRSGQPAEDFSFSAISDYLADDDTLVWADIYDPDHQT
FT                   LLDLAAELGLNTWAVEDAVAPKERTKASVYKTHTFFTVYAIDILTSGGGTGSLLVKHRI
FT                   SAFVLPHGLITVRLPGLDGAAHEFDIHEVSRRFDDLGGQRYGVGSLVHGLLDVVVDGHF
FT                   EAVEALDDAIEGLEDELFDDRGPNRGLQRRTFRLRKDLVELRRVVLPTREVVSTIQHRR
FT                   LDSRTSPELDPLYADLYDHVLRASEWTESLRDMVTTVFETHLSLQDARLNTVMKKLTGW
FT                   AAIIAVPTAITGFYGQNVTYPGVDTVAGFVTSSALIAVLVGLLYVMFKRRDWL"
FT   gene            complement(136796..136912)
FT                   /locus_tag="MSMEG_0112"
FT   CDS_pept        complement(136796..136912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0112"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70955"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNP0"
FT                   /protein_id="ABK70955.1"
FT                   /translation="MRQQQQQSADSVVFTRLFVPTAADSVKISNRREFFSRG"
FT   gene            136950..137810
FT                   /locus_tag="MSMEG_0113"
FT   CDS_pept        136950..137810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0113"
FT                   /product="taurine transport system permease protein TauC"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74926"
FT                   /db_xref="GOA:A0QNP1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNP1"
FT                   /protein_id="ABK74926.1"
FT                   /translation="MSVFVDIVPGSETDSPRPAAPSNRGRAILTKALLPLLSVAVFFAV
FT                   WQAVAVAGIWNQTFVPYPSAVWRAFIDLSTTHDGVRGYAGYLLVEHLYMTLRRVVAGVV
FT                   IGVVLGVLLGLLMGSVGWLRSVLEPWLTFLRALPPLAYFFLLVIWLGIDEAPKITLLAL
FT                   AALPPAAVATTAAVVAAPVGLQEAARALGATRAQVIRDVVVPSALPETFTGIRLAVGMA
FT                   YSSVVAAELFNGIPGVGGLVKDASNYNNTPVVLVGIFAIGFSGLVIDGLLRAVERRAVP
FT                   WIGKV"
FT   gene            137817..138845
FT                   /locus_tag="MSMEG_0114"
FT   CDS_pept        137817..138845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0114"
FT                   /product="extracellular solute-binding protein, family
FT                   protein 3"
FT                   /note="identified by match to protein family HMM PF04069"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74633"
FT                   /db_xref="GOA:A0QNP2"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNP2"
FT                   /protein_id="ABK74633.1"
FT                   /translation="MKLKSLLVATAASALALAGCAVDNSEQDAEKPTIRVGYQTFPSGD
FT                   LIVKNNGWLEEALPDYNIKWTKFDSGADVNTAFVAGELDFGALGSSPVARGLSAPLNIP
FT                   YKVAFVLDVAGDNEALVARDGSGVNSIADLRGKRVATPFASTAHYSLLAALAQNGLSPN
FT                   DVQLIDLQPQAILAAWERGDIAAAYSWLPTLDDLRKTGKDLITSRELAADGKPTLDLGV
FT                   VSDKFATEHPDVVDTWREQEARALDVIKDDPDAAAKAIAAEIGLSPEDVAGQLKQGVYL
FT                   TPAEVASEQWLGSDGKPGNIAANLQSASEFLAEQKQIPEAAPLGTFEDAIYTKGLPGAI
FT                   SK"
FT   gene            138829..139626
FT                   /locus_tag="MSMEG_0116"
FT   CDS_pept        138829..139626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0116"
FT                   /product="taurine import ATP-binding protein TauB"
FT                   /EC_number="3.6.3.36"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71144"
FT                   /db_xref="GOA:A0QNP3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNP3"
FT                   /protein_id="ABK71144.1"
FT                   /translation="MPSASEAGPGAEGELRIRNVAHRYGRGPNEVTALGPVDLDVEPGA
FT                   FVVLVGASGCGKSTLLRLIAGFETPTEGEVVVAGSRPTPGVTSGVVFQQPRLFPWRTVG
FT                   GNIDLALKYAKVPRERRAERRTQLLERVGLEGTEKRKIWEISGGQQQRVAIARALAAET
FT                   PLFLLDEPFAALDALTRERLQEDVRQVSADSGRTTVFVTHSADEAAFLGSRIVVLTRRP
FT                   GKVALDLPVDLPRTGVDPQELRRSPEFHRLRTEVGEAVKAAAA"
FT   gene            complement(139607..140287)
FT                   /gene="dehII"
FT                   /locus_tag="MSMEG_0115"
FT   CDS_pept        complement(139607..140287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dehII"
FT                   /locus_tag="MSMEG_0115"
FT                   /product="haloacid dehalogenase, type II"
FT                   /EC_number="3.8.1.2"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01428; match to protein
FT                   family HMM TIGR01493"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71408"
FT                   /db_xref="GOA:A0QNP4"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNP4"
FT                   /protein_id="ABK71408.1"
FT                   /translation="MTEHVLVFDVNETLIDLESLTPHFERTFSDPHVLREWFGQLVMHS
FT                   MALTLSGNYTDFFTLGQGVLRMLADIHGVTISDDDVQALAEGMRTMPAYPDVEEGLQRL
FT                   RGNGYRLVTLTNSPHHQGATPLENAGLAGYFERQFTVGEHRVFKPSTSLYTHVASALGV
FT                   EPGQCTMVASHTWDLLGAQSAGYRGVLITRPGNAPLTAPGVPQPQIVAADLLQLNDVLT
FT                   RQRL"
FT   gene            complement(140284..141147)
FT                   /locus_tag="MSMEG_0117"
FT   CDS_pept        complement(140284..141147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0117"
FT                   /product="hydrolase"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75028"
FT                   /db_xref="GOA:A0QNP5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNP5"
FT                   /protein_id="ABK75028.1"
FT                   /translation="MNIHHRYATIDGQRIFYRAAGPADAPPIVLLHGFPTSSFMFRDLI
FT                   PLLARNHRVIAPDHLGFGFSDAPSADEFDYTFDALADLTEGLLTHLGIVRYAIYVQDYG
FT                   APIGWRLALRHPEAISAIVTQNGNGYVEGFVDGFWSTVWDYHREQTPQTEAAIRTALDP
FT                   ESVKWQYVTGVADESLVSPDTWNHDAAQLARPGNDVIQLKLFADYATNPPLYPTLHEYL
FT                   RTSGVPVLAVWGRNDPIFGPDGARAFEKDATDAEIHLLDGGHFLLETHVDEVAGLIDSF
FT                   LDRKVS"
FT   gene            141232..141732
FT                   /locus_tag="MSMEG_0118"
FT   CDS_pept        141232..141732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07336"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABK76138"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNP6"
FT                   /protein_id="ABK76138.1"
FT                   /translation="MDVAVVDRRDEEFLLDLLNTTPVVDGQERDDLADDDSARAWMRAR
FT                   GVESSRGDLIAVRDLLQDVVRGMRTPSALDRFLGDVTMRPKMTPDGVSWELAASPAARA
FT                   VLAWDALRINSPGRLRACANDECRLFLIDRSKPNTARWCSMAICGNRMKARRYYQRAKG
FT                   SEK"
FT   gene            complement(141740..141850)
FT                   /locus_tag="MSMEG_0119"
FT   CDS_pept        complement(141740..141850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0119"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74013"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNP7"
FT                   /protein_id="ABK74013.1"
FT                   /translation="MDPNPDYDLSDEGEFFFNWIPWGLRGVYPPPAYPPV"
FT   gene            141969..142628
FT                   /locus_tag="MSMEG_0120"
FT   CDS_pept        141969..142628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0120"
FT                   /product="probable transcriptional regulatory protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74268"
FT                   /db_xref="GOA:A0QNP8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNP8"
FT                   /protein_id="ABK74268.1"
FT                   /translation="MTSAANNGTSRREELLNVAAKLFAARGYHGTRMDDVAEAVGLNKA
FT                   TVYHYYASKSLILYDIYKSAADFTVEALHDDPTSSARETIYHFTRRLMVGIANDLERAA
FT                   VYFQEGPYIAEWFTEEQVEYIRHSEAQVYEHVRDVIDRGIASGEFYDCDSHVLALGYIG
FT                   MVLGAYRWLRPHGRRTAKEIAVEFSTALLRGLIRDENIRVESPLGIDVQAGSEEQR"
FT   gene            142625..143398
FT                   /locus_tag="MSMEG_0121"
FT   CDS_pept        142625..143398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0121"
FT                   /product="rhamnolipids biosynthesis
FT                   3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71635"
FT                   /db_xref="GOA:A0QNP9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNP9"
FT                   /protein_id="ABK71635.1"
FT                   /translation="MSDLFGLDGKVAVVTGGGRGIGLMIARGLLQAGASVYIAGRKEAE
FT                   LSAAVAELSPLGRVEAVPADLGTAEGVTTLTAAITGRENAVHALFNNAGAAWGAPYEDF
FT                   PESGFDKVYNVNVKGVFLLTRALTPLLRAGATDDDPARVINTGSIDGIVAPGRGRDNFS
FT                   YSASKAAVHMLTRHLAGELAPHILVNAIAPGLFPSRMTKELLAAGEDAVGSALPLRRVG
FT                   RPDDIAGIAVFLASRASTYITGAVIPVDGGVSTIR"
FT   gene            143535..144542
FT                   /locus_tag="MSMEG_0122"
FT   CDS_pept        143535..144542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0122"
FT                   /product="putative periplasmic solute-binding protein"
FT                   /note="identified by match to protein family HMM PF03401"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69643"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNQ0"
FT                   /protein_id="ABK69643.1"
FT                   /translation="MAIPALRRTRLVLAAAAAAGLVLSGCGGVQNTTGGGSGGTYPSGT
FT                   VEMYVGASAGGSSDLISRAVSKGLSDSLGASFPVINREGANGALAAAEVSKAKPDGSVI
FT                   AIQNASLFTITPLAVSPGEVTDIDDFDVVYGISRDDYVLVTNPASGYKTMGDLEAATKP
FT                   VRYGTTGVGTGAQLAAALLFKSADVPSQAVPFDGGAPALTALLGNQIDVAVLQVGEAIE
FT                   NIQSDKLIPLSVFGPERIDYLPEVPTAKEQGLDVEVTQYRFMTVPKGTPQEVRDRIVEG
FT                   LEATFATDAYKKFNEQNSLTPMEQPGPEVLEQLKADSKRYADLTKEFGIDLRAS"
FT   gene            144542..145048
FT                   /locus_tag="MSMEG_0123"
FT   CDS_pept        144542..145048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0123"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71321"
FT                   /db_xref="GOA:A0QNQ1"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNQ1"
FT                   /protein_id="ABK71321.1"
FT                   /translation="MSDTLAAVTAPQEAPEEQQPPAGGPWYQTVAAVVGIALGAGAAVL
FT                   AHGYGLGTLHQPGPGLWPFVVGIVIAVLSVLLLLLGRKLTDTEAFTRSSVLAAAGAVTF
FT                   VGFGLLMPLIGFEIPALVLCVIWLRFLGGESWRSTAIVSVVTTAVFYFLFLYGLRIPLP
FT                   HLISF"
FT   gene            145067..146593
FT                   /locus_tag="MSMEG_0125"
FT   CDS_pept        145067..146593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0125"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF01970"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70240"
FT                   /db_xref="GOA:A0QNQ2"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNQ2"
FT                   /protein_id="ABK70240.1"
FT                   /translation="MDLNAFLDGFALVVEPQNLLYCLVGVLIGMVIGVLPGLGPAATIA
FT                   ILLPITYTIDPVSAIIMLAGIYYGAQYGGTITSVLLRLPGEASSVVTVFDGFALAKQGR
FT                   AGTALGVAAIGSFVGATISIVGLSLLAPVVAEVALDFGPPEYAALALLGVLLVATIGNG
FT                   NMLKSLIAAAVGLLLATVGRDSFSGASRFTFESLQLADGIDFVVVAMGLFGVGEILYNL
FT                   EQRHGKPHVPAKVGNPWPSRKDLRQSSGAIGRGSVIGFVLGVLPGGGAVLASLVAYATE
FT                   KKRSKHPERFGKGAVEGVAAPETANNAAATSSFIPLLTIGIPANASMAMLFGALLILGI
FT                   SPGPQLVGEHPDLFWGVINSMYIGNLALLILSIPLVGLFVRILRVRPAILAPITALITL
FT                   LGVYTINNSVFDIFVMIAFGVVGYLMKKTGFDPGPLVLAFVLGSLVESNVRRSLLIFGG
FT                   DPTGFVTRPLSGTILAILVAVVAIPVIRQLLRSRAKSPVTGETPSSVTKV"
FT   gene            complement(146549..147232)
FT                   /locus_tag="MSMEG_0124"
FT   CDS_pept        complement(146549..147232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0124"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75586"
FT                   /db_xref="GOA:A0QNQ3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNQ3"
FT                   /protein_id="ABK75586.1"
FT                   /translation="MSTSLAQRVVAGLKDKIFAGDLPPGHKLPSEAELIDEFGVSRTVV
FT                   REAVTRLRAEGLIETFQGRGSFVLAVPEPTAFTIESAAIRTQRDVLDMVDFRLGVECEA
FT                   AALAAARIDARGRDAVRTALDEFVGAAPEDAVEADFRFHRTIAEVSGNRFYLDLLNSLG
FT                   PMMIMLPRTRLGDAHSITDAAHAERVRREHDQVAAAVAAGDPDLARAAMRLHLGNTRRR
FT                   LAGDR"
FT   gene            complement(147229..148347)
FT                   /locus_tag="MSMEG_0126"
FT   CDS_pept        complement(147229..148347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0126"
FT                   /product="mandelate racemase/muconate lactonizing enzyme"
FT                   /note="identified by match to protein family HMM PF01188;
FT                   match to protein family HMM PF02746"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74119"
FT                   /db_xref="GOA:A0QNQ4"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR033978"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNQ4"
FT                   /protein_id="ABK74119.1"
FT                   /translation="MTDRICRLALSHVVLPLPKPVSDAKVLTGRQKPLTETVLLFVEVS
FT                   TSDGLQGMGFSYSKRAGGPAQYTHLHEIAEVALGQDPSDIDRIYQSLLWAGASVGRSGV
FT                   ATQAIAALDVALWDLKARRAGLPLAKLIGAQRDSCRVYNTSGGFLQASLDEVKDAATAS
FT                   LESGIGGVKIKVGQPDWAEDLKRVAAMRAHLGDTPLMVDANQQWDRARARRMCRELEQF
FT                   DLVWIEEPLDAWDAVGHADLSHTFDTPIATGEMLTSVPEHMALIDAGYRGIVQPDAPRI
FT                   GGITPFLRFATLASHAGLALAPHYAMEIHLHLAATYPTEPWVEHFEWLNPLFNERIEIR
FT                   DGRMWLPDRPGLGFTLSDQMRALTREQAEFQA"
FT   gene            complement(148387..149478)
FT                   /locus_tag="MSMEG_0127"
FT   CDS_pept        complement(148387..149478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0127"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70013"
FT                   /db_xref="GOA:A0QNQ5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNQ5"
FT                   /protein_id="ABK70013.1"
FT                   /translation="MKIRGAVLERIGAPRPYAESRPLTISELDLADPGPDELLVRIESA
FT                   GLCHSDLSVVDGNRVRPVPMLLGHEAAGVVETPGADLETGQRVVMTFLPRCGSCPACGT
FT                   DGLTPCGPGSVANGAGTLMNGDIRLRRDGEPVFHHLGVSGFATHAVVDRRSIVPVPDDV
FT                   PATVAALLGCAVLTGGGAVLNVGRPKPGQTVVVVGLGGVGMAAALTALAHDDVRVVGVD
FT                   QLSDKLARAAELGVHETFTPEQAADLRAEVVIEAAGHPAALETAIGLTGPGGRTITVGL
FT                   PRPDARITVSPLGFVAEGRSLIGSYLGSAVPSRDIPRFVELWRAGRLPVESLVSSTIAL
FT                   DDINAGMDELAEGRAVRQVIDFA"
FT   gene            149514..149963
FT                   /locus_tag="MSMEG_0128"
FT   CDS_pept        149514..149963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0128"
FT                   /product="thioesterase superfamily protein"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72056"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNQ6"
FT                   /protein_id="ABK72056.1"
FT                   /translation="MTRRDEPTPTGREFPVHWPVGTRWTDNDMFGHLNNAVYYELFDTA
FT                   INAWIQTSCDVDPVTAPWLGVVAESGCRYFTELKFPGRLVVGLAVSRLGTSSVTYRLAL
FT                   FAEDAADEPVAAVGHWVHVYVDRHTRRPVPIPDAIRDLLASAAGR"
FT   gene            149990..150424
FT                   /locus_tag="MSMEG_0129"
FT   CDS_pept        149990..150424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0129"
FT                   /product="cyclase/dehydrase family protein"
FT                   /note="similar to Streptomyces cyclase/dehydrase family
FT                   protein; identified by match to protein family HMM PF03364"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75452"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNQ7"
FT                   /protein_id="ABK75452.1"
FT                   /translation="MSKTVEVAASAETITSIVSDFEAYPQWNPEIKGCWILARYNDGRP
FT                   SQLRLDVEIQGQSGVFITAVYYPAENQIFTMLQQGDHFTKQEQRFSIVPLGPDSTLLQV
FT                   DLDVEVKLPVPGPMVKKLAGETLEHLAKALEGRVEQLTQS"
FT   gene            complement(150431..151123)
FT                   /locus_tag="MSMEG_0130"
FT   CDS_pept        complement(150431..151123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0130"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70358"
FT                   /db_xref="GOA:A0QNQ8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNQ8"
FT                   /protein_id="ABK70358.1"
FT                   /translation="MNTPVRTGAQPRRGVRREQLSDEVAAHLRAEIMTGALRPGTFIRL
FT                   DETAAALGVSITPVREALRTLRGEGMVQLEPHRGHVVVPMSRTDVEDIFWLQATIAREL
FT                   AATTVTRITDHQIDELERLNDELEIAVGRGDPDEISTIEFAFHRAFNHASGRIKLAWFL
FT                   LHVARYLPALIYSTDPGWGQQAVAGHRLLIEALRRRDARRVVQLNGAQFTDGARRLIAR
FT                   LEEIGMWD"
FT   gene            151273..152907
FT                   /locus_tag="MSMEG_0131"
FT   CDS_pept        151273..152907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0131"
FT                   /product="AMP-binding enzyme, putative"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72555"
FT                   /db_xref="GOA:A0QNQ9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNQ9"
FT                   /protein_id="ABK72555.1"
FT                   /translation="MTAEPSQIEQPYLARRQNWVNQLTRHAMMQPDKTALRFLGRTTTW
FT                   RELDDRVTRLAGALNRRGVGFGDRVLILMLNRTEFVEAMLAANRLGAIAVPVNFRMTPP
FT                   EIAYLVSDCEAHVVVTEPVLAGVATAVRDLDATLQTVIVAGGATEDGVLGYDDLIAEEG
FT                   EPPAPVDIPNDSPALIMYTSGTTGRPKGAVLTHTNLSAQAMMHLFTTGADLNSDVGFVG
FT                   VPLFHIAGVAGSVLSGVTLGVPTVLYPLGAFDPDGLLDVLESEQVTGIFLVPAQWQAVC
FT                   AAQRARPRNLKLRALSWGAAPASDTLLREMNEVFPDAQIFAAFGQTEMSPVTCMLLGDD
FT                   AIRKLGSVGRVIPTVSARVVDDNMNDVPVGEVGEIVYRGPNLMVGYWNNPKATAEAFAG
FT                   GWFHSGDLVRQDEEGYVWVVDRKKDMIISGGENIYCAEVENVLAAHPAIMEVAVIGRPH
FT                   EKWGEVPVAVVALNSATAESISLGELDSFLTERLARYKHPKALEVVDALPRNPSGKVLK
FT                   TELRERFGRATSLDGGESNSATTVSAG"
FT   gene            153100..153900
FT                   /locus_tag="MSMEG_0132"
FT   CDS_pept        153100..153900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02405"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71797"
FT                   /db_xref="GOA:A0QNR0"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNR0"
FT                   /protein_id="ABK71797.1"
FT                   /translation="MTASTDGFVDYLRGQLEKPLATVGGFFKMSVMTGKALFTRPFQWK
FT                   EFVLQSWFLIRVAFLPTLAVSIPLTVLIIFTLNILLAEFGAADVSGAGAALGAVTQLGP
FT                   LVTVLVVAGAGSTAICADLGARTVREEIDALEVLGIDPIERLVVPRVVASTFVAFMLNG
FT                   AVITIGLVGGFFFGVYIQNVSAGAYVSTLTLLTGFPEVLISVVKATLFGMIAGLVGCYR
FT                   GLTVAGGSKGVGTAVNETLVLCVVALFAVNVVLTTIGVRFGTGR"
FT   gene            153902..154771
FT                   /locus_tag="MSMEG_0133"
FT   CDS_pept        153902..154771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0133"
FT                   /product="ABC-transporter integral membrane protein"
FT                   /note="identified by match to protein family HMM PF02405"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73585"
FT                   /db_xref="GOA:A0QNR1"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNR1"
FT                   /protein_id="ABK73585.1"
FT                   /translation="MSTVQVLRSRFPRAFSRSSEIAATPARFLDSMGHVAWFVVQAIVH
FT                   VPHAFRHYRRESLRLVAEIGMGTGAMAVIGGTVAIIGFVTLSAGSLIAIQGFASLGNIG
FT                   VEAFTGFFAALANIRVVAPVVTGQALAATVGAGATAELGAMRISEEVDALEVMGIKSIS
FT                   YLVSTRIMAGAIVIIPLYAMAILLSFMSAQLVTTIFYSQSVGTYEHYFHTFLRVDDVMW
FT                   SFLEVIIMSVIVMLNHCYFGYFASGGAVGVGEAVGRSMRTSLIAIVLVVLLASLALYGT
FT                   DPNFNLTV"
FT   gene            154776..156005
FT                   /locus_tag="MSMEG_0134"
FT   CDS_pept        154776..156005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0134"
FT                   /product="virulence factor Mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74488"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNR2"
FT                   /protein_id="ABK74488.1"
FT                   /translation="MTEPPAPTAPLNKPKTPPYKLAGLILGLVGVLVLALTWMQFRGQF
FT                   EDKVQLTVLSGRAGLSMDPGSKVTFNGVPIGRLASIDVVEVDDNPEARLTLDVDPKYLD
FT                   LIPENANVELRATTVFGNKYISFLSPKNPSAERLSASTPIRAQGVTTEFNTLFETITAI
FT                   SEQVDPIKLNETLTAAAQALDGLGDKFGRSIVDGNAILADVNPRMPQIRRDITGLANLG
FT                   EVYADASPDLFDGLDNAVTTARTLNEQRGNLDQALVAAVGFGNTGGDIFERGGPYLVRG
FT                   AQDLLPTSALLDEYSPALFCTIRNYHDAAPKLAGALGGNGYSLLTNSLVVGVGNPYVYP
FT                   DNLPRVNAKGGPEGRPGCWQPITRDLWPFPYLVMDTGASIAPYNHFELGQPMFAEYVWG
FT                   RQVGENTINP"
FT   gene            156002..157033
FT                   /locus_tag="MSMEG_0135"
FT   CDS_pept        156002..157033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0135"
FT                   /product="virulence factor Mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71170"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNR3"
FT                   /protein_id="ABK71170.1"
FT                   /translation="MSIKGTLFKLGIFSLVLLTFTALIFVVFGQIRFNRTTEYSAIFKN
FT                   VSGLRDGQFVRAAGVEVGKVKSVDLINGGEQAEVKFTVERSLPLFQETTAAIRYQDLIG
FT                   NRYLELKRGDSDQILPPGSTIPVERTEPALDLDALVGGFRPLFRSLEPEKVNTIATSLI
FT                   TIFQGQGGTINDILDQTAQLTASLADRDQAIGEVIKNLNTVLDTTVRHQKQFDETLVNF
FT                   ETLITGLKNRADPIATSVADISDAAGSLADLLSDNRPLLKDTIGYLDVIQAPLVEQKQE
FT                   VSDILVQMPQALKIIGRAGGIYGDFFNFYACDLTLKLNGLQPGGPVRTVRITTQPSGRC
FT                   TPK"
FT   gene            157030..158604
FT                   /locus_tag="MSMEG_0136"
FT   CDS_pept        157030..158604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0136"
FT                   /product="virulence factor Mce family protein, putative"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75590"
FT                   /db_xref="GOA:A0QNR4"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNR4"
FT                   /protein_id="ABK75590.1"
FT                   /translation="MRTLQGSDRFRKGLMGVIVVALIIGVGSTLTSVPMLFAVPTYYGQ
FT                   FADTGGLNIGDKVRIAGMDVGNVKSMEIDGDKVVIGYTLGGRTIGTESRAAIRTDTILG
FT                   RKNIEIEPRGSETLKPRGVLPVGQTSAPYQIYDAFLDVTRNAAGWDTQAVRQSLNVLSE
FT                   TVDQTSPHLSAALDGVARFSETIGKRDEDVKKLLASANKVATVLGDRSTQVNQLLVNAQ
FT                   TLLAAVNERGRSVSLLLERVSSVSRQVEGFVDENPNLNHVLEQLRTVSDVLNERKQDLA
FT                   DILTVAGKFITSLAEALASGPYFKVMLVNLIPPTILQPFVDAAFKKRGIDPEEFWRNAG
FT                   LPAFRFPDPNGERHENGAPPAAPTPLEGTPEHPGPAVPPGSPCSYTPPADGIPSPGNPL
FT                   PCAHLSQGPYGPVPGGYPPPNVATSAPNPDGIAHSPGVPSAAIPGQMPPEQPGAPVEIA
FT                   PGPPGARTVPVSPIPGAPDFTPGIAPPPPAITGPPPPPGPGPQLAPVGEAPLPGNPPFL
FT                   PPGSQSR"
FT   gene            158623..160266
FT                   /locus_tag="MSMEG_0137"
FT   CDS_pept        158623..160266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0137"
FT                   /product="virulence factor mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73798"
FT                   /db_xref="GOA:A0QNR5"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNR5"
FT                   /protein_id="ABK73798.1"
FT                   /translation="MSTIFNIRNIQLPRLSRAAVIIGALVVAAALVAGYFGMNAYRKLT
FT                   NTTVTAYFPEVLALYPGDKVLIMGVRVGSIDSIETAGDKMKVVFHFNNKYKVPENATAS
FT                   ILNPSLVASRVIQLSPPYTGGPTLRDGAVLDVDRTQVPIEYDEVRNQVTRLLADLGPTP
FT                   EQPKGPFGDIIESFADGFAGKGEQLNRTLRGLSDALTALNEGRGDFFAVVKSLALFVNA
FT                   LHRSDQQFVALNNDLAQFTNSFTNTDQELANALQDLNRVLKTTREFLDRNGGVLTHDID
FT                   NLEQVTTAILQPEPRDGLETGLHAYPNLAANVLNINSPNQGGIIGLPVLPGVTNFSNPL
FT                   QFVCSSIQAGSRLGYQESAELCAQYLAPIMDAIKFNYLPFGMNLASTAMTLPKQIAYSE
FT                   KRLQPPPGYKDTTVPGIWSRDTLFSHGNHEPGWIVAPGMQGVQVQPATANMLTPESLAE
FT                   LLGGPDIVPPPAPPAFGTTRGGNLPGPPNAFDENNPLPPPWYPQPGPPPAPAPGVIPGD
FT                   PLSAVAPAAPAAPAAPAPAGPPLPAEAGAG"
FT   gene            160266..161438
FT                   /locus_tag="MSMEG_0138"
FT   CDS_pept        160266..161438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0138"
FT                   /product="virulence factor Mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74878"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNR6"
FT                   /protein_id="ABK74878.1"
FT                   /translation="MRLLKGFPKMRNWTRVGRRTAVLAAVALVLTSCGQWRGIANVPLP
FT                   GGPGTESGSMTLYVQMPETLALNANSRVRVRDVFVGRVRKIELINWVPTLTVDVEPGIK
FT                   LPKNTLAKIGQTSLLGSQHVELNPPEDPSSELLRDGDTIPLAQSSAYPTIERTLAGISG
FT                   ILTGGGIPNIEVIQTEVFNILNGRADQIREFLNQLDTFTDELNQQREEITRAIDSTNRL
FT                   LNIVSQRNDTLDRVLTEFPPLIQHFAETRDLFADAVTALGRLSAAADETLSGSNANLHT
FT                   NLQNLQRPLKQLGRAAPYLVGALKLILTVPFNIDNIPKAIRGDYINVSLKLDLTLSSVD
FT                   NAFLSGTGVSGMLRALEQAWGRDPATMIPDVRFTPNPHDAPGGPLVERGE"
FT   gene            161440..162996
FT                   /locus_tag="MSMEG_0139"
FT   CDS_pept        161440..162996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0139"
FT                   /product="mce-family protein mce1f"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75818"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNR7"
FT                   /protein_id="ABK75818.1"
FT                   /translation="MLLTRFIKMQLVIFLTLTLVALVVLALFYLRLPTWAGLGMYKLNA
FT                   DLPNSGGLYATANVTYRGTTIGKVTSVEPSESGARVEMNIYDRYKIPADATANVHSVSA
FT                   VGEQFIDLTSDSGGGAYFQPGDTITKATVPAEVGPALDAAEKGLAVLPKEKIGTLLDEA
FT                   ATAFGGLGPSLQRLVDSTQAIAGDFRANIDPVNDIIENSGPIIDSQVNSGDAIQRWAAN
FT                   LNTLAAQSAQNDEALRSGLQQAAPTADQLNAVFSDVRESLPQTLANLEIVIDMLKRYNK
FT                   NVEQVLVALPQGAAVAQTGTIFAPEGLLHFGLGINAPPPCLTGFLPASQWRSPADTRTE
FT                   PLPSGLYCKIPKDAPNAVRGARNYPCADVPGKRAATPRECRSDEPYQPLGTNPWYGDPD
FT                   QIRNCPAPGARCDQPVDPGRVIPAPSINNGLNPLPASQLPPPEVSSGPSSDPLTAPRGG
FT                   TVTCSGQQPNPCIYTPAAGATATYNPASGEVVGPGGVKYSVTNSNTPGDDGWKEMLAPA
FT                   S"
FT   gene            162966..163574
FT                   /locus_tag="MSMEG_0140"
FT   CDS_pept        162966..163574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0140"
FT                   /product="probable conserved mce associated membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75357"
FT                   /db_xref="GOA:A0QNR8"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNR8"
FT                   /protein_id="ABK75357.1"
FT                   /translation="MEGDAGASQLNPTDQQQEHTEPQIEQTTVEADARRPSRLGRGWMA
FT                   TVCAALVLVAAALGVGGYLALRSHLDSNVIARDEAEAMQAAKDCVTATQAPDTAAMAAA
FT                   QAKIIECATGDFGAQAVLYSGILLDAYQAANVQVQVSDMRAAVEKHNDDGSMDLLVAVR
FT                   VLVTNTEKANEEQGYRLRVKMARDEDGLYKVARLDQVTS"
FT   gene            163571..164539
FT                   /locus_tag="MSMEG_0141"
FT   CDS_pept        163571..164539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0141"
FT                   /product="probable conserved mce associated transmembrane
FT                   protein"
FT                   /note="identified by match to protein family HMM PF06271"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70536"
FT                   /db_xref="GOA:A0QNR9"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNR9"
FT                   /protein_id="ABK70536.1"
FT                   /translation="MSSVLDTPAAAEDAVIDQAPLASWQARAGAFAIDMLPGAGIIVTL
FT                   ALLAWTAPLLGWVWWVYTVAAVLVVGAVLANRVLLPTTRGWTLGRAVVGIRVVKADGGD
FT                   AAMVRLLLRDLAHVLDTLAVFVGWLWPLWDARNRTFADLLTRTEVGRVTPAAGDVRRLA
FT                   GKVLLAAVAVCAVAVALGYFAVFRPQEAVHEAREQIANEGPRIVEQMLSYGVDSFNEDL
FT                   DKAQTLATDNYRPELVRQQDVIRKAGPTTNEYWAVTSAVLSATKNDASMLLALQGQRGT
FT                   NPQDLKFLTATVRVDFRKTGDTWQVDNLTVLKKPNLNGAAQ"
FT   gene            164536..165084
FT                   /locus_tag="MSMEG_0142"
FT   CDS_pept        164536..165084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69572"
FT                   /db_xref="GOA:A0QNS0"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNS0"
FT                   /protein_id="ABK69572.1"
FT                   /translation="MSPRRRIDASERDYFAVEVEPPFRWGLPLVALVSALLIAAAIAGS
FT                   TLMLVRHESDRRTEIKNAAALGYVREFMTMYTTLDPFHANEYTDRILTQATGDFHKMFK
FT                   EKQNEINIQVARNEPTAGSVLEAGVQRWNDDGSADVLVATKTTTRLPDGKTFESGSRWV
FT                   ATTILEGQQWKISQLIQVI"
FT   gene            165051..165941
FT                   /locus_tag="MSMEG_0143"
FT   CDS_pept        165051..165941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0143"
FT                   /product="probable conserved mce associated membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75140"
FT                   /db_xref="GOA:A0QNS1"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNS1"
FT                   /protein_id="ABK75140.1"
FT                   /translation="MEDQPADSGDLTTPARRRRWGFPLRRRQAEPAEQSDATGEGTEPS
FT                   TEAGNESDAETKPRPVGKRQRTALSTGEQTAEDQTEETAGAAAYEKPTETEESEVSEPV
FT                   AADEPADEDQPTQNIVFAPFRPAGKGLTYAAIAAATLFVAAGAFAGATVWPYLSDRALV
FT                   DTKVQVAQTSADAITTLWTYTPENIDTLPDRASRFLSNDFAAEYRQFIDSIVPSNKQAQ
FT                   ITNNTQVVGTAVESISANEATAIVYTNSVSTSPVTKNVPSLRYLSYRLTLVRSDGDWRI
FT                   TQMPALTQLDLSPQL"
FT   gene            165944..166612
FT                   /locus_tag="MSMEG_0145"
FT   CDS_pept        165944..166612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06912"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75834"
FT                   /db_xref="GOA:A0QNS2"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNS2"
FT                   /protein_id="ABK75834.1"
FT                   /translation="MAIASPVSERLTVTALLLLTVATGLVDAISVLVLGHVFVANMTGN
FT                   VIFLGFWFVPHSGVDLTAAVVAFPAFVVGTIIGGRLARHLDGQVRTWLTTALGVEVVLL
FT                   TVLSILAGTGVLDYQDNTKLFLIAGLAITFGIQNATARQFGIQELSTTVLTSTIVGLGF
FT                   DSRLAGGTGEREKLRYAVVATMCLGAVIGATLSRFTVAPVIALAAVVIATSACIFRFGR
FT                   "
FT   gene            complement(166609..168477)
FT                   /locus_tag="MSMEG_0144"
FT   CDS_pept        complement(166609..168477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0144"
FT                   /product="HNH endonuclease"
FT                   /note="identified by match to protein family HMM PF01844;
FT                   match to protein family HMM PF02720"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74432"
FT                   /db_xref="GOA:A0QNS3"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNS3"
FT                   /protein_id="ABK74432.1"
FT                   /translation="MSWGYPQTRVHPQIAVLRCRGGFTVGRFERMYEGLLVQIAEFSAL
FT                   SDLELEGQARGWAQAEASASAHKHAAMAELFIRATSTPSADERRWWFVDPDAAVGAQLG
FT                   AAQGITAWAALHQAQRGVALRDRLPKVNEVFAAGLVSEMIVRNICWSTALMLEPDKLAL
FT                   IDAELAAQISGWGKLTLKEIDNTIDDLILKHDPGSFRRGRASRRGRYFDIGSPTDAPGV
FT                   LTVTGRLQAHLGNAYDARIAELIEGVCPDDPRTLNELRHDALGAILDHTTLACECEDPD
FT                   CVRGREQSPRGHLVVHVIAREDTVTAAQHAATTTNTPDDAPADTPAADTEPAEPAEPAE
FT                   PAEPAEPAEPAEPAEPVEPVDDPDIAPAASATETATDTTASPTGTDCDPESVSVTEFTD
FT                   NSSDTPSAFLDPDEHPLDRVPPAVLFGGGVLPAYALAEIINNATIRPLKHPGDTAPEDR
FT                   YIPSRALADYVRCRDLTCRFPGCDKPADRCDLDHTVPYPAGPTHASNLKCLCRFHHLLK
FT                   TFWTGPRGWTDRQHPDGTIVWTSPSGRQYTTVPGSHRRLSITELAAPTGALDLPATPIP
FT                   TADPDLRGVKMPKRRRTRAQNTARTIAAERKLNDDLVAEHNKPPPF"
FT   gene            complement(168543..169361)
FT                   /locus_tag="MSMEG_0146"
FT   CDS_pept        complement(168543..169361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0146"
FT                   /product="mosc domain protein"
FT                   /note="identified by match to protein family HMM PF03473"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74772"
FT                   /db_xref="GOA:A0QNS4"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNS4"
FT                   /protein_id="ABK74772.1"
FT                   /translation="MADELLRVDSLHRYPIKSMLGESVTSLEVYLGGVDRDRHLAFIDQ
FT                   ETGRVASAKQARLWRNLLKCRARIDDNGSVQVRLPDGTESSPEDDDFDDVFSKLLARPV
FT                   RLLTSRPDGASLERADPEQVLMAGLDAEVDAPLLEIAEATPGDSFVDLAPLHVITTATL
FT                   ERIGTEAARYRPNIVITTPPDYPAYSENDWTGREFTIGGVRVKAMGPTPRCVIPTLEHG
FT                   DLDRAQHALRTPAAENRVESFGLGELPCAGAYLEVLGEGTVRVGDEFRPA"
FT   gene            complement(169419..170333)
FT                   /locus_tag="MSMEG_0147"
FT   CDS_pept        complement(169419..170333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0147"
FT                   /product="C-5 sterol desaturase"
FT                   /EC_number="1.3.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70024"
FT                   /db_xref="GOA:A0QNS5"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNS5"
FT                   /protein_id="ABK70024.1"
FT                   /translation="MEQLAEQVKMVFVYGLPAFLLLIAVEYYSYFRERRENTAPSEPKR
FT                   GVSSRDTAANISTYLIRLVVSPLEKFIELPIIVIAAAFAPLALPADQWWTWALALFLAD
FT                   ATYYVKHRMGHRIRLFWAEHSVHHSSQYFNLSTSLRLPWLVPGSFLKSVVSIPMALIGI
FT                   PVWMIFLCQAIVLVYQFPIHTERVGRLPRPIEFIFNTPSHHRVHHGSNNPYLDKNYGGI
FT                   LIIFDRMFGSYAEELEPVRYGLTKNIDTNNPIKVNYHEFVLMLRDVWHAETWRGRIGYL
FT                   LRPPGWQETKTDTAQPELVHTAS"
FT   gene            complement(170367..170996)
FT                   /locus_tag="MSMEG_0148"
FT   CDS_pept        complement(170367..170996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0148"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71124"
FT                   /db_xref="GOA:A0QNS6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNS6"
FT                   /protein_id="ABK71124.1"
FT                   /translation="MVPRKRLTRAEARAQTRRRLLDAAAETFARKGYDAASVEEIAEAA
FT                   GYSVGAVYSNFSSKEQLFSELRSERAALRLDEVADALRSAQGDPGGPFAKLSRQLVEVA
FT                   DKNIEVAALHTEFWLHAIRNPGAMDVLAESVGQTLQSLTGIAADLLAEHNVDQSVVRPE
FT                   TFAVSLLALHQGLIRQRRTNPSWVPEELFGQLLSWLLAGMPKLPAH"
FT   gene            complement(171077..172504)
FT                   /locus_tag="MSMEG_0149"
FT   CDS_pept        complement(171077..172504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0149"
FT                   /product="ThiC family protein"
FT                   /note="identified by match to protein family HMM PF01964"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73135"
FT                   /db_xref="GOA:A0QNS7"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNS7"
FT                   /protein_id="ABK73135.1"
FT                   /translation="MSAEAHCPGPAPQGPDRDTGVPTGPIPGSSKCYRDPVGAPGGRVP
FT                   FRRVHLSGGRHLDLYDTSGPYTETDTPARLATGLPSRPGVVTDRGTQLQRAREGVVTSE
FT                   MAFVAARESLRPKVVRDAVAAGHAVIPANHRHPESEPMIIGRAFRVKVNAGIGSPPDAV
FT                   IGDMVRAIRWGADIVTDLSGSDCDRMVRNMPVPVGTVPLYQALGRVHGDIAALTWNTFC
FT                   DTVIEQAESGVDCMTVHAGLRREHLSLAAGRITGIVSRGGAVIADWCLLHNAESFLYAH
FT                   FDQLCETLARYDVTLALAAGLQPGSVADANDAAQIAELRTLGQLARVAHRHGVQVVVEG
FT                   PGRVPMHKIAESVRIHQQLCRNAPSYTIGPLTTDVAPEHDHATAVIGAAVAAQAGTSML
FT                   CCLPRPARLRESVIAHKIAAHSADLAKGHPQAHEHDHAISRARCETHCRDRLALSPDPD
FT                   AAFTGHDHSKGSYLPFP"
FT   gene            complement(172501..173934)
FT                   /locus_tag="MSMEG_0150"
FT   CDS_pept        complement(172501..173934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0150"
FT                   /product="NAD(P) transhydrogenase beta subunit"
FT                   /note="identified by match to protein family HMM PF02233"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72576"
FT                   /db_xref="GOA:A0QNS8"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNS8"
FT                   /protein_id="ABK72576.1"
FT                   /translation="MNYLVTALYIAAFALFILGLSGLTGPKTAVRGNLIAAAGMGLAVV
FT                   ATLIKVRDTATVNWVLIVVGLVLGVVLGVPPAKKTKMTAMPQLVALFNGVGGGTVALIA
FT                   WAEFIETDGFGHFTPDQSPTVALVVGSLFAAIIGSVSFWGSLVAYLKLQESIPKNVEKA
FT                   LVRSAKVFQTSNVVLLLGAIATAAYIGLHAGTGNPLWLIVVVLVLAGIMGLFVVFPIGG
FT                   ADMPVVISLLNALTGLSAAAAGLALNNTAMIVAGMIVGASGSILTNLMAVAMNRSIPAI
FT                   VFGSFGAGGDTAAVAGGEQGTAKSTSAADAAIQMAYANQVIVVPGYGLAVAQAQHAVKD
FT                   MAAILESKGVEVKYAIHPVAGRMPGHMNVLLAEADVAYDAMKEMDDVNGEFSRTDVTLV
FT                   IGANDVTNPAARNDPSSPIHGMPILNVDESKSVIVLKRSMSSGYAGIENPLFFLNHTSM
FT                   LFGDAKKSVGEVIEELKAL"
FT   gene            complement(173931..174254)
FT                   /locus_tag="MSMEG_0151"
FT   CDS_pept        complement(173931..174254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0151"
FT                   /product="PntAB protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74118"
FT                   /db_xref="GOA:A0QNS9"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNS9"
FT                   /protein_id="ABK74118.1"
FT                   /translation="MYDQLLANLAILVLAGFVGFAVISKVPNTLHTPLMSGTNAIHGIV
FT                   VLGALIVLGDLPADASWGVRIIAFVALVFGTLNVIGGFLVTDRMLGMFKTRKPEVREAE
FT                   AAK"
FT   gene            complement(174258..175340)
FT                   /locus_tag="MSMEG_0152"
FT   CDS_pept        complement(174258..175340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0152"
FT                   /product="Alanine dehydrogenase/pyridine nucleotide
FT                   transhydrogenase"
FT                   /note="identified by match to protein family HMM PF01262;
FT                   match to protein family HMM PF05222"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71348"
FT                   /db_xref="GOA:A0QNT0"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3P2Y"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNT0"
FT                   /protein_id="ABK71348.1"
FT                   /translation="MTLIGVPRESAEGERRVALVPKVVEKLSARGLEVVVESAAGAGAL
FT                   FSDADYERAGATIGDPWPADVVVKVNPPTSDEISQLKPGSVLIGFLAPRTQPELASRLR
FT                   IADVTAFAMESIPRISRAQTMDALSSQANVAGYKAVLLGASLSTRFVPMLTTAAGTVKP
FT                   ASALVLGVGVAGLQALATAKRLGAKTTGYDVRPEVAEQVRSVGAQWLDLGIDAAGEGGY
FT                   ARELSEAERAQQQQALEDAITKFDIVITTALVPGRPAPRLVTAAAATGMQPGSVVVDLA
FT                   GETGGNCELTEPGRTIVHHGVTITSPLNLPATMPEHASELYAKNVTALLDLLLTDDGVA
FT                   PDFTDEIVAASCITRTEGDI"
FT   gene            175555..176568
FT                   /gene="panE"
FT                   /locus_tag="MSMEG_0153"
FT   CDS_pept        175555..176568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panE"
FT                   /locus_tag="MSMEG_0153"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="identified by match to protein family HMM PF02558;
FT                   match to protein family HMM TIGR00745"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75090"
FT                   /db_xref="GOA:A0QNT1"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNT1"
FT                   /protein_id="ABK75090.1"
FT                   /translation="MRIAVVGAGAIGAYWGAAMHRGGAEVHLIARNAHLHAMREHGVRV
FT                   LSDRGDFVAHPNATDDPHEIGPVDYVFLGLKAHSYPSCGPLIEPLLGEHTAVLAAQNGV
FT                   PWWYFHELQGPYRGRRIEAVDPGGATSAVLAPERAIGCVVYPATTIEAPGVIRHLEGTR
FT                   FSIGEPSGEISQRCIALSEAMIAGGLKAPVEADLRSDIWIKLMGNVAFNPLSALTRATM
FT                   VEICQNPYTRQVVVQLMEETLDIASRLGAKPDISIEKRLRGAENVGHHKTSMLQDLEAG
FT                   KQLELDAIVTAVVEMADLTGAPAPTLRTVHAATDLLARTAVPAAVPQEQALKPALR"
FT   gene            176579..178012
FT                   /gene="pyk"
FT                   /locus_tag="MSMEG_0154"
FT   CDS_pept        176579..178012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="MSMEG_0154"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="identified by match to protein family HMM PF00224;
FT                   match to protein family HMM PF02887; match to protein
FT                   family HMM TIGR01064"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69970"
FT                   /db_xref="GOA:A0QNT2"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNT2"
FT                   /protein_id="ABK69970.1"
FT                   /translation="MANRRAKIVCTLGPATATSSVLTELVDAGMDVARLNFSHSTHAEH
FT                   SALYGMVREIAAQRGRVVGVLADLQGPKIRLGCFADGPVVWATGEHVTITTEDCPGDHD
FT                   RVSTTYAGLSQDVRAGDRLLVDDGRVDLRVVAVDGPDIRCEVVDGGPVSDHKGISLPNI
FT                   PVSVPPLSDKDIEDLKFALELGADMIAMSFVRAPEEVELAHKIMDEVGRRVPVIAKLEK
FT                   PEAVSDLPAIVEAFDGLMVARGDLGVEMPLEQIPLVQRRAIALCRQAAKPVIVATQMLD
FT                   SMVSDRRPTRAEVSDVANAVFDRADAVMLSAETSVGADPAHAVATMARIVVAAESGSGR
FT                   GETPESALVEAVNGTDAVFGDAIAVAACEVGRRLGAAALCCFTRTGDTALRLARQRSPL
FT                   PLLAFAHDDEVRGRLTFSWGVESAVLAPTELAESMPGEVSRALLSMGACHPGDVVVVVS
FT                   GSRSGVAGYTDSVRVLRVE"
FT   gene            complement(178054..178524)
FT                   /locus_tag="MSMEG_0155"
FT   CDS_pept        complement(178054..178524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0155"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00989;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74329"
FT                   /db_xref="GOA:A0QNT3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNT3"
FT                   /protein_id="ABK74329.1"
FT                   /translation="MTETPTAISASWLAQAVVDASSEAIVVTDKAGDIVLWNDGAARMF
FT                   GFTAADALGQSLDLIIPEKQRDRHWKGYHQTMATGVTKYGDSMLAVPATHKDGHRLSIE
FT                   FSVALLRDDTGEIVGISAIMREVSERRAAERALHARIAELQNELNEVRAGLS"
FT   gene            178631..179557
FT                   /locus_tag="MSMEG_0156"
FT   CDS_pept        178631..179557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0156"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74585"
FT                   /db_xref="GOA:A0QNT4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNT4"
FT                   /protein_id="ABK74585.1"
FT                   /translation="MLLRQLEYFVAVARERHFARAAEVCYVSQPALSTAIAKLERELDV
FT                   TLIHRGQNFEGLTLEGERLVVWAKRLLAEHDGLKAEAAALRTGISGTLRLGTGPTVSTT
FT                   TAIPVAAFCNLHPKANVSISSRLSSAELLRQLRDFELDAAIAHFGPEDRAGLEVVPLYK
FT                   ERYVLLVSGDQLAPGTRAITWSDAAQLPLALLEPHMRFRQFIDKAFAENGVTPSPQVET
FT                   DSVASLYALVATGAWASVVPHTWLRAVPQLGAARAVRLIEPETTAQISLAIHAGRGSAA
FT                   ARAFVNVAAGARLDDQFDLQSEHWLLK"
FT   gene            179717..181450
FT                   /locus_tag="MSMEG_0157"
FT   CDS_pept        179717..181450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0157"
FT                   /product="oxalyl-CoA decarboxylase"
FT                   /EC_number="4.1.1.8"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74591"
FT                   /db_xref="GOA:A0QNT5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR017660"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNT5"
FT                   /protein_id="ABK74591.1"
FT                   /translation="MTVAPTRDTEAASTDEPGALTDGIHLVVDALKLNDVQTIYGVVGI
FT                   PITDLARLAQASGLRYIGFRHESDAGHAAAAAGFLTQKPGICLTVSAPGFLNGLVALAN
FT                   ATTNCFPMVQISGSSERHLVDLQRGDYEEMDQLAAARLFAKAAYRVSRAEDIGRGIARA
FT                   IRTAASGRPGGVYLDIPAAVLGEVIDAEKAKKTLWRVVDPAPKQMPEIDAVDKAIELLA
FT                   GAERPLIVLGKGAAYAQADDTIREFVESTGIPYVPMSMAKGLLPDDHPQSAATARSLAL
FT                   KRADVVMLVGARLNWLLGHGDAPQWNPDAKFIQVDISATEMDSNQPIAAPLVGDISSVV
FT                   ETLLERSKPGQISVAPEWRQELAAKSEQNVAKMSGRLEAALTAHPMKFLGALQAIRDVL
FT                   ADNPQVYVVNEGANALDLARNTIGMQVPRHRLDSGTWGVMGIGMGYAIAAAVETGDPVV
FT                   AIEGDSAFGFSGMELEAICRYNLPIVTVILNNSGVYRGDEASGSTADPAPTALRAQHEY
FT                   MIKAFGGKGYQATTPDEVAAALREALASGRPALIDCVIDPSDGTESGNIAHLNPKGIST
FT                   K"
FT   gene            181519..182781
FT                   /locus_tag="MSMEG_0158"
FT   CDS_pept        181519..182781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0158"
FT                   /product="formyl-coenzyme A transferase"
FT                   /EC_number="2.8.3.16"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69972"
FT                   /db_xref="GOA:A0QNT6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR017659"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNT6"
FT                   /protein_id="ABK69972.1"
FT                   /translation="MTELPLSGIKVIDFTGVQAGPACTQMLAWYGADVLKVERPGGGDV
FT                   TRKQLRDIPDVDALYFTMLNSNKRSLAIDTKSPEGLEVMEKLIRDADVLVENFAPGALD
FT                   RMGLSWETLQKWNPRLIFGSVKGFNDDSTWNDLKVYENVAQCAGGAASTTGFWDGPPTV
FT                   SGAALGDSNTGMHLLIGILTALIQRDKTGKGQKVSASMQDAVLNLCRVKLRDQQRLEAV
FT                   GYLEEYPQYPHGEFGDTVPRGGNAGGGGQPGWVLKCKGWETDPNAYIYFTIQEQNWVRT
FT                   AEAIGHPEWAEDPAYNTAKARQDKIFEIFGEIEKWLADKTKYEAVDILRKWEVPCAPVM
FT                   SMKELANDPSLRKSGSIVEVDQKGRGSFLTVGSPVKFSAFQPEIKGAPLLGEHTDEVLA
FT                   GLGYDADQIEDFHRKKIVVGS"
FT   gene            182884..183369
FT                   /locus_tag="MSMEG_0159"
FT   CDS_pept        182884..183369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0159"
FT                   /product="formate dehydrogenase, gamma subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="identified by similarity to GB:CAA11233.1; match to
FT                   protein family HMM PF01257"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75546"
FT                   /db_xref="GOA:A0QNT7"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNT7"
FT                   /protein_id="ABK75546.1"
FT                   /translation="MKRTTTGETSVATLVREIAADHRDHRGPLLPILHAVQERLGCVPA
FT                   EAVPVLAEELNLSRADVHGVITFYHDFRSEPAGRTTVRVCRAEACQALGASRLVAHLQD
FT                   RHGVQLGDATDDGTLTAEQVFCLGNCALGPSAQVDGRLYGRLDEARLSALIDSAVTR"
FT   gene            183366..184964
FT                   /locus_tag="MSMEG_0160"
FT   CDS_pept        183366..184964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0160"
FT                   /product="formate dehydrogenase, beta subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="identified by similarity to GB:CAA11234.1; match to
FT                   protein family HMM PF01512"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74648"
FT                   /db_xref="GOA:A0QNT8"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNT8"
FT                   /protein_id="ABK74648.1"
FT                   /translation="MSEPVTVYVPCDSAAKSVGADEVAHALTAAAERVGRPIRLVRNGS
FT                   RGMLWLEPLIEVATPNGRVGYGPVTPDQVDELVGAGLFDAAEHPLRVGVVEDLPWMATQ
FT                   DRVTFARVGVTDPVSPDDYLDHGGLAGLRRALQMSPAEVVAEVTDSGLRGRGGAGFPAG
FT                   IKWKTVLDCADALKFVCCNADEGDSGTFADRMVMEGDPFMLIEGMTIAAHAVGATEGYI
FT                   YIRSEYPDAIATMRAAIDIARGRGWLGDDVLGSGLRFDMHVRVGGGAYICGEETSMLES
FT                   LEGKRGMVRAKPPIPAINGLFGKPTVVNNVLTLSSVPLVLAEGAQAYADFGVGRSRGTQ
FT                   IFQLGGNIRRGGIVERAFGITLGELVEHYGGGTLSGRPVRAVQVGGPLGAYLPSDRFDL
FT                   PMDYEAFAEAGAMVGHGGIVVFDETVDMAAQARFAMEFCAAESCGKCTPCRVGSVRGME
FT                   VIDRITAGDHREENLALLDDLCDVMTEGSLCAMGGLTPMPVRSALTHFPDDFGPRQPSA
FT                   DATAAPLGARTEGPR"
FT   gene            184961..187780
FT                   /locus_tag="MSMEG_0161"
FT   CDS_pept        184961..187780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0161"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF00111; match to protein
FT                   family HMM PF00384; match to protein family HMM PF01568;
FT                   match to protein family HMM PF04879; match to protein
FT                   family HMM TIGR01591"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73120"
FT                   /db_xref="GOA:A0QNT9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNT9"
FT                   /protein_id="ABK73120.1"
FT                   /translation="MTLLSEPDFGTPAKPGPATVTVEVDGIPVSVPEGTSVMRAAAEAG
FT                   IDVPKLCATDRLDAFGSCRLCLVEIDGRRGTPASCTTPVAEGMVVHTQTPKVAKLRESV
FT                   MELYISDHPLDCLTCPANGDCELQDMAGVVGLRQVRYGYEGANHFDAEPDHSNPYFDFD
FT                   PSKCIACSRCVRACGEIQGTFALTIEGRGFESKVSPGAGELFMDSECVSCGACVQACPT
FT                   ATLQERSVVELGIPTRSVTTTCAYCGVGCSFKAELRGDELVRMVPQKAGGANEGHSCVK
FT                   GRFAFGYATHPDRVLRPMVRDKITDPWREVEWDEAINTVARRMQEIAQRHGAGAIGAIT
FT                   SSRCTNEEVYVVQKMVRAAFGNNNVDTCARVCHSPTGYGLKQTFGESAGTQDFRSVAEA
FT                   DVIVVIGANPTDGHPVFASRMKQRIREGARLVVVDPRRIDLVRSPHIEADHHLQLRPGT
FT                   NVAVVNAMAHVVVTEGLTDASFVAERCEGFEEWAEFIAREENSPEAVEPITGVPAEELR
FT                   AAARLYALAPNAAIYYGLGVTEHSQGSTMVMGMANLAMACGNIGRDGVGVNPLRGQNNV
FT                   QGSCDMGSFPHELPGYRHVSDDAVRQVFENLWGTELLAEPGLRIPNMFDAAIEGSFRGL
FT                   FVHGEDIAQSDPNVKHVLAALESMELVVVQDLFLNETSKYAHVFLPGASFLEKDGTFTN
FT                   AERRINRVRAVMKPKSGMHEWDIVCRIATAMGYPMHYDHPSQIMDEIATLTPTFTGVSF
FT                   DKLDQLGSIQWPCDEEAPEGTPIMHVDAFTRGLGRFVPTPFVPTDERSTRRFPLILTTG
FT                   RILSQYNVGAQTRRTANIAWHAEDVLEIHPHDAEVRGIADGDLVTLASRVGETTLHAQT
FT                   SDRMPTGVVYTTFHYPVTGANVVTTDSSDWATNCPEYKVTAVQVALAPPSARQAEARVD
FT                   ELPETELVR"
FT   gene            187782..188006
FT                   /locus_tag="MSMEG_0162"
FT   CDS_pept        187782..188006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0162"
FT                   /product="NAD-dependent formate dehydrogenase delta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69733"
FT                   /db_xref="InterPro:IPR021074"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNU0"
FT                   /protein_id="ABK69733.1"
FT                   /translation="MQIHEAPTTATEIKLINQIAAHFGYLPEDKAAAAVADHVRRFWEP
FT                   RMQRRLFSLIYADASELTPVAMAAASQLR"
FT   gene            complement(188070..188381)
FT                   /locus_tag="MSMEG_0163"
FT   CDS_pept        complement(188070..188381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0163"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73344"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNU1"
FT                   /protein_id="ABK73344.1"
FT                   /translation="MTSFAGNPAVDSLHRLIDNLMHHVSALEVTHGRVPAVHRVVNDVE
FT                   RIRNGIERLKIDLAELAPAGVRSSATAVEKIQIPDSDYGIDFWRDVDHEGIAGVRRHA"
FT   gene            complement(188427..189770)
FT                   /locus_tag="MSMEG_0164"
FT   CDS_pept        complement(188427..189770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0164"
FT                   /product="transmembrane transport protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72197"
FT                   /db_xref="GOA:A0QNU2"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNU2"
FT                   /protein_id="ABK72197.1"
FT                   /translation="MAANDTAAPVVVRDLRGRTYRVGEDPQDLIGCSRAWMLAFSWIAM
FT                   AGIGVLQYGYGVALTALHVTEGRSLTAALWVLALWVVFQAGAAAPTAVLSHRFALSPSR
FT                   AVPIGAALCAAGPLTVAHTDNIALAILGYSVLSGTGAGIVYATCTATVAKWYPENRAAR
FT                   IGLVTGAVGCGAVPFIAAFALTLTSTTRTALFTAVAVIVLVVVAQVGSLLKDPPAGWWP
FT                   AHVDPRQWAFDKTLNRSLRHNVTAIRQFSPAEAARTPAFVVMYLIMVIAAAAALLAIVY
FT                   VPIMAISQGFSLAVAALAVGLLAVVNGTGRSIAGWASDRLGRRQVLSAALLIQGCAQLG
FT                   LVYSASSAVPVAFVVFAGLSGLSGGAFYPLIASLVADYFGEPNAVRNFSLVYSAKLFGG
FT                   LIGVGVPALLISSHLMNPFVVAGLLSLGAAAMTRLLHLPGFPIVALPR"
FT   gene            189944..190786
FT                   /gene="fdhD"
FT                   /locus_tag="MSMEG_0165"
FT   CDS_pept        189944..190786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhD"
FT                   /locus_tag="MSMEG_0165"
FT                   /product="formate dehydrogenase family protein accessory
FT                   protein FdhD"
FT                   /note="identified by similarity to SP:P39756; match to
FT                   protein family HMM PF02634; match to protein family HMM
FT                   TIGR00129"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74066"
FT                   /db_xref="GOA:A0QNU3"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNU3"
FT                   /protein_id="ABK74066.1"
FT                   /translation="MGRVTNRYRVVRLAEGGAAERPDTLAAEEPLEIRVAGRPLTVTMR
FT                   TPGNDFDLARGFLVSEGVVARAGDIAGIRYCAGATRDGSNTYNVLDVVLAEGVTAPDAS
FT                   LERNFYTTSSCGVCGKASLEAVRTVSSWTVGDDPVELSAATIVTMPDQLRAAQRVFDRT
FT                   GGLHAAALFDVDGELLCVREDVGRHNAVDKVIGWALDGDRLPLRGTVLMVSGRASFELV
FT                   QKAVMAGIPAMAAVSAPSSLAVDLAREMGLTLVGFLRGATMNIYAGAERISDDRFATV"
FT   gene            complement(190817..191545)
FT                   /locus_tag="MSMEG_0166"
FT   CDS_pept        complement(190817..191545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0166"
FT                   /product="GntR-family protein transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73089"
FT                   /db_xref="GOA:A0QNU4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNU4"
FT                   /protein_id="ABK73089.1"
FT                   /translation="MSRPYPAGKPKKASPSNMLGDAAPRVVRPAPLRQAVYDAIIEMII
FT                   QGTLQRGQHLVEAELAEYLGVSRQPVREALQRLQTDGWIELRPAQGAFVHVPSEEEVDQ
FT                   LLGVRTVLETYSAALAAERATPEDVNRLWELQQDGLNALTTNNSEGLVEANAALHAAIT
FT                   ELAGNQVLADHISLVERKWRWYYLPIARPRGHDAWSEHAELIKAIAAHDVEQATDIMRR
FT                   HTDRTRQTYHEERMAKAAQA"
FT   gene            complement(191746..193149)
FT                   /locus_tag="MSMEG_0167"
FT   CDS_pept        complement(191746..193149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0167"
FT                   /product="transmembrane transport protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75752"
FT                   /db_xref="GOA:A0QNU5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNU5"
FT                   /protein_id="ABK75752.1"
FT                   /translation="MTSSAQPTYREVVDDNGRVYRIGETDRDILGRSRAWMVWLPWISM
FT                   MAISSSEYAFTSAEDTLADAHGWHGSHIFWLLGAWVLFQAAVAFPAGKLRESGKLSARA
FT                   AMMLGAAGSLMGYLALAYSPNVFFAYLGFSFFGGGAAGFVYATCVNMVGKWYPERKGGK
FT                   TGFVNGGFAYGSVPFIFIFTSYMDLANYQGVLFAVGVFLAGLVAVSGFFFKDPPKNWWP
FT                   PHVDPLGAASDPRIARALRKNPPAVKQFTPMEAIKTGILPLMWFVLLCTAGINIFGIAM
FT                   QVPFGKEMGFAGGIVALAMSLKAIINGTGRGVIGWISDRFGRRDTLILVCLVLGLAQYA
FT                   VYFSGSIGNMPLFLLASMVSGFGGGAIFPLFAAMTADYFGENNNATNYGLVYSSKLVSG
FT                   LVGAGMGSVVVSAWGYGAAFIIAGSVGVACAFLTLLLKQPKLPKSERLAAEDPARHSSQ
FT                   AKEASLAAD"
FT   gene            193685..194971
FT                   /locus_tag="MSMEG_0168"
FT   CDS_pept        193685..194971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0168"
FT                   /product="formyl-coenzyme A transferase"
FT                   /EC_number="2.8.3.16"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70125"
FT                   /db_xref="GOA:A0QNU6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR017659"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNU6"
FT                   /protein_id="ABK70125.1"
FT                   /translation="MDMAETRPVNDDPAVPKNVGGKALSGVRVLDMTHVQSGPSATQLL
FT                   AWLGADVIKLEAPKTGDITRNQLRDVPGVDSLYFTMLNCNKRSITVNMKSDAGKQIFTD
FT                   LVSRVDILVENFGPGVVDRFGFPWERLQEINPRLIYASIKGFGPGKYANFKAYEVIAQA
FT                   MGGSMATTGFEHAPPTVTGAQIGDSGTGIHLVAGVLAALYQRVSTGRGQRVEVAMQEAV
FT                   LNLCRVKLRDQQRLTHGPLAEYPNDNFTDEVPRAGNASGGGQPGWAVRTKGGGPNDYIY
FT                   IIVQPQVWAPLAELIGHPELADHPDWARPENRLNKLDKMFALIEDWSERLSKWEALEAL
FT                   NALNVPCGPVLGTKELIEDETLAELGAVVEVEHPQRGSFKTVGSPLRLSDSPVEIVRSP
FT                   LLGEHTDAICAELGYTPEQLELFRVSGAI"
FT   gene            complement(195087..195203)
FT                   /locus_tag="MSMEG_0169"
FT   CDS_pept        complement(195087..195203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0169"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74134"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNU7"
FT                   /protein_id="ABK74134.1"
FT                   /translation="MRALKTSFILFLAMIAAGARLPHSRKVVVTVPDVERLP"
FT   gene            195185..196567
FT                   /locus_tag="MSMEG_0170"
FT   CDS_pept        195185..196567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0170"
FT                   /product="transmembrane transport protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70159"
FT                   /db_xref="GOA:A0QNU8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNU8"
FT                   /protein_id="ABK70159.1"
FT                   /translation="MSSALANYREITDANNRVYRIGESDREILGRSRSWMVWLPWLAMM
FT                   AVSVYEYGYGAAEEAIRDAHGWSMSETFWLLAIWALFQAGIAFPAGKLREKGIVSARAA
FT                   MLIGAALSALGFVTLTQGNLFVAYLGFAVCGGIGAGLVYATCINMVGKWFPERRGGKTG
FT                   FVNGGFAYGAVPFIFIFSYALHPSTYVWVLDLVGAYMLVVLVICGLMFRDPPKNWWPES
FT                   VDPLQWANSKAGAKGLAKNPPAVKQFTPMEAIKTGMLPLMWLSLGISAGVSLFGSSYMV
FT                   PFAKELGFGPLIAASSAGVLSIINGTGRGATGWVSDRLGRKLTLILVLLVSAVALVGLL
FT                   YAGQAHNEVLFLFFAFLVGFGGGAFYPMFAALTPDYFGENNNASNYGLVYSSKLLGSVV
FT                   GIGVGASVIDTWGYAGAYWIAAASALVSAAIAVFLRQPGRRSGAAVAPSSTKTSTLASA
FT                   SD"
FT   gene            196658..197587
FT                   /locus_tag="MSMEG_0171"
FT   CDS_pept        196658..197587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0171"
FT                   /product="histone deacetylase superfamily protein"
FT                   /note="identified by match to protein family HMM PF00850"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74628"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNU9"
FT                   /protein_id="ABK74628.1"
FT                   /translation="MTTMLIHHEIFAAHRTAAGHPERPDRYRAVEMALAQSRFDDLLRV
FT                   EAELAELDVTRYVHSNAYVDALEAARPTDGFVYLDGGDTMMEPSTWEVVLRGVGGTLQA
FT                   VDSVLDGTAQNAFVACRPPGHHAETERAMGFCLFNNISIGARHAQLKHGLSRVAIVDFD
FT                   VHHGNGTQEIFYSDGSVVYASTHQMPLFPGTGATDETGVGNIFNAPLRAGDGGDELREA
FT                   FRDRIIPAVDRFEPELIIVSAGFDAHERDPLGSLSMTADDFGWATRELMAAAERHCEGR
FT                   LVSVLEGGYDLQGLRESVSAHVDELVRG"
FT   gene            complement(197588..198190)
FT                   /locus_tag="MSMEG_0172"
FT   CDS_pept        complement(197588..198190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0172"
FT                   /product="probable conserved transmembrane protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70744"
FT                   /db_xref="GOA:A0QNV0"
FT                   /db_xref="InterPro:IPR039708"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNV0"
FT                   /protein_id="ABK70744.1"
FT                   /translation="MYTKTRARVPSGTATPVRWWAACAFVRTPLVRRADRIQAWALIAG
FT                   LLLAVVALYPAALLGQAGYAGRAETIAAEAATRHAVDATATKGSTIDPTVAESSAAASF
FT                   RVPVKWETNRGVRTAETSVDHPVKAGDTVQIWLDEKGAVTSAPKTESDARIAGIGAFVF
FT                   AWLAMVGLIGGGYAALHVVLNRSRNREWDLGLRELVH"
FT   gene            complement(198371..198691)
FT                   /locus_tag="MSMEG_0173"
FT   CDS_pept        complement(198371..198691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0173"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71022"
FT                   /db_xref="GOA:A0QNV1"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNV1"
FT                   /protein_id="ABK71022.1"
FT                   /translation="MTPMRDSGLQVERTRLAWRRSLLALVAVLALVGRPVVLGQNAVAT
FT                   IAFGSAAVVALGLVVAYRRRSRAVESAMRDGRPLPGAGVPAAFVVTCVWCAIVAVVALL
FT                   TM"
FT   gene            complement(198688..199059)
FT                   /locus_tag="MSMEG_0174"
FT   CDS_pept        complement(198688..199059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0174"
FT                   /product="putative inner membrane protein"
FT                   /note="identified by match to protein family HMM PF02656"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72165"
FT                   /db_xref="GOA:A0QNV2"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNV2"
FT                   /protein_id="ABK72165.1"
FT                   /translation="MGTLMRNRFPRSVYDTGSDPDPRFTLANERTLLAWLRTSLALLAA
FT                   GVALETLGLPLQPTLRLVASVALVVLAIALPPVAWLSWAATERAMRRGEPLPSSVLAPG
FT                   LTVALPVIGLVILAGLLLG"
FT   gene            199157..200293
FT                   /locus_tag="MSMEG_0175"
FT   CDS_pept        199157..200293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0175"
FT                   /product="FAD dependent oxidoreductase, putative"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72656"
FT                   /db_xref="GOA:A0QNV3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNV3"
FT                   /protein_id="ABK72656.1"
FT                   /translation="MSSVVVVGSGVVGLCTAWNLARAGAEVTVVSGLDPEREIGWGSGA
FT                   WVNASSKVRLGYPDHYTLLNQRGMTALHHLAEKLTDERWLHITGAVEIVSGDDQRRTLA
FT                   EDVRRLVEFDYPAELLDDADAARVMPGVRLADDEAAAVFPAEGWVDIALLLTTLTAAIA
FT                   EAGGRFVRRTVTGFVDDAGTVTGVGLDDGSVLSADRYVIAAGAWTGQLAALAGIDIPVL
FT                   PADHPKVPGLAVAVTSPANESFPILVTPEVVARPSGPNRMLLAGDSHGIALTIDSPRSD
FT                   LIRAAEVLLARATARVPALAASAILDVRLSLRAIPSDGITIAGFPAGRDDVYVLTTHSG
FT                   FSLAAVLGDLAAREILTGQEQQALHEYRPTRFSANASA"
FT   gene            200304..201158
FT                   /locus_tag="MSMEG_0176"
FT   CDS_pept        200304..201158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0176"
FT                   /product="glutamine ABC transporter periplasmic-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69529"
FT                   /db_xref="GOA:A0QNV4"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNV4"
FT                   /protein_id="ABK69529.1"
FT                   /translation="MNKSMQRLARSAVACCVAGALVSGCSSAPGDTSQETDGAKPSGQE
FT                   ITVATDATYRPFETVDPATKKIVGLDADLVEAIGDTLGLTVKLTNVGFDSIVPGLQARK
FT                   YDAAASGISVTPEREKVVDFVPYMSAGSGLAVQKGNPHDLKMEPLALCGHTIGAPKGTI
FT                   QAIGQLPEISAKCVAEGKPEISISQFPSQDAVNLALSSGRIDAAMAANISLAIQVEESD
FT                   GALELAPGDPYDPSPVGIAFPKGSDLLPAVKTAMAQLDSSGELKKIVTKWGMPENSIYT
FT                   GAS"
FT   gene            201116..202087
FT                   /locus_tag="MSMEG_0177"
FT   CDS_pept        201116..202087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0177"
FT                   /product="ABC polar amino acid family protein transporter,
FT                   inner membrane subunit"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75561"
FT                   /db_xref="GOA:A0QNV5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNV5"
FT                   /protein_id="ABK75561.1"
FT                   /translation="MGHAGELDLHRCIVTGAMTATETCETQSPGVARVVRQRHLGRWLS
FT                   GGVMVVLVALALRSVATNDRFGWPLVAGYLFDPQILEGVRLTLVLTFVCMAIGIVLGTV
FT                   LAVMRLSANPVAQALAFAYVGFFRGTPVLVQLIFWFNFAALYPHLSFGIPGVDIDANAL
FT                   ISPVLAGVLGLGLHEAAYMAEIIRGGIGSIDVGQIEAARALGLRKNQVLRRIVLPQAMR
FT                   VIVPPTGNEVVGMLKTSSLVSVLAVGELLYSAQLIYASNYQTIPLLIVASLWYLVLTAV
FT                   LSAGQMRLERHFARGSVEIRTAAAEWVRGWLGLGHLARRGVR"
FT   gene            202084..202866
FT                   /locus_tag="MSMEG_0178"
FT   CDS_pept        202084..202866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0178"
FT                   /product="ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70491"
FT                   /db_xref="GOA:A0QNV6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNV6"
FT                   /protein_id="ABK70491.1"
FT                   /translation="MTVPSETARPLVRAQSVTKSFGTVRVLDNVDVEIARGEVVCLIGP
FT                   SGSGKSTFLRCINHLETLDGGQLWVDGELVGYRRKGDKLIELSDRQASVRRAEIGMVFQ
FT                   HFNLFPHMTVIQNIVEAPVRTRRATLEEATARGEDLLTRMGLADKRTVYPAELSGGQKQ
FT                   RVAIARALAMQPKLMLFDEPTSALDPELVGDVLRVMKGLAESGMTMIIVTHEIGFAREV
FT                   ADRVIFFENGRVVEQGSARDVLDSPSNPRTAAFLSAVR"
FT   gene            complement(202876..203547)
FT                   /locus_tag="MSMEG_0179"
FT   CDS_pept        complement(202876..203547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0179"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75769"
FT                   /db_xref="GOA:A0QNV7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNV7"
FT                   /protein_id="ABK75769.1"
FT                   /translation="MLPDLSVNRSTTVERVSDALRAAVLSGELTPGTPLREVDLAERMK
FT                   VSRGSVREALVRLSDEGLLRRTSFRGVEVKQLTADEIRDLFVVRKLIELTAVDAAGTAG
FT                   AAALAELRRAVDEFGQAIRTGAAVDRNRADMFVHITLVGLLNSPRLSRIHGELMSELQL
FT                   ALVSQYRDSTILPGTELTNRHEEFLRMLLDGDTVGAREQLERRLDLAQRLLLGTADPGE
FT                   N"
FT   gene            complement(203664..204173)
FT                   /locus_tag="MSMEG_0180"
FT   CDS_pept        complement(203664..204173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0180"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71800"
FT                   /db_xref="GOA:A0QNV8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNV8"
FT                   /protein_id="ABK71800.1"
FT                   /translation="MTTASGGQRDAGARIRPVVLTHAADLFAERGPAATSLRDVAERSG
FT                   VNAGLIFRHIGNKEALVAAVLDFLADELVTARGTDAPEEVIEAHVERSWKVIARALLDG
FT                   YDVGALQHRFPVVEELVEAARQRHQDDHAARAATADAIALQLGWRLFGPFLRAATGLDD
FT                   NHPPAD"
FT   gene            204225..205163
FT                   /locus_tag="MSMEG_0181"
FT   CDS_pept        204225..205163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0181"
FT                   /product="alpha-ketoglutarate-dependent taurine
FT                   dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /note="identified by match to protein family HMM PF02668"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72553"
FT                   /db_xref="GOA:A0QNV9"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNV9"
FT                   /protein_id="ABK72553.1"
FT                   /translation="MTDTRHAPPPAPRPIPEYDVSAGPFSHLAAERDRLAALRWRHFDA
FT                   EQVGTTLGAQISGVDLTRPLAGAVFDELRTALHEYKVLFFRDQPMSADAHAALARQFGP
FT                   LEVHPLLPANSAESALARFQKDANVSGYENAWHHDVTWRPEPSILAILHAIEVPPIGGD
FT                   TLFADMYAAYDSLDDETKAEIDRLDAAHDFTYYLRGLVPDEKIAELQAAHPPVTHPVVC
FT                   THPITGRRHLYVNRMFVSHIAGYPHDTGRALLDRLCRTADAPEHQVRFRWAPDSVAIWD
FT                   NRAVQHYAASGYWPHTRIMERASVTGPVPCR"
FT   gene            205190..206347
FT                   /locus_tag="MSMEG_0182"
FT   CDS_pept        205190..206347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0182"
FT                   /product="epoxide hydrolase 1"
FT                   /EC_number="3.3.2.9"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM PF06441"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72822"
FT                   /db_xref="GOA:A0QNW0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNW0"
FT                   /protein_id="ABK72822.1"
FT                   /translation="MARPEPFVHITPDEQLDDLRRRLRATRWNDAPEDAVWSIGADSGY
FT                   LRELVDYWVDEFDWRQRELELNALPRFRASLDGLGIHFVHARAVEGSPAPVPLILTHGW
FT                   PDSFWRYAKVLALLTDPASHGGDPADAFDVVVPDLPGFGYSDRPRIPALNAAEVAALWS
FT                   RLMTALGYPRYGAVGGDIGSSVSRFLALDFPEQVVAVHRMDAGLPAGTAELGDLSEDER
FT                   RWIKEATRWVGAEGAYAAMHRTKPQTAAVGLTDSPAGLAAWIVEKMRAWSDCGGDVESV
FT                   FSKDDLLTNVTVYWMTATISSSMRMYRANAAIPVEQYARRVEVPTGYSLFRGDIVRPPH
FT                   AWLHRTSNAVYITEPPRGGHFAPYEQPELYAEELRNFFRPYRNHT"
FT   gene            206362..208134
FT                   /locus_tag="MSMEG_0184"
FT   CDS_pept        206362..208134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0184"
FT                   /product="transferase"
FT                   /note="identified by match to protein family HMM PF01019"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70193"
FT                   /db_xref="GOA:A0QNW1"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNW1"
FT                   /protein_id="ABK70193.1"
FT                   /translation="MMPFTTRPTLTGWHGMAASTHWLASGTAQAVLERGGNAFDAAAAA
FT                   GFVLHVAEPHLNGPGGDMVALVSTATTSEPVVLVGQGPAPEGATIAAFRERGLTHVPGA
FT                   GALAAAVPAAVETWFHLLERYGTWRLSDVLGYAAEYAERGIECSEQLSAVLATMARHFT
FT                   AHWPTSRDVWLPDGTPPAPGDLVRNPAYAAVLRRLSEAGATGTRVAGIDRARRMWRNEI
FT                   ASAIVEFTSRPHRHSGGGDHAGVLTTSDFQNLRIGSEASLRLRFRGVDVVKAGFWSSGP
FT                   VLLQALGILDQAAASRSIDPDTAAGAHTIVETVKLAMADREAYYGDARPDQGVLGQLLS
FT                   VEYCAERAGAITDHAATVVDPGVLPGIRPYRSRTTVTPHDELGTGEPTVSRTGETRGDT
FT                   CHLDVVDRFGNMISATPSGGWLQSSPAVPGLGFCLGTRLQMTWLDEDSPSALKPGTRPR
FT                   TTLSPTMVLEAGVPVTSLGTPGGDQQDQWQLLYLLRTIVTGMTPQQAIDAPMYHTTAFP
FT                   GSFVPRTASERGVVVEDRAGTEVIDGLRGRGHDVTVTDGWSLGRLSMVGRDRVTGRLCA
FT                   AANPRGGTGYAVGR"
FT   gene            complement(208033..208584)
FT                   /locus_tag="MSMEG_0183"
FT   CDS_pept        complement(208033..208584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0183"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71036"
FT                   /db_xref="GOA:A0QNW2"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNW2"
FT                   /protein_id="ABK71036.1"
FT                   /translation="MTTSTLYGIFAIISFTLIWVAAFGAFMFTRRVGRRAHVTATLGIG
FT                   AATAAVRKVGKRAPMTADELSLARQVLHDRGSLLALAVPATLFFLGCFYVFGSLEQLHG
FT                   RTPSERTFLGIFPMITSTNLSLQILRSVRLKRRAEGLEPLPEPPVDSPPDGITGAATGV
FT                   GGRAQPAGHTVSAHHGQPSE"
FT   gene            complement(208581..211442)
FT                   /locus_tag="MSMEG_0185"
FT   CDS_pept        complement(208581..211442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0185"
FT                   /product="MmpL6 protein"
FT                   /note="identified by match to protein family HMM PF03176"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73250"
FT                   /db_xref="GOA:A0QNW3"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNW3"
FT                   /protein_id="ABK73250.1"
FT                   /translation="MPGQVRMSAHRAGRPFFARTVRVLAVPIIVFWGLLAVTTNTFIPQ
FT                   VEHVADELAGPMIPNYAPSQVALLHIGEKFQESDSTNLTMLVFEADRPLDDGDHRYYDD
FT                   LVRRLQADTEHVQYVMDLWGKPITAAGAQSVDGKASFVLLRLAGNIGQLEANESVDAVR
FT                   DIIADDAPPQGLKVYVSGAAPLASDTLSTANSSLNNITIFTIILIVVMLLLVYRSAACL
FT                   LVPLPAVLIEMLVAKGVIATLGHFGLIPLSSFAVNVVVALTLGAGTDYGIFLLGRYHEA
FT                   RQSGESREDAYFTAYRSVAPIIIGSGLTIAGACFCLSLARLDYFHTMGPAVAISMLFTI
FT                   AAALTLAPALLTLGSLLALFDPKRPTRGHLYRRIGTSVVRWPKPIFVASAAVVMVGAVF
FT                   VPSYRVNYDDRAYQPVDAAANLGFQAADRHFNQSKLFSEMLMIETDHDMRNSADFISLD
FT                   RVAKALIRLPGVAMVQSITRPLGRPLEHATIPYLFTTQGSTNGQQLPFSEQANENTDRQ
FT                   AEIQARSVEVLQHVITITQQMSAELHSTVLTFENLKEVTDEVNEGISNLDDFLRPLKNY
FT                   FYWEPHCFDIPVCFAMRSLFDSLDGIDSLDEQIGNAVVSFEAIDRLLPQMITQLERMIA
FT                   DSRALLGVITNNYGPAHLQSTQTDQTYYDQINVGNDFDAARSDDFFYIPHEAFDNDDVK
FT                   TGMKLLMSPDGKAARFIITHEGNAMAPEGIEHVEQFPDAIKMALKETSLAGAKIYIGGA
FT                   ASNNLDIKTYAASDLLIVAIAAFVLIFLIMLYLTRSLVAALVIPGTVAFSFAGAFGLSV
FT                   MMWQHLIGLPLHWLILPLSFIILVAVGSDYNLLLISRVKEETGAGLNTGLIRALGSTGA
FT                   VVTSAGLVFAFTMLSMLVSDLRTIGQLGTTVCIGLLLDTMIVRSLVVPCLLRLLGPWFW
FT                   WPTFIRQRPLRQAVRQRERADVV"
FT   gene            complement(211421..211915)
FT                   /locus_tag="MSMEG_0186"
FT   CDS_pept        complement(211421..211915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0186"
FT                   /product="MmpS2 protein"
FT                   /note="identified by match to protein family HMM PF05423"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74172"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNW4"
FT                   /protein_id="ABK74172.1"
FT                   /translation="MTLVAVKPPARKTGERTTARRTVVPGALQKGWLPAVTVIALGIGS
FT                   LAVWKVHEMSAPGPVPTVLAAQAPEQFTPKRMTYELFGSPGNGGMLTYVDIEGNPHRVD
FT                   VSELPWSHTETTTLTVVSGSISAQVQGGEVGCRILVNDVVRDERSSTHANADVTCRVKS
FT                   A"
FT   gene            212103..212558
FT                   /locus_tag="MSMEG_0188"
FT   CDS_pept        212103..212558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0188"
FT                   /product="MarR-family protein transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72079"
FT                   /db_xref="GOA:A0QNW5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNW5"
FT                   /protein_id="ABK72079.1"
FT                   /translation="MVDTRSVEAISEMIITGTDLLWRHLVDRTALSSSATLLLNRLERQ
FT                   GPMRLTALAEAEGASQSGMTQLVQRLEQQGLVERCSDPEDGRARLVAISEAGRKQWDTR
FT                   AEIRRQRLTGLLAAVPADDQVALALAAQIGARVLTQMREIADAGLSE"
FT   gene            complement(212548..213024)
FT                   /locus_tag="MSMEG_0187"
FT   CDS_pept        complement(212548..213024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0187"
FT                   /product="acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70568"
FT                   /db_xref="GOA:A0QNW6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNW6"
FT                   /protein_id="ABK70568.1"
FT                   /translation="MFYGCRVSDTVIRRAEPADVPGIERLVRDAFALYVPRIGREPAPM
FT                   SADYAAALENSRVWVLEADGRLVGALVNEVHDDHLLLDTVAVAPGTQGRGYGARLLARA
FT                   EQDARELGLPEVRLYTNEKMTENQTFYPRHGYVETARGEQDGYSRVFYAKRITR"
FT   gene            complement(212999..214165)
FT                   /locus_tag="MSMEG_0189"
FT   CDS_pept        complement(212999..214165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAC16516.1; match to
FT                   protein family HMM PF03702"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69604"
FT                   /db_xref="GOA:A0QNW7"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNW7"
FT                   /protein_id="ABK69604.1"
FT                   /translation="MIGLMSGTSHDAIDAAAADITVDDDALVLRALGQLSIPYPTELRE
FT                   LLAATLPPASTTAHAVTMLDTMIGRAFASAARRALSELCDGSADLVVSHGQTVYHWVED
FT                   GEVRGTLQLGQSAWIAEATGLPVVSDLRSRDIAAGGQGAPLVAMVDTLALRGRPGTPAA
FT                   LNLGGIANLTVVATDSDPVAFDTGPANALMDAAVAHLTGGAAAYDQDGRRAGAGHVDEA
FT                   LLRVLLDDDYYRRPAPKSTGKEHFHLPYLLRALDGLPPVNADDVLATLARLTAVTVADA
FT                   CRAHGVTELFASGGGTRNPVLMNMIGEELPSVPLRSSDQLGLPSDAKEALAFAVLGFLT
FT                   FHGLPGTLPSGTGARRAAVLGSITPGLAPLRLPSPVTTAPRVLRLSCE"
FT   gene            complement(214183..215742)
FT                   /locus_tag="MSMEG_0190"
FT   CDS_pept        complement(214183..215742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0190"
FT                   /product="integral membrane transport protein"
FT                   /note="identified by match to protein family HMM PF00474"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74877"
FT                   /db_xref="GOA:A0QNW8"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNW8"
FT                   /protein_id="ABK74877.1"
FT                   /translation="MRVLDLVVIVVYLVAIAWFGLRASGRQKTSKDYFVGEGKLPWWTV
FT                   SFSVVATETSVLTVISVPGGAYSGQAFGNVELALGYVVGRVVVAVVLIPLYKRGGFVSA
FT                   YQYLGTRFGLKLQGLASVTFVFTRLLAEGVRLFASAIPIKLLLDEFGVHADYRTIIVVV
FT                   TAITVVYTYLGGIKAVVWTDAVQMTLYLGGAILAIIVLWGHVGSTGVADALHAGKFDVF
FT                   DTNFSLAHIATSTFALPTAIIGGAIFAMASHGSDQLIVQRILATRTLRDSQKAMIASGV
FT                   FITFQFAAFSLVGALLWSYNGGRTFQELGLASSDNLYPNFILHGLPVVVSGLLVASILG
FT                   AAMGSLSAALNSMSSSSVSDFINSFLSRSPSEQSLLRLGRLMTLVWAVLMAVFACGFSA
FT                   NTGNVYLTGLAIAGYTYGALLGAFLLGRLVRRANQFDAVVSFVVTVVVMTYIVRYVKID
FT                   VTASGETVPSAIAAQWLVPIGVLITLLVGGVMSRFHRPPEVAALPDHDDESATVPTVAG
FT                   RN"
FT   gene            complement(215751..216680)
FT                   /locus_tag="MSMEG_0191"
FT   CDS_pept        complement(215751..216680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0191"
FT                   /product="BadF/BadG/BcrA/BcrD ATPase family protein"
FT                   /note="identified by match to protein family HMM PF01869"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75724"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNW9"
FT                   /protein_id="ABK75724.1"
FT                   /translation="MWPQDADSPSQSHEAHGAPGLAAQRGVTAARDAVCAAVSPLLNDR
FT                   AGLRLSTVFVGAAGAATAPEAARALAAELLAGLPADEVAVTSDAVTAHAGALGARPGVV
FT                   LSVGTGSVAVGVGADGTFARVGGWGPWLGDEGGGAWIGTAGLRAALHAHDGRGPATQLL
FT                   AMATARFGDLQQLPATVEAQGNPARTSASFAPDVARAAESGDPVAAGILADAATALASA
FT                   VLTTTLRIDPRNRLPVAITGGLVRLGEPLLRPLRTALSAESPQTTLALPLGDSLHGAHL
FT                   LSRDLTTPHEAHIARVRHTSTQSHPAVR"
FT   gene            216912..217814
FT                   /locus_tag="MSMEG_0192"
FT   CDS_pept        216912..217814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0192"
FT                   /product="transcriptional regulator, RpiR family protein"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM PF01418"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75578"
FT                   /db_xref="GOA:A0QNX0"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNX0"
FT                   /protein_id="ABK75578.1"
FT                   /translation="MARQDATATLADIRAVRPTLAPSERRVADVVLADPARASGFSISV
FT                   LAEHAETSVATVMRFCRTVGLTSYSQLRLALAAAAARELAREGESPAPGTDISVTDTVD
FT                   EIVKKIIYNEIRVLEDTGAALDIEMLNRAIDVVSGARRVDISGVGASAFVAQDLHQKLH
FT                   RIGRIAFVWSDRHSAVTAAALLGPGDVAFAVSHSGETDDVVEFLDAAAGCGATTIALTN
FT                   SPRSALAEAADIVLTTCARETPFRSGATVSRIAQLAVVDCLFVGVAQRSFGETTTALEK
FT                   THAAVQRHRRSPRRTSNNG"
FT   gene            217828..218724
FT                   /locus_tag="MSMEG_0193"
FT   CDS_pept        217828..218724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0193"
FT                   /product="putative glucokinase regulator"
FT                   /note="identified by match to protein family HMM TIGR00274"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74684"
FT                   /db_xref="GOA:A0QNX1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNX1"
FT                   /protein_id="ABK74684.1"
FT                   /translation="MDLSALETEGRNTRTTELDRLTVPELLAVMNDEDRTVASAVRDVL
FT                   DQIGAAVELITESLRRGGRLIYLGAGTSGRIGLLDAVECPPTFGTTPDQVVGLLSGGPG
FT                   AFVTAVEGAEDQPERAADDLDAIGVSADDTVVGLAASGRTPYVVGGLQHARGAGAATVS
FT                   IACNRDALVSRYADVAIEVLTGPEVLTGSTRLKAGTAEKMVCNMLSTASMVRLGKVYGN
FT                   LMVDVRATNGKLVDRVRRIVVESTGAEPETAEQALAAADGHAKTAIVMLAAGCSADEAA
FT                   RRIERAGGDIRTAIGAG"
FT   gene            complement(218725..219423)
FT                   /locus_tag="MSMEG_0194"
FT   CDS_pept        complement(218725..219423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0194"
FT                   /product="serine esterase, cutinase family protein"
FT                   /note="identified by match to protein family HMM PF01083"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73124"
FT                   /db_xref="GOA:A0QNX2"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNX2"
FT                   /protein_id="ABK73124.1"
FT                   /translation="MKWIRALGVCCASVAAPLSAMTAPQAFAAPESCADVEVIFARGTG
FT                   EAPGVGPTGQAFIDALRPRLGDRSVDVYPVNYPATDQWATGVDGVRDASTRIISMAETC
FT                   PQTEMVLGGYSQGAAVAGFVTSAAVPDGVDPATVPKPLQPDIADHVAAVVLFGLPNERA
FT                   MNFLGEPRVVIGPLYETKTRTYCATEDPVCSDGLNFAVHNPSSYDGDLTDQGAAFAADR
FT                   INTGPVTATN"
FT   gene            219598..221238
FT                   /locus_tag="MSMEG_0195"
FT   CDS_pept        219598..221238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0195"
FT                   /product="steroid monooxygenase"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70350"
FT                   /db_xref="GOA:A0QNX3"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNX3"
FT                   /protein_id="ABK70350.1"
FT                   /translation="MTTSSDRRQAVDVVVIGAGFAGLYALHRLKRSGLQVTCFEAGEGV
FT                   GGAWYWNRYPGARVDFESMQYSYSFDDDLQQDWVWPELFSPQEDLERYLNHVADRFGLR
FT                   PMIQFGARVDHIAFDEDVEKWRVSTEAGHQVTAKYVVAACGPTNVANVPPFPGLDTFEG
FT                   TSVHTARWPEGGVEYAGKRVGVIGTGASGVQVIPEVAKTADHLYVFQRTPVYSVPANNR
FT                   PLQPDHERDWKDNYAERRAVARRNPYAMVLPVRQHGSVLAHTPEQRAEILDAAWQQRSG
FT                   LALMFLFDDVLTDAGANEVLAEWLRGKIREVVADPETAEMLCPKTYPVGTKRLCVDNGY
FT                   YETFNRENVTLVDVRDSPIVAITREGVQTEARHHPVDVLILATGFHGLTGSLTRMNVNG
FT                   RGGVVLADKWKAGPVNYLGMVISGFPNLFVVNGPGSPSVLTQMVAHSEYQVDWISALIE
FT                   DMERRGISSVDTTSDAETQWWEQLTAVAGQTLFPQADSWYTGANIEGKPRNFMLWAGGF
FT                   DTYIDMCDGVAAEGYTGLVFDGCFHGKAN"
FT   gene            221243..222139
FT                   /locus_tag="MSMEG_0196"
FT   CDS_pept        221243..222139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0196"
FT                   /product="putative dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75609"
FT                   /db_xref="GOA:A0QNX4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019921"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNX4"
FT                   /protein_id="ABK75609.1"
FT                   /translation="MKFGMALPQYGPALGSAKDLARFATRLEELGYDTLWAAERLVMPL
FT                   KIHSDVPVGDDDTWASYLDMIGAFGDPFSLVAAAAAVTDRIRFNFGTLNAPLHQPIRLA
FT                   QTLTTLDVLSDGRIDAGFGLSWVRDEYDVSGLDWSSRGRRLDDTLDFLRVWWTENPVEY
FT                   ASPFISLPPSRVDLRPAQAGGPPVYLGGSSNAALARVGRRAAGWIGFDQLPDDVMKSLW
FT                   STARRAAEEADRDPDALRKIVRVNGEPGESVSHIADRLARQVDEGADEVMVDLVFTYKT
FT                   IDERLDAAERLMHRKTW"
FT   gene            complement(222149..222793)
FT                   /locus_tag="MSMEG_0197"
FT   CDS_pept        complement(222149..222793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0197"
FT                   /product="nudix hydrolase"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74917"
FT                   /db_xref="GOA:A0QNX5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNX5"
FT                   /protein_id="ABK74917.1"
FT                   /translation="MPSDHDASDLIRRQALTLLAVAQNGLTFAHDPFDRQRYTQVRRAA
FT                   EELMTLIADGDIEQLRAAFSVDTGYMTPKVSVRGAIFNSEEELLLVQERADRLWTLPGG
FT                   WCDVLETPAQAVAKEVREEAGLIVDVDKLVAVLYHDRHRPSRQPAPLFHVHKLFFLCHE
FT                   RGRVPADLTGTSAIDWFALDRLPPLAPSVDEAQLRMMHTHWRHPELPTVFD"
FT   gene            complement(222803..223936)
FT                   /locus_tag="MSMEG_0198"
FT   CDS_pept        complement(222803..223936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0198"
FT                   /product="acyl-CoA dehydrogenase, C-domain protein"
FT                   /note="identified by match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71041"
FT                   /db_xref="GOA:A0QNX6"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNX6"
FT                   /protein_id="ABK71041.1"
FT                   /translation="MTTQVQTHDVLDLPGALRASIEASVEEADGLGDIPSRLHDELRDA
FT                   GAFRLLTPRELGGWAAPLPTALSVYEKFGRIDGSVGLLVWNTNFGFIGAMLPETGNKRI
FT                   WGTGVEPVFANSGMPGTATPTNGGFQLSGHWKIVTGIRSATWIVVVGIVTGDTNGAPDV
FT                   RLFAVPTDQIDIQDTWNVTGLRATGSRDVVIDDVFVPEDLATRLDAPVNTDSPVYRGFI
FT                   GNLVFGGCAAVTLGIAAHMIEETVTLVRSKASVVGGVVADATRTQYLVAKAQASVDAAR
FT                   LLLLSTASELADAGDQLTLDQRAAHRAAITHAAEVSRIALVDMYNLAGSSALYRTNTIE
FT                   RIFRDGMAATQHANQSALFMEGAGRVRLGMDHGLPLF"
FT   gene            223997..224775
FT                   /pseudo
FT                   /locus_tag="MSMEG_0199"
FT                   /note="aminoglycoside phosphotransferase; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF03881"
FT   gene            225160..227712
FT                   /locus_tag="MSMEG_0200"
FT   CDS_pept        225160..227712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0200"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABK76172"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNX7"
FT                   /protein_id="ABK76172.1"
FT                   /translation="MAGKNRKRGQRAKKIATLSAATVTATALTAGIAPIGEANAAVVAR
FT                   EAALQADVRPFPPPDQIPDITGGLGAAGYDLAQAIGAQVMTSLMESISLAALAQAAGID
FT                   PQSIATGLLNEAIGSVLGGTLDQLPIDLTGVLQPLLAQVLTPLVSEILGELPIGGALGD
FT                   ALIGVVAGLVVSTLALELSDLGAIDNVGALLAALGLDLSNPLNLSGDPIPGLNLVTTGS
FT                   PFTFLKLFGVDLGWVPPFPNPVAEDINNTEYLKVGLAGLLENLGIELDPIDLDILDLNL
FT                   LGVDLSVLESVLDGLGLGLDLGNSGGLLGGLLGGLGLDLGLDLDALGLGTLDPNEILNL
FT                   LPDVVALRIPIVVGFQLGAFAAGAAYQQVVDELPNQPGGANYQGTNPLLGSFTILPMVL
FT                   IDNPGRANGGLFARAYPLFRLMGIDTVTPDTQVQSSTSGDSLLNNIQLLGLTVGGANLI
FT                   PIKVDATAEYLPLSDFAAWPNPFTMTNNVAAALFPTYILRNQSIPGVITDLTGQVVGQL
FT                   LGDLADYVADPGDDPTKGPKLNIYYTLDAKSLPLLEPTYLAVDVINLFTGLNLNNPIGT
FT                   ALSPALTTLVNLGYTDVRRVETADGVEYVRDFDDSDIPTAFGSFPDVEWAKVPGDVVTQ
FT                   LVRGVQKAVGDGLVNQSPVPSPLTTLLGLLGLGNALPSGGSVLNLPDLNGLLPTAGTTN
FT                   VAARQSEPNTKFEPQAITETKATDPDTTVLNLPSPQEKTTVPEPTKKVGGEVKKVVADI
FT                   DEARAEIEAKVKKANERAKASAEKARERTQKAVKDAQDRVNKIADNGRKQIKAVADGVE
FT                   KAVKDTKQAVKKATAKPTKKTQAGSQNNDNDKKDKDAA"
FT   gene            complement(227725..228231)
FT                   /locus_tag="MSMEG_0201"
FT   CDS_pept        complement(227725..228231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0201"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73172"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNX8"
FT                   /protein_id="ABK73172.1"
FT                   /translation="MSAAGATVTADRDQQSRGSPPERFMSQRASHAVTYNAFFAAAAAP
FT                   PILIGDPARQHGPIRVEALAGHLQPELVEAAESRQVSAGEARPTGSVRHVEVFQMDGVG
FT                   TSIIGRPRPLSRHRRADDLYTLNCEEPVCSCNRRGGRLHAPQTPKRHSSRACPRTLPAE
FT                   MPCRR"
FT   gene            227950..229272
FT                   /locus_tag="MSMEG_0202"
FT   CDS_pept        227950..229272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0202"
FT                   /product="IS1096, tnpA protein"
FT                   /note="identified by similarity to GP:150005; match to
FT                   protein family HMM PF01610"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73547"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNX9"
FT                   /protein_id="ABK73547.1"
FT                   /translation="MPDATGRAGFACADLTTFCRLDELGLEVTGQRLDPDRAVLACRVA
FT                   DEDRWCRRCGEEGVVRDSVTRTLAHEPFGWRPTALLVTIRRYRCAGCAHVWRQDASAAA
FT                   EPRARLSRRALRWALEALVCQHLSVARVAEALAVSWNTANNAVLAEGQRVLIADPARFD
FT                   GVAVIGVDEHVWRHTRRGDKYVTVIIDLTPVRDGTGPARLLDMVEGRSKKAFADWLAQR
FT                   PQEWRDRVDVVAMDGFSGFKTAATEELPDAATVMDPFHVVRLAGNALDECRRRVQLATC
FT                   GHRGRSTDPLYRSRRTLHTGADLLTDRQKARLAALFAANAHAEIEATWAMYQRTVAAYR
FT                   EPDRTKGRTMMAALITTLSTGVPTSLTELITLGRTLKKRAADVLAYFDRPGTSNGPTEA
FT                   INGRLEHLRGSALGFRNLTNYIARSLLETGGFRTQLRQPRR"
FT   gene            complement(229280..229981)
FT                   /locus_tag="MSMEG_0203"
FT   CDS_pept        complement(229280..229981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0203"
FT                   /product="IS1096, tnpR protein"
FT                   /note="identified by similarity to GP:150004; match to
FT                   protein family HMM PF07929"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71378"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNY0"
FT                   /protein_id="ABK71378.1"
FT                   /translation="MSGGSVDLALLQKLMADAGRNVFAGMFDEPTPEVRAVPDRARGFR
FT                   VRVDLMYAKPPIWRRLDLPGDLMLDELHVVLQVVMGWQDSHLHKFGVGADRRTRAYFVT
FT                   GFDLSEGDDGVVEDSVRLDQVVSDKGERLFYDYDFGDGWDHVLVVEDVFDDPPPAAVCL
FT                   TGKMACPPEDCGGLGGYEELAAWVRGGYDPRETPMGLGAQEMRDWLPRGWHPDRFSVAE
FT                   TNDALAALNTR"
FT   gene            230210..232255
FT                   /locus_tag="MSMEG_0204"
FT   CDS_pept        230210..232255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0204"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72774"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNY1"
FT                   /protein_id="ABK72774.1"
FT                   /translation="MATKRSSRKARAKKAATLSAAAMTATALTAGVAPIAEANSAVVSR
FT                   EVALMAGPNYTQLVNDSSNSLNNVLFAGGNFGGAAAGLWNPLAAAFPGGVLPTFYSGTG
FT                   QEDLSSVDGFVDALNALTGVFGDLNLDAVPGLPDGASTAVLAGLIPGLAPAALVFALAN
FT                   APLLPVTGIEVLLSGLSGIRGVTGVPSIDELIEGLSVTQTTYSSGFDWPILGGSGNTTV
FT                   SNLFAQLPEQSFGDIIAAIQGEVDVPNNALTKLFVAGLFATANAALGGVETPSVTAWLP
FT                   SGSGNYSLLGGSYGWLAAMPTLVVGPVDLGPIGESGTETVVAIPIFAQGLTLPMGLASM
FT                   AMVTSPGALFPTATGVSTLGGTTVQSFGIPLLGIDFSVTNLLQSTYVGTNGFNVNSGTT
FT                   IAALTTPFGTLPIVFSLGGLNAGSTGFGFTLPSLFTVGVAPSFQVGTAPNQQSPDGVIP
FT                   ASVLNLGLELPTQTTDVASLLGLPDVGGAVSNVLTPVFNVTIAPIGETFTEALNEQAGP
FT                   LVNDFVSTVEQLTAAIADLSEQLPEAGTPPAVEQEQNNMLAAKTGDPAPPKIEGTEAKS
FT                   SEGGVTEVAANTEETQAVLETGAKKPDDSTKASAKKMRQGTQQAVKKAQDRVNKVAENG
FT                   RKQVKAVTDGVKKAVKETRDAVKKAISKPAKKTQSTGTDNDNKDSE"
FT   gene            complement(232344..232667)
FT                   /locus_tag="MSMEG_0205"
FT   CDS_pept        complement(232344..232667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0205"
FT                   /product="tetracenomycin polyketide synthesis hydroxylase
FT                   TcmH"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF03992"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70908"
FT                   /db_xref="GOA:A0QNY2"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNY2"
FT                   /protein_id="ABK70908.1"
FT                   /translation="MTTIQQHSPIATLINVFTVEPHRSRELVELLSRATDEVMRHVPGF
FT                   ISANIHLSADGTRVANYAQWQSVEAYKAMLDDPAAREHMGKCAQVAVSFDPHQYTVESV
FT                   HQV"
FT   gene            232728..233168
FT                   /locus_tag="MSMEG_0207"
FT   CDS_pept        232728..233168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0207"
FT                   /product="MarR-family protein transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01047;
FT                   match to protein family HMM PF01978"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73191"
FT                   /db_xref="GOA:A0QNY3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNY3"
FT                   /protein_id="ABK73191.1"
FT                   /translation="MSTVDVESGPGYLVKRVQQALRRRCDTELRTIGLSMAQYAVLRAL
FT                   ADHPTASASELARLCFVTRQSLQDVLRGLRNGGLVENADGPQVGRARALHLTAAGTKLL
FT                   DEAHAIVIDVENQMVGGLSASAQKQLAQSLLRCAENLEAEIS"
FT   gene            complement(233161..235296)
FT                   /locus_tag="MSMEG_0206"
FT   CDS_pept        complement(233161..235296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0206"
FT                   /product="acyltransferase 3"
FT                   /note="identified by match to protein family HMM PF01757"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72296"
FT                   /db_xref="GOA:A0QNY4"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNY4"
FT                   /protein_id="ABK72296.1"
FT                   /translation="MTASSKGRTRRDKPASGQKILSATQFRPDIEGLRAVAILTVVLYH
FT                   AGVPGLRGGFVGVDVFFVVSGFLITGLLVREVARTGTVGLASFYAARARRLLPAAAVVL
FT                   VATSVAAAVLLPPLQARKVLGDTVAAALYLGNYRFAIEGTDYLADTAPSPLQHYWSLGV
FT                   EEQFYLVWPALILGVAWWLRRRSAGGGRGTASLPYFVVLAVLAGGSLALCVLWTRTLPA
FT                   WAFFSLPTRAWELAIGGLVALTATQWRRLPPVCAAVVGWGGLALILATCNQIGAATPYP
FT                   GTAALLPVLGTALVIGAGCATPDLGVGRLLSKPVLRAIGRVSYSWYLWHWPALLLAPAL
FT                   IGADLGLAGRLAMVVMSLGLAILTLHLVENPARFAAALRSSTWRSLAVGATATGIAVCA
FT                   GLALLAIRPVPTGTGAAVPAAAIVDPPTPRAPTPSEQLRDAVAQSVHPHAVPSNLTPRL
FT                   DDITKPDMFVNGCVLSWDDVVQPECASGVPDSTTTVALIGDSHAAMWQPALEPVSRQQG
FT                   WRLETMSKVTCPLMKLPIISPYLGREFTECKQWRATVLERIERERPALIVLDMVRRYGA
FT                   DFGFVSYDQAWLDGLTRLVTQLRGTGARVLVLGPVPDPHATVPTCVSGHMYDALACAPE
FT                   RSIAMNHDGIAAEAAAVRAGGGQYADLGEYFCTDQRCPVIIGNTLVFRDDNHITAEYAQ
FT                   LMSPVLAELTRSALALN"
FT   gene            235408..235785
FT                   /locus_tag="MSMEG_0208"
FT   CDS_pept        235408..235785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0208"
FT                   /product="ribonuclease"
FT                   /note="identified by match to protein family HMM PF00545"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71372"
FT                   /db_xref="GOA:A0QNY5"
FT                   /db_xref="InterPro:IPR000026"
FT                   /db_xref="InterPro:IPR016191"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNY5"
FT                   /protein_id="ABK71372.1"
FT                   /translation="MLALVLASVFLVACTSTGTQAPPSEAGDGTCSLAGLPPEVADTVD
FT                   LIESGGPFPYPRNDGVVFGNFEGLLPEHERGYYREYTVPTPGLKHRGARRIVTGGTPLD
FT                   DPPEMYYTDDHYESFCLIGGT"
FT   gene            235782..236060
FT                   /locus_tag="MSMEG_0209"
FT   CDS_pept        235782..236060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0209"
FT                   /product="ribonuclease inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71601"
FT                   /db_xref="InterPro:IPR000468"
FT                   /db_xref="InterPro:IPR035905"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNY6"
FT                   /protein_id="ABK71601.1"
FT                   /translation="MKTYEIDGSAVASKADFFTEIGRAVNGEGGYFGSNLDALADCLRG
FT                   GFGTPDDGKFRFVITSYKHVKDAVGEDVWSALLTIFTTEGVDLWLRS"
FT   gene            complement(236061..237149)
FT                   /locus_tag="MSMEG_0210"
FT   CDS_pept        complement(236061..237149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0210"
FT                   /product="LprO protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70375"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNY7"
FT                   /protein_id="ABK70375.1"
FT                   /translation="MYFVPGLAKLFRRVTAGAATFALCAVLGTGGAPPTRAEDPRTLLL
FT                   GAIANTKGSYLVYNFGGQFAAPFLTADGRAYTLNNGGHLMTIKNASTRLNPRLLVDTHQ
FT                   GYQSRCERTPGARTSEGLWQASETYAPLNAWHVLGQPTIAVNANFFDVRPQKGGSWRDT
FT                   KCSSPLGAYVDNTRGQGRTNKAVTGTLAYAGKQGLSGGNEHWSALATMILPVGGAPYVI
FT                   MPKGPNDYDAASPEIQRLVDSGTRFVAVAGIGLLAPGDTGQLNDGGPSAARTALGYNRA
FT                   ADQLYVFQGGSYTPDNMQDLFRGLGADNAVLLDGGGSSAIVLRRDTGGMWSGAGSPRGN
FT                   CDTRQVLCDSRERALPSWLAFN"
FT   gene            complement(237244..239607)
FT                   /locus_tag="MSMEG_0211"
FT   CDS_pept        complement(237244..239607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0211"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74387"
FT                   /db_xref="GOA:A0QNY8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNY8"
FT                   /protein_id="ABK74387.1"
FT                   /translation="MHPADSHDRIRVTGARENNLKDIDIELPKRRLTVFTGVSGSGKSS
FT                   LVFDTIAAESQRLINETYSAFIQGFMPNQARPEVDVLEGLTTAIIVDQQRMGSDPRSTV
FT                   GTVTDAGAMLRILFSRLGKPHVGSPQAFSFNVASISGAGAVEFQKGGRTVKERRDFNIV
FT                   GGMCPRCEGRGSVNDIDLTALYDDSKSLNEGALTIPGFSMDGWYGRIFRGCGFFDPDKP
FT                   IKKFTKKELDALLYKDATRLKIDGTNLTYLGLIPQIQKSFLSKDVEAMQPHIRAFVERA
FT                   VTFTTCPECDGTRLSETARSSKIDGVNIADASAMQITDLATWLAGLEKKATAKSVAPLL
FT                   TALRHTLDSFVEIGLGYLSLARPAGTLSGGEAQRVKMIRHLGSALTDVTYVFDEPTIGL
FT                   HPHDIARMNTLLLQLRDKGNTVLVVEHKPETIAIADHVVDLGPGAGTAGGEVVFQGTVD
FT                   GLRASDTVTGRHLGYRAALKDSVREPDGALEVRGANTNNLHDVDVDIPLGVLVVITGVA
FT                   GSGKSSLIDGSVAGREGVVLVDQSPIRGSRRSNPATYTGLLEPIRKAFAKANGVKPALF
FT                   SSNSEGACPVCNGAGVIYTDLGVMATMESPCEECEGRRFQATVLEYTLAHRNIAEVLEM
FT                   PVTEAVEFFGAGEAKVPAAQKILERMADVGLGYLTLGQPLTTLSGGERQRLKLAAQMAD
FT                   KGNVYILDEPTTGLHLADVEQLLALLDRLVDSGKSVVVIEHHQAVMAHADWIIDLGPGA
FT                   GHDGGRIVFEGTPADLVAARSTLTGRHLAEYVSS"
FT   gene            complement(239607..240026)
FT                   /locus_tag="MSMEG_0212"
FT   CDS_pept        complement(239607..240026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0212"
FT                   /product="lyase"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75158"
FT                   /db_xref="GOA:A0QNY9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNY9"
FT                   /protein_id="ABK75158.1"
FT                   /translation="MSNDLTIHNTFVPHEDPEESLAFYRDALGFEVRLDVGHGTMRWIT
FT                   VGPPNQPGTSIVLYPPTADPAITEEEGKVIREMMAKGTFASIVLATADVDATFERLQAT
FT                   TAEIVQEPTDQPYGVRDCAVRDPAGTMIRIQERAL"
FT   gene            complement(240031..240471)
FT                   /locus_tag="MSMEG_0213"
FT   CDS_pept        complement(240031..240471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0213"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75155"
FT                   /db_xref="GOA:A0QNZ0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNZ0"
FT                   /protein_id="ABK75155.1"
FT                   /translation="MPGEEQRLRDLKLLRRVRDRIDREYAQPLNVEALARGVNMSAGHL
FT                   SRQFKAAFGESPYSYLMTRRIERAMALLRRGDLSVTEVCFAVGCSSLGTFSTRFTELVG
FT                   LPPSTYRDRAAAIQEGLPSCLEKYVTRPVRNREAPAVRLHLA"
FT   gene            complement(240488..241771)
FT                   /locus_tag="MSMEG_0214"
FT   CDS_pept        complement(240488..241771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0214"
FT                   /product="L-sorbosone dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75388"
FT                   /db_xref="GOA:A0QNZ1"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNZ1"
FT                   /protein_id="ABK75388.1"
FT                   /translation="MRAWPGISAVVVTASVVLAGCGTEPQTTEPTAQPSRSSSQTTAEH
FT                   PAGAAELTPVTVEVPEGLDDAPLDQPRQALVPDGWTLEVVARVPKARMAAWAPDGALLV
FT                   SVPSTGEVLKVLPTQSTLLDGLDQPHGLFFAGPTLYVAESDQIDAYDYADGAAVNRRTV
FT                   IDGLPDAKSPDLRGAYAHALKSVVVGDDGAVYFSIGSTGNISAEDRTADPPRATIMRVP
FT                   PGGGPAEPFATGVRNGTGLAFAPDGSLWTAVNNRDNVADPDGRVVQSYVDDHPPESVAR
FT                   LTPGRELGWPYCNPDGPPPAKLIRDLQTNPDGAEMDCAALPPIEQTLGAHSAPLGMSFA
FT                   ELPQPFGQGALVGVHGSWNRDAPRAPEVSFFAWRDGTLGPQQTLVGGFQDDDGQRWGRP
FT                   VAAVTGPDGAVYITDDFAGAVYRLAPPP"
FT   gene            complement(241749..242465)
FT                   /locus_tag="MSMEG_0215"
FT   CDS_pept        complement(241749..242465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0215"
FT                   /product="YhhW family protein"
FT                   /note="identified by match to protein family HMM PF02678"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70417"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNZ2"
FT                   /protein_id="ABK70417.1"
FT                   /translation="MPPTVDIRRADQRGVSVTDWLQSRHSFSFGDYYDPANTHHGLLLV
FT                   NNDDIVAAGGGFDTHPHRDMEIVTWVLDGELAHADSMGNSGVIYPGLAQRMSAGTGVQH
FT                   SEKNASSDKPVHFVQMWVIPDRAGLTPGYEQREITLAENLTPIASGAGDAAVTLHNRNA
FT                   TLYGARLRPGDAVGLPEARYVHLFVARGRVTLEDAGDLAEGDAARLTGSGGQRVTATDE
FT                   PAEILVWEMHASLAGD"
FT   gene            242603..243397
FT                   /locus_tag="MSMEG_0216"
FT   CDS_pept        242603..243397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0216"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75375"
FT                   /db_xref="GOA:A0QNZ3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNZ3"
FT                   /protein_id="ABK75375.1"
FT                   /translation="MSYAVGVDINGASAIVTGGASGIGAASARLLAAKGAKVVIADLQA
FT                   DKGEALAKELGGAFVSVDVTETDQIIAAVDKAAELGPLRALVNSAGIGWAQRTIGKDGE
FT                   YASAHNLDVYKKVLAINLVGTFDCIRIAATAMSRNEPTETGERGAIVNMTSVAAFDGQI
FT                   GQAAYSSSKGGVVGLTLPVARDLSAVGIRVNTVAPGLIDTPIYGEGEGSEAFKAKLGES
FT                   VLFPHRLGKPEELASMVIELITNSYMNAEVVRVDGGIRMPPK"
FT   gene            complement(243477..244601)
FT                   /locus_tag="MSMEG_0217"
FT   CDS_pept        complement(243477..244601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0217"
FT                   /product="alcohol dehydrogenase B"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69584"
FT                   /db_xref="GOA:A0QNZ4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR023921"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNZ4"
FT                   /protein_id="ABK69584.1"
FT                   /translation="MKTKGALLWELNSPFKVDEIDLGDPVADEVQIRLHAAGMCHSDYH
FT                   ITTGATPIGLPALGGHEGAGVVTKVGKNVTGIEEGDHVILAFIPACGECPPCLKGFRSL
FT                   CDRGAVLLGGKAIADGTSRIHAGSHEVSPMNLLGTFAPYMTVHKDSVVKIDKDIPFETA
FT                   AIMGCAVPTGFGSATNVAQVQAGETVIIVGVGGIGMSALQGAVISGAKQVIAIDPNEWK
FT                   REQAVKFGATHVYPTMAEAIAPVIDVTHGLMADKVIIAVGEMKGEYIEEALILTAKTGT
FT                   CVVTGMGAMTDVDVKLNLFLFTMLQKTLKGNIFGGGSSHIETPRLAALYKSGLLNIDDM
FT                   VTRTYKLEDINSGYQDMLDGKNIRGVIKYDESDW"
FT   gene            244773..245267
FT                   /locus_tag="MSMEG_0218"
FT   CDS_pept        244773..245267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0218"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /note="identified by match to protein family HMM PF06983"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74272"
FT                   /db_xref="GOA:A0QNZ5"
FT                   /db_xref="InterPro:IPR009725"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNZ5"
FT                   /protein_id="ABK74272.1"
FT                   /translation="MPVKINASIVPNLWFDREAEEAAEHYIAAFGGNGRILNKIAAHPD
FT                   APSPQDVPVVVEFELVGQRFVGINGGPQFTFNEAVSLEVRVAGQEQLDQVWAALTEGGE
FT                   ELPCGWLKDKYGLAWQVTPSEYYDMVTKGDEEANNRLMTAVLSTHGKFDLAKLQAAYDN
FT                   A"
FT   gene            complement(245271..246293)
FT                   /locus_tag="MSMEG_0219"
FT   CDS_pept        complement(245271..246293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0219"
FT                   /product="RNA polymerase sigma-70 factor, family protein"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM TIGR02937; match to protein family HMM
FT                   TIGR02960"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75263"
FT                   /db_xref="GOA:A0QNZ6"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNZ6"
FT                   /protein_id="ABK75263.1"
FT                   /translation="MSVILRKLTTVTVLAHKLDDDSPADAFLAEAQTYRRELLAHCYRM
FT                   TGSLHDAEDLVQETYLRAWKSYQGFQGRSSVRTWLYRIATNTCLTSLEGRSRRPLPSGL
FT                   GTPSSAPTDQITEHHEVPWLEPLPDGDDPADPSQIVGTRESVRLAFVAALQHLSPRQRA
FT                   VLVMREVLQWKASEVGEAIGASTAAVNSLLQRARAQLEAVGPNEDDKIEAPDSPQAQAT
FT                   LDRYIAAFEAYDIDKLVELFTEEAIWEMPPFDSWYQGPQAIGDLSRYKCPAEEPGDMRF
FT                   LQTTANGQPAAAMYMLNRETGRHEAFQLHVLDITADGISHVVAFMGEGLFKKFGLPETL
FT                   "
FT   gene            246357..247199
FT                   /locus_tag="MSMEG_0220"
FT   CDS_pept        246357..247199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0220"
FT                   /product="monoglyceride lipase"
FT                   /EC_number="3.1.1.23"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74423"
FT                   /db_xref="GOA:A0QNZ7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QNZ7"
FT                   /protein_id="ABK74423.1"
FT                   /translation="MVSSTRSEHSFAGVGGVRIVYDVWTPDTDPRGVVVLAHGYAEHAG
FT                   RYHHVAQRFGAAGLLVYALDHRGHGRSGGKRVHLRDLSEFVEDFRTLVGIAANDHPTLP
FT                   RIVLGHSMGGGIVFAYGARYPGEYSAMVLSGPAVNAHDGVSPVLVAVAKVLGKLAPGIP
FT                   VENLDADAVSRDPEVVAAYKADPMVHHGKLPAGIARALIGLGQSMPQRAAALTAPLLVV
FT                   HGDKDRLIPVAGSRLLVDRVASEDVHLKVYPGLYHEVFNEPEQKLVLDDVTSWIVSHL"
FT   gene            247214..248173
FT                   /locus_tag="MSMEG_0221"
FT   CDS_pept        247214..248173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0221"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74753"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNZ8"
FT                   /protein_id="ABK74753.1"
FT                   /translation="MLMSLLVLAGCGENHQAAEPGWTDTDVSFDSDGLTIHGTYRHDGK
FT                   PGPAALLISESGPTDRNGDNKVVGPVGNMRQLAETLSDNDVSSLRFDKIGTGATGLGPY
FT                   ETKPTQVVSGVYTAGAGAALRYLADQPDTDGDRLSIYAVGEGAVHAMSLAGREDPKVHS
FT                   LALFQPLSGRYLDIITNRVRAGGTPEVLDAWLATVEEIRTKGTVPDDLPEGLTAIVNPG
FT                   NLNAIIEADKIDPLALAAQLPDDMPVLLTCSDTDAQASCETERPLIDALHHTALTVIEL
FT                   KGVNHVLRDDPTDNIANYSTSAPLSPQVTDAIAEFASK"
FT   gene            248214..248957
FT                   /locus_tag="MSMEG_0222"
FT   CDS_pept        248214..248957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73105"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNZ9"
FT                   /protein_id="ABK73105.1"
FT                   /translation="MSDDKMLARIAALLRQAEGTDNPHEAEAFMAAAQRLATATSIDLA
FT                   LARAHSDKRTKAQMPVQRTITIGQAGTKGLRTYVQLFVLIAQANDVKCDVASNSTFVYA
FT                   YGFAEDIDATHALYTSLVMQMVRASEAYIASGAHRPTPTITARLNFQLAFGARVGQRLA
FT                   EARDEARQEADAADQPGTALALRDKDIELKSFYRQASQARGTWRATSASAGYSSAARRA
FT                   GDRAGRRARLGPMQELSGARGALEK"
FT   gene            248954..249436
FT                   /locus_tag="MSMEG_0223"
FT   CDS_pept        248954..249436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0223"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73301"
FT                   /db_xref="InterPro:IPR027595"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP00"
FT                   /protein_id="ABK73301.1"
FT                   /translation="MTARDTQRARVYAAEEFVRTMFDRAAQHSSRAIDFFGTQLTLPPE
FT                   AKFGSVAAVQRYVDDVIARVGAAPVAVRARRGTKAAHYEIENAVIAVPEQQTTWALREL
FT                   VVLHELAHHLCATGPDPDAPAHGPQFVATYCELCETVMGPEVGLVLRMVYAKEGVS"
FT   gene            249456..250112
FT                   /locus_tag="MSMEG_0224"
FT   CDS_pept        249456..250112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0224"
FT                   /product="O-methyltransferase MdmC"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01135;
FT                   match to protein family HMM PF01596"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71473"
FT                   /db_xref="GOA:A0QP01"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP01"
FT                   /protein_id="ABK71473.1"
FT                   /translation="MAEPSDVDVLFNQLLQTEDQALAAARESTQAAGMPAIEVSAQHGK
FT                   LLSLLAGISGARRVLEIGTLAGYSTINLARGVGADGRVVTCEYEPRHAEVARANLERAG
FT                   VAGRVEILVGTALDTLPKLAERGDVFDLVFIDADKENNVAYVEWAIKLGHPGTVVVVDN
FT                   VTRFGRVLEPAPDDLQARGVRDMLQMMGEHPRLDAAAIQTVGAKGWDGFAVAVIS"
FT   gene            complement(250120..253017)
FT                   /locus_tag="MSMEG_0225"
FT   CDS_pept        complement(250120..253017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0225"
FT                   /product="MmpL4 protein"
FT                   /note="identified by match to protein family HMM PF03176;
FT                   match to protein family HMM TIGR00833"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69676"
FT                   /db_xref="GOA:A0QP02"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP02"
FT                   /protein_id="ABK69676.1"
FT                   /translation="MSTPDAPTEAIPSAHGKYTNHGGIAKLIRTLAVPIILVWVALIAV
FT                   LNTIVPQLEEVGEMRSVSMSPDDAPSMIAMKRVGEVFEEFKSNSSVMIVLEGEQPLGDE
FT                   AHKYYDEIVDKLEADKTHIEHVQDFWGDPLTASGAQSSDGLASYVQVYTAGNQGEALAN
FT                   ESVKAVQDIVDSVQAPPGVTAYVTGPAAMSADQQIAGDRSMRMIEALTFTVIIIMLLMV
FT                   YRSIITVILSLVMVVFSLAAARGVIAFLGYYEIIGLSTFATNLLVTLAIAAATDYAIFL
FT                   IGRYQEARSVGESREQAYYTMFHSTAHVVLGSGMTIAGATLCLHFTRMPYFQSLGIPLA
FT                   IGMTVVVLTALAVGPAIITVASRFGKTLEPKRAMRTRGWRKVGAAVVRWPGPILVAAVG
FT                   LSMIGLLALPGYRTNYNDRDYQPADLPANSGYAAADRHFSQARMNPELLMIESDHDLRN
FT                   SADFLVIERIAKRVVGVPGVSRVQAITRPQGTPIEHTSIPFTISMQGTTQTMNQKYMQD
FT                   RMADMLVQADQMQVTVDTMTKMIALMEQMRDTMNSMVGKMHGMVDDIKELRDNISDFDD
FT                   FFRPIRNYLYWEPHCYNIPMCYSLRSIFDTMDGIDTMTADFEQIVPDMDRMNALIPVMI
FT                   ANMEPMITTMKTMKTMMLTMQATNAGLQDQMAAMQENSTAMGEAFDKAKNDDSFYLPPE
FT                   TFDNPDFKRGMKMFLSPDGHAVRFIISHEGDPMSPEGIQKIDDIKLAAKEAIKGTPLEG
FT                   SKIYLGGTAATFKDMQEGANYDLIIAGIAALCLIFIIMLIITRAVVASAVIVGTVVISL
FT                   GSAFGLSVLIWQHLVGLELHWMVLAMAVIVLLAVGADYNLLLVSRIKEEIHAGLDTGMI
FT                   RAMGGSGSVVTAAGLVFAFTMMSMAVSELAIIGQVGTTIGLGLLFDTLVIRSFMTPSIA
FT                   ALLGKWFWWPQMVRRRPKPSPWPKPIQREPADAVN"
FT   gene            complement(253014..253442)
FT                   /locus_tag="MSMEG_0226"
FT   CDS_pept        complement(253014..253442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0226"
FT                   /product="MmpS5 protein"
FT                   /note="identified by match to protein family HMM PF05423"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73296"
FT                   /db_xref="GOA:A0QP03"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP03"
FT                   /protein_id="ABK73296.1"
FT                   /translation="MKLLKRFWIPLLIGVVVLVGAFTVMRVRTFFGSGDDPSLASAKVD
FT                   DTKPFDPKVVIYEIYGEPGATADVNYLDLDAQPQRVDGVSLPWTLTLSTTAPSVFPNIV
FT                   AQGNGDSITCRITVDDELKDERTSNGVNAQTFCLVKSA"
FT   gene            253688..254257
FT                   /locus_tag="MSMEG_0227"
FT   CDS_pept        253688..254257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0227"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75876"
FT                   /db_xref="GOA:A0QP04"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP04"
FT                   /protein_id="ABK75876.1"
FT                   /translation="MAKSVAPRGFARERVLEAALNLFAEHGVNGTSLQMIADRLGVSKA
FT                   AVYYQFHSKDDIVFAVVEPIFGDMRRVLRIAEAMSSPDARREAAVSGMVELAVRHRRVS
FT                   AVFHGDPAIDNLVHSRKDLHEVIERLTAILLGPEPGTACRVMMSMLASGIFSSAMDPEL
FT                   ADIDDEELHRVLLDCTQRLLNAPVSS"
FT   gene            254330..257482
FT                   /locus_tag="MSMEG_0228"
FT   CDS_pept        254330..257482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0228"
FT                   /product="adenylate and Guanylate cyclase catalytic domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00211"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70558"
FT                   /db_xref="GOA:A0QP05"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP05"
FT                   /protein_id="ABK70558.1"
FT                   /translation="MVACGTCGTELRQGARFCDSCGTAIVDGSKHAEYKQVTVLFADVV
FT                   DSMRLAAAVGAERLREILSALVSRCSGVVGHYGGTVDKFTGDGIMALFGAPLALEDHAL
FT                   RACLAALDLQYESHRLADELDLPAGVGLQIRVGLNSGQVIAGEMSAGGFGYTAIGEQVG
FT                   MAQRMESVAPHGGIMCSDTTARLVEDSVLLGAPEMLRVKGCDRPVAARRLLAATNAAHG
FT                   GRSDPTLVGRSWELNTIAGLLDEAVEGRGGIVSVVGPPGIGKSRMVRESIELARRRGVA
FT                   VFYTYCESHASDVPFHVVVPLLREGFGVAGLDPAAARVRVRSLVPDADPEDLLLLDDVL
FT                   GIADPDVPMPDLDADARRRRVAALVNAASLARREPGLYVLEDAHWIDEVSESMLAEFLT
FT                   VVTHTHSVMLITYRPEYTGVLARVSGAQTIALRPLTDGQTSTLLTELLGPDAAAHQLAG
FT                   LIADRAAGNPFFTQEIVRDLAERGVLRGERGAYRFHGADVEIGVPATLQATIAARIDRL
FT                   EVEAKRTLSAAAVIGLRFGPDMLAALGADVSMQALIDAELVDQVMFAPRPEYAFRHPLI
FT                   RMVALESQLKSDRAELHRRLAVDIERRAPHAADEHAALIADHYEEAGDLRAAFTWHMRA
FT                   GTWLTNRDIDAARLSWQRARHVADQLPHDAEDRAAMTIAPRTLLCLSTWRAGGHLSDTG
FT                   FDELCALAAAADDKVSLATAMAGQVSALLVHAHYRESSSLASELTSLLESVGDRRLTVA
FT                   LLFAALGAKFQTGEANEVVRLADRLIELADGDANMGNLIIGSPLVTAWTVGGMARACLG
FT                   DPDWRTGLDRATPLVRDFGITTRALMLTYKCIGLPTGLLLPSPELLEESCEVLEVAQRS
FT                   ADDLALAGAQVSRGLLLLWQGGPYRDEALELLSLGREASVREQFTMAAVPAVDTELARD
FT                   MAARGDLDGAIELARDVVDTSIDSGEAINMSASVTVLVQSLIARGDRDDLDHAQRVIDR
FT                   FAALPTDPGFVLYDVQLMRLRALLARARGDEERYRECSDRYRELATAYRYEGHMALAAR
FT                   MA"
FT   gene            complement(257573..259288)
FT                   /gene="ilvD"
FT                   /locus_tag="MSMEG_0229"
FT   CDS_pept        complement(257573..259288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="MSMEG_0229"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="identified by match to protein family HMM PF00920;
FT                   match to protein family HMM TIGR00110"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73424"
FT                   /db_xref="GOA:A0QP06"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP06"
FT                   /protein_id="ABK73424.1"
FT                   /translation="MPSDDKSTETPDIKPRSRDVTDGLEKAAARGMLRAVGMGDADWAK
FT                   PQIGVGSSWNEITPCNMSLQRLAKSVKDGVHEAGGYPLEFGTISVSDGISMGHEGMHFS
FT                   LVSREVIADSVETVVQAERLDGTVLLAGCDKSIPGMLMAAARLDLASVFFYNGSIMPGV
FT                   AKLTDGTEKEVTIIDAFEAVGACVRGLMSREDVDIIERAICPGEGACGGMYTANTMASA
FT                   AEALGLSLPGSASPVAIDKRRDEFARRSGEAVVDMLRRGITARDILTKEAFENAIAVVM
FT                   AFGGSTNAVLHLLAIAREAEVELTLDDFTRVGSKVPHLADVKPFGRHVMKHVDEIGGVP
FT                   VVMRALLDAGLLNGECLTVTGKTMAENLAHIAPPDPDGKVLRAMNNPIHPTGGITILHG
FT                   SLAPEGAVVKSAGFDSDVFEGTARVFDRERAAMDALEDGTIQAGDVVVIRYEGPKGGPG
FT                   MREMLAITGAIKGAGLGKDVLLMTDGRFSGGTTGLCVGHIAPEAVDGGPIAFVRDGDRI
FT                   RLDVAKGTLDVLVDEEEFEARKAGFEPLPPRYKTGVLAKYTKLVQSAAVGAVCT"
FT   gene            259367..259672
FT                   /locus_tag="MSMEG_0230"
FT   CDS_pept        259367..259672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02583"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69823"
FT                   /db_xref="GOA:A0QP07"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP07"
FT                   /protein_id="ABK69823.1"
FT                   /translation="MDATDESGVHGYSAQKENYAKRLRRIEGQVRGIAKMIDEDKYCID
FT                   VLTQISAVNSALQSVALGLLDEHLGHCVSQAVAEGGQEAEAKLAEASAAIARLVRS"
FT   gene            complement(259691..259990)
FT                   /locus_tag="MSMEG_0231"
FT   CDS_pept        complement(259691..259990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01910;
FT                   match to protein family HMM TIGR00106"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74155"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP08"
FT                   /protein_id="ABK74155.1"
FT                   /translation="MIVAFSVSPTGGDESGSVSAAVAAAVRVVRESGLPNETNAMFTNI
FT                   EGEWDEVMDVVKRAVDAVAAVSPRVSLVLKADIRPGYTGQLTAKVERIERELGD"
FT   gene            260053..261282
FT                   /locus_tag="MSMEG_0232"
FT   CDS_pept        260053..261282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0232"
FT                   /product="sugar transporter family protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71413"
FT                   /db_xref="GOA:A0QP09"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP09"
FT                   /protein_id="ABK71413.1"
FT                   /translation="MTVTPPTVSPWTVRVAAQLTVLAAAAFIYVTAEILPVGALPVIAA
FT                   DLNVSEGLVGTLMAGYALIAALTTVALVRLTARWPRRRALLVTMVCLTVSQVISAMAPN
FT                   FAVLAGGRVLCALAHGLMWSVIAPIGVRLVPPSHAGRATAAVYVGTGLALVVGNPLTAA
FT                   LSELWGWRQAVVAVAIAAAAVTLAARVLLPLMPAERARAGSAGRPVHGRGLLTLSLLTL
FT                   IGVTGHFVAYTFIVAIIRDVVGIDGPHLAWLLAGYGVAGLAAMAAMARPLDLWPKASVT
FT                   AALVVLAASLVTLAVLSAQPRAGVTTGAVMVIGTVAIVLWGASSTALPPMLQTSAMRTS
FT                   PEDPDGASGRYVAAFQVGIMTGALVGAGVYEAVGLTAMIGTAAVLITAAMCGALAVPDV
FT                   FNRSRDLSTR"
FT   gene            261440..262480
FT                   /locus_tag="MSMEG_0233"
FT   CDS_pept        261440..262480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0233"
FT                   /product="lipoprotein Lpps"
FT                   /note="identified by match to protein family HMM PF03734"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABK76034"
FT                   /db_xref="GOA:A0QP10"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP10"
FT                   /protein_id="ABK76034.1"
FT                   /translation="MPKSAKRRLITAFMAAGLVGGLVMSPSASADPEVPAPPVPVEPAA
FT                   PPAPPNPFAFPPPAAPAAVGPADPATPGATATDPDAQVVTNYGAPAVPIEGVPEGQNPE
FT                   PFTGQPPFLPPSFNPVNGSMVGVAKPIYINFQRPIANKQMAQDAIRITSNPPVPGRFYW
FT                   VTDTQLRWRPQDFWPSNTVVNIDAAGTKSSFRVGDYLVATVDDSTHQMEIRRNGKLEKT
FT                   FPVSMGKNDGKHETKNGTYYVLEKFEDIVMDSSTYGVPVDSAEGYKLKVKDAVRIDNSG
FT                   IFVHSAPWSVGDQGKRNVSHGCINLSPENARWFYEQFGSGDPVVIKNSKGGWYDQPDGA
FT                   SDWQMF"
FT   gene            complement(262543..264543)
FT                   /locus_tag="MSMEG_0234"
FT   CDS_pept        complement(262543..264543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0234"
FT                   /product="metallopeptidase"
FT                   /note="identified by match to protein family HMM PF01431;
FT                   match to protein family HMM PF05649"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69870"
FT                   /db_xref="GOA:A0QP11"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP11"
FT                   /protein_id="ABK69870.1"
FT                   /translation="MTVQATRGTADATGKSGIDLTHVDPRTRPQDDLFGHVNGRWLTEY
FT                   EIPADRATDGAFRLLYDRAEEQIRDLITEAAASGAADGTDEQRIGDLYASFMDTQTIAE
FT                   RGLQPLLDELALIDAAPDADALAAVLGGLQRTGVGGGAGVYVDTDSKNSTRYLLHMGQS
FT                   GIGLPDESYFRDEQHAEILAGYPVHIAKMFGLIYGGDHTDTAARIVALESKIAAAHWDV
FT                   VKRRDADLTYNLRRFADLPAEAPGFDWSGWVQGLGTTPDTVAELVVRQPDYLTAFAGLW
FT                   ASEDLEDWKAWARWRVIHARAGLLTDDLVAEDFAFYGRTLSGTEQIRDRWKRAVSVVEN
FT                   LMGDALGKLYVQRHFPPEAKARMDELVANLREAYRVSIDELDWMTPETRAKALAKLDKF
FT                   TPKIGYPARWRDYSAVVIKRDDLYGNYRRGYIVNSDRELAKLGGPVDRDEWFMTPQTVN
FT                   AYYNPGMNEIVFPAAILQPPFFDAEADDAANYGGIGAVIGHEIGHGFDDQGAKYDGDGN
FT                   LVDWWTDADRTEFGARTKALIEQYEQFTPRGLDPSHHVNGAFTVGENIGDLGGLSIALL
FT                   AYKLSLKGKEAPVIDGLTGVQRVFFGWAQVWRTKSREAEAIRRLAVDPHSPPEFRCNGV
FT                   VRNIDDFYEAFDVTENDELFLEPERRVRIWN"
FT   gene            264607..265227
FT                   /locus_tag="MSMEG_0235"
FT   CDS_pept        264607..265227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0235"
FT                   /product="probable conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70520"
FT                   /db_xref="GOA:A0QP12"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP12"
FT                   /protein_id="ABK70520.1"
FT                   /translation="MPDAPSKDAPEREPETDPGATGGIFSSYGVASAVLGVIAIAAVVL
FT                   GTMIFTAHRDEISERDYQTRVLQAAAEWTNVLINMTAETVDADMQKLHEGTVGQLNNDF
FT                   DSAVQPYRELVQRLQSRTTGQLDSVAIESLYHPQPGPDGRVQQPERAELTGMVSRIDTV
FT                   LVVATSVTETAGSDKPRTVRWNLRLDVADVDGQLMISRLEPIR"
FT   gene            265224..265913
FT                   /locus_tag="MSMEG_0236"
FT   CDS_pept        265224..265913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0236"
FT                   /product="putative conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74412"
FT                   /db_xref="GOA:A0QP13"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP13"
FT                   /protein_id="ABK74412.1"
FT                   /translation="MRNRLRVLAFDVAAPLAAIAALVYLGAALGWPTWWVSVCSILCLL
FT                   IVQGVVVNVVLACRDGVTLGTDDDGPGLRLAVVGVATAALVAAVVVGYLRWTAPDDEFN
FT                   RDREQVVRIASSVAEATATFTPQSPTASIDRAAAQMAPDRAEAFKNEFATVAKDLTSRN
FT                   VSAQASTVSAGVEALGPRAASVAVVLRGTQSVPGKPTDNAVLALRVTLTKSDGRWLVDD
FT                   VRPAHSR"
FT   gene            266047..267453
FT                   /locus_tag="MSMEG_0237"
FT   CDS_pept        266047..267453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0237"
FT                   /product="ISMsm3, transposase"
FT                   /note="identified by similarity to GP:4838457; match to
FT                   protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73198"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP14"
FT                   /protein_id="ABK73198.1"
FT                   /translation="MKSIAAASRVKVSADGHGVVSHAGMGLLRELADRTGLSAQVTGAL
FT                   ADTYRGPWTYAPGEVFADLAAAVADGADCIDGVGQLCGDREHAFGAKASTTTMWRLVDE
FT                   RIDAAHLPAVRAARASARAAAWAAGAAPEPGGWLHIDIDATVVIDHSDNKHGATPTWKK
FT                   TFGHHPLLAFLDRPEIAGGEALAGLLRSGNAGSNTASDHIIVLAQALAALPAPWRPDSS
FT                   RGGDPDRPQVLVRCDTAGATHRFADACREQGVGFSFGYPVDARVQDAADTLNLAEGWYP
FT                   AIDTDGGIRDGAWVAEATTLVNLNSWPPGTRLILRKERPHPGAQLRFTDTDGMRVTAFI
FT                   TDTPTGVVAGQVAGLELRHRQHARVEDRIRELKNTGLRNLPCHGFWANAAWLEIVLAAT
FT                   DLVTWARLIGFTSDPTLARAEIATFRYRVLHVAARITRGARQLRLRIDATWRWASAIAT
FT                   AWQHLRTAFG"
FT   gene            complement(267632..268102)
FT                   /locus_tag="MSMEG_0238"
FT   CDS_pept        complement(267632..268102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0238"
FT                   /product="O-acetylhomoserine/O-acetylserine sulfhydrylase"
FT                   /note="identified by match to protein family HMM PF02629"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72157"
FT                   /db_xref="GOA:A0QP15"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP15"
FT                   /protein_id="ABK72157.1"
FT                   /translation="MTDALTRQRILRETRSVAIVGASANTSRASYFVWTYLKSTGDYDI
FT                   YLVNPTIKEIEGTPVYPSLSELPVVPDLVDVFRRRDDLPDVLKETIAVGAKTLWLQLGL
FT                   RHDEVVRDGEAAGLQVVQDRCMKIEHARFAGGLHLAGFNTGVIDSRRPKKAY"
FT   gene            complement(268095..269390)
FT                   /locus_tag="MSMEG_0239"
FT   CDS_pept        complement(268095..269390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0239"
FT                   /product="O-acetylhomoserine/O-acetylserine sulfhydrylase"
FT                   /note="identified by match to protein family HMM PF01053;
FT                   match to protein family HMM TIGR01326"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABK76067"
FT                   /db_xref="GOA:A0QP16"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP16"
FT                   /protein_id="ABK76067.1"
FT                   /translation="MTDRTFGLATRAIHAGQRPDAATGARVTPIYANASFVFNDTDDAA
FT                   NLFALQKYGNIYSRIGNPTVAAFEECIASLENGLGAVAMASGLSAQFAVFAALAGAGDH
FT                   IVSAASLYGGTVTQLDVSLRRFGIDTTFVGGTDPADYAAAVTDRTRLIYAEVISNPSGE
FT                   IADLAGLAEVARDAGVPLIVDSTVATPALCRPIEHGADIVVHSATKFIGGHGTTLGGVA
FT                   VDAGRFDWGAGKFPQMTEPVASYGGLSWWGNFGEFGFLTKLRSEQLRDLGATLAPQSAF
FT                   QLLQGVQTLPQRMAAHIANARAVAEWLEADPRVTYVRWAGLPSHPHHDRARHYLPDGPG
FT                   AVFAFGVKGGRAAGEKFINSVQLASHLANIGDVRTLVVHPASTTHRQLTDEQLTAGGVG
FT                   PELIRISVGIEDVEDIIWDLDQALTQAEKADD"
FT   gene            complement(269466..270074)
FT                   /locus_tag="MSMEG_0240"
FT   CDS_pept        complement(269466..270074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75273"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP17"
FT                   /protein_id="ABK75273.1"
FT                   /translation="MAPDVRDMRDARRKDMSPIQPPSNRSPGQRNQGPRPAAVRPRDPQ
FT                   APARGAARGPQRQFDDRPVEYWPTAAIRAALETDDLTVWQRIVAAIKRDPYGRTARQVE
FT                   EVLETARPYGVSKALSEVLVRTRDHLEASERAEVAKQIQAMLRRSKLAPPEFASRVGVS
FT                   NEEFATYLEGSVSPRASLLLRMQRLSDRFAKIAAQRSGK"
FT   gene            complement(270077..272941)
FT                   /locus_tag="MSMEG_0241"
FT   CDS_pept        complement(270077..272941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0241"
FT                   /product="MmpL11 protein"
FT                   /note="identified by match to protein family HMM PF03176"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71905"
FT                   /db_xref="GOA:A0QP18"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QP18"
FT                   /protein_id="ABK71905.1"
FT                   /translation="MMRLSSTLRRFRWAVFATWLLLLVPSIYLALNQSSNLTGGGFEVE
FT                   GSQSLHVQRQLEEHFPDQGASPLALVAAPRADASYEDMNAAVVHLEKLAAEVPSVKIVP
FT                   NPQQPAPQPDRPYVITLQLDFNNTGAVDVAKQLRQKVGIHGEEPGESQNGKVKFYVIGQ
FT                   GALGAAATQATKHDIAAAEKWNMPIVLIVLLAVFGSLAAAALPLVLGVCTVVVTMGLVY
FT                   LLSMFTTMSVFVTSTVSMFGIAVAIDYSLFILMRFREELRAGRDQQDAIDAAMATSGLA
FT                   VALSGLTVIASVTGIYLINTPVLVSMATGAILAVAVAVLTSTTLTPAVLATFGKAAAKR
FT                   SSYLHWSRRAEAAQSRFWTRWTGAVMRRPWASAIAAAILLLVLAAPAFNMVLGNSMQRQ
FT                   FDPTHEIRGGVNAAADALGPGALGPIRVLVTFPGEGDASSQAATTTIEAVRQQMTKAPS
FT                   VVSVQPPVVSDDNDSALLSAVLSVDPEDMAAREAIDWMRAELPGVAGQNATIDVGGPTA
FT                   LIKDFDDRVSATQPLVFVFVALIAFVMLLVSIRSVVLAFKGVLMTVLSVAAAYGSLVVV
FT                   FQWGWLEQLGFPRISSLDSTIPPLVLAMTFGLSMDYEIFLLTRIRERFLQTNSTRDAVA
FT                   YGVSTSARTITSAALIMIAVFIGFAFAGMPLVAQLGVACAVAIAVDATVVRLVLVPALM
FT                   AMFDQWNWWLPRWLDKILPEVDFEKPLPKIEVTDLVIIPDNIAALGPSGSDLRTMVRTA
FT                   ARMKTLAPQTISVADPLAFSGCTRPTTRLSTQRAGRPKAHTPGLHPVTMWRGRLSVAVD
FT                   ALQTEADTEQAPVERRGPVETTNVQLPTGDRLQIPTGAETLRLAGYLIMCRNTTKDFED
FT                   FARLVDLMDSHTAALVLASMDRYYCGRDPSNRWVATQLVRRLADPQPSDEHDVRMSGPD
FT                   AAEDWEKVRQRCLSVAVAMLEEAK"
FT   gene            273263..273844
FT                   /locus_tag="MSMEG_0242"
FT   CDS_pept        273263..273844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0242"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73632"
FT                   /db_xref="GOA:A0QP19"
FT                   /db_xref="InterPro:IPR030937"
FT                   /db_xref="InterPro:IPR032407"
FT                   /db_xref="InterPro:IPR038378"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP19"
FT                   /protein_id="ABK73632.1"
FT                   /translation="MKAAITGAISGAKHDLRRTLGTVFVATAVGGAATAALLGPSATAA
FT                   TDPCAASEVARTVGKVATDTGDYLDENPQTNQALTTISKQQAGPATLASIKTYLDANPQ
FT                   VAKDLQRLQQPLTALGTKCQLPVTLPQLLGLVQAAQQQGTAAAGSLPGGLTSPQIAGVP
FT                   GVVGPAQRTPISPVSQGSGPLPGPAVTSTR"
FT   gene            274044..274394
FT                   /locus_tag="MSMEG_0243"
FT   CDS_pept        274044..274394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0243"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72092"
FT                   /db_xref="GOA:A0QP20"
FT                   /db_xref="InterPro:IPR032407"
FT                   /db_xref="InterPro:IPR038378"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP20"
FT                   /protein_id="ABK72092.1"
FT                   /translation="MVAGAAGAGAVAGAMLFGAIPSALADPAPNPPNCTAADLAGVASG
FT                   VSAGTSAYLFTHPQVNDFFTSLEGLPREEVKPKVADYLAANPQVKDELTAVRQPLVDLK
FT                   NRCGTAPAPELP"
FT   gene            274400..275140
FT                   /locus_tag="MSMEG_0244"
FT   CDS_pept        274400..275140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0244"
FT                   /product="two component response transcriptional regulatory
FT                   protein prra"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72873"
FT                   /db_xref="GOA:A0QP21"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP21"
FT                   /protein_id="ABK72873.1"
FT                   /translation="MRVDMTPASGEGSRAPEGVNRTVLMVDDDPDVRTSVARGLRHSGF
FT                   DVRVAASGKEALRLLSTESHDALVLDVQMPELDGVAVVTALRALGNDIPICVLSARDTV
FT                   NDRIAGLEAGADDYLTKPFDLGELVARLHALLRRASHTEQPSDTMTVGPVTIDTARRLV
FT                   FVSGERVDLTKREFDLLAVLAENAGVVLSRQRLLELVWGYDFDVDTNVADVFISYLRRK
FT                   LERDGVPRVIHTVRGIGYVLREEP"
FT   gene            275161..276513
FT                   /locus_tag="MSMEG_0246"
FT   CDS_pept        275161..276513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0246"
FT                   /product="sensor-type histidine kinase PrrB"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74047"
FT                   /db_xref="GOA:A0QP22"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP22"
FT                   /protein_id="ABK74047.1"
FT                   /translation="MRRLRLPAFIRSASLRTRVAVAAAAAASAVVAAFTILTSVVLASN
FT                   DAAQLDRRLDAIVDASINPEHLQDPQRGVLTTGRTRTGGQVVFQRGFQLPALPPGTATV
FT                   EVNGVDYRVRTVSVDQQGGIMMSIGIRADSILLSANRIPLYAAVGVVTVLVAAGLGWLL
FT                   AGPAIRPLRKLTEHTSKLGSGGPDTLPEVRGVREAEDLSEAMSGMLTRLAAAQRATTNS
FT                   LQAAQDFAANAAHELRTPLTAMRADLDTLRIHDLPEDERDEVVADLSRAQRRVEAIITA
FT                   LGQLASGQLAQAEDRELIDITDMLDRVARENTRADTGVRIEVHADDDVGLVLGWPGGLR
FT                   IAVDNLVRNAITHGEAGRVVVSAHRTGQMLTIVVDDNGRGLPVEEHETVLGRFRRGSTA
FT                   VAGGSGLGLALVAQQAELHGGQIKLSDGPLGGLRATLTVSIAPTGPTDQLA"
FT   gene            complement(276501..276869)
FT                   /locus_tag="MSMEG_0245"
FT   CDS_pept        complement(276501..276869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0245"
FT                   /product="probable conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69705"
FT                   /db_xref="GOA:A0QP23"
FT                   /db_xref="InterPro:IPR021414"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP23"
FT                   /protein_id="ABK69705.1"
FT                   /translation="MRATSARALLADLVCVVVFCTIGRRSHAEGITVAGVAETAWPFLV
FT                   GTLVGWVVSRGWQRPTSLAPTGIAVWACTIVVGMLLRKLTSAGTAVSFIVVASLVTAAL
FT                   LLGWRGVLAAARRKAQAN"
FT   gene            complement(276856..278070)
FT                   /locus_tag="MSMEG_0247"
FT   CDS_pept        complement(276856..278070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0247"
FT                   /product="secreted peptidase"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71138"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP24"
FT                   /protein_id="ABK71138.1"
FT                   /translation="MRYLTLAVSLGTATALAVLTACSSAETTESESTTTTTPKVQPTPV
FT                   IGSVLAEPIPVPTTDGRTHLAYELMLTNPMSGNVTLNAVSVMDGDRKLLTLSGDSLKYW
FT                   TRALGNPAAPANVLGPGQSATVWLDVVADDPAQVPTELTHAIDLTVAKPMPPLIPANVT
FT                   ETIAPVSVQTRKPPSISPPLTGDRWLDINSCCDMTAHRMALNPINGKIWAAERFAIDYV
FT                   QLGTDGRIYTGNKAAVESYPYFGAEIRAVADGPVVSVLDGQPEQTPGVTPSGLTLEQYG
FT                   GNHIVQDIGDGVYAFYAHLQPGSLKVKPGDQLSTGQAIASLGNSGNSDAPHLHFHVMDG
FT                   PDPLAADGLPFVFDSFRLDSRLTSATAGDALLDGKPAALQPGFATREVSEVSPLVLDVM
FT                   TYASD"
FT   gene            complement(278070..279161)
FT                   /locus_tag="MSMEG_0248"
FT   CDS_pept        complement(278070..279161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03706;
FT                   match to protein family HMM TIGR00374"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71706"
FT                   /db_xref="GOA:A0QP25"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP25"
FT                   /protein_id="ABK71706.1"
FT                   /translation="MSHDAQADAARGRAGSARGKYWWLRWVLIAVAVAVLGVELTLVWD
FT                   QLAKAWKSLVSANVWWVLAAVVAAMASIHSFAQIQRTLLLSAGVQVRQWRSEAAYYAGN
FT                   ALSTTMPGGPVLSTTFIYRQQRIWGASPLVASWQLVMSGVLQILGLALLGLGGAFMLGA
FT                   SKNPLSLIFSLGGLLALVLLGQAVASRPELIEGIGVKVLHWVNSVRGKPSDTGLAKWRE
FT                   ILKQLEAVKLGRRDLTVSFSWSMFNWIADVACLAFACYAAGGHPSLAGVTVAYAAARAV
FT                   GSIPLMPGGLLVVEAVLVPGLVTSGMTLASAISAMLIYRLISWIFISAIGWVIFFFMFR
FT                   TETDLDVDRVDQHEPAPERQEPN"
FT   gene            279235..280374
FT                   /locus_tag="MSMEG_0249"
FT   CDS_pept        279235..280374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0249"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF01594"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73203"
FT                   /db_xref="GOA:A0QP26"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP26"
FT                   /protein_id="ABK73203.1"
FT                   /translation="MALDPVADEAVSPLVRKAAAWSWRLLIIGGAIVALLWLIKRLEIL
FT                   FVPVALATMVAALLLPAVDFMDRRGAPRGSAVALVLLGGIAVVGGILTFVVTQFIQGAP
FT                   DLVEQMTRSIDGVRNWLIDGPLHLSKEQIDSAGNTAIEALQRNQEKVTTGALSTAGTLT
FT                   ELLTGAVLTLFTLIFLLQGGRNIFAFVTKAFPEDVRERVRDAGRAGFHSLIGYVRATFL
FT                   VALVDAIGIGTGLAIMGIPLALPLASLVFLGAFVPLVGAVIAGFLAVVVALLAKGLVYA
FT                   LITLGLIIAVQQLEGHVLQPLVMGRAVSIHPLAVVLAIAGGGVLAGIVGALLAVPAVAF
FT                   LNSATRVLLARDPHAEEEALVAESTTIIAAESDDLPERE"
FT   gene            complement(280382..283423)
FT                   /locus_tag="MSMEG_0250"
FT   CDS_pept        complement(280382..283423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0250"
FT                   /product="membrane protein, MmpL family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74656"
FT                   /db_xref="GOA:A0QP27"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP27"
FT                   /protein_id="ABK74656.1"
FT                   /translation="MFAWWGRTVYQFRYIVIGVMVALCLGGGVYGISLGNHVTQSGFYD
FT                   EGSQSVAASLIGDEVYGRDRTSHVVAILTPPDDKKVTDKAWQKKVTEELDQVVKDHEDQ
FT                   IVGWVGWLKAPDTTDPTVSAMKTQDLRHTFISIPLQGDDDDEILKNYQVVEPELQQVNG
FT                   GDIRLAGLNPLASELTGTIGEDQKRAEVAAIPLVAVVLFFVFGTVIAAALPAIIGGLAI
FT                   AGALGIMRLVAEFTPVHFFAQPVVTLIGLGIAIDYGLFIVSRFREEIAEGYDTEAAVRR
FT                   TVMTSGRTVVFSAVIIVASSVPLLLFPQGFLKSITYAIIASVMLAAILSITVLAAALAI
FT                   LGPRVDALGVTTLLKIPFLANWQFSRRIIDWFAEKTQKTKTREEVERGFWGRLVNVVMK
FT                   RPIAFAAPILVVMVLLIIPLGQLSLGGISEKYLPPDNAVRQSQEQFDKLFPGFRTEPLT
FT                   LVMKREDGEPITDAQIADMRAKALTVSGFTDPDNDPEKMWKERPANDSGSKDPSVRVIQ
FT                   NGLENRNDAAKKIDELRALQPPHGIEVFVGGTPALEQDSIHSLFDKLPLMALILIVTTT
FT                   VLMFLAFGSVVLPIKAALMSALTLGSTMGILTWMFVDGHGSGLMNYTPQPLMAPMIGLI
FT                   IAVIWGLSTDYEVFLVSRMVEARERGMSTAEAIRIGTATTGRLITGAALILAVVAGAFV
FT                   FSDLVMMKYLAFGLLIALLLDATIIRMFLVPAVMKLLGDDCWWAPRWMKRVQEKLGLGE
FT                   TELPDERKRPTVRESETDQRALVGVGAPPPPPRPHDPTHPAPEPVRPMPPMRSNAPSAA
FT                   GTARISTPPQPPQPPQAPAQQAGDEPATTRFAMARNAVRNAVNSAVHGGAGSAAAPTER
FT                   APRPGGPAQPPAPPQREEREIESWLGALRGPAPAKNVPQPPAQPQRPSTDTTRAMPPQG
FT                   RPPAGPADRGNENAPTTAFSAQRPPNGGAPADATTAIPTPPQREQEPSTEKLNTREDAP
FT                   EDPETKRRGGGMSAQDLLRREGRL"
FT   gene            complement(283518..284216)
FT                   /locus_tag="MSMEG_0251"
FT   CDS_pept        complement(283518..284216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71042"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP28"
FT                   /protein_id="ABK71042.1"
FT                   /translation="MTPDIVEDLQQESSPETDAVPGVRRVLLVWDAPNLDMGLGSILGG
FT                   RPTAAHRPRFDALGRWLLAYTAELADGVGAEETAISHEPEATVFTNIAPGSADVVRPWV
FT                   EALRNVGFAVFAKPKIDEDSDVDSDMLDHIALRRREGLAAVLVASADGQAFRQPLEEIA
FT                   REGTPVQVLGFREHASWALASDTLEFVDLEDIPGVFREPLPRIGLDSLPEQGAWLQPFR
FT                   PLSSLLTSRV"
FT   gene            complement(284219..284941)
FT                   /gene="trmB"
FT                   /locus_tag="MSMEG_0252"
FT   CDS_pept        complement(284219..284941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="MSMEG_0252"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="identified by match to protein family HMM PF02390;
FT                   match to protein family HMM TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72503"
FT                   /db_xref="GOA:A0QP29"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP29"
FT                   /protein_id="ABK72503.1"
FT                   /translation="MNASAGPPAEPHRLPRVTSFRTRRSTLSGGQQGTWDRLWPKLGMQ
FT                   ARDEDSQPITDLDTEAWFGRSAPLVLEIGSGTGTSTLEMAKAEPHIDVIAVEVYRKGLA
FT                   QLLSAIDREGVTNIRMIRGDGVDVLEHMIGSNTLTGVRVFFPDPWPKARHHKRRLLQPA
FT                   TVALIADRLREGGVLHAATDHMGYAEHIAEVGDAEPLLRRVSTSDDLPISLERPVTKYQ
FT                   RKALAGTEVAELVWEKRL"
FT   gene            285164..286186
FT                   /locus_tag="MSMEG_0253"
FT   CDS_pept        285164..286186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0253"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70049"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP30"
FT                   /protein_id="ABK70049.1"
FT                   /translation="MEGRQMFAAELKRFAGCVGDGNRDPRLAKISARVCAPVGVSVHGR
FT                   RGVGVTTVAEALGANGVAVRDDGPGELAVLVTVEVLKPEDLTLADALRARGADVLVVLN
FT                   KADLVGRAPDGSLAAAHHRAQQLRERTGLPVVPMVGLLARATLSPHLVEALRLLATTPA
FT                   DLTSTEAFLADPHPVAQATRTELLTTLDRFGIVHACRELSRDPNADAAVLSAALRRLGE
FT                   TDRVLAALDALAAPRRYRRIERALTELQAVGGESVGRFLAADTTVVAVMDAALEVMRAA
FT                   GVVVPSRAACGRDAHLRRARFWWRYCRGPVGALHGRCAAAIARGSLRLAGLDTEEAARR
FT                   "
FT   gene            286183..287649
FT                   /locus_tag="MSMEG_0254"
FT   CDS_pept        286183..287649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0254"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72554"
FT                   /db_xref="GOA:A0QP31"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP31"
FT                   /protein_id="ABK72554.1"
FT                   /translation="MSTATEEPTPDPIAEADALVAAVDPGLSSPGVQARDVILVTGPWL
FT                   AGTSSVLAALRERMPQHTFVESEDLLAGEAPKAVVFVVSAAAPITESDCALLDLASQYT
FT                   DVVVGAVSKIDAHRNWRDVRETDVKTCAARSQRYEQMPWAGVAAAPDLGEPRIGELVAA
FT                   LTERLTDTDMLRRNRLRAWEARLEAVMGRYEADASGADRKTRLETLRERRAEINRTRRL
FT                   TKTERSVALRSQLQQARVQLGYFARNRCNSVRTELQEDVAALGRRRIGEFETYVRERCD
FT                   TIVDEVHEGVTVHLGDVASELGLDAPATPERPSVPDIASPPLKTRTLETRLMAVLAVGF
FT                   GLGVALAVSRLLAGAAPRLAVTGLAVGALVGLLLAVWVVSTRGLLHDRAVLDRWVNDAT
FT                   ATVRSAVEELVATRVLQAEADLTTQLAGRDEAEAAAAAEQIAAIDTELREHAVATARAA
FT                   ALRDRRIPPLRRALDAVRADLYGDSASTDE"
FT   gene            287807..289633
FT                   /locus_tag="MSMEG_0255"
FT   CDS_pept        287807..289633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0255"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /EC_number="4.1.1.32"
FT                   /note="identified by match to protein family HMM PF00821"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74449"
FT                   /db_xref="GOA:A0QP32"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QP32"
FT                   /protein_id="ABK74449.1"
FT                   /translation="MTSATIPGLDTAPTKHQGLLAWVQEVAELTQPDRVVFADGSDEEY
FT                   ERLCAHLVEAGTFQKLNPEKQPNSYLALSDPSDVARVESRTFICTEREIDAGPTNNWMD
FT                   PAEMRGIMTDLYRGSMRGRTLYVVPFCMGPLDAEDPKLGVEITDSEYVVVSMRTMTRMG
FT                   RAALDKLGDDGFFVKALHSIGAPLEPGQKDVPWPCNDTKYITHFPETREIWSFGSGYGG
FT                   NALLGKKCYSLRIASAMAHDEGWLAEHMLILKLISPENKAYFIAAAFPSACGKTNLAML
FT                   QPTIEGWRAETVGDDIAWMRFGKDGRLYATNPEFGFFGVAPGTNWSSNPNAMKTIAAGN
FT                   TVFTNVAKTDDGDVWWEGLEGDPQHLIDWKGNDWTPESGEKAAHPNSRYCTPISQCPTL
FT                   APEWDDPQGVPISAILFGGRRKTTVPLITEARDWQHGVFIGATLGSEQTAAAEGKVGTV
FT                   RRDPMAMLPFLGYNVGDYFAHWINVGKNADESKLPKVFFVNWFRRGDDGRFLWPGFGEN
FT                   SRVLKWAVERIEHKADGKSTPIGIVPTAADLDLEGLDVDPADVDEALAVKPEEWRAELP
FT                   LIEEWFEFVGEKLPTGLKDEFDALKHRLSEEG"
FT   gene            289749..290651
FT                   /locus_tag="MSMEG_0256"
FT   CDS_pept        289749..290651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0256"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70562"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP33"
FT                   /protein_id="ABK70562.1"
FT                   /translation="MRQLIVGSQALAEGTVTEHELRRWYRRMYRDIYIPAGYTPTLIDH
FT                   IDGAWLRSGRQGIVAGVAASALFGADWVDAGIAVEMVWDNTRPPRGIIARDERTEDDEI
FT                   TTAQCITVTTPARTAFDLGRHLRRSEALARMDALMRATAFSPDDVAALAERYRGARGIR
FT                   QLRELLPLVDGGAESPRETRTRLLLFDAGFPRPTTQIPAVDERGRLVRMLDMGWEEFMV
FT                   AAEYDGDQHRTERARYVKDIRVWPKLRELGWDVIRVIKEDRDSDVLQRVHRALVARGWD
FT                   GKLLPRLRSLQDRRISRPT"
FT   gene            290685..292199
FT                   /locus_tag="MSMEG_0257"
FT   CDS_pept        290685..292199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0257"
FT                   /product="acyl-CoA synthase"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71363"
FT                   /db_xref="GOA:A0QP34"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP34"
FT                   /protein_id="ABK71363.1"
FT                   /translation="MQIREHVGANKPAIILYPSGTVVTFDELEARANRLAHHFRNQGLQ
FT                   EGDVVAILMENNSHIHTVMWAARRSGLYYVPISTHLTAAEAAYIVDNSGAKAIVGSAKM
FT                   RDVLAGLGDELPNGLPDTLLIADGDLDGWLRYPEAVADLPDTPIDDELDGDLLQYSSGT
FT                   TGRPKGIKRELPHVHPSENPGMMAALISFWMTPDSVYLSPAPLYHTAPSVWSMQVQAAG
FT                   HTTVVMEKFDAEGCLEAIQKHRVTHGQFVPAMFTRMLKLPESVRNSYDVSSLKRVMHAA
FT                   APCPVDIKKQMIDWWGPIVDEYYASSEAIGATLITAEEWLKHPGSVGKPLTGIVHVLDE
FT                   DGNELPPGQAGEIFFEGGQDFEYLNDAEKTASSRDARGWKTVGDIGYLDEEGYLYLTDR
FT                   RHHMIISGGVNIYPQEAENMLVTHPKVMDAAVFGVPDDEMGQSVKGVVQTVDPADATPE
FT                   FGEELLAWLRDRLAHYKCPRSISFELQLPRTDTGKLYKQELIAKYS"
FT   gene            292201..293106
FT                   /locus_tag="MSMEG_0259"
FT   CDS_pept        292201..293106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0259"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73013"
FT                   /db_xref="GOA:A0QP35"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP35"
FT                   /protein_id="ABK73013.1"
FT                   /translation="MIELPGGIRIGLIDDPDDAEDATFTLSEAATDDRRVVTVASIADT
FT                   LELLRQRCERRPQTAAVCDDVLRSADPDASTFSGVITESLAYSTLQSGAEFARWLDERG
FT                   PATVPQLPDPVRAHRDGNTLHVRFNRPQRHNAFSTDARAALLEALEVARLDPSVDEVVL
FT                   AGNGQSFCSGGDLAEFGSFADPAAAHLARTRYSPALVLDELTARLGRRCRAHVHGQVLG
FT                   SGLEMACFCGWVSCDPDAKLGLPELELGLVPGAGGTVSITRRIGRWRTAYLVLSGRTID
FT                   PTTALSWGLVDEIVSVAAPA"
FT   gene            complement(293084..293794)
FT                   /locus_tag="MSMEG_0258"
FT   CDS_pept        complement(293084..293794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0258"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family protein"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74405"
FT                   /db_xref="GOA:A0QP36"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP36"
FT                   /protein_id="ABK74405.1"
FT                   /translation="MSENKIILVTGVTSGIGEAVAIRLAAEGHLVVGGARRADRLAALK
FT                   RENLHVRRVDVTDRADMAAFVDEAVSEHGRVDAIVNNAGIMPLSRVDTLLVDEWDAMID
FT                   VNVRGLLNGIAAALPHFQRQGHGHFVTMASIGAHQVVPTGAVYCATKHAAWAITEGLRL
FT                   ELDPSIRVTTISPGVVESELAQTITDPDAAKAMEIYRAESIPPDAIARAVSYAVNEPAD
FT                   VDVNEVIVRPARQR"
FT   gene            293906..294721
FT                   /locus_tag="MSMEG_0260"
FT   CDS_pept        293906..294721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0260"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71523"
FT                   /db_xref="GOA:A0QP37"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP37"
FT                   /protein_id="ABK71523.1"
FT                   /translation="MTDLGDYLRSRRALVTPADVGLPAAGHRRVPGLRREEVALLAGLS
FT                   VDYYSRLEQGRERSPSAQVLDALAAVLRLDEDGRRHLFAVAGLTPRARLAPVPDRVDPA
FT                   LMRLMATWPDNPALVYNRAYDLLASNALADALYDGILHHNMLMMVFTEPRARELYADWP
FT                   VIAADAVAGFRMNHGIAPHDPRINAVLTELLDRSAEFTELWSRHDARGKSATVKSFRHP
FT                   QVGAVTLQMQTFDVRSAPGQELVVYQAEPGTPSADALKLLGSLAATAEA"
FT   gene            294737..295729
FT                   /locus_tag="MSMEG_0261"
FT   CDS_pept        294737..295729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0261"
FT                   /product="p40 protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75292"
FT                   /db_xref="InterPro:IPR016790"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP38"
FT                   /protein_id="ABK75292.1"
FT                   /translation="MTAHGRRSGGPYFDDLAVGQVFDTAPSMTLTEGAAAAHQAVIGDR
FT                   LRLSLDAELSSAVTGEPGPLAHPALVCDVAIGQSTLVTQRVKANLFYRGLAFHRFPVIG
FT                   DTLTTRTEVVGLKQNSNKPGRAPTGLAALRMTTTDHKDRLVLDFYRCAMLPLSENGGDT
FT                   GYSDDLSAIGADASPTPTAHWDADAYRARVPGPHLDDLRDELAGAVLRSTADVVSSAPE
FT                   LARLTLNIAATHHDWRSGGRRLVYGGHTIGLALAQATRLLPNLVTVLGWESCDHTGPVH
FT                   EGDTVFSELHVESIEANVVGLRSIVFAAGGPDGGADRQVLDWRFSALLF"
FT   gene            295766..296872
FT                   /locus_tag="MSMEG_0262"
FT   CDS_pept        295766..296872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0262"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70258"
FT                   /db_xref="GOA:A0QP39"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP39"
FT                   /protein_id="ABK70258.1"
FT                   /translation="MTGISGAVAARAQQVADAFARMTGVAVDARVLLTGRAALLGMCPQ
FT                   GCISAGGATHLFPSRKGTWCALTLSRPDDVAAVPALVQADTVDADPWPVVETWAAATEA
FT                   HAITERARLLGLPAAVLGETVPAAPRITRMWPRGTGRPLTGLLVADLSSMWAGPLCGQL
FT                   LRQAGATVVKVESHARPDGTRNGPQVFFDWMNHGKLSYVADFGEPSALGALLDVADVVI
FT                   ESSRPTALVRRGLGPDVVASREGRVWVRITGHGTTGEHADWVAFGDDAAVSGGLVKNHH
FT                   GTPSFAGDAIADPLTGLHAAHAVAESLTRGGGDLIEFAMSAVAATYADLATTGADIATV
FT                   EPASAPAGPALGADNGAVTRLIAGSRPC"
FT   gene            296866..298137
FT                   /locus_tag="MSMEG_0263"
FT   CDS_pept        296866..298137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0263"
FT                   /product="amidohydrolase 3"
FT                   /note="identified by match to protein family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70713"
FT                   /db_xref="GOA:A0QP40"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP40"
FT                   /protein_id="ABK70713.1"
FT                   /translation="MLIQRASLLDGRIADIRVGEAIEDVGPSLRARRGEAVLDAALGAV
FT                   IPGLHDHHVHVYSAAAEQNSLRVGPREAHDTGELRRLLAGAAPGADGWIRAIGYHEQVA
FT                   GPLDRDRLDALAPAVPVRVQHRSGVLWVLNSAGLAAINRPDHPDGILRSADPTWAEALP
FT                   RRDTDIDSYAERLARYGITGITDATPDLSEPPRGLPQHLHVLAPGKKILHDDMLDLDGL
FT                   VTWIGERHARGVPVAVHCVTSAQLVVTIAAMRVTGVLPGDRIEHAAMVPEDCVRDLCEL
FT                   GVTVVTQPNFVTERGDAYRSDVDAADHHQLWRVATLLAAGVRVALSTDAPFGDADPWAV
FT                   MRAAVHRRTPHGFVLNPAERIPPRTALELFFGTAQDPAHPRRVDVGQPGDLCVLAAPPR
FT                   QVVETLDADLVAATIIGGSVVFSR"
FT   gene            298158..299276
FT                   /locus_tag="MSMEG_0264"
FT   CDS_pept        298158..299276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0264"
FT                   /product="transmembrane transport protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72866"
FT                   /db_xref="GOA:A0QP41"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP41"
FT                   /protein_id="ABK72866.1"
FT                   /translation="MPALLGSAALGFTGLAFLLPVAPMWAVHIGADNLGAGLVNTVLMA
FT                   CTVVAQLLVGRLIRRVGMRVTLAIGLLLLGGPALLHLFAETLWAVLVLAALRGLGFGIL
FT                   TVSGVDGVAGLFAQEHRGRAVGAYGLAIAAPQFIFTPLAPWLAEQAGFGLVFALATAPV
FT                   LAIPFALAFTRPVPTPPRRDDDEKFALTAGLVSPIVALVVITASGGAILTFAPQFGSAE
FT                   AAFASLLALTGLTALARWLVGGLADRFGPARFIQPLLYLGAVGLATVATGIARGALIAE
FT                   ILIVVGAALVGIAYGALQNVTLVQAFAATGEHARSKVSVAWNVGFDGGTGIGALAVGAL
FT                   ATSGSFPMAFAVLAAACAVMGVASYFAHRRTV"
FT   gene            299314..300771
FT                   /locus_tag="MSMEG_0266"
FT   CDS_pept        299314..300771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0266"
FT                   /product="arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="identified by match to protein family HMM PF01276;
FT                   match to protein family HMM PF03711"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75092"
FT                   /db_xref="GOA:A0QP42"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP42"
FT                   /protein_id="ABK75092.1"
FT                   /translation="MDQTETPLLDALNEYHASNRYGYSPPGHRQGRGVDDRVLRVLGRE
FT                   PFLSDVLANGGLDDRRSSNGYLQKAEDLMAEAVGADTAWFSTCGSSLSVKAAMMAVAGG
FT                   DGSLLLSRDSHKSVVAGLIFSGVMPRWITPRWDADRHLSHPPSPEEVEETWRRYPDAAG
FT                   ALIVSPSPYGTCADLAGIADVCHARGKPLIVDEAWGAHLPFHENLPTWAMNAGADVCVV
FT                   SVHKMGAGFEQGSAFHLQGDLIDQDRLSACADLLMTTSPNVLVYSAIDGWRRQMVEHGH
FT                   RLFGAALDLADDTRRRIEEIDDVEVLDEELLGAQASHDLDRLQILIDVSATGTSGYQAA
FT                   DWLRENCQVDVGMSDHRRILATMSVADGSDTAGRLLHALSLWRKAADDFAPPPPIDLPS
FT                   PAELQLTTKTSPRDAFFAEVEQIPVEHAVGRIAAEQITPYPPGIPAVVPGERLNEAVLD
FT                   YLVTGVQAGMNLPDPADPQMGSIRVMA"
FT   gene            complement(300761..301390)
FT                   /locus_tag="MSMEG_0265"
FT   CDS_pept        complement(300761..301390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0265"
FT                   /product="uracil DNA glycosylase superfamily protein"
FT                   /note="identified by match to protein family HMM PF03167;
FT                   match to protein family HMM TIGR00758"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75207"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP43"
FT                   /protein_id="ABK75207.1"
FT                   /translation="MAGAQDFVPHTADLAELAAAAGECRGCGLYRDATQAVFGAGGRSA
FT                   RIMMIGEQPGDKEDLAGLPFVGPAGRLLDRALEAADIDRDALYVTNAVKHFKFTRAAGG
FT                   KRRIHKTPSRTEVVACRPWLIAEMTSVEPDVVVLLGATAAKALLGNDFRVTQHRGEVLH
FT                   VDDVPGDPALVATVHPSSLLRGPKEERESAFAGLVDDLRVAADVRP"
FT   gene            301478..302494
FT                   /locus_tag="MSMEG_0267"
FT   CDS_pept        301478..302494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0267"
FT                   /product="esterase"
FT                   /note="identified by match to protein family HMM PF07859"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75113"
FT                   /db_xref="GOA:A0QP44"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP44"
FT                   /protein_id="ABK75113.1"
FT                   /translation="MTSSVSTIDARPDLSVGKQIMHRRRSAESFALAAGCRAFVRNAVR
FT                   VWAMQPNLAWPLGSIDRMVGLLPHRVDAKIRSVQLPDCAAELVCANGVSADRAILYLHG
FT                   GAFMTCGINTHRSLVARLSREADAAVLNVGYRMLPKYGLAEAIDDAVAGLRWLQEQGYT
FT                   SDQIVIAGDSAGGYLALATALQLSSRGEVPAAGIAAISPLTDLDPASKLEHPNARKCAM
FT                   FTGAALAGFAKYLHRCERRPVSRREAAAFVNPVTADLTKLPPVTVHVSADESLYSDSEL
FT                   LAGRLAEAQVPCELHVWHGQVHDFPLAADILPEGRRALRYVGDFVKQTTGTRLANVS"
FT   gene            complement(302495..303274)
FT                   /locus_tag="MSMEG_0268"
FT   CDS_pept        complement(302495..303274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0268"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF02082; match to protein
FT                   family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74367"
FT                   /db_xref="GOA:A0QP45"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP45"
FT                   /protein_id="ABK74367.1"
FT                   /translation="MPVQSEELRRRLVADINAGTPGAKLGSERDLAEKYGTSRSSLRQV
FT                   LAALEEAGLVHRVIGRSGGIFISHGQVERNLSDVVGVPAFLANQGYVAGTRILSTRITT
FT                   PDQTTRTALRLGPGEYVVEIQRVRLADGSPISLEQAQFPAEKFPGLLEQQLGGSLYEVL
FT                   ESQYGLVPGRADERIEAVNATSNEATLLGIKPKAALLLITRVTFDQTGTPYEFSRDLFR
FT                   GDRTALAVTAKGRGIAAASNSGTDNRTASVTLHRQVG"
FT   gene            complement(303324..304103)
FT                   /locus_tag="MSMEG_0269"
FT   CDS_pept        complement(303324..304103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0269"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71438"
FT                   /db_xref="GOA:A0QP46"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:6CI8"
FT                   /db_xref="PDB:6CI9"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP46"
FT                   /protein_id="ABK71438.1"
FT                   /translation="MFTSLEGRSAIVTGGSKGIGRGIAETFANAGVDVVITGRNQDDLD
FT                   RTVADLSGTRGKVTAVRADVTDPEDARRTVAETVSRHGGLDIVCANAGIFPSGRLEDLT
FT                   PDDIEQVLGVNFKGTVYIVQAALQALTASGHGRVVVTSSITGPITGYPGWSHYGASKAA
FT                   QLGFLRTAAMELAPKKITINAVLPGNIMTEGLDEMGQDYLDQMASAIPAGRLGSVADIG
FT                   NAALFFATDEAAYVTGQTLVVDGGQVLPESHLAIAEL"
FT   gene            complement(304140..305144)
FT                   /locus_tag="MSMEG_0270"
FT   CDS_pept        complement(304140..305144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0270"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69722"
FT                   /db_xref="GOA:A0QP47"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="PDB:6EF6"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP47"
FT                   /protein_id="ABK69722.1"
FT                   /translation="MGVITDDVTIAQQALTHYDVSDNASLRLLNLSENATYLVEDGEHQ
FT                   SILRVHRQDYHQPHEIESELDWLAALRTDSDVTVPTVVPARDGRRVVTVDPADSDAVPR
FT                   HVVHFEMVGGAEPDEESLTLDDFQTLGRITASLHEHSQRWTRPAGFGRFSWDWEHCLGD
FT                   TPRWGRWQDAEGVGASETALLTRAQDLLHRKLEEYGSGPDRYGLIHADLRLANLLVDSS
FT                   TPQRTITVIDFDDCGFGWYFYDFGTAVSFIEHDPRLGEWQESWVAGYRSRRELPAADEA
FT                   MLPSFVFLRRLLLLAWMGSHTHSRESATKAISYAAGSCALAERYLSSDGLRLT"
FT   gene            complement(305144..305800)
FT                   /locus_tag="MSMEG_0271"
FT   CDS_pept        complement(305144..305800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75166"
FT                   /db_xref="PDB:5SUH"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP48"
FT                   /protein_id="ABK75166.1"
FT                   /translation="MVAPETERIRTQIRVYLLVEDLQRQFAAYLGTPTRARGYPPYEGE
FT                   HALIVEVSPALAIERVIDLALRAVPGVQPGILYVERQFGVLEIHSASLDEVRRAGEAIL
FT                   AGTGNRAEDQLRPRVLFHDIITDITDQHAVILNRNRQASMILPGQSLLVYEMTPALFAA
FT                   VAANEAERVAPGLTVVDVQMIGAAGRLYIGGSTDEVTVARDHITTVLSAIEGQEH"
FT   gene            complement(305803..306084)
FT                   /locus_tag="MSMEG_0272"
FT   CDS_pept        complement(305803..306084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0272"
FT                   /product="propanediol utilization protein PduA"
FT                   /note="identified by match to protein family HMM PF00936"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74854"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="PDB:5L38"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP49"
FT                   /protein_id="ABK74854.1"
FT                   /translation="MSSNAIGLIETKGYVAALAAADAMVKAANVTITDRQQVGDGLVAV
FT                   IVTGEVGAVKAATEAGAETASQVGELVSVHVIPRPHSELGAHFSVSSK"
FT   gene            complement(306097..306360)
FT                   /locus_tag="MSMEG_0273"
FT   CDS_pept        complement(306097..306360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0273"
FT                   /product="ethanolamine utilization protein EutN"
FT                   /note="identified by match to protein family HMM PF03319"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69839"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="PDB:5L37"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP50"
FT                   /protein_id="ABK69839.1"
FT                   /translation="MLRATVTGNVWSTRRIEGIPAGAFLEVEVEGTGSRMIAFDVLGSG
FT                   VGEHVLIAQGSVASSWFTGTPPPIDALIIGSIDTRSDSNPAE"
FT   gene            complement(306377..306898)
FT                   /locus_tag="MSMEG_0274"
FT   CDS_pept        complement(306377..306898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0274"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71758"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP51"
FT                   /protein_id="ABK71758.1"
FT                   /translation="MGITREELRALVREVVREAVGSLNSSPAQASNQASKPAPPAPPPR
FT                   ATVADQMGLEPTGPRAVEGRNRTETVRLTDDKDLDTFVRKLLRLFESPKTRADLKAGRL
FT                   RFRLAPGSGAAMANGQAQVTHRIDSGAVTERHIADLAGGTLVLGPRAVLTPLAREKART
FT                   LGIVIEKERR"
FT   gene            complement(306901..307509)
FT                   /locus_tag="MSMEG_0275"
FT   CDS_pept        complement(306901..307509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0275"
FT                   /product="bacterial microcompartments protein family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00936"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72692"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="PDB:5L39"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP52"
FT                   /protein_id="ABK72692.1"
FT                   /translation="MAELRSFIFIDRLQPQTMSYLGTWIKGALPRANMAAQIIEVAPGL
FT                   DIEGVTDVALKHAEVKAGILVVERQFGYLEFHGETGAVKAAADAALDYLGGDPDAAVRP
FT                   EILASRIISSIDHQHAFLINRNKIGSMVLPGESLFVLEVAPASYAILATNEAEKAADVK
FT                   VVDFRMIGATGRVYLSGTEADVRQAADAARDALAVLQGA"
FT   gene            complement(307518..309101)
FT                   /locus_tag="MSMEG_0276"
FT   CDS_pept        complement(307518..309101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0276"
FT                   /product="aldehyde-alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /EC_number="1.2.1.10"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74973"
FT                   /db_xref="GOA:A0QP53"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP53"
FT                   /protein_id="ABK74973.1"
FT                   /translation="MSEVIQDRRSAVDTARAGHMLERARWAAAAYGEYDAATVEGIVAA
FT                   VAEAAHAHAERFAADAVAETGMGVVADKVRKNRACSRGIVEYYRGHDYISPRVDPDRKI
FT                   VELPRPAGVVLALTPTTNPVATVYFKTILALMTRNAVVVAPHPRAARCSAEAARVLAEA
FT                   AVAAGAPDGVVQVIDEPSIPLVQALMADERTDVIVATGGTAVVRAAYSSGNPALGVGPG
FT                   NVPVLVDASADVAAAAQRIVDSKAFDNSVLCTNESVLIAEDAVADKLRAALTRAGAHIL
FT                   DEDGARRLRAYMFADGHLNTDVVGRDAAWIAGQAGLRVTPKTRVLIAPFDHVIAEEMLA
FT                   HEKLSPVLGMTTVADAARGIRAARAVVRIGGAGHSAAIHSENPAVITDFAAQVPVLRVS
FT                   VNVGNSTGSAGLDTNLAPSMTIGTGFVGRSSIGENLQPHNLVNWTRIAYNSDPGVVMGN
FT                   FTGIDPWRAPAGPVPAYPRASNDRDGAVIQAAPQRSYQSPSRTTDVNLDALRAELRALV
FT                   VEELAQLIKR"
FT   gene            complement(309098..310378)
FT                   /locus_tag="MSMEG_0277"
FT   CDS_pept        complement(309098..310378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0277"
FT                   /product="putative aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="identified by match to protein family HMM PF00202"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72673"
FT                   /db_xref="GOA:A0QP54"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP54"
FT                   /protein_id="ABK72673.1"
FT                   /translation="MYDYGTFAFASKADVLDQAKAFWNPDKTQFWTDSGVDLVIDRREG
FT                   YFLWDMSGRRLIDLHLNGGTYNIGHRNPEVMQAISEGMAHFDVGNHHFPSVARTALAKR
FT                   LVETAPASIKKVAFGSGGGEAIDIALKSARHGTQRRKIVSVIKAYHGHTGLAVATGDDR
FT                   FAKLFLADRPDEFIQVPFGDIGAMEAALAGGDVAAVIMETIPATYGFPLPPPGYLEAVK
FT                   ALTERHGTLYIADEVQTGLMRTGELWGITKHGIDPDIIVTGKGLSGGMYPISAVLLGER
FT                   AARWLDQDGFGHISTFGGAELGCVAAIKTLEICTRPEVRSMVHYIADIFDTGLRRIQAD
FT                   YPDWFVGIRQNGVVIGLEFDHPEGAKFVMRELYENGVWAIFSTLDPRVLQFKPGLLLSR
FT                   ELCEDVLDRLEVAVGRARATVTGRRNG"
FT   gene            310563..312098
FT                   /locus_tag="MSMEG_0279"
FT   CDS_pept        310563..312098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0279"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72790"
FT                   /db_xref="GOA:A0QP55"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP55"
FT                   /protein_id="ABK72790.1"
FT                   /translation="MTEQSVAGSENAAHDIQRLKRNAVGTVGVIFMAVATAAPITAMVG
FT                   NVPIAVGFGNGSHAPAGYFVATVVLGLFAIGYATMAKHITATGAFYGYISHGLGRIVGM
FT                   AAGGLITMAYVVFEASLIGIFSFFFQNFLDSQLGIHIHWIIPALLMLATNAILTYFDVN
FT                   LTAKVLGVFLVTEIVMLALGAVAVLFRGGGPDGFAVNEILNPAGAFSPATGIVGASAGL
FT                   GLFFAFWSWVGFESTAMYGEESRNPKRIIPRATMIAVLGVGVFYVFISWMAIAGTGPQQ
FT                   SIELAQDANTASEIFFAPVRDTYGEWAITVFNILLVTGSFACGMAFHNCASRYLYALGR
FT                   EGLSRGLQKTLGATHPTHGSPYIASFVQSAIALVIVLSFLFAGMDPYVHMYTLLAILGT
FT                   MAILIVQSLCAFSVISYFHIHKNHPESKHWFKTLVAPGLGGLGMLYVVYLLWEHKDTAA
FT                   GTASGTLLFKLTPWIVVSVFVLGAALATYFKLRDPRRYGLIGRIVYDEAVERD"
FT   gene            complement(312095..312322)
FT                   /locus_tag="MSMEG_0278"
FT   CDS_pept        complement(312095..312322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0278"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75222"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP56"
FT                   /protein_id="ABK75222.1"
FT                   /translation="MRPCAGEQIPVGIGQRRGAQTAAHDRIGEPLTKLPDRHAERDPDV
FT                   VLAWTPEGSPREDEPHDVTVVGIHRPSLSV"
FT   gene            complement(312359..313258)
FT                   /locus_tag="MSMEG_0280"
FT   CDS_pept        complement(312359..313258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0280"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="identified by match to protein family HMM PF07859"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75813"
FT                   /db_xref="GOA:A0QP57"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP57"
FT                   /protein_id="ABK75813.1"
FT                   /translation="MTATTPTRFHPDLERVARYIPRHMVNRATLPVFQRLTRLMGRRVP
FT                   PGCEVLTLPSGVGIRLFRPPASTTLPGPALVWIHGGGYVLGSAAQDDAQCLQFARQAGV
FT                   TVASVEYRLAPQNPYPAGLEDCFAALRWLTALPSVDPARVAIGGASAGGGLAASLALLA
FT                   RDRGIDVAAQLLVYPMLDDRSSFVPSLDHPGQRLWNQGSNRFGWKAYLGDADPDVAVPA
FT                   RREDLSGLPPAWVGVGTLDLFHDEDLAYAGRLHAAGVPCEIDVVHGAFHGFDGVAPKAA
FT                   VSRAFRNAQCAFLKRALT"
FT   gene            313349..314920
FT                   /locus_tag="MSMEG_0281"
FT   CDS_pept        313349..314920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0281"
FT                   /product="choline dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00732;
FT                   match to protein family HMM PF05199"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75735"
FT                   /db_xref="GOA:A0QP58"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP58"
FT                   /protein_id="ABK75735.1"
FT                   /translation="MNVEINQRYDFIVCGSGSSGSVVARRLAENPDADVLLLEAGGSDD
FT                   VPEVQQAVQWPENLGSPRDWQFEAQANPHLNGRAIPMNMGKVLGGGSSINVMMWSRGHR
FT                   NDWDFFAAEADDEGWGYEAVLDIYRRIEDWQGKPDPQYRGTDGNVYVQPAPDPNPIADA
FT                   AVAAAASVGIPAFDHPNGAMMEGAGGAALSDIRVRDGIRQSVFRSYVHPYLGRPNLTVL
FT                   TGAVVTRVTLDGHRASGVEFVRDGVTFRVAAGSEVVLGLGAINTPKVLMLSGIGDSAEL
FT                   ARHGIKTVVHLPGVGRNLQDHPAFGCVWEYDVALEPRNTGSEATYFAKSDSRLDTPDLQ
FT                   TCQIEAPFASAETIARFGLPQAAWTMFAGIVRPESRGSVRLTGCSPDDPVRIDANMLSD
FT                   PADMTAAMIAVELCREIGNAAPLSAHAKREVMPGNLKGRDLERFIRDAAVSYWHQSGTA
FT                   KMGRDEMSVVDGNLRVHGIERLRIADASIMPRITTGNTMAPCVVIGERAAQLIRDTYAA
FT                   QEPAHE"
FT   gene            314913..315233
FT                   /locus_tag="MSMEG_0282"
FT   CDS_pept        314913..315233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07110;
FT                   match to protein family HMM TIGR02118"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73690"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP59"
FT                   /protein_id="ABK73690.1"
FT                   /translation="MSETKITVIYDNPTDPAAFEAAYPTEQLEAARRIPGYLRLEASKV
FT                   WPKEDGSPTPAYRCLDLYYPDYATACEAVTTPEAGAFFEAMGRLATGGVRVLMSDVEVP
FT                   AV"
FT   gene            315285..316055
FT                   /locus_tag="MSMEG_0283"
FT   CDS_pept        315285..316055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0283"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73151"
FT                   /db_xref="GOA:A0QP60"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP60"
FT                   /protein_id="ABK73151.1"
FT                   /translation="MSNQRPLEGRRALVTGGTKGAGAAVVRTLRASGAHVTAVARRPGG
FT                   DADEFVAADVMSEAGIAEIATHVRATGGVHILVHVAGGSSSPAGGFAALSEQDWIDELN
FT                   LNLLSAVRLDRAVAPMMIEAGGGVIVHISSIQSRMPLYDGTLGYAAAKAALRTYSKGLA
FT                   NELAPKGIRVNTVSPGFIRTTAAEALIERIAEAGNGTREQALDSLMASLGGIPLGRPAE
FT                   PDEVAGVVGFLVSDAAASVVGADIVVDGGTVPAI"
FT   gene            complement(316060..316854)
FT                   /locus_tag="MSMEG_0284"
FT   CDS_pept        complement(316060..316854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0284"
FT                   /product="ribosyldihydronicotinamide dehydrogenase
FT                   (quinone)"
FT                   /EC_number="1.10.99.2"
FT                   /note="identified by match to protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70726"
FT                   /db_xref="GOA:A0QP61"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP61"
FT                   /protein_id="ABK70726.1"
FT                   /translation="MTLTHTPEPGTALWLYAHPLRGSLNDHLFQAGTEALSEQYTVLTS
FT                   DLHAQRFDPVLGDRDFGGRTGSIVQITADAYRRGEHAADVREEQAKLAAAELLVIQFPL
FT                   WWYGPPAILKGWFDRVLTNEFAYGDVDSVLGIPRRYGDGQLAGRRALVIVTVGEDARSL
FT                   GTRGISGDIDSLLFPLTHGTLWYTGVGSFDLHVIYDADSLGSEGLQQETERLRDRLKAI
FT                   DSEPADRFRRLADGDYHGTRALREDIHPGRTDLGIHLSEALG"
FT   gene            complement(316851..317453)
FT                   /locus_tag="MSMEG_0285"
FT   CDS_pept        complement(316851..317453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0285"
FT                   /product="transcriptional regulator TetR family protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71191"
FT                   /db_xref="GOA:A0QP62"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP62"
FT                   /protein_id="ABK71191.1"
FT                   /translation="MSKQERRTQLLEVARELIREAGTEDFTLGRLADRAGVTKPVVYDH
FT                   FGDKSGALAELYREFEARRRETLAAALEEAADDLDAVAHAVAEAYIDCCAAEGRELSGV
FT                   VAALEGSPTLSLLRQEADDAYLDVCGRALFPSSVPARSAGLRAIIGAGDALFRDVLADR
FT                   ITPTDACETLARVVAAVAASATPGSRPESPAPDRRSR"
FT   gene            complement(317634..318320)
FT                   /locus_tag="MSMEG_0286"
FT   CDS_pept        complement(317634..318320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0286"
FT                   /product="GntR-family protein transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71748"
FT                   /db_xref="GOA:A0QP63"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP63"
FT                   /protein_id="ABK71748.1"
FT                   /translation="MTLAHTIRTALDVTLAGLQEGDPVPAERELAARFGVARETVRQAL
FT                   HELLVAGRIERRGRGTVVARPKLVHALSLQSYTEGAQTVGRTPGRMLVTREIIEASTEL
FT                   ASGLDIATGAPVLHLERVLLADDQRIGLESTYLAAARFGRFEHDFDPATSLYAAIRATG
FT                   VEFASATERIETALPTPREATLLECTTALPMLLLNRCSVDTDGVAIEVVRALYRGDRVA
FT                   FETVLT"
FT   gene            complement(318317..318844)
FT                   /locus_tag="MSMEG_0287"
FT   CDS_pept        complement(318317..318844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0287"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABK76226"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP64"
FT                   /protein_id="ABK76226.1"
FT                   /translation="MHALNEVDRILRSLQGIWDEEAVDELEHALQAAARAQEDGADDEL
FT                   VLAAALHDVAHSPLLGGPHVPGHERIARDWLTERFGERVGWLAGAHVAAKRYLAATDRE
FT                   YRLSETSLTSLHHQGGPGVDADTVAHPWFPDAVRLRRYDDAAKDPRAQGLTVEQVLAIA
FT                   SRVAARVTGTDR"
FT   gene            318960..320069
FT                   /locus_tag="MSMEG_0288"
FT   CDS_pept        318960..320069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0288"
FT                   /product="FAD dependent oxidoreductase, putative"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74046"
FT                   /db_xref="GOA:A0QP65"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017741"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP65"
FT                   /protein_id="ABK74046.1"
FT                   /translation="MTIIGGGILGTAHAVEAVRRGHRVVHLEREAEARGATVRNFGLVW
FT                   ISGRSTAELDATLRSRELWEKLAVDVPGIGFRPAGSITLVRTPAELAVAQEAATRSDAG
FT                   HRGFTLLEPDEVRELNPALRGRFLGGLHCALDAAVESRQALPAIREHLTASGRYEFVAG
FT                   VEARGVENRTVRDDRGNRHESDIVLVCAGAAHGGLVRDLAGELPVRRVRLQMMQTEPLG
FT                   ERLTTAIADADSFRYYPGFAGPALNTLRDNQPQHRVADGQHMQLLCVQRLHGGLTIGDT
FT                   HEYTEPFGFDVHEEPYTYLLDVVEEFLGRKLPPIRQRWAGVYSQCLDPEQLVCRTAPED
FT                   DIWVITGPGGRGMTLGPAIAEQTADMIGL"
FT   gene            320261..321361
FT                   /locus_tag="MSMEG_0289"
FT   CDS_pept        320261..321361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0289"
FT                   /product="alpha/beta hydrolase fold family protein"
FT                   /note="identified by match to protein family HMM PF07859"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70226"
FT                   /db_xref="GOA:A0QP66"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP66"
FT                   /protein_id="ABK70226.1"
FT                   /translation="MIGKHFEPLGSMTAMSIWGLRHLPDFVAASAKSRLAPGAAAMRRE
FT                   EREQTTAAAVAALRNVVPPAELAAEWPAPQNLPPLWNVLEHRRSVYRTSVRYGDDPAQL
FT                   LDVWRPKELPAQPAPVLLFVPGGAWVHGSRVLQGYALMSHLAQQGWVCLSVDYRVSPHH
FT                   RWPRHIHDVKAAIAWARANVDKFGGDRHFIAIAGCSAGGHLAALAGLTPNHPELQGDLP
FT                   DGADTSVDAVVGIYGRYDWEDRSTVERERFVDFLERVVVKRSIERHPEIFRLASPIAQV
FT                   HADAPPFLVVHGSADTVIPVAQARSFVDRLGAASRAPVSYLELPGAGHGFDMTDGARTG
FT                   AMATAIGLFLKEIHRNRTRNTAKAVI"
FT   gene            321386..322804
FT                   /locus_tag="MSMEG_0290"
FT   CDS_pept        321386..322804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0290"
FT                   /product="acyltransferase, ws/dgat/mgat subfamily protein"
FT                   /note="identified by match to protein family HMM PF03007;
FT                   match to protein family HMM TIGR02946"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70404"
FT                   /db_xref="GOA:A0QP67"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP67"
FT                   /protein_id="ABK70404.1"
FT                   /translation="MQRLSGWDAFLLYSETPNVHMHTLKIAIIDLEGIGDRTFGVEDFR
FT                   KVLRGRLHKLDPFRFQLVDIPFKFHHPMWRENCDVDLEYHVRPWQVRAPGGRRELDEAI
FT                   GEIAGTPLDRSRPLWEMYFVEGLAGGRIAVVNKIHHALADGIASANLLARGMDLREGPQ
FT                   RDRDSYVTDPEPSKGELVRTAFADHMRQIGRIPATIRYTAQGVARVRRSSRKLSPELTR
FT                   PFTPPPSFINHMITSKRKFATATIALADAKETSKKLGITLNDLVLAMSSGALRTLQLRY
FT                   DGRADHPLLASVPMSFDFSPDRIWGNRFSGVLVALPVDVADTGERVRRTREAANLAKES
FT                   HQLIGPELVARWAAYMPPVPVEALFKRLSSKDGQNKVLNLNISNVPGPRERGKVGGATV
FT                   TELYSVGPITAGSGLNITVWSYVDQLNISVISDDATVDDPHEVTDAMLDEFREIRRTAG
FT                   LSEKLTVVETAMPQ"
FT   gene            complement(322807..323652)
FT                   /locus_tag="MSMEG_0291"
FT   CDS_pept        complement(322807..323652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0291"
FT                   /product="dioxygenase, TauD/TfdA family protein"
FT                   /note="identified by match to protein family HMM PF02668"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75785"
FT                   /db_xref="GOA:A0QP68"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP68"
FT                   /protein_id="ABK75785.1"
FT                   /translation="MSVLTINKLTASVGAEVVGIDSERLATDDGIAAAVLDALEDNGVL
FT                   VFRGLYLEPEAQVAFSQRLGEVDRSADGHHPVSGIYPITLDQTKNKAAEYLKATFDWHI
FT                   DGCTPLNDECPQKATVLSAIEVAARGGETEFANAYAAYESLDADEKQRYARLRVVHSLE
FT                   ASQRRVYPDPTAEQRRRWAARPTHENPLVWTHRNGRKSLVLGASADHIVGMDRDEGRAL
FT                   LDGLLARTTTPDKVYSHKWSVGDTVIWDNQGVLHRAAPYEPDSPRHMLRTTVLGDEPIR
FT                   "
FT   gene            complement(323681..324010)
FT                   /locus_tag="MSMEG_0292"
FT   CDS_pept        complement(323681..324010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0292"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74227"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP69"
FT                   /protein_id="ABK74227.1"
FT                   /translation="MARLPSAFAELEPYAETWCLATETARWERRVSSSMPQLHDFYDAF
FT                   FPRLEEAIEYCDKYPLDDMPDDAVNLLHLIYSLIMVAMAVEIMHQPAPVDAADAVMVRT
FT                   GEPTP"
FT   gene            complement(324012..325277)
FT                   /locus_tag="MSMEG_0293"
FT   CDS_pept        complement(324012..325277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0293"
FT                   /product="Rieske [2Fe-2S] domain protein"
FT                   /note="identified by match to protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71342"
FT                   /db_xref="GOA:A0QP70"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP70"
FT                   /protein_id="ABK71342.1"
FT                   /translation="MATKWPKPAEGSWTEHYPELGTGPISFRDSTSREFYALEREAIFK
FT                   RAWLNISRVEETPDAGSYITRRVEAADASLLLVKGADGRIRAFHNVCRRRGHTVAAPDF
FT                   RATELRNTGTEFACGHCGWRYGLDGSLIAAPDADRFTGFDATELGLAEVHCDVWAGFVF
FT                   VNFDTTPRQSLREFLGPMVTGLDDYPFEKLTERYDWVAHNNSNWKIFADAFQEYYHVPS
FT                   LHTQQVPPEVRDPNAGFTCGHFQIDGPHRLVSTAGTRRWLLAPEYMYPIERATQSGLVG
FT                   PWRTPDIGKLPTGLNPGGIEPWGISNFQIFPNIEILIYGGWYLLYRYWPTSHNTHRYEA
FT                   FTYFHPARTVRERIEHEVAAVVLKEFALQDAGMLGGTQAALEYDVIDDYPLNDQEILVR
FT                   HLHKVAVDWVEAYQREPAPAGV"
FT   gene            complement(325317..326060)
FT                   /gene="fabG"
FT                   /locus_tag="MSMEG_0294"
FT   CDS_pept        complement(325317..326060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="MSMEG_0294"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01073; match to protein
FT                   family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABK76070"
FT                   /db_xref="GOA:A0QP71"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP71"
FT                   /protein_id="ABK76070.1"
FT                   /translation="MNRVAVVTGGASGMGEATCHELGRRGHKVAVLDVDVDAAQRVTDH
FT                   LRSEGVTAFAVGADVTDRAAVEEAFAKVRSELGAVGILVTSAGMFGYASFADITEQSWA
FT                   QMIDVNLSGTFRCCQVALPDMVDAGWGRIVLISSSSAQRGTPFAAHYAASKGALLTLTK
FT                   SLAREYAKHGITVNNIPPSGIETPMQHASQAAGYLPPNETIAANIPLGRLGAPADIAAA
FT                   VGFLCSEEAGFITGQTLGVNGGSVM"
FT   gene            complement(326057..327133)
FT                   /locus_tag="MSMEG_0295"
FT   CDS_pept        complement(326057..327133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0295"
FT                   /product="oxidoreductase, FAD-binding"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM PF00175; match to protein
FT                   family HMM PF00970"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74307"
FT                   /db_xref="GOA:A0QP72"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP72"
FT                   /protein_id="ABK74307.1"
FT                   /translation="MAAMETSTAPLDEPAGLTDADGFTPLRVKDVIRETTDAVSLILDV
FT                   PELIEDRFRYTAGQFVTVKTTIRGEEHRRCYSMSSSPHVGPDLRITVKRDRDGVVSNWI
FT                   NDTAAAGDRLLTAPPDGRFVLTTADRDVVTFAGGSGVTPVFSLVNTTLATTGRRVRMFY
FT                   ANRDADSVIFRDALTRLTDSHSDRLHVHHHLDTRDGVVSARHITEFLGASTVSTAEADF
FT                   YICGPAPFMDTVERVLLDAGVPAQRVHLERFTVTPADPAVEAESAATEEVTIVLGRTTV
FT                   TQPYRAGTTLLQTARLAGLKAPSSCEVGTCGTCIGQVVEGSARLLNNDALDDDEIAEGW
FT                   VVTCQALPTSHTVKVVYE"
FT   gene            complement(327192..327647)
FT                   /locus_tag="MSMEG_0296"
FT   CDS_pept        complement(327192..327647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0296"
FT                   /product="transcriptional regulator, MarR family protein"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70361"
FT                   /db_xref="GOA:A0QP73"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP73"
FT                   /protein_id="ABK70361.1"
FT                   /translation="MELTDNTLWWLKQAFYFSLTAVNDAVKDHGVSTAQIGVLRQLSNE
FT                   PGLSGAELARRLLITPQGVQLALTALEKRGLVERKQDPQHARILQVFLTEEGRAVASSV
FT                   VSDAIAAHDRVFGVLSRDEQEQLRDLLRRVIEQGTGHTVQADHVDPM"
FT   gene            complement(327678..328937)
FT                   /locus_tag="MSMEG_0297"
FT   CDS_pept        complement(327678..328937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0297"
FT                   /product="amidohydrolase"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABK76071"
FT                   /db_xref="GOA:A0QP74"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP74"
FT                   /protein_id="ABK76071.1"
FT                   /translation="MTQTVLRAARWVDVAAGVVRAPAVVVIEGNRITEVNPAAPLPDTA
FT                   AVIDLGDVTLLPGLMDMELNLLIGGPEGLPSPMHGVQDDPAYRTLRGAVNARTTVQAGF
FT                   TTVRNLGLMVKTGGYLLDVALQRAIDQGWHQGPRIHPAGHAVTPYGGHLDPTVFQRLAP
FT                   GIMPLSVAEGIANGVPDVIACVRYQIRHGARLIKVSASGGVMSHSTAPGAQQYGDAELA
FT                   AIADEAHRAGVKVAAHAVGDTAIQACIRAGIDCIEHGFLATDETIQMMVDHGTFLVSTT
FT                   YLTDAMAIDRIAPELRKKALDVFPRAKAMLPKAIAAGVRIACGTDAPAIPHGQNAKELC
FT                   ALVERGMTPMQALQAATVVAAELVDASDELGRLAPGYLADVVAVPGDPSTDISAILDVS
FT                   FVMKDGAVVKHREPSDAAVR"
FT   gene            complement(328934..329275)
FT                   /locus_tag="MSMEG_0298"
FT   CDS_pept        complement(328934..329275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0298"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74458"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP75"
FT                   /protein_id="ABK74458.1"
FT                   /translation="MPDKVPNKLPPEFADLEPFSGWCLGSEPERYAKRLASTMTEIQAF
FT                   YDAITPRAEEAISYCDKFPLDDLPEDVLNLLHLLYSMVTVSFPVECWKQPRVPDSGATW
FT                   LDCVAEPVP"
FT   gene            complement(329279..330544)
FT                   /locus_tag="MSMEG_0299"
FT   CDS_pept        complement(329279..330544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0299"
FT                   /product="Rieske [2Fe-2S] domain protein"
FT                   /note="identified by match to protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73660"
FT                   /db_xref="GOA:A0QP76"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP76"
FT                   /protein_id="ABK73660.1"
FT                   /translation="MARFPKPAEGSWTQHYPELGTGPVSYEDSISPEIYELERQAIFKR
FT                   AWLNVGRVELLPRKGSYFTKELKAANTSIIVVRNKSGKINAFHNVCRHRGNKLVWDDLP
FT                   QQETSGVCRQFTCKYHAWRYDLDGDLTFVQQEEEFFDLDKSRYGLVPVHCQVWEGFIFV
FT                   NFAQEPEQSLRDFLGPMITNLEGYPFDKLTSRFTYRSEVKANWKLYMDAFQEFYHAPVL
FT                   HANQSPTAYSRAAAEAGFEAPHYRIEGPHRLVSTSGVRAWEMPDEMRKPIEDICQSGLF
FT                   GPWDKPDLGEMPVGLNPAKCDPWGLDSFQLFPNFVMLFWGQGWYLTYHYWPTSYNTHTF
FT                   ECTLYFPQARTPRERLAQELAAASFKEYGLQDANTLEATQSMIETRVVEEFLLCDQEIL
FT                   LRHLHSETAAWIEDYQRKTAGV"
FT   gene            330792..331799
FT                   /locus_tag="MSMEG_0300"
FT   CDS_pept        330792..331799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0300"
FT                   /product="amidohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF04909"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70765"
FT                   /db_xref="GOA:A0QP77"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP77"
FT                   /protein_id="ABK70765.1"
FT                   /translation="MTIHTSQRTPAAERIAVRCVDSDVHPVPRRGVLGEYIPEPWRSSY
FT                   FGTHDVGELIYYDAPDYAHAYAMRVDTFPSDGEFAGSDPDLAFRQLIMEAGADIAILEP
FT                   AAYSAHIPEANHAMNCALNDWQANHWLDSHNNWHERWRGSICLAVEAPELAAQEIERWA
FT                   GHPYFAQCLIKAEPRPSWGDPKYDPLWAAATKHDIVVSCHLSRGEYDELPTPPVGLPSY
FT                   NHDFMDAIYERRKSWMDIKRKPSEYVKDHIKFTTQPLDYPEDKTELSRAFEWMECEKIL
FT                   LFSSDYPHWTFDDPRWLVKHLPEHAREAVMFRNGIETYKLPDTVPVLEGQVRVF"
FT   gene            complement(331803..333170)
FT                   /locus_tag="MSMEG_0301"
FT   CDS_pept        complement(331803..333170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0301"
FT                   /product="oxidoreductase, FAD-binding"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02913"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75134"
FT                   /db_xref="GOA:A0QP78"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP78"
FT                   /protein_id="ABK75134.1"
FT                   /translation="MDPALAELAADLPAHALLTDPDQIEGYRRDAAADPLAGRPRAVVR
FT                   ATCTADVQSVMRWATRHRVAVVPRGAGSGLSGGASAVDGCVVLSTERMRAIRIDPATRV
FT                   AVVQPGALNAEVKQAAAEHSLWYPPDPASVDISSIGGNAATNAGGLCCVKYGVTTDYVL
FT                   GMQVVLADGTAVTLGGPRLKDVAGLSLTKLFVGSEGILGVITEVTLRLIPAQASPSTVV
FT                   AMFDTVQDAANAVVAITASVRPAMLELMDHASINAVEDYGRMGLDRSAQALLLVQSDAP
FT                   GDAASEVAHIVEACEKSGASEVFATDDPAEGAGFTAARRLVAPALMQLGTVLLEDVTVP
FT                   IPTLPALLAGINRISAECDVLICVVAHAGDGNTHPVVVFDPDDAESQARAERAFSEVMD
FT                   LAIAMGGTITGEHGVGRLKRDWLPKQLGDDVMWVTRRVKDALDPLGILNPGAVLRP"
FT   gene            333272..334264
FT                   /locus_tag="MSMEG_0303"
FT   CDS_pept        333272..334264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0303"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75841"
FT                   /db_xref="GOA:A0QP79"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP79"
FT                   /protein_id="ABK75841.1"
FT                   /translation="MDGIGRNLLQLREVAIPEPAHGEILVRVSAVALNHRDKMVTENGR
FT                   GLQLTYPFTPGSDLAGTVVALGDGVQRFAVGDRVISNFVPEWLDGVRPGDARTLPYRTL
FT                   GGHHPGVLAEYVAFPEDWFVRAPWSLGDAEAATLPCSGLTAWFALVERGRVRAGETVLV
FT                   EGTGGVALFALAIAKIHGAEVIVSASATNLARARELGADHVIDRRREDWTDAVLTLTAD
FT                   RGVDHVLEIVGGSHLAEAVQVSAIGGQIHQIGALEGFEISTPVMPLMLKGITVNGIGTG
FT                   HRRALEDMVRAVDAAGLKPVIDTRYRFEDLHAALDHLDRGPFGKLVLET"
FT   gene            complement(334261..335472)
FT                   /locus_tag="MSMEG_0302"
FT   CDS_pept        complement(334261..335472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0302"
FT                   /product="peptidase, S9A/B/C families"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF00326;
FT                   match to protein family HMM PF07859"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70602"
FT                   /db_xref="GOA:A0QP80"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP80"
FT                   /protein_id="ABK70602.1"
FT                   /translation="MAKPLLTASAEVLNAVNAVKPFGRKGYSTVVAFAFGWPTSENGPL
FT                   ITTVSALDALRRAVRGDYRTTPGRISLLLKAVAWALLYIVHRRNRTSRRFFEEPLRSAL
FT                   GADYAVARRARRPGGVIRTSWARHRYATTTVRYGPHRANLADIWMRPDLPRDGKAPVLL
FT                   QVPGGAWMIGMRRPQSYPLMSHLAEQGWICVSIGYRISPKHSWPDHIVDVKQALAWVKA
FT                   NIADFGGDPESVCITGGSAGGHLTALAALTPNDPKWQPGFEDADTSVVAAVPVYGRYDW
FT                   YSTTGPGRTEFMEILERLIVKRPLDGNAELYRDASPIMLVRPDAPPFFVLHGTNDSLIP
FT                   VVEGRDFVAALREVSNSPVVYAEIPHAQHAFDFFGSPHGHFTADAVEKFLNWVLAKRGV
FT                   AQNR"
FT   gene            complement(335465..337096)
FT                   /locus_tag="MSMEG_0304"
FT   CDS_pept        complement(335465..337096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0304"
FT                   /product="acyl-CoA synthase"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72259"
FT                   /db_xref="GOA:A0QP81"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP81"
FT                   /protein_id="ABK72259.1"
FT                   /translation="MGLLDRITDPLIDTVGMVTTMRRAGLIAPLRPDKYLRIVAAMARE
FT                   NMSVTSGFASAAQRCPDRPGLVDELGTLTWREIDQQADALAAGLQALSGGAPRVLGIMA
FT                   RNHRGFVLSLIAANRIGADVLLLNTSFSGPALAEVVSREKVDAVIYDEEFTDTVDRALA
FT                   GAPEAPTRIVAWTDTAAHDVTVAALTEKFAGRQPQRGGQKSKVILLTSGTTGTPKGAKH
FT                   SGGGPEILKAILDRTPWRAEEPVVIVAPMFHAWGFSQLAFAASMACTIITRRKFDPEAT
FT                   LELVDRHRATGLCVVPVMFDRIMELPEDVLNRYDGRSLRFAAASGSRMRPDVVIAFMDR
FT                   FGDVIYNNYNATEAGMIATATPADLRAAPDTAGRPAEGTEIRILDGDLRDLPTGEVGTI
FT                   YVRNSTQFDGYTSGTTKDFHEGFMCSGDVGRLDDAGRLFVVGRDDEMIVSGGENVYPIE
FT                   VEKVLTTHPAVAEAAVIGVDDEQFGQRLAAFVVLSGDATVDDLKSHVRDNLANYKVPRD
FT                   ITILDELPRNSTGKIARRELQEKVNG"
FT   gene            complement(337102..337911)
FT                   /locus_tag="MSMEG_0305"
FT   CDS_pept        complement(337102..337911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0305"
FT                   /product="acyltransferase domain protein"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72003"
FT                   /db_xref="GOA:A0QP82"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016676"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP82"
FT                   /protein_id="ABK72003.1"
FT                   /translation="MAATDTDPGEITKWDPGLTEKVMGWLRPLIKGYHRAEVHGLDTFP
FT                   NGGALVVSNHSGGLFPMDVPVFATGFYEKFGYDRPVYTLSHDMLMTGPTADFFKKTGFI
FT                   RANHENADEALRSGGVVVVFPGGDYDVYRPTLAANKIDFAGRTGYVRAALNAGVPIVPM
FT                   VGVGGQETQLFLSRGTAVAKALGPIARLARTKIVPVSFGFPFGLSAVLPLNVPLPSKIV
FT                   MKTLPPIDITAEFGEDPDIDEVDAHVRHVMQQALDELAEQRRFPVIG"
FT   gene            337990..338826
FT                   /locus_tag="MSMEG_0306"
FT   CDS_pept        337990..338826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0306"
FT                   /product="arylamine N-acetyltransferase"
FT                   /EC_number="2.3.1.5"
FT                   /note="identified by match to protein family HMM PF00797"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72783"
FT                   /db_xref="GOA:A0QP83"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP83"
FT                   /protein_id="ABK72783.1"
FT                   /translation="MAGMAMDLSGYLARIGLDGRPRPDLGTLHAIVAAHNRSIPFENLD
FT                   PLLGIPVADLSAEALSAKLVDRRRGGYCYEHNGLLGYVLEELGFDVERLSGRVVWMRAD
FT                   DAPLPAQTHNVLSVAVPGADGRYLVDVGFGGQTLTSPIRLEAGPVQQTRHEPYRLTRRG
FT                   DHHTLAAQIRGEWQPLYTFTTEPRPRIDLEVGSWYVSTHPGSHFVTGLTVAVVTDDARY
FT                   NLRGRNLAVHRSGATERIRFDSAAQVLDAIVNRFGIDLGDLAGRDVQARVAEVLDT"
FT   gene            338897..339805
FT                   /locus_tag="MSMEG_0307"
FT   CDS_pept        338897..339805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0307"
FT                   /product="transcriptional regulator, AraC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70153"
FT                   /db_xref="GOA:A0QP84"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP84"
FT                   /protein_id="ABK70153.1"
FT                   /translation="MEPNGRDRLRELLDAVVDSENDGVGDMARNSYASEFHFSREVRRL
FT                   TGEPPAALRRRIMLERAAWRLRQGAGVAEVAAAEGWSSPEVFSRAFRRAFGVPPSRATD
FT                   VGFRLPAPNGVHFHPPRSLWCDGRAGGGGPDIAQFMLVHDIADTAYLIEQAYALTENQW
FT                   RQEVSPGQTVLDWDGPEPSVAAVLAAIVWTKEVWLATIEGRDFPSRDTTCNASPRELAV
FT                   HHDTVGNRWTTVISEYSTAGRLGDTVIDALCDPPESFQLYGIVAHVLTYSAHRRGLARA
FT                   MLSRHGIDTHRGDPLEWMRRD"
FT   gene            339809..340336
FT                   /locus_tag="MSMEG_0308"
FT   CDS_pept        339809..340336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0308"
FT                   /product="dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75430"
FT                   /db_xref="GOA:A0QP85"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="PDB:2XW7"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP85"
FT                   /protein_id="ABK75430.1"
FT                   /translation="MKTVYYTASSLDGYIVDENQSLDWLTSRDITPDGPFGYEQFIETI
FT                   GVLVMGASTYEWVVEHGDWSYDQPAWVLTHRPEIAAESHPMQVFSGDVAELHPELVAAA
FT                   GGKDVWVVGGGDVAAQFVAADLIDEIIVSYAPCTLGVGSRVLPMRSEWVLDDCARNGDF
FT                   VCARWKRPVLHT"
FT   gene            complement(340411..341904)
FT                   /locus_tag="MSMEG_0309"
FT   CDS_pept        complement(340411..341904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0309"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71023"
FT                   /db_xref="GOA:A0QP86"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP86"
FT                   /protein_id="ABK71023.1"
FT                   /translation="MTAMTQTAPAATAATTNWDKLFIGGQWVEPSSSEIIEVFSPATGE
FT                   KVGQAPLATKADVDAACAAARKAFDEGPWPRMTPQEREAVLAKATALIEESADEFKTLL
FT                   KLETGQPQTIVDMMQYGAAMSTLQFYASAADKFAWKDIRDGIYGQTLVLKEPVGVVGAV
FT                   VAWNVPFFLAANKLGPALLAGCTIVLKPAAETPLTTNLMAQKFLEAGLPEGVLSVVPGG
FT                   PETGRALTDNPALDKFTFTGSSAVGKEIGKIAAEKLKPCTLELGGKSAAIILEDADLDS
FT                   TLPMLLFSGLMNSGQACVGQTRILAPRSRYDEVVEKVAAGVAAMQVGVPDDPAAMVGPL
FT                   ISEKQRERVEGYIKKGIEEGARLVTGGGRPEGLDSGWFVQPTVFADVDNSMTIAQEEIF
FT                   GPVLVVIPFEDEDDAVRIANDSVYGLAGSVYTTDHAKGVEIASKVRTGTYGINMYAFDP
FT                   GAPFGGYKNSGIGRECGPEGIAGYCESKSVLLPFGYTPE"
FT   gene            complement(341951..342714)
FT                   /pseudo
FT                   /locus_tag="MSMEG_0310"
FT                   /note="SAM-dependent methyltransferase; this gene contains
FT                   a frame shift which is not the result of sequencing error"
FT   gene            342748..343923
FT                   /locus_tag="MSMEG_0311"
FT   CDS_pept        342748..343923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0311"
FT                   /product="glycosyltransferase"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73284"
FT                   /db_xref="GOA:A0QP87"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP87"
FT                   /protein_id="ABK73284.1"
FT                   /translation="MSARPESAPHVRRVLLLCWRDTGHPQGGGSEAYVQRIGAYLAGRG
FT                   VDVTLRTARYPGSARTEVVDGVRISRGGGPYTVYIWAGLAMVLARIGLGPLRRARPDVV
FT                   IDTQNGLPFLARFAFGRRVAVLVHHCHRELWPVAGPVMGRIGWFVESWLSPRLHRRNQY
FT                   VTVSLPSARDLNELGVDSQRIAVVRNGLDEAPATTLKLPRSETPRLVVLSRLVPHKQIE
FT                   DALEAVAQLRTEMPDVHLDILGDGWWRERLVEHAELLGITDAVTFHGHVDEDTKHRVLQ
FT                   RSWVHVLPSRKEGWGLAVTEAAQHAVPTIGYRSSGGLTDSVVDGVTGLLVDDRDGLVAG
FT                   LRQLVSDPVLRTQLGSKAQTRSDEFSWAQSADAMRTVLESVRAGRYLSGLV"
FT   gene            complement(343930..344559)
FT                   /gene="eda"
FT                   /locus_tag="MSMEG_0312"
FT   CDS_pept        complement(343930..344559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="MSMEG_0312"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /EC_number="4.1.3.16"
FT                   /note="identified by similarity to SP:P10177; match to
FT                   protein family HMM PF01081; match to protein family HMM
FT                   TIGR01182"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75471"
FT                   /db_xref="GOA:A0QP88"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP88"
FT                   /protein_id="ABK75471.1"
FT                   /translation="MSLDSLLDLVPVIPVVVVHDAADAVPIAKALVEGGLPVIELTLRT
FT                   PAALDAIKRIADEVPEILVGAGTVVDSAQPEQAAANGAQFLVSPGSTPSLRAAMRDSGL
FT                   PHLPGVSTVSEVLTLLEEGYTELKFFPAEQAGGAKYLRAIHSPVPAARFCPTGGITPAN
FT                   MGDYLASPNVGCVGGSWLTPADVVGRKDWAEVARLARTAKAAAEAF"
FT   gene            complement(344556..346385)
FT                   /gene="edd"
FT                   /locus_tag="MSMEG_0313"
FT   CDS_pept        complement(344556..346385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="edd"
FT                   /locus_tag="MSMEG_0313"
FT                   /product="phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /note="identified by similarity to SP:P25530; match to
FT                   protein family HMM PF00920; match to protein family HMM
FT                   TIGR01196"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73106"
FT                   /db_xref="GOA:A0QP89"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP89"
FT                   /protein_id="ABK73106.1"
FT                   /translation="MSTVHPTVAEVTRRIVERSAATRGVYLERMAEQTHRGPARGRLAC
FT                   ANLAHGFAATEPADKEALRRIVKPNLAIVSSYNDMLSAHKPFEDYPAQLKAAALGAGAI
FT                   AQVAGGVPAMCDGITQGRAGMQLSLFSRDVIAMSTAIALSHDMFDAALLLGVCDKIVPG
FT                   MLIGALSFGHLPAIFVPAGPMTSGLPNGEKSRIRQMFAEGKVDREALLDAEAASYHGRG
FT                   TCTFYGTANSNQLLMEAMGLHLPGSSLVTPDTPLREALTAAAGARAAEVTALGDAYTPV
FT                   GAVVDERAVVNGAVALLATGGSTNHTMHLVAIARAAGIILTWNDIADLSAVVPLLARIY
FT                   PNGKADVNHFQAAGGMAFLVRSLLDAGLLRDDVATVAGPGLRRYTTEPYLDDGALRWRD
FT                   GVHASLDTDVLRGVDDPFAPDGGLKTLSGNLGTSVMKTSAVDPEHRTVTAPAVVFDSQE
FT                   AFLEAFGAGELDRDFVGVLRYQGPQALGMPELHKLTPALGVLQDRGFKVALVTDGRMSG
FT                   ASGKVPAAIHVTPEAAAGGPLSRVRNGDVITVDATVGTLSVDVAPADLDARSSTGQAPT
FT                   NDEWTGTGRELFATLRASVGPADEGATIFRSAV"
FT   gene            complement(346382..347869)
FT                   /gene="zwf"
FT                   /locus_tag="MSMEG_0314"
FT   CDS_pept        complement(346382..347869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="MSMEG_0314"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="identified by similarity to SP:P22992; match to
FT                   protein family HMM PF00479; match to protein family HMM
FT                   PF02781; match to protein family HMM TIGR00871"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72464"
FT                   /db_xref="GOA:A0QP90"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QP90"
FT                   /protein_id="ABK72464.1"
FT                   /translation="MNRTPSPVDPCDFVIFGGTGDLAARKLLPALYLRDRDGQLAGATR
FT                   IIGVAKAGLDDAGYRNTVRAGLARHVEPDLLDSDVVDRFLSRLRFVSVDLTEPSDYAAV
FT                   GDVLTSPDGGSGHDIRVFYLACAPALFGPICGALGAQGLVTESSRVVLEKPIGRDLASA
FT                   QQINEAVGAVFAEHQIFRIDHYLGKESVQQLLVTRFGNTWLEPLWNSSRIDHVQITAAE
FT                   SLGVGARGDYYDQSGALRDMLQNHLLQVLCLVAMEPPTHVNRESVRDEKRKVLEALEPL
FT                   TAEQTQRDTVTGQYGPGLVGDEVVGSYREEVADPHSRTETFVAVKAHIRNWRWAGVPFY
FT                   LRTGKRMSQRFSEIVVQFKPVPLPMFPGIEGTSEPNRLIISLQPDEAIRLEMTAKEPGS
FT                   GGRLRPVSLALNYTEAFPERSPDAYERLLMDVVRGDPTLFMRRDEVEAAWAWAEPILRH
FT                   WQDADRVPRTYPAGTDGPVDAATLIERDGRRWHGGAA"
FT   gene            348060..349247
FT                   /locus_tag="MSMEG_0316"
FT   CDS_pept        348060..349247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0316"
FT                   /product="putative NagC regulator"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69909"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP91"
FT                   /protein_id="ABK69909.1"
FT                   /translation="MEAMPPPATLVSPTPGEVFALIRDRRATTRGELGRLTGLSRTAVT
FT                   ARVAALEAGGLVIERDQASTGGRPAAQLMFNVDAGVVFSAAIGRSRTQLAVCNLDGTIL
FT                   ASTDIDQEPGIAPDDLLPDLVKRLDMLLDESARRDAHIFGVGLSLPGTVDQRTGASLDS
FT                   PNMSGWDGVPLAPYFTSLTDAPVVIDNDANAIAVAERRGGYGEYDDMLVVKASTGLAAG
FT                   IIMGGQLQRGAVQAAGEFGHSKTAAAAGVHCRCGDTGCLEAIAGGWALVRALQRDGRAV
FT                   NHLRDVVALAHTGDPEARRMIRESGRHIGEVLAAAVNLLNPAVLVIAGDMVGAYDLFVA
FT                   GLRETLYGNATALATRTLQIVPSIHRERSSMVGCATNVLDRVLSPDAVDAAMYGD"
FT   gene            complement(349207..350844)
FT                   /locus_tag="MSMEG_0315"
FT   CDS_pept        complement(349207..350844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0315"
FT                   /product="probable conserved transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75380"
FT                   /db_xref="GOA:A0QP92"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP92"
FT                   /protein_id="ABK75380.1"
FT                   /translation="MPAYALVLSVLVTAPLLAPGYLLLRDAVSTPRSYVTDAALGLTEA
FT                   APRALPQDFAVALASSVLDGGVVVKALLLAGLAAAGWGAARLVGHVLFDAGLAGRFTAA
FT                   TLAIWNPYVAERLLQGHWSLLVGYGCLPWVAVSVLRLRERASWTPVAPLVFWMALAGLT
FT                   PTGLVLAATVALVCVAAPGDGWRRARVAGLGLGVAVAAACPWLVAAFVSGAVSSSPDPG
FT                   AGVRAFAARAEPGLATLGSLAGLGGIWNGDAVPASRTSLFAVVATVVLLGVVAAGLPVV
FT                   ARRRAAVPLLVLAAGAVIMPALMASAPGLVVVEALIDAVPGLGIVRDGQKWVALAMPGY
FT                   ALAAGAAPMMLRRLRIPAAAAAAVCCAALIAVLPDLTWGVGNQMRAVRYPQSWAQVAAT
FT                   INADPRPVVALPADSIREFSWAGTVLDPLPRWLRADVLTTGDLLIGGRTVPGEGARARA
FT                   VQGLLRDGASPQQLAEAGVGWLVRETDSGITAQRIGGEAPSSPHRGLLIAAHLVWLAAL
FT                   AGGALGLVAGRVGRVLSRRTWRHRPRPG"
FT   gene            complement(350874..352070)
FT                   /locus_tag="MSMEG_0317"
FT   CDS_pept        complement(350874..352070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0317"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75558"
FT                   /db_xref="GOA:A0QP93"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP93"
FT                   /protein_id="ABK75558.1"
FT                   /translation="MNRAVALRIAACGLLGLGAALLIAALLLTTYTKGKIAKIPLDIDT
FT                   SLVSDGTATAFDPDSLVAERFKIDRDVPVALQQQMSVEAPSNADVVTFQVGTTLRRTDR
FT                   QQDAGLLLALVDTVTMNRNTAEAVSSENNPGGAVQKPRAIEDEKPPTNIALPHEGLTYR
FT                   FPFDTEKKTYPFFDPIAQKAFDANYDGEEDVNGLTTYRFVQNVGYDADGKLADPIKYSS
FT                   LYEDDADASVTARAEVWGVPGEPDESITMDRFYAASRTFWVDPVSGTIVKSEEHGYQYY
FT                   AREALKPEVTYVDFKVTTNEESVESQVAAASDERDRIALWTRILPITFTALGLVSLVGG
FT                   AVLGSFALRTESTLIDPGLDTADHGFFDTQGIQVPGAEAKTEKLPAQRPTDLPPDRPI"
FT   gene            352236..353429
FT                   /locus_tag="MSMEG_0319"
FT   CDS_pept        352236..353429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0319"
FT                   /product="acyltransferase"
FT                   /note="identified by match to protein family HMM PF01757"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75288"
FT                   /db_xref="GOA:A0QP94"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP94"
FT                   /protein_id="ABK75288.1"
FT                   /translation="MTTEQSAQAEHEVGGTRGFLPAVEGMRACAAMGVVLTHVAFQTGH
FT                   TGGISGRIFGRFDLAVAVFFALSGFLLWRGHAAAARGLRPRPRTGHYLRSRIVRIMPGY
FT                   VVAVIVILLLLPEAKADLTVWLANLTLTQIYVPLTLTAGLTQMWSLSVEVSFYLALPLL
FT                   ALLARRLPVRARIGVITAVAALSLLWVCIPFAGDTGHNPWNWPPAFFSWFAAGMVLAEL
FT                   TVSPYGRVHRLARRRVLMAAIAVVAFAIAASPLAGKEGLHPGSVGQVMLKTAMGAVVAG
FT                   ALLAPLVLDHPGTRHRILGSAVMVTLGRWSYGLFVWHLAALAMVFPMLGEFLFNGRMLV
FT                   VLILTLVFGFALAAVSYALVESPCREALRRWEYRHSRPVPPLDSSITEQPEPAPAAR"
FT   gene            complement(353392..354879)
FT                   /locus_tag="MSMEG_0318"
FT   CDS_pept        complement(353392..354879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0318"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71594"
FT                   /db_xref="GOA:A0QP95"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP95"
FT                   /protein_id="ABK71594.1"
FT                   /translation="MTDKGFDVPPIGTQVAHLAAADPDRPAVSCQGRTLSRGELDRSTN
FT                   RLARAYAELGVRQGDYVTICLHNSIEWVQATLATWKLGAVPQPLSPRMPDAEFEAILGL
FT                   KRRALVVGRDPGGDISWVPGDFEPGPGLADDPLPEAVSPTWKSIASGGSTGRPKLIEAG
FT                   GDGRVPALIGAPLGAEPDDVTLMSVPMSHNTGFTTFAIALLMGQHLVLMPRFEPAEFLR
FT                   LVTSHRVTFLTTVPTIMQRLLPVYRAEPDAYDLTSIRRFWHVGAPCPPAVKQAWIDLLG
FT                   PQVVWELYGGTELQALTFISGEQWLTHPGSVGVVVAGEMKVLDDDGNECPPGVTGEVYM
FT                   RPSPGSTPTYRYVGTTAKSRDGWDSLGDLGYFDTDGFLYLNDRRVDMFTVGGRNVYPAE
FT                   IEAALSAHPEVLSCLAVGIPHTDLGQVPHALVQTAPGSTLDAAGLRDFLRDAVSSYKVP
FT                   HTIEFVDEPLRDDAGKARRTAVRDAVIARLGRAPAAR"
FT   gene            complement(354881..355858)
FT                   /locus_tag="MSMEG_0320"
FT   CDS_pept        complement(354881..355858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0320"
FT                   /product="putative phosphotriesterase"
FT                   /note="identified by match to protein family HMM PF02126"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70367"
FT                   /db_xref="GOA:A0QP96"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR017947"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP96"
FT                   /protein_id="ABK70367.1"
FT                   /translation="MPTVNTAAGAIDTADLGVTLMHEHVFIMTTEVMLNHPESWGDEHR
FT                   READAIVRLGELKARGVDTIVDLTVIGLGRYIPRIARIAEATELNIVVATGLYTYNDIP
FT                   MTFHFRGPGTALDGDEPMAEMFVRDIEKGIADTGIKAAILKCATDEPGVTPGVERVLRA
FT                   VAAAHRQTGVPISTHTHAATRRGLEQQRVFAEEGVDLTRVIIGHCGDTTDIGYLEELIA
FT                   NGSYIGMDRFGVDVFLPFEQRVATVATMCERGHAERMVLSHDTWCYFDALPDELTTAAL
FT                   PNSHYLHIHNDVIPALRQRGVTDEQITTMLVDNPRRIFEHKGGY"
FT   gene            complement(355916..358708)
FT                   /locus_tag="MSMEG_0321"
FT   CDS_pept        complement(355916..358708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0321"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00196;
FT                   match to protein family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75637"
FT                   /db_xref="GOA:A0QP97"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP97"
FT                   /protein_id="ABK75637.1"
FT                   /translation="METGGRGQPLHGRAAECDALRRSIADVQSAQSRVLVLRGEAGVGK
FT                   TALLDFAAQHAKGFRITQVAGVESDMELAYAGLQQLCAPLMNNLDDLPEPQRDALAVAF
FT                   GLGVGQTPDRFLVGLAVLSLMAAAADEKPLLCIVDDAQWLDSVSVQTLAFVARRLLAEP
FT                   VGLIFAVRDHGAPALAGLPELLVDGLSDTDARELLDSVILGRLDERVRDRVVAETRGIP
FT                   LALLEVPRTIPAAELAGGFSTIAGRRSAGRVEDSFTSRVRSLPDEARQLLLLAAAEPIG
FT                   DAALFVRAAAHLGVAVPALAPAESAGLIEFGTRIRFHHPLVRSAAYRAASVEDRRAAHH
FT                   ALAEATDAVTDPDRRAWHAANAAAGPSDAVATELEASAGRAQTRGGIAAAATFLERAAV
FT                   LSADLHLRGARAVAAAQAKRDAADLQAAYELLAIAELSPLSDLQRAQIARLRAQMEFSH
FT                   SRREDSGPAQLRDAAAMLLDAARRLESLDDELALQTHLEAIAAAMYAGHLGAPDALLTT
FT                   AAAAQAAVDRLASRDDPIALLLDGVAKCLTGDVGDAAVPLRKALTAWCSAAQHGDGAVL
FT                   PWIFVGYPIVQESAVDELWDDTLMERLADAMVRYTRDAGALAILPAALSCRAGAHLLSG
FT                   EFGTAGNLLDEANAIAVAIADQPLRYHRLHLAAWRGSTAETIAMIDSATAMAHRNGEGR
FT                   LLAVLGYFAALLYNGAGRYEEAYAAIRPACSTKNLGFGGWSLVELIEAAVHTGRREAAE
FT                   EAADRLAAQAGASGTDWGLGALAGARAMLADHDTADALFTEAIERLQRTRIAVELARTH
FT                   LRYGEWLRRVNRRPDARRHLGVAFDMFTRMGAAGFAERARRELTATGEKVRKQPVSSGD
FT                   ELTAQEAQIARLAADGLTNQEIGSQLFISTHTVEWHLRKVFVKLGIGSRRQLRTIEWAG
FT                   "
FT   gene            complement(358764..359046)
FT                   /pseudo
FT                   /locus_tag="MSMEG_0322"
FT                   /note="glyoxylase family protein; this gene contains a
FT                   frame shift which is not the result of sequencing error"
FT   gene            complement(359235..360470)
FT                   /locus_tag="MSMEG_0323"
FT   CDS_pept        complement(359235..360470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0323"
FT                   /product="acyl-CoA dehydrogenase, short-chain specific,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74406"
FT                   /db_xref="GOA:A0QP98"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP98"
FT                   /protein_id="ABK74406.1"
FT                   /translation="MLEQDMTDEEFEPYFAKAQEVSQFFREIGPKYDQENTFAYPSIEA
FT                   FKKSGLGALPVPRAFGGPGGNILHVSKVVTELSRGDSAITLAYNMHYIMLGIAGNLMSE
FT                   EQNKYWMGRVIDGELIFGPFSEQRAGFSGLADMKAVPQPGGGWRLYGKKTWGTLCEAAS
FT                   IITTNATETDANGNLPETFEERVAAEKLFIGDFTVDENGAGDGIRIEKTWDALGMHATG
FT                   TQTIVFDGYFVPEDGFVSVWRAGAFGTLEWASLMFASIYLGMQQRILEEATNALAKKHL
FT                   GATFGAIVAEDTAVKDVGHIVDGIGDFASRVEWSRRVLHRTCEDLLEGRDKEWPAELRF
FT                   PYLGLAKTFIADNVLHMSRHAMSMIGGSAFRKGTIFERLYRDSAASMFQPLNADQTRTY
FT                   VGQYLLEQAAAK"
FT   gene            360723..361178
FT                   /locus_tag="MSMEG_0324"
FT   CDS_pept        360723..361178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07366;
FT                   match to protein family HMM TIGR02096"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70279"
FT                   /db_xref="InterPro:IPR011721"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A0QP99"
FT                   /protein_id="ABK70279.1"
FT                   /translation="MSHSFAVKWLKAFRTSAEAVVALYADDFLFEDPILAQKITTKEEL
FT                   LRVFAPYANKDTENGIGINNFRIDEVVGDERAAIYRWTWNAPTATAFVGVPTNGKVPGA
FT                   RGITFHIYDTDGRIKREASFWDVSTAVRDLGLSVDPTAVAKKSSALV"
FT   gene            361191..361703
FT                   /locus_tag="MSMEG_0325"
FT   CDS_pept        361191..361703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02096"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71426"
FT                   /db_xref="InterPro:IPR011721"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPA0"
FT                   /protein_id="ABK71426.1"
FT                   /translation="MTLDTSFAEQHAQRWLDALTSDTAAAVALYADDLVYDDHADSDHM
FT                   IDTAITKDDLAPRLAPFANKNPDNGLGVHRFTATDAFQLAGVGGNSAVVILWDWTGEGL
FT                   DTFRGVPTEGKTLSTRGITWHQLDSDGKIERETTYWNDTPVLQELGLPIITPPYWVEGF
FT                   DPAALTG"
FT   gene            361710..363317
FT                   /locus_tag="MSMEG_0326"
FT   CDS_pept        361710..363317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0326"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75654"
FT                   /db_xref="GOA:A0QPA1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPA1"
FT                   /protein_id="ABK75654.1"
FT                   /translation="MSNDGMWGVLPDVLDRACAYYGERTAILDAATGASVTYRELGQWR
FT                   NQIAHALIDNGVQKGERVGLLMPNCLEFIPIQQAIWAAGAVLVQMPTRAAAEGFKSNLA
FT                   QTDATTLLYHAKFEDAIASIRDGLPKLQTLIRVGTAENEKSVDALDFATLVAGQPTHRP
FT                   QVDIDEHDEAYVLFTSGSTGEPKGVVNSHYTWSYYSISAGLEIGDIRFGEVFAHGAPLT
FT                   HFTQIFVLPTFVRGGTNVMLPGLEPESLLTFIERHGVTAVALVPTIIYLLLDHPRRSEF
FT                   DLSTLQTVVYAGSPIAPERLRQALEVFGPIFIQTYAGTEPGYVACLRKPEHVQREGESV
FT                   EEWTARLAAAGRPMFPVRVSVQDENDRILPVGEVGEICSQQLGQMLSYLDPARNAETLR
FT                   DGWVHTGDVGYLDHDGYLYIVDRKKDMVVSGGFNVFPRQVEDALATHPAVAQSAVIGVP
FT                   HEKWGEAVMAVVVPQSGEITGPELESELIKHVKAALGSVAAPKTVLFADSLPLNPAGKV
FT                   DKKAIRKPYWRNQTRQVG"
FT   gene            363333..364835
FT                   /locus_tag="MSMEG_0327"
FT   CDS_pept        363333..364835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0327"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74396"
FT                   /db_xref="GOA:A0QPA2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPA2"
FT                   /protein_id="ABK74396.1"
FT                   /translation="MSEHYSMYIDGKWIDTDEVYEIRSPATEELVATVAKGNTASVDAA
FT                   VEAAKGAFAEGTWRRTPPAQRAAIINNVAERLGARADELAALQTRENGATIRITGALHV
FT                   GLSVAQLQYLAAIAENYEWETPGPAIEPVAADGVVVREPLGVVAAIVPWNIPLLTTVWK
FT                   IGPALVAGNSVVLKPDEHAPLLALELAREFDAAGLPPGVLNVVTGDGEPVGAHLSGHPD
FT                   VRKVAFTGSTAVGKSILRQSADTVRRVTLELGGKGANIILDDADIDMAVDGALFACMAN
FT                   NGEACEAGTRLLIPASRRDEIVDKLLARASTLRVGDPLDPATHIGPVISQTQRDRILNY
FT                   FRIAAEEGAIAALGGKARSGPEFDKGYWIEPTIYLDVTNDMRVAREEVFGPVLVVMTYD
FT                   TDEDALAVANDTNYGLSAGVWGSEERATALARRLEAGMVWVNNWHIIHPAYPFGGYKES
FT                   GLGREGGPNAIDEYVEEKFIAVDRSGGIENKAFAIVIDPAGD"
FT   gene            364857..365306
FT                   /locus_tag="MSMEG_0328"
FT   CDS_pept        364857..365306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0328"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71847"
FT                   /db_xref="GOA:A0QPA3"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPA3"
FT                   /protein_id="ABK71847.1"
FT                   /translation="MTTATATPDTSGSEGTPRRQLRFGVDSDNSLWTNGSDNVLRIQAV
FT                   DLRDLANKAAAAREDSPHAVVVVDIDVMIAQDIRTARAALRDSGYECGDRMVYVGTAAG
FT                   LAGLVADIHALGIADGAVLVPVAGDGVLELIRDVVVPELTAMSGA"
FT   gene            365303..365797
FT                   /locus_tag="MSMEG_0329"
FT   CDS_pept        365303..365797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0329"
FT                   /product="FMN oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01613"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70314"
FT                   /db_xref="GOA:A0QPA4"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPA4"
FT                   /protein_id="ABK70314.1"
FT                   /translation="MMVTAEQYRAALRRHPAGVAIVTMMSTGGPVGFTATSFASLSLSP
FT                   PLISFNITETSSSIEAMRAAESVVVHLPGADQLPLAQRFSRSAEHRFADPCAWSLLPTG
FT                   EPVLHGVPTWLRAGVERLIEAGDSTLVIGEVAQIHCEDGAECPEPLLYHNGAYLGTRPL
FT                   T"
FT   gene            complement(365798..366985)
FT                   /locus_tag="MSMEG_0330"
FT   CDS_pept        complement(365798..366985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0330"
FT                   /product="transcriptional regulator, LuxR family protein"
FT                   /note="identified by match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73806"
FT                   /db_xref="GOA:A0QPA5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPA5"
FT                   /protein_id="ABK73806.1"
FT                   /translation="MSVLIGAESSRTAGTGRVRSDRLSKRTEFDERFSALRDRAAAVLG
FT                   TERPPALESGSPIRVGEVISDFSQLCVRRLQAVRSSDTEAERQLGSLLLELQQLALDWY
FT                   LFETGVRSQRLADCAVSLNRLRAMPTTAALLDNACHELVFRLGFRRAVLSTVDTRGWTP
FT                   MILLDRTEPADRGWFSNWQNQTVPLVQTTPEALSLSRRRPCLIEDTTDAPVYRPLIVHA
FT                   GQSRSYVVAPLVQSGDVMGFLHTDHYPENTPVDEADRDVLWAFADGFSHIYQRAALLEN
FT                   LRRQRDHIRDLLISTVDQIDELCDVSVEATAWADENGQTADDDATTGARPPHRVELTER
FT                   ESEVLRLMVTGASNHEIAEQLVITEGTVKSHVKHILRKYGAVNRAQAIAWALQGT"
FT   gene            complement(366982..368034)
FT                   /locus_tag="MSMEG_0331"
FT   CDS_pept        complement(366982..368034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0331"
FT                   /product="transcriptional regulator, LuxR family protein"
FT                   /note="identified by match to protein family HMM PF00196;
FT                   match to protein family HMM PF01590"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75397"
FT                   /db_xref="GOA:A0QPA6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPA6"
FT                   /protein_id="ABK75397.1"
FT                   /translation="MMTTKERPIGTELLSRSSSAVATTLLSEKAFAAGRATHRDLASPG
FT                   EQISAALDALLASLDEVRQATSPAETLECAPRALATSAVFQRVMLSRVSGSTWLPDAVY
FT                   GVDGQRRRDVRFECYPDERLEDLQIPLASPLVEAEVVRRRLPALVSDAHHETRVHPPLI
FT                   ERMQAGEYVVAPITAGSTVLGLLHASRPTDGRPLTTAHRDLLRMFADGVGLSYEHALLV
FT                   ERIERQRRYVLDACDSAVRSAAGTDLTTPIPLRPRPFRTNTVVSTQTSFTQTSQRRESS
FT                   RLTILTSREREVLALLASGATNAQLADQLTVAESTVKSHVKHILHKLGASNRAAAISFY
FT                   LRETRGRSRS"
FT   gene            368223..369158
FT                   /locus_tag="MSMEG_0332"
FT   CDS_pept        368223..369158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0332"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /note="identified by match to protein family HMM PF03060"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75680"
FT                   /db_xref="GOA:A0QPA7"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPA7"
FT                   /protein_id="ABK75680.1"
FT                   /translation="MNPLPTAWSGRLVLPVIAAPMTSVSGPELVIAACRAGVIGSFPTH
FT                   NATSPEELDSWLRRITAQAGGGAPVAPNLVVHRSNARLQADLDCLIRHRVELVITSVGS
FT                   PAAVVDRLHGIGAQLYADVASLRHAWAALDAGADGLVLLTAGAGGQTGWANPLAFLSAV
FT                   RERFDGPLVLAGGIADGRSILAAQAAGADLAYVGTRFIATSKSRASDEYRRAVVDSTLD
FT                   DVKLSDRVGGIPASLLSAWLDRQADPEGASDGFAQDRLLSNGDAWSAGHSVSGVHGVTT
FT                   VEELVAELAGQYQAARAEFAALCEAGGPLR"
FT   gene            369275..370873
FT                   /locus_tag="MSMEG_0333"
FT   CDS_pept        369275..370873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0333"
FT                   /product="Carboxyl transferase domain protein"
FT                   /note="identified by match to protein family HMM PF01039"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70870"
FT                   /db_xref="GOA:A0QPA8"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPA8"
FT                   /protein_id="ABK70870.1"
FT                   /translation="MPPLTSEIDPHSDTFKSNYEVQTAAVAALNEQLAIVAGGGGERYV
FT                   KRHHDRGRLLARERIELLLDRDAPFLELSSLAAWGTDFNVGAAIVTGVGVVSGTECMII
FT                   AHDPTVRGGTMNPYTLRKNLRALEIAKVNRLPVLYLVESGGADLPTQSELFVHAGRIFR
FT                   DLTELSSMGIPSVAMVFGNSTAGGAYVPGMCDYAVLVDKQAKVFLGGPPLVKMATGEDA
FT                   DDESLGGADMHTRVSGLGDYFAVDEVDAIRIGRDIVAHLNWRKLGPGPSRPADEPLYDS
FT                   EELLGIASGDSRVPFDPREVIARIVDGSRFSEYKPRWGTSLATGWASIHGFPVGILANT
FT                   RGVLFSEESKKATEFILLANQTDTPLIFLQNVTGFMVGTEYEQGGIIKDGAKMINAVTN
FT                   STVPHITLNMGGSFGAGNYGMSGRAYDPRFMFSWVNAKLAVMGAQQLAGVLSIVGKAAA
FT                   QAAGREFDHEADAKRTKEIEEQIDRESHAFFNSARIYDDGVIDPRDTRSVLGIALSAAH
FT                   SNVVAGRRGFGVFRM"
FT   gene            370879..372888
FT                   /locus_tag="MSMEG_0334"
FT   CDS_pept        370879..372888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0334"
FT                   /product="acetyl-/propionyl-coenzyme A carboxylase alpha
FT                   chain"
FT                   /EC_number="6.3.4.14"
FT                   /note="identified by match to protein family HMM PF00289;
FT                   match to protein family HMM PF00364; match to protein
FT                   family HMM PF01071; match to protein family HMM PF02785;
FT                   match to protein family HMM PF02786"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72823"
FT                   /db_xref="GOA:A0QPA9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPA9"
FT                   /protein_id="ABK72823.1"
FT                   /translation="MITTHQPIGKLLIANRGEIASRIIRTAREMDIATVAIHSDADRYA
FT                   PYVAAADEAVHLPGTAPADTYLRADLVLAAAVATGADAIHPGYGFLSENADFAKACAES
FT                   GVIFVGPSPEAIASMGSKIAAKEMMAAAGVPVLPGVTVGADEDADPDKLRKAAAETGFP
FT                   ILVKAAFGGGGRGMRIVADEDELLEAVAGARREAASAFGDGTVFLEKFVESPRHIEVQI
FT                   FGDSHGTVVHLGERECSIQRRYQKIIEEAPSTAVDPALREELGRAAVAAGKALAYEGAG
FT                   TVEFVMAPDGSFYFLEVNTRLQVEHPVTELVTGIDLVRAQLLVAAGEPLPDEMLHTEPN
FT                   GHAVEVRLYAEDVDAGFIPVSGTLHTLEFPDVPGVRIDAGFTSGSTVSTFYDPMLAKVI
FT                   GYGQTRDEACRRVARALRETRIHGVTTNRDLLVGILRENDFRAGAIDTGYLQRNDPAEL
FT                   GVADPSAVRTHAVAAALASMTQRRTQTTILPGLPSGWRNLPSQDQVVVYRDGDDVVEVR
FT                   YRVQRDGIRVTVGDWHPQVRIFDAAADLVDAEIDGVRRRYRAARICDVDYVDSSLGSTA
FT                   LQEVPRFPDPSTIQEAGSLLAPMPGAVVRVEVGEGDEVQLGDIIVVLEAMKMEHTVRAP
FT                   SDGVVTTIAVKQGDQVESGQVLAVVSGPDEDGPS"
FT   gene            372885..373643
FT                   /locus_tag="MSMEG_0335"
FT   CDS_pept        372885..373643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0335"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71822"
FT                   /db_xref="GOA:A0QPB0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPB0"
FT                   /protein_id="ABK71822.1"
FT                   /translation="MSVDYEVRNGVAWLTINRPEARNSLNKAVRDGLFDGVRRFNNDAQ
FT                   AKVLVLTGAGDKAFCAGGDLKEMSDDQLTVPPIDFVPQFGRNITVDKPTIAAVNGVAFA
FT                   GGFLLAQTCDLCVASTTAKFAITEAKVGRGSPWAAPLPLMIPRRIAMELVLTGAPISAA
FT                   RAHEIGFVNRLAEPADLHAVAQKLAEQIAANAPLSVAAGKRTATLTAEHPLSEAFDIAE
FT                   SIWEPVYLSGDAQEGMAAFKEKRSPVWKGR"
FT   gene            373643..374437
FT                   /locus_tag="MSMEG_0336"
FT   CDS_pept        373643..374437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0336"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR03083;
FT                   match to protein family HMM TIGR03084"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72839"
FT                   /db_xref="GOA:A0QPB1"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017518"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPB1"
FT                   /protein_id="ABK72839.1"
FT                   /translation="MALDYGRLLDELRTESDLLTGHLQDLPFEEWGRDTPAAGWSIQDQ
FT                   VSHLAFFDDAAKLALRQPDDFRAMADRLIAGGMDFPDRIAEQHRILAPDALLQWLLAAR
FT                   RDLLAALSEDDPKRRIPWFGPDMSVASCATARLMETWAHGRDIYETIGVAPPASPGLRS
FT                   IAHLGVSTFAFSHRLNGQDVPSEPVAVQLHSPGGETWTWGPQDAADRITGTAEDFVLVV
FT                   TQRRHWTDTGLTVEGPVATGWMEVAQAFAGAATKTEPKVQAR"
FT   gene            374434..376188
FT                   /locus_tag="MSMEG_0337"
FT   CDS_pept        374434..376188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07287"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71915"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPB2"
FT                   /protein_id="ABK71915.1"
FT                   /translation="MSRAVRIGNVSGFYGDRHSAMRDLVATADVDVITGDYLAELTMLI
FT                   LWKSRKKNPETGYAHTFLTQFREVAAECARRGIKVVVNAGGLNPAGMAGRVRELLAELG
FT                   VDLTVAHVEGDDLMPRLPQLLERGHEFANIDTGIPLRDKDVEPVSANAYLGGWGIASAL
FT                   ARGADVVVTGRVTDAALVVGAGAWWHGWSRDDYDALAGAVAAGHIIECGPQATGGNYSQ
FT                   IHEVTDRRYPGSPIAELEHDGSFVITKPTDSGGVVTPGTVTAQLLYEVGAPAYVNPDVV
FT                   AHFDTCSITQAGENRVRVSGTVGTPPPPTLKVAMNYIGGFRNTMTMALTGLDIEEKAKW
FT                   AVEELMTILGGQERFDHVDIQLLRYDTPDPVSMEQATAHLRVTVKDRDRAKVDRAFSNA
FT                   VIELYVAGYAGFYTTTPPSSASEFGVYWPTLIPASEVAHTVVHADGTRELIEHSTETAG
FT                   LTAAQAPESPAPRDFGTTSRRPLGTIVAARSGDKGGNANVGVWTDTDERWEWLRSHLTE
FT                   QRFAELVPECRGLTIRRFEFPNLKALNFVVAGFLGDGVASCTRPDAQAKSFGEYLRAVH
FT                   TDVPDALI"
FT   gene            376204..377340
FT                   /locus_tag="MSMEG_0338"
FT   CDS_pept        376204..377340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0338"
FT                   /product="acyl-CoA dehydrogenase fadE12"
FT                   /EC_number="1.3.99.-"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF02771; match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71379"
FT                   /db_xref="GOA:A0QPB3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPB3"
FT                   /protein_id="ABK71379.1"
FT                   /translation="MDFREPSEHSDLRAAVAAITDRYGPAYFAERATAHEPTDELWKDL
FT                   AQHGFIGINFPEEFGGGGAGMAELAIVCEETAAGGCPLLLMLVSSAISGELISRYGSSE
FT                   QQKDWLPRMASGETKVVFAITEPDAGSNTRQIATTAVRDGGDYVINGTKYYISGVDEAE
FT                   CLIVVTRTAPERLSLFLVPTDAPGLVKHRLPVGINLPEKQYTLHFDNVRVPASNLVGVE
FT                   HEGFKQVFDGLNPERITGAAVCVGIGRHVVEKAADYARQRSVWGPPIGTYQAIAHPLAK
FT                   AKIEVDMAALATSRAAWLFDNQLPAGEASNIAKYLAAEAAVAAADHAIQLHGGNGISAE
FT                   YGLLPQWGLARLLQIAPVSREMILNYVAQHSLNLPRSY"
FT   gene            377377..378393
FT                   /locus_tag="MSMEG_0339"
FT   CDS_pept        377377..378393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0339"
FT                   /product="FMN-dependent monooxygenase"
FT                   /note="identified by match to protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72130"
FT                   /db_xref="GOA:A0QPB4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019951"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPB4"
FT                   /protein_id="ABK72130.1"
FT                   /translation="MQLGYWAAQPPSNHAELVAAAEDAGFDTVFTAEAWGSDAFTPLAW
FT                   WGRETSRLRLGTSVVQMSARTPTACAMASLTLDHLSGGRHILGLGVSGPQVVEGWYGQK
FT                   FPKPLARTREYVDIIRQVWAREAPVTSDGPHYPLPLAGAGTTGLGKALKPITHPLRADI
FT                   PIMLGAEGPRNVALAAEICDGWLPIFYTPRMADTYNAWLDEGFAKPGARRTRETFEICA
FT                   TANIVITEDRAAAFAAMKPYLALYMGGMGAEDTNFHADVYRRMGYGEVVDEVTRLLRSR
FT                   GKEEAAQAIPDEVVDDAAIVGDVAYVREQIKVWEAAGVTTMVVNARSPEHIHQLTSL"
FT   gene            378402..379154
FT                   /locus_tag="MSMEG_0340"
FT   CDS_pept        378402..379154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0340"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74377"
FT                   /db_xref="GOA:A0QPB5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPB5"
FT                   /protein_id="ABK74377.1"
FT                   /translation="MLEITDQNRVRTIALARHDALNAFDEALYDATAIALQDAAEDGDV
FT                   AVVILTGSGRAFCAGTDLKELHARATKNGFVPGKYGFNGLMAVLAEFPKPLICAVNGVG
FT                   LGIGTTILGFADLAFMSTSARLKCPFTSLALAPEAASSYLLPALLGRQNAAWVLMSSEW
FT                   IDAQQALEMGLVWRLCEPDQLDDEVRRHAELLASHPISSLIAVKRTLTAPHVEAVRAAL
FT                   AREDALLEELLGAPPNMAALAQFVGKRD"
FT   gene            complement(379158..380174)
FT                   /locus_tag="MSMEG_0341"
FT   CDS_pept        complement(379158..380174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0341"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73410"
FT                   /db_xref="GOA:A0QPB6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019919"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPB6"
FT                   /protein_id="ABK73410.1"
FT                   /translation="MAGAEEAGISGLLGQAARAQDIGFDGIWSTDVDRDPFLPLAVAAM
FT                   TTTNVQLGTGIAVAFARNPMTTAMAANDLQEMSDGRFVLGLGTQIQAHIERRFSMPWSA
FT                   PAERMSEYVNAIRAIWRSWRTGERLDFRGDHYQHTLMTPMFTPTPHPHGDPKIVISAVG
FT                   PRMTRVAARDADGLLVHGFTTQRYLSEVTLPIVEEELRKVGRRRADFTISYPGLIASGS
FT                   TDEELTRAVSAVRRQIAFYGSTPAYRHVLELHGWHDLHTELHRLSKAGDWTTMTGLIDD
FT                   EVLNTFAAVGEPTEAGAEVVTRFAGLVDRFTLLTPYPLGDEAAAAIVAGARAATARA"
FT   gene            complement(380208..381053)
FT                   /locus_tag="MSMEG_0342"
FT   CDS_pept        complement(380208..381053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0342"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75726"
FT                   /db_xref="GOA:A0QPB7"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPB7"
FT                   /protein_id="ABK75726.1"
FT                   /translation="MGRMTSEVMTHDVSLLWQNIFTWASWVITLAMIAIAIRMGLRQRT
FT                   PFYLFAVVAAGVAAYAEPLYDVAFDLWFYDAQNGQPGAGLMHFSAFGIPQPNWTHSGYI
FT                   ILYAGACLYAGRRLYEGRFDRRSLLALWGLEIVTSCVFEVIGTGTDVYTYYGPHVLRIW
FT                   NYPLVIGVLEGTQVVLFTVAAVLIWRRASDWWLLLGLFVLFPMTFFGANFGLGYPVIIG
FT                   MHLDNGLASTPLIFAATLASIALCSITIYGLAAFLPTRTPDAGTPAKESVTPTEAQLAN
FT                   "
FT   gene            complement(381177..381809)
FT                   /locus_tag="MSMEG_0343"
FT   CDS_pept        complement(381177..381809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0343"
FT                   /product="TetR-family protein transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75889"
FT                   /db_xref="GOA:A0QPB8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPB8"
FT                   /protein_id="ABK75889.1"
FT                   /translation="MHSGGVLIVVDSPPGTAKARTRDPDRKNRILLAASELIGRRGFHA
FT                   VSIADIGNAAGITGSGVYRHFESKSAILVALFDQVIDDLIAEEKRILDETDDLPTALAE
FT                   LIEGQVEFVIGDRQLAQVYHNEINNLPEEDRRRLRRKQRLYLEEWVHLVNELREDLDDT
FT                   EARVIVHAAIGAIQSPLFHNTGLADDRLRVLLADSARSILSTDRRTP"
FT   gene            382067..382837
FT                   /locus_tag="MSMEG_0344"
FT   CDS_pept        382067..382837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02405"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73074"
FT                   /db_xref="GOA:A0QPB9"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPB9"
FT                   /protein_id="ABK73074.1"
FT                   /translation="MIALGPAAKPVGALGGFFAMTLDVFITIARPPFAWREYLNQTWFV
FT                   ARVSLVPALMLTVPYTVLLVFTFNILLIEFGAADFSGTGAAIGTVSQIGPIVTVLVVAG
FT                   AGSTAMCADLGARTIREELDAMRVMGIDPIQALVVPRVLAATTVALALSATVIIVGLAG
FT                   GFVFAVFIQHVPPGSFVAGLTVLTHGADVAVALAKAALFGLSAGLIACYKGISVGGGPA
FT                   GVGNAVNETVVFTFMALFAINVIATAVGVKITVV"
FT   gene            382881..383699
FT                   /locus_tag="MSMEG_0345"
FT   CDS_pept        382881..383699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02405"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74217"
FT                   /db_xref="GOA:A0QPC0"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPC0"
FT                   /protein_id="ABK74217.1"
FT                   /translation="MSNRLDRVRAAWDGIGVQTQFYARAIGSIGDAAMNYRTELIRLIA
FT                   TMGLGAGALAVVGGTVAIVGFLTMTTGALVAVQGYNQFASVGVEALTGFASAFFNVRLI
FT                   APGTTAVALSATIGAGATAQLGAMRINEEIDALEVIGIRSVSYLASTRVAAGVIVVIPL
FT                   YCVAVIMSFISSRLGTTVIYGQGSGVYDHYFNTFLNTNDLLWSFGQSVAITVVIMLVHT
FT                   YYGYTASGGPAGVGEAVGRAVRTSLIVAAIVVVMISLALYGQSGNFHLAG"
FT   gene            383703..385127
FT                   /locus_tag="MSMEG_0346"
FT   CDS_pept        383703..385127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0346"
FT                   /product="virulence factor"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72335"
FT                   /db_xref="GOA:A0QPC1"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPC1"
FT                   /protein_id="ABK72335.1"
FT                   /translation="MQPRFRDARIKPAWWTWILIAALGVFFFTTGSLFAGTFRSFVPVT
FT                   LVSDRSGLVMETGAKVKLNGVEVGRVSEIRGGASGVSLQLEIEPDQIRFIPANVEARIT
FT                   ATTAFGAKYVDLSYPDNPTGQHLAAGAVLRSRNVSTEVNTVFENLTDVLKMVDPAKLNA
FT                   VLSALAEGFRGQGERMGQAITDANEVLMAINPRQDTIREDWRAMGEVSAAYDHAADDIV
FT                   KILDAGTTTAETVTSHRSELDTLLLNVIGFGRAGVDLLAPSFTNLVNAVNGFAPTSDLL
FT                   MKYQPEYTCLLDGSVSLLQNGHVDAFGGNGRSAIFDIGLLLGNDPYHYPDDLPIVGAKG
FT                   GPGGKPGCGSLPDVAKNFPVRQLVTNTGWGTGLDIRPNPGIGFPGWANYFPVTRGIPQP
FT                   PIIRNLGGGPAPGPIPYPGAPPYGADLYADDGTPLWPGLPPAPPPSDQPPPDPNNPPPG
FT                   AEPFVPPAPAAMTPTQ"
FT   gene            385157..386185
FT                   /locus_tag="MSMEG_0347"
FT   CDS_pept        385157..386185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0347"
FT                   /product="virulence factor Mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71990"
FT                   /db_xref="GOA:A0QPC2"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPC2"
FT                   /protein_id="ABK71990.1"
FT                   /translation="MNKEVLSTLIRVSAFLTVCAVGVFALFSIFADLRFGERKQYTAQF
FT                   SDISGLKEGDFVRIAGVEVGQVQKVSMDENALVLVEFAMEDSVELTSTSTAVIRYDNLI
FT                   GGRYLELKQGEEPGAVLQAGATIPLARTRPALDLDELIGGFRPLFKALDPDQVNALSTQ
FT                   LVQVFQGQGATISSFLDQTAAMTSTLADRDQLIGEVIGNLDVLLGSLGEQSHQFDKAVN
FT                   SLSELVAGLSARRTDITNAIANSDNAATEIADLLAQARPPLQNVVTQADRAAAIAVADH
FT                   EYLDNILNTLPDKYRVLGRQAMYGDYFSFYLCDLILKLNGKGGQPVYVKLAEQVTGRCA
FT                   PK"
FT   gene            386170..387498
FT                   /locus_tag="MSMEG_0348"
FT   CDS_pept        386170..387498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0348"
FT                   /product="mce-family protein mce3c"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73028"
FT                   /db_xref="GOA:A0QPC3"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPC3"
FT                   /protein_id="ABK73028.1"
FT                   /translation="MRAEMKAFSERDPRTIGLVGIAITVVIALAALNFDKLPLLSSTKG
FT                   YSAYFADAGGLNTGATVRVSGFAVGKVERIRLDGRKVLVDFTVDSAIHLGEQSEAAIKV
FT                   KSLLGTKVIDVIPRGGGQLHEPIPLERTTSPYQLPDALGDLATTVENLNTDDLSAALDT
FT                   MAQTFAGTPPDVKIAVAGVARLSETINKRDTELRNLLANARKATAVLATRTDQVVGLVQ
FT                   DSNALLAELRTQSDALDRVSQDISRAATQLRGFMADNRQQLRPMLDKLNGVLTIVDNRK
FT                   DRLQEAVKLLNKYALSLGESVGSGPFFKAYIPNLIPGQFSQPFIDAAFSDLGLDPATLL
FT                   PSQLVDPPVGQPGTPALPVPYPRTGQGGEPRLNLPDAITGNPGDPRYPYREPPPAPAPG
FT                   GPPPGPPAPPVPGLESTPSPTPSPVYVPAPGEPTTPIPAGEGR"
FT   gene            387495..388796
FT                   /locus_tag="MSMEG_0349"
FT   CDS_pept        387495..388796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0349"
FT                   /product="virulence factor mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70545"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPC4"
FT                   /protein_id="ABK70545.1"
FT                   /translation="MRISKKQLTLAAGLVVVMVAGVLVGFRMTGPAARTTITAYFANSN
FT                   GLFAGDDVLILGVPVGKVKEIEPLPERAKVTFWVDKEFQVPADATAAILSPQLVTGRAI
FT                   QLTPPYESGPELPDDAVIPIERTAVPVSWDDFRVQLEKLTRTLQPETPGGTSALGNFIN
FT                   TAADNLRGEGDNIRDALVKLSKTVTTVSDHKDDVFSTLNNLATLVSALRDSTDVLAALN
FT                   RNMAAVSALLADSPDEVGQAIADLNSLAVDVKSFVVENRDAVGTTSDVSASISTALVQS
FT                   LDDIKQSLHIFPTTLANFGNIYEPANGSLTGALAINNFSDPISFICGAIEAASRLGAER
FT                   SAKLCVQYLAPIVKNRQFNFPPFGENTFVGAQARPNEITFSEDWLRPDYIPPAQPVTQD
FT                   LDPEVLPAEAAPTDGSADPSAGLPGLMIPTEAGS"
FT   gene            388793..389932
FT                   /locus_tag="MSMEG_0350"
FT   CDS_pept        388793..389932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0350"
FT                   /product="virulence factor Mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70883"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPC5"
FT                   /protein_id="ABK70883.1"
FT                   /translation="MTHMRRVVACAATVAALMIGVTGCSNWRGLNSVSLPGTEGGGPGA
FT                   FDIQVQMPDITNLQPNSRVRVADVTVGTVTKVERQGWHALLTLRLNGDVNLPANCTATI
FT                   GQTSLLGSLHVELAPPAAAPPQGRLHQGSLIPLADSTTHPTTEQTLAAVSMLLNGGGLG
FT                   QMQDITKALSTALRGREADLRNLIGQLETFVAKTNDQTGDIIEATEKLNRLTGKFAAQQ
FT                   PVVDKAVRTIPDALEVLKDQRDNLTAALDQLGRFSALAADSTRQTKDSLVREFRNIGPV
FT                   LESLANAGPNMTRALSILTTYPFPNETLEKWLRGDYGNMTAIVDLTLSRIDAGFFTGTR
FT                   WEGDLTELEMQWGRTIGQLPSPYTAVNPLVAPYRWDQGR"
FT   gene            389934..391421
FT                   /locus_tag="MSMEG_0351"
FT   CDS_pept        389934..391421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0351"
FT                   /product="virulence factor mce family protein"
FT                   /note="identified by match to protein family HMM PF02470;
FT                   match to protein family HMM TIGR00996"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75309"
FT                   /db_xref="GOA:A0QPC6"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPC6"
FT                   /protein_id="ABK75309.1"
FT                   /translation="MIHRRTKIQLAIFCVIAVVFGTVMIFGYMRLPAHLFGIGLYTVNL
FT                   DLDRTGGLYPTGNVTYRGTEVGRVESVGLSENGGVRAVLKLKSGIDIPSDLRAEVHSQS
FT                   AIGEQYVELLPRSAAAPPLQDGDVIAAKDVFIPPDINSLLDAANTGLQAIPQDNLKTAI
FT                   DESYAAVGGLGPAISRLVRGSTALASDARKNLGSLTTLIDLWQPVAESQIGTADSIEAW
FT                   AANLAAVTGQLKQHNADVVGLIEQGAPAAEEARRLFERVQPTLPILLANLVSINEVAVT
FT                   YQPGIEQILVLLPQGIAQLQGPNLANRDNKDTAHKGMFLAFNTNINLPPPCTTGFLPAQ
FT                   QRRPPSFEDYPERPAGDLYCRTPQDSPFNARGARNIPCETVPGKRAPTVKLCESDENFV
FT                   PLNDGYNWKGDPNATLSGQSIPDLGPGQGESAPETSPAPPAPPVEGDPVPMAIARYDPA
FT                   TGTYLGPDGQVYTQADLADNGSKEQTWQSMLTPHGMN"
FT   gene            391385..391987
FT                   /locus_tag="MSMEG_0352"
FT   CDS_pept        391385..391987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75111"
FT                   /db_xref="GOA:A0QPC7"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPC7"
FT                   /protein_id="ABK75111.1"
FT                   /translation="MAVDVDTARHELTQPGQADDQETDEKSGVDTDSREPTSAQVRGVR
FT                   GALVIGVLLLAIVGGATGWLVWQTQRAEQDQRMNEMLLQAGREAAVNLTTMDFEHIRED
FT                   IQRVLDGSTGTFYDEFEQRAPAFEEVVTKTQSKTEGTVTEAGIESVSADSARVLVAVSV
FT                   KTSNIAAPEQRPRLWRMRIDVQRVGDVAKVTNVGFVA"
FT   gene            392047..392592
FT                   /locus_tag="MSMEG_0353"
FT   CDS_pept        392047..392592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0353"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75809"
FT                   /db_xref="GOA:A0QPC8"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPC8"
FT                   /protein_id="ABK75809.1"
FT                   /translation="MLAAQEVSEPEAAQPQSDSGPRRSVRVLAYVVIPLLIVGLAACAG
FT                   YLQWRSSSMRAAQAANVSAVPAATDSTIKMLSYKPDTVQKDLELAAEGLTGPFRDDYNS
FT                   LIHDVVIPGAQEKQISAVATVPAAAVVSATGNRAVVMVFVNQTTIVGADPPTSTASTVR
FT                   VTMDKVGERWLVSDFTPI"
FT   gene            392616..392957
FT                   /locus_tag="MSMEG_0354"
FT   CDS_pept        392616..392957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05305"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73810"
FT                   /db_xref="InterPro:IPR007969"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPC9"
FT                   /protein_id="ABK73810.1"
FT                   /translation="MAAAMGTTVTAVATVAAPHAAAEEFVYLLNVTVRPGYNFASPDAA
FT                   LTYGRGVCAKLAEGTAYGQLVDDVRRDFGTADEFQASYLVSQAVNELCPEMIWQLRSSA
FT                   SGYRSGEVR"
FT   gene            392954..393448
FT                   /locus_tag="MSMEG_0355"
FT   CDS_pept        392954..393448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73113"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPD0"
FT                   /protein_id="ABK73113.1"
FT                   /translation="MNLIAQRSVVLVACGVLTAGAVSHAPDAAADNRRLNSSVVSNVYT
FT                   VQRQAGCTDNITVDPRLLEAARRHTLDVLNNRSLDGDIGSDGSTPQVRASNADFYGRVA
FT                   ETVAVNPALAINNLDVINQWYHRPDYLAIMRDCGFTRMGVWSENSLDRSVLVAVYGSPE
FT                   V"
FT   gene            complement(393601..393897)
FT                   /locus_tag="MSMEG_0356"
FT   CDS_pept        complement(393601..393897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0356"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74887"
FT                   /db_xref="GOA:A0QPD1"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPD1"
FT                   /protein_id="ABK74887.1"
FT                   /translation="MPDAHHYELTVDGEHAGVLAYVDIGDQRVFHHTEVDDKFSGQGLA
FT                   GELVSAGLSDAKAAGKRIVAVCPYVAKYVSRHHDFDDVLDPVTPEAKAAVGGG"
FT   gene            394013..395614
FT                   /locus_tag="MSMEG_0357"
FT   CDS_pept        394013..395614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0357"
FT                   /product="transmembrane transport protein"
FT                   /note="identified by match to protein family HMM PF05977;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71151"
FT                   /db_xref="GOA:A0QPD2"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPD2"
FT                   /protein_id="ABK71151.1"
FT                   /translation="MTTATPAMGATSTWAPLASPIYRALWIAQFVSNLGTWMQTVGAQW
FT                   MLVGDPRAAVLVPLVQTATTLPVMLLALPSGVLADLVDRRRLLIAAQGATAAGVASLAT
FT                   LTGAGLATPTVLLTLLFLIGCGQALTAPAWQAIQPDLVPREQIPAAAALGSMSMNGARA
FT                   IGPAIAGALVSLSGPTLVFALNAVSFVGIVAVLLLWRRPAAERMLPAERPLAALSAGGR
FT                   YIRSAPIVRRILLRTVLFIAPGSALWGLLAVIAKDQLDLTSSGYGVLLGALGLGAVCGA
FT                   FVLGRLQKMFELNTLLVVAAIGFGGATVVLALVHQVAVVVIALVLGGTAWLLALSTLNA
FT                   SMQLSLPGWVRARGLSVYQLVFMGGQALGSLLWGLIAGAAGSVTALLVSAGLMGVCAVS
FT                   AIWWPLHARTGNLDMTPSAHWPEPALIFEPEPLDGPVVVLVSYRVEPAQETGFFEAMAA
FT                   LGRSRQRTGASQWQLFRSGEHAGTFVEAFIVRSWEEHLRQHHTRLTGHDLLVEETVRRF
FT                   TVGEPTSQHLIAAKTH"
FT   gene            395654..396616
FT                   /locus_tag="MSMEG_0358"
FT   CDS_pept        395654..396616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0358"
FT                   /product="ribonucleoside-diphosphate reductase, beta
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="identified by match to protein family HMM PF00268"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72528"
FT                   /db_xref="GOA:A0QPD3"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QPD3"
FT                   /protein_id="ABK72528.1"
FT                   /translation="MTRTHFDSIRAGGLNWSSLPLKLFAGGNAKFWDPADIDFSRDRAD
FT                   WEALTEREREYATRLCAEFIAGEEAVTKDIQPFMSAMRAEGRLGDEMYLTQFAFEEAKH
FT                   TQVFRMWLDAVGVTDDLHSLIEEVPAYVQIFCEELPAALEALTSDPSPAAQVRASVVYN
FT                   HVVEGMLALTGYYAWHRICVDRGILPGMQELVRRIGDDERRHMAWGTFTCRRHVAADDA
FT                   NWAVFETHMNELIPVALRLTQEGFALYGDDIPFGLEEGEFLQYSSDRGMRRFGTISSAR
FT                   GRPLAEIDVDYTPLQLEDTFADEDERALTAVKAAAAAAN"
FT   gene            complement(396891..401135)
FT                   /locus_tag="MSMEG_0359"
FT   CDS_pept        complement(396891..401135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0359"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71542"
FT                   /db_xref="GOA:A0QPD4"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR021798"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QPD4"
FT                   /protein_id="ABK71542.1"
FT                   /translation="MVAAATLVLTFAQSPGQISPDTKLDLTANPLRFLARAFNLWNSDL
FT                   PFGQAQNQAYGYLFPHGTFFLLGDVLGVPGWVTQRLWWALLLTVGFWGVLRVAEALGIG
FT                   STPSRLIGAAAFALSPRVLTTLGAISSETLPMMLAPWVLLPVILALRGQHSVRLMAARS
FT                   AGAVALMGAVNAVATLTGCLAAVIWWACHRPNRLWWRFTAWWLLCGALAVTWWVVALLM
FT                   LGRISPPFLDFIESSGVTTQWMSLTEMLRGTMSWTPFVAPSATAGASLVTSTTAVLATT
FT                   VVAAAGLAGLALRTMPARGRLITMLLIGVVLLGLGYSGGLGSPVALQVQAFLDGSGTPL
FT                   RNLAKLEPVIRLPLALGLVHLLGRIPLPGSAPRAVWVSAFAHPERDKRVAVAIVVLSAL
FT                   AAGTSLAWTARLTPPGSFTAIPQHWHDAAAWLDEHNTDRGRVLVAPGAPFATQVWGNSH
FT                   DEPLQVLGDNPWGVRDSIPLTPPETIRALDSVQRLFASGRPSPGLADTLARQGISYVVV
FT                   RNDLDPDTSRSARPILVHRAVEGSPGLTKVAEFGDPVGPGTLEGFVADSGLRPRYPAVE
FT                   IFRVEPADAGSSQQRSPMHPYLVDSDAMTRVAGAPEALLRLDERRRLNGEPPLGPMLLA
FT                   ADARRAGLPVDGVIVTDTPTAREIDYGRVDDHASAIRTPDDARHTYNRVPDYPSDGADL
FT                   VYGKWTGGRLSVSSSAADSTALPYVAPATGPAAAIDSDSSTAWVSNALQAAVGQWLQVD
FT                   FDHPVTNATLTITPSATAVGAQVRRIEIATATGTSSLRFDTAGKPLTIPLPVGETPWVR
FT                   VTAVATDDGSPGVQFGVTDLAITQYDASGFAHPVTLRHTVEVPGPPAGSVVQQWDLGTE
FT                   LLGRPGCADSPVGVRCAAAMALASEEPVNLSRTLTVPQDTEVQPTVWIRGRQGPNLADL
FT                   VAQPDTTRAFGDSDPIDVLGSAYAATDGDPRTSWTAPQRVVQFQTPPTLTLKLPRPTEV
FT                   SGMRIVPGDTEPPAHPTLVAIDLGDGPQMHRLPADGEPRTVTLKPRVTDTVTVSLLAWN
FT                   DIIDRTSLGFDQLKPPGLAELTVLDGRGAPVGAADAAKNRSRAVALPCGQGPIIAVAGQ
FT                   FIQTSVHTTVGALLDGEPIPARPCRSEPVKLPAGQQELVVSPGAAFIVDGVELPTPAAD
FT                   EIRSAPTTSAETGTWTADRREVRVSAAAQQRVLVVPESVNRGWSAHDPAGAELQSVTVN
FT                   GWQQGWVVPAGTEGTVTLTFASNMPYRVGLIGGLALLPLLALLALIPVRRPVRAAAPAR
FT                   PWNPGPVLTGAAALVAGTAISGVAGLLVVGAAMGVRILLNRRGAAGEKVWDNVTVVVAA
FT                   GGLILAGSVLSQYPWRSVDGYVGHTPGVQFLALLSVAFLAASAVRLVNRPEPSEDGRSA
FT                   KPEHTGASAHAG"
FT   gene            complement(401170..401343)
FT                   /locus_tag="MSMEG_0360"
FT   CDS_pept        complement(401170..401343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74274"
FT                   /db_xref="InterPro:IPR022566"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPD5"
FT                   /protein_id="ABK74274.1"
FT                   /translation="MNRFVVPSAASIVVGLLLGAAAVFGVTLMVQQDTKPPLQAGDPAS
FT                   SVLNRVEYGDRS"
FT   gene            401448..402611
FT                   /locus_tag="MSMEG_0361"
FT   CDS_pept        401448..402611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0361"
FT                   /product="Glycosyl hydrolase family protein 3"
FT                   /note="identified by match to protein family HMM PF00933"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70873"
FT                   /db_xref="GOA:A0QPD6"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="PDB:4YYF"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPD6"
FT                   /protein_id="ABK70873.1"
FT                   /translation="MASPRLLATFVALSGLLLACSPAAPPDAGPSTGPSGSPDMQPMAT
FT                   TAPLPEAPATCDLAALPARDKLAQLLTVGVTDAADARAVVADHHVGGIMIGSWTDLSML
FT                   TDGSLGDIAASAAPLPLAVSVDEEGGRVSRLASLIGSQPSARELARTKTADEVYGIALD
FT                   RGRKMRDLGVTVDFAPVVDVTDAAADTVIGDRSFGSDPAVVTEYAGAYARGLRDAGVLP
FT                   VLKHFPGHGHASGDSHTGGVTTPPLDVLMGDDLVPYRTLTGQAPVAVMVGHMQVPGLTG
FT                   SDPASLSPAAYNLLRSGGYGGPGFGGLVYTDDLSSMGAINQRYGVADAVLRALQAGADN
FT                   ALWITTAEVPAVLDRLEQALASGELNQGAVDASLQRNAAVKGPLRCG"
FT   gene            complement(402623..403786)
FT                   /locus_tag="MSMEG_0362"
FT   CDS_pept        complement(402623..403786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0362"
FT                   /product="amidohydrolase 2"
FT                   /note="identified by match to protein family HMM PF04909"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABK76030"
FT                   /db_xref="GOA:A0QPD7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPD7"
FT                   /protein_id="ABK76030.1"
FT                   /translation="MDVFDGVENEVPGELAERLRTVGLIDHHVHGASAVRVGRAEFEAS
FT                   INEASTAPVPEFMTQFDSPLGLSIRRWCAPVLGLPAHASADEYFARRSEFAPAELSSTL
FT                   LAHAGVERWIVDTGFGTELITTPEQLAALSGRPASTILRLERLAEELLESHSGADDFVD
FT                   RFRSALDAAAQSTDIVGTKTIAAYRTGFDIDWARPGDDDVAARARAAADGPGPLRLQDP
FT                   VLVAFGVHEAAERGLPVQVHVGFGDRDLDLHRTDPLLLLPLLRCMAPVPVLLLHCYPFH
FT                   RQAGYLAQAFDHVHFDVGLAVNHLGTRSVGLVAEALETAPFAKQLYSSDAYGPPELHLL
FT                   GSVLWRRAMGLVLGGWVRAGDCTEIDAIRIVELIGAQNAARVYGLGR"
FT   gene            403864..404502
FT                   /locus_tag="MSMEG_0363"
FT   CDS_pept        403864..404502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0363"
FT                   /product="TetR-family protein regulatory protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69655"
FT                   /db_xref="GOA:A0QPD8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPD8"
FT                   /protein_id="ABK69655.1"
FT                   /translation="MGMAGGTKRLPRAVREQQMLDAAVQMFSVNGYHETSMDAIAAAAE
FT                   ISKPMLYLYYGSKEELFGACLDRELRRFVDTVRGQIDFSQSPKELLRTAVLAFLTYIDR
FT                   NRASWMVLYTQATSSQAFAHTVREGRERIIDLVARLLSTGTRNPQPDSDFEMMAVALVG
FT                   AGEAIATRVSTGDADVDEAAELMINLFWRGLKGTPSDAGTPPVSAGSSG"
FT   gene            404569..404868
FT                   /locus_tag="MSMEG_0364"
FT   CDS_pept        404569..404868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0364"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74963"
FT                   /db_xref="GOA:A0QPD9"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPD9"
FT                   /protein_id="ABK74963.1"
FT                   /translation="MGSPLKVAPGQLRSAAAEEVALGAAVAALGVGDLLSAAVAALPRL
FT                   QSGKACGHAAVIVDAAVKAAADEVAAHADKLSAAAAAYEGTDGEQAHRLIRTMD"
FT   gene            404871..406751
FT                   /locus_tag="MSMEG_0365"
FT   CDS_pept        404871..406751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06259"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73417"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR010427"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPE0"
FT                   /protein_id="ABK73417.1"
FT                   /translation="MPGSIFEVRSSDPDALVRAGADIGNRAGRLQAQMDRQQAVIDDLR
FT                   RGWNGASADAAIESAERSLQHMRRLHDSLTTLQSALQTGGADLAQQRDRIVNHVDQLHA
FT                   QGWQVADDGTVSIRPGSVLDFFAKVSPVQRVMLEALAARASAELKAMLAQFDATDVTVG
FT                   AQIRDAVAGLTAHGPAPASPPPNNAKALVDRLAGMTPDERREFLAGLSPETVHEMVLAD
FT                   PETMGNTDGVPFETRIEANDINIRNALEEELAKPSPDQARVQQLQAMLTPIKDPAGSGK
FT                   LVPRKFVAFSPDGNGRMIEMIGEIKPGIKGVGVVVPGTNTNLNGSGSNHTSAVELSKQS
FT                   GSPVFLYMDGDFPQGLDKAADPAYAASMAPKLVSFGHEIDREVGIGAPDTPVTYIGHSY
FT                   GGAIVGTAEQMGLRADRVLHASSAGTGILSGDYTNPNPNVQRFSMTAPGDPISLVQSLP
FT                   RDVAISSIPGVDSIPGIPHNTDGRIGNPLGGLPSATDPDNIPGVTRLDTGYYGAEGAHP
FT                   NQVIVGPDGHGKYWDDYDSDAFKNMVAVISGGEATGYVERGIETNYVDIDLGDDGDFRD
FT                   EAADQAKAGAAPKAPRLPWDDNGTYERRQHPWDNPRVTDNPGLGPRVPVR"
FT   gene            406748..407275
FT                   /locus_tag="MSMEG_0366"
FT   CDS_pept        406748..407275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0366"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72729"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPE1"
FT                   /protein_id="ABK72729.1"
FT                   /translation="MRFRAAVFVTTLMAVVLFATGACGPNGEDSTNDQKAQPPMTPPTE
FT                   LTVTEAARVAAGYVSMILGKPVDPDPAMARKIGCRTDDALMSVGPPWKVQVDEWLVDPA
FT                   PDLVEGALTRIDTLLDEGFEPIPSDRPDEDSPTHKAYRDARGYVVSVKAETTAGGVYGL
FT                   DVHATSPCADEG"
FT   gene            complement(407282..408355)
FT                   /locus_tag="MSMEG_0367"
FT   CDS_pept        complement(407282..408355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0367"
FT                   /product="O-demethylpuromycin-O-methyltransferase"
FT                   /EC_number="2.1.1.38"
FT                   /note="identified by match to protein family HMM PF00891"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69594"
FT                   /db_xref="GOA:A0QPE2"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPE2"
FT                   /protein_id="ABK69594.1"
FT                   /translation="MPPARLVRAVERARHHVRRLWLRSVPPEAAMLELLLGAWLAQGIT
FT                   AAAQLGVADALSGGPLRADELARRVGADADALDRLMRALVGEGVFRRTRDGRYALNPLG
FT                   DTLRTDAQVSMAGMAKFVGAAQHREHWSHLADAVRTGESAIRTLRGMEPFDYIASQPEL
FT                   GTIFNDAMTSMSELAITPLIAAYDFTRFGTIADVGGGHGRLLSAILGSAPQAKGVLYDL
FT                   PNVVEGAPEMLARHGVADRVQVIPGSFFDEVPDGADLYVMKNIIHDWADAPAAEILRNV
FT                   RAAARTGATLLLVEGVIPDHDRAFPLKWVDMEMLIGNAARERTEAQYRKLYTEAGFRLT
FT                   RVVPTACPYSLIEGVAI"
FT   gene            408516..409982
FT                   /locus_tag="MSMEG_0368"
FT   CDS_pept        408516..409982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0368"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72581"
FT                   /db_xref="InterPro:IPR021804"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPE3"
FT                   /protein_id="ABK72581.1"
FT                   /translation="MPDADVGRPSLQRLHELNREVAESRSVRLLVANNLAGYLTLMERH
FT                   LDRGTKLTEPELVARLERDLADLGADGEQSGLALIKYWASQGWLHRITEQAGDGERNVC
FT                   YLTYEARAVLDFARRMRREDTIATGGSIAGIAAGLRRVAGQVSNDPERIRADIEAEIDR
FT                   LRAELDALDEGRRPEPDPLDVEDEARAIALQMEQIISDIGQYGAMLNRITTRLLDASAD
FT                   SDVGYRERQRQLFDDYESLFASRESASYTAFTRMIQDPEQRAALVADIELVTSQLPQLD
FT                   PSLREVMSGFFTLVSAQTAEVGRTRQRCARRIKRFVASGTLEESRGVTRQLNDALAAAN
FT                   ALLSVSLADSRVGFEVPLARADFNSIGAVAFKIRDAVPPTPAQPSEGEVNLSAFGALAA
FT                   QVDATELAELVNDTVVSRPLPLNEAIGMLDSAYLGHVIVLWSWALKQPAVGNAESVRVR
FT                   FRSLEGPDREIEVPKLVFTEPIPIVSESLL"
FT   gene            409979..410701
FT                   /locus_tag="MSMEG_0369"
FT   CDS_pept        409979..410701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0369"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70333"
FT                   /db_xref="InterPro:IPR025449"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPE4"
FT                   /protein_id="ABK70333.1"
FT                   /translation="MSDTSIDFDALPSIDAVERSAPERRAPRFDGDVSELPDRACWALQ
FT                   HLLSRRYISKHNHTELWSWVTRYRTELTVRLSELDLRLVVSDDHEIAYVEQAEYESHWR
FT                   RKLLRRETLNTYDSILALHLAKLMRSANRDENVLITREDIHELFAAVNNDTDRDVASFD
FT                   RRIDNAIERLTDIEILVRNREDEDSFTISPVINAIMTASTITELTQQFEQLRRAASGDP
FT                   DPDPDPAAAEDEVDADGI"
FT   gene            410691..414047
FT                   /locus_tag="MSMEG_0370"
FT   CDS_pept        410691..414047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABK76126"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPE5"
FT                   /protein_id="ABK76126.1"
FT                   /translation="MASEPTNQFYLSRLQVINWGVFDGYHSIPFSPAGTLITGSSGSGK
FT                   SSLLDAISLAFLPSHRRNFNASGDTTAAGSGTGKRTVDKYVRGAWGERRDGTSRQIMYL
FT                   RGTGPAWSAVAVTYSDRTGRAVTGLVLKWLAAEKTSDPGSRYYLIDDDRDIFDLCNRWA
FT                   AGGYDASVFREAGWNGGRSESQYLAQLYSIIGIRASEAAQQLLGKAKSLKSVGGLEQFV
FT                   REFMLDEPASLAGVDEALEQINPLVEARGMLDVARRKRNTLGNIEAVQARYADEAAKFG
FT                   VIDTIDNAMVRDYVDQLRLQQAGPEIENLDDQINQLGAQRDDFGAQQRQLKNEHNALMA
FT                   QINSASVDLVPLQQRLSEAEKLADEVGRRRGAYEDKVTALQLTPPDTAEEFWSLRETLM
FT                   EEADRLHRELFTGNQAYVEASAKEVRAREARDAVQTELERVRRLGSSLPKTEYEMRARI
FT                   ARAIGIPERDLMYVAELMELKPDESRWRMAVEKVLRGAGLRLLVPEAHLDAALRFVNEN
FT                   DMRGRIQLQHVKHDAQLRTPLEGTLASKLQVVDPTHDSAVEALNVIASVGDYMCVDSPD
FT                   EFTTHTRAVTDQGLRKDSGRLSIKDDRSKLRPSDYIFVGGTEAKVAALQADLAAAEDVY
FT                   AAARKARERLDQHRAALQARERACRALCDQYMQWTDIDTDSADEALTRLQDELDLLVSD
FT                   NPDVEKLQQRADECWERVEKVIQQIGSLNERETLLDNRRTALLELTERLKPGEISQHAR
FT                   DTLDGYAADIALPLDLLDSEPFRNELVRVIGRERDRLRADRNRSHDELAGIMAAYDSSF
FT                   PDAIPNDSDDFDERVHDYVALCRRIDERELPDAYERMQRLITEQAPGAILNLHMIADNE
FT                   ARRITEQIARVNTGLGAVEFNRGTRLTLHAGTRHLAAVDELNEMAQRISARVSLVSFGD
FT                   ETAMFEQYTDILQLRKLLAGNTPEDRQWTRDALDVRNRFVLYCEERDAETGVVIRTYSN
FT                   SGDNSGGEQEKLMAFCLAGALSFNLASPGSADTRPMFAQLMLDEAFSKSDPQFAQQALS
FT                   AFRKFGFQLVIVATVQNTTTIQPYIDSVVMVSKSDASAPNARPVASVTAASIAEFGELR
FT                   RGAEPEAVPAP"
FT   gene            complement(414063..414920)
FT                   /locus_tag="MSMEG_0371"
FT   CDS_pept        complement(414063..414920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0371"
FT                   /product="MaoC like domain protein"
FT                   /note="identified by match to protein family HMM PF01575"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73237"
FT                   /db_xref="GOA:A0QPE6"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPE6"
FT                   /protein_id="ABK73237.1"
FT                   /translation="MADTQTTQPSGLKNMARAVVGALPFVTRSESLPKRTVTVDDLTID
FT                   PANVAEYAQVTGLRFGDAVPLTYPFTLTFPAVMSLVTGLDFPFAAMGSVHIENHITQYR
FT                   PIAVTDTVGVAVHAENLREHRRGLLVDIVTDVKVGNELAWHQVTTFLHQQRTSLSGEPK
FT                   PPPQKQPKLPPPNAVLRITPGQIRHYAAVGGDHNPIHTNAIAAKLFGFPTVIAHGMFSA
FT                   AAVLANIEGQLSDAVKHSVRFAKPVVLPAKAALYVERDADGWELTLRHLTKGYPHLTAT
FT                   VTPL"
FT   gene            complement(414922..416274)
FT                   /locus_tag="MSMEG_0372"
FT   CDS_pept        complement(414922..416274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0372"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family protein"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73905"
FT                   /db_xref="GOA:A0QPE7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3U0B"
FT                   /db_xref="PDB:5VP5"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPE7"
FT                   /protein_id="ABK73905.1"
FT                   /translation="MASDLFSQVVNSGPGSFLAKQLGVPQPETLRRYRPGDPPLAGSLL
FT                   IGGSGRVAEPLRTALADDYNLVSNNIGGRWADSFGGVVFDATGITEAEGLKELYTFFTP
FT                   LLRNLAPCARVVVVGTTPAEAGSVHAQVVQRALEGFTRSLGKELRRGATVSLVYLSADA
FT                   KPGATGLESTMRFILSAKSAYVDGQVFRVGAADSTPPADWDKPLDGKVAVVTGAARGIG
FT                   ATIAEVFARDGATVVAIDVDGAAEDLKRVADKVGGTALTLDVTADDAVDKITAHVTEHH
FT                   GGKVDILVNNAGITRDKLLANMDEKRWDAVIAVNLLAPQRLTEGLVGNGTIGEGGRVIG
FT                   LSSMAGIAGNRGQTNYATTKAGMIGLAEALAPVLADKGITINAVAPGFIETKMTEAIPL
FT                   ATREVGRRLNSLFQGGQPVDVAELIAYFASPASNAVTGNTIRVCGQAMLGA"
FT   gene            416355..417653
FT                   /locus_tag="MSMEG_0373"
FT   CDS_pept        416355..417653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0373"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70351"
FT                   /db_xref="GOA:A0QPE8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPE8"
FT                   /protein_id="ABK70351.1"
FT                   /translation="MANESRRRVAVLGGNRIPFARSDGAYANASNQDMFTAALGGLIDR
FT                   FNLAGEQLGAVIGGAVLKHSRDFNLMRECVLGSALSPYTPAFDIQQACGTGLQAAIAAA
FT                   DGIAAGRYESAAAGGVDTASDAPIAFGNDLRRVLLGLRRAKSNVDRLKLVGKLPASLGV
FT                   EIPVNSEPRTGMSMGEHAAVTAKAMGIKRVEQDELAAASHRNMAAAYDAGFFDDLVTPF
FT                   LGVYRDNNLRADSSVEKLAKLKPVFGVKAGDATMTAGNSTPLTDGASVALLAGEDWAQA
FT                   RGLEPLAYFVDAETAAVDYVNGPDGLLMAPTYAVPRLLARNNLTLQDFDFYEIHEAFAS
FT                   VVLAHLQAWESDEYCKERLGLDKALGSIDRTKLNVNGSSLAAGHPFAATGGRIVAQLAK
FT                   QLAEKKKSTGRPVRGLISICAAGGQGVAAILEA"
FT   gene            complement(418197..420065)
FT                   /locus_tag="MSMEG_0374"
FT   CDS_pept        complement(418197..420065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0374"
FT                   /product="glycolate oxidase subunit"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02913"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74706"
FT                   /db_xref="GOA:A0QPE9"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPE9"
FT                   /protein_id="ABK74706.1"
FT                   /translation="MSALTAPNVTVDKTLIHRFTEAVAGHAEVITDGAVLDARGHDFWG
FT                   VGGTAELLLHPHDRDEVAAIMRIASQHQVPIVPRGGASNCSGGMMPARGRVLLDLSNLN
FT                   RIIDVDVESRCARVEPGVINSALQEHLAPYGLCFSPDPVSAHLATVGGNIIENAGGPHA
FT                   LKYGVTYNHILGVEVVLPDGTTVTLDAEDDGPDLLGLVVGSEGTLGIVTEATVALRPVA
FT                   EVTHSLMGAFATAREAADTIAAIIATGVVPAAVEWLDHDGIMGLQQFYDTGYPLDADSI
FT                   VLIDVDGTADEVARDQAIVERVLRERATTVRIAEDEKDRAALWYGRLHAPDSVVQSGKG
FT                   FFIGDVTVPRDRIPEMQEAIGATAERHKDGLLFIAVCGHAGDGDLHPTTFYDKDNPLAA
FT                   SALEAANNEIIEAALRLGGTITGEHGVGTEKIQFMTKRFTPVEIAAQRAIKEAFDPAGL
FT                   LNPGVMLPEQSPDEPVTAAFGTAVRDAVEGTLLTDPGAALTTGTDTGIAANLGNLSLVV
FT                   GADATVEQINRYLDDHGIFCPAVPATGGERSIGEVVATATGAERIGIRHALLGADVTVV
FT                   DGNAAARFGAETMKDVAGYDAKRLYIGGHGAFGALRTLIFKICVRR"
FT   gene            complement(420213..421805)
FT                   /locus_tag="MSMEG_0375"
FT   CDS_pept        complement(420213..421805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0375"
FT                   /product="phospholipase D family protein"
FT                   /note="identified by match to protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75641"
FT                   /db_xref="GOA:A0QPF0"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPF0"
FT                   /protein_id="ABK75641.1"
FT                   /translation="MMAGLADWFLTAEERGNPHTSLPDWFTGNNVEVLVHGATYFDRLT
FT                   DEVEKLGRGDHLFFTDWRGDPDERTRDGGPTIAELFCRAAQRGVVVKGLMWRSHLDQFA
FT                   YSEEQNRHLGEAIERAGGEVLLDQRVRIGGSHHQKLVVLRHPASPQRDVAFAGGIDLCH
FT                   SRRDDAGHRGDPQAVPMGRQYGDHPPWHDAQLQIRGPAVGALDLTFRERWTDPAPLDML
FT                   SPIAWITDKLRRSDLSADPLPGRPPDPPPCGTQAVQVLRTYPDAHFEYDFAPRGERSIA
FT                   RGYTKAVLRARRLIYLEDQYLWSKQVSRLFAAALAANPDLHLIAVVPRHPDVDGRLSLP
FT                   PNQVGRQQAIATCRRAAPDRVHVFDVENHKGTPVYVHAKVCVIDDVWASVGSDNFNRRS
FT                   WTHDSELSCAVLDDEREEREPRDPAGLGDGARVFARELRLKLLREHLDLDGKNDDAALI
FT                   DPSDAVAAVNASANALQAWYDSGRTGPRPPGRLRPHRPERLGLLTRAWAEPVYRAVYDP
FT                   DGRNYRDRLRRYW"
FT   gene            421882..422928
FT                   /locus_tag="MSMEG_0376"
FT   CDS_pept        421882..422928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0376"
FT                   /product="transcriptional regulator, AraC family protein"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71864"
FT                   /db_xref="GOA:A0QPF1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPF1"
FT                   /protein_id="ABK71864.1"
FT                   /translation="MPWNEDEGMPPVLSDPRTVVFALYDKVTLADVAAPLEIFARANDF
FT                   GANYTVLLASLTGTAVGTTAFAKLDANVALDEVPAAVDTLVVPGGVPAGFSFTPGLHDI
FT                   PEEPTPDTIPDAVHLVRHLAPRARRVASVCTGAFVLAALGLLNGRRATTHWAHCQTLAR
FT                   NYPHVRVDPDSLFVQDGRFFTGAGISAGTDLALALVESDHGPTMARRVARWMVVFLQRP
FT                   GGQAQFSVWSGLPAADGLREIMDSVIAHPGAEHSLAALAARAAVSERHLVRMFREQVGM
FT                   TPARFVEQARLEAAKVLLATGDQSQDAVARLVGFGSPDTMRRTFRRNLGISPGLYRNRF
FT                   RTTGIDRQ"
FT   gene            422996..423736
FT                   /locus_tag="MSMEG_0377"
FT   CDS_pept        422996..423736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0377"
FT                   /product="nitrile hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72826"
FT                   /db_xref="GOA:A0QPF2"
FT                   /db_xref="InterPro:IPR003168"
FT                   /db_xref="InterPro:IPR008990"
FT                   /db_xref="InterPro:IPR024690"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPF2"
FT                   /protein_id="ABK72826.1"
FT                   /translation="MRLQHFIGGLEGLTGPLDFEKRVFVEDWEKRIFGIHVAMMALSTH
FT                   LGEALPGYRVADVPTTFREKWTWAHLRTGAEGMNPFDYFKFRYYEKWLGGISQFFVDKG
FT                   YLSEDEIRAAPVGSPPKAPAPGVKAAIDDQVLDYLRRGDSPRRGSAIPRFAPGDKVRIA
FT                   DVPAGEHTRLPGYLRNRTGTVERCFEGEYSYFVHTGDGIGDPMPIYIVEFTPRELWGAR
FT                   AEPGASALYAELFEAYLSPVEEDQ"
FT   gene            423733..424353
FT                   /gene="nthA"
FT                   /locus_tag="MSMEG_0378"
FT   CDS_pept        423733..424353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nthA"
FT                   /locus_tag="MSMEG_0378"
FT                   /product="nitrile hydratase, alpha subunit"
FT                   /EC_number="4.2.1.84"
FT                   /note="identified by match to protein family HMM PF02979;
FT                   match to protein family HMM TIGR01323"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69995"
FT                   /db_xref="GOA:A0QPF3"
FT                   /db_xref="InterPro:IPR004232"
FT                   /db_xref="InterPro:IPR018141"
FT                   /db_xref="InterPro:IPR023900"
FT                   /db_xref="InterPro:IPR036648"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPF3"
FT                   /protein_id="ABK69995.1"
FT                   /translation="MSDQFAYPAEREQDSARRVAALERLLIEKGVITDQTVDKVLGYFE
FT                   SEMTPLNGKKIVVKAWTDPDFAARVVTDTPAALAELDLPEGMAGAEGEHIQAVANAPGI
FT                   HNLVICTLCSCFPWPVLGLPPYWYKDPVFRARAAREPRTVLAEVGVDLPDDTEIRVWDS
FT                   SGHSRWFVIPERPAGTDDLTDEQLMDLVTTESMIGVALAGRPA"
FT   gene            424350..424631
FT                   /locus_tag="MSMEG_0379"
FT   CDS_pept        424350..424631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0379"
FT                   /product="nitrile hydratase activator P14k"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69566"
FT                   /db_xref="GOA:A0QPF4"
FT                   /db_xref="InterPro:IPR008990"
FT                   /db_xref="InterPro:IPR023808"
FT                   /db_xref="InterPro:IPR024690"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPF4"
FT                   /protein_id="ABK69566.1"
FT                   /translation="MKLHQTCTTDQAAPSFDHEWQRRAFGLALALSEFGHYPWSEFQQS
FT                   LIDAIGAWDASTGSDSDSHADWQYYDHWVAALEKVVAQRGLLAEAAGS"
FT   gene            425344..425763
FT                   /locus_tag="MSMEG_0380"
FT   CDS_pept        425344..425763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0380"
FT                   /product="MmpS4 protein"
FT                   /note="identified by match to protein family HMM PF05423"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABK76107"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YHI9"
FT                   /protein_id="ABK76107.1"
FT                   /translation="MRRLWIPLLVIAVVAVGGFTVSRLHNVFGAEKRPSYADTKAADSK
FT                   PFDPKRLTYEVFGPPGTLADISYFDEDSNPQFVEKVSLPWSLHFDIGKTTAVGSIMAQG
FT                   DSDTIGCRIIVDDEVKAEKVSNQTNAFTSCLLKAA"
FT   gene            425760..428642
FT                   /locus_tag="MSMEG_0381"
FT   CDS_pept        425760..428642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0381"
FT                   /product="Mmp14a protein"
FT                   /note="identified by match to protein family HMM PF03176;
FT                   match to protein family HMM TIGR00833"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73197"
FT                   /db_xref="GOA:A0QPF6"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPF6"
FT                   /protein_id="ABK73197.1"
FT                   /translation="MTEPATTQNREARPRIASFIRRFSVLIILAWIVVAALATFAIPPL
FT                   EVVEREHSVSLSPPDAPSVQAMKRMGEVFQESNSNSVAVLVLEGQEPLGDDAHRYYDEI
FT                   IRKLKDDPEHVQHVQDFWGDPLTAGAAESGDRKAAYVQINLHGSFGQAEANESVKAVQD
FT                   AVESTPAPPGVQAFVTGPAAIVADMGESGNKTVLLITLVTVGVIFLMLLLLYRRVLIVL
FT                   ILLATVAIELQVARGLVSFLALNGIVGLTTYVVNLLVSVGIAAGTDYGIFFAGRYQEAR
FT                   QAGEDREQAYYTSFAGVAKVVLASGATIAGAIACLSFTRLPYFQPLGIPGAVGIGVAVA
FT                   VALTLVPACIAATNRFGWFDPRRLVTTRRWRRIGTAVVRWPAPILIATIAVAVIGLLTL
FT                   PGYNPSYSDQKYIPQDIPANQGFAAAARHFPESKMTTPDILLVEADHDMRNSADLLVLN
FT                   KLAKAVFAVPGVSNVQAITRPEGTPIEHTSIPFMLSMSNASQRLSLPFQQQRMEDLLKQ
FT                   ADELTKNIALMKHMYALMQEMVATTHSTVETTHEVQQTTKDLRDSIEDFQDFWRPIRNY
FT                   LYWEPHCYDIPLCWSIRSLFDGLDGINEVTDKMGDLVEDLDHLDTLMPQMLLQFPPMIA
FT                   MLENSRSMILTMHSTMSGIFSQMDDSTDNATAMGKAFDAARNDDSFYLPPDILENEDFK
FT                   RVMKIFMSPDGKAARMLITQRGDPATPEGIALVEPIRVAAEEALKGTPLESAELHLAGT
FT                   AAGVKDLVDGSKIDLLIAGVAALCLIFIIMLIMTRSFIAALVIVGTVAMSLGASFGLSV
FT                   LVWQHLLGIQINWVVLAMSVIVLLAVGSDYNLLLVSRMKEEIGAGLNTGIIRAMGGTGK
FT                   VVTAAGLVFAATMASMIVSDLLTIGQVGTTIGLGLLFDTLVVRAFMTPSIAALLGRWFW
FT                   WPQRVRQRPASAMLRSVGPRPLVRSLLLRD"
FT   gene            428652..431636
FT                   /locus_tag="MSMEG_0382"
FT   CDS_pept        428652..431636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0382"
FT                   /product="putative transport protein"
FT                   /note="identified by match to protein family HMM PF03176;
FT                   match to protein family HMM TIGR00833"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73006"
FT                   /db_xref="GOA:A0QPF7"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPF7"
FT                   /protein_id="ABK73006.1"
FT                   /translation="MSTEQSGTEKARRPFFARAVRTLSPFIIVGWLAVILVTTLAAVGG
FT                   DWSAAIPALERVGEKNSVSLMPQDAPSAKAMKHMGQKFEESDSDSFAMIVLEGQEPLGP
FT                   DALDYYTGLISELRNDSKHVEHVQDLWGDRLTASSAQSADGKAAYVQLNLAGNQGTPLG
FT                   DESVAAVRDLVARTPAPEGVSVYVTGAAPLVSDMQHSGNRSILKITAVTVVIIFAMLLM
FT                   VYRSVITVILLLIMVGFEVAAARGIVAFLGANEVFVLSTFAVNMLVFLAIAAGTDYGIF
FT                   FFGRYQEARAAGEDRETAYYSMYRGVTPVVMASGLTIAGAIFCLTFTRLPYFHTMGVPC
FT                   AIGMLAAVAVAVTLVPAGVALAGRIGWLEPKRKMRVRRWRGIGTAIVRWPAPILVASLA
FT                   VALVGLLALPGYETSYNDRDYIPADIPANAGFAAADRHFSQARMTPDILMVESDHDMRN
FT                   PTDFLVLNKIAKAIFKVRGVSRVQGITRPEGTPIERTSIPFLLSLQSAGQVQATNFQKQ
FT                   RIGDMLKQVDDMNMMIGVMKTTYGVLQELAATTHSLNGSTHELRDVARDLRGSIAIFDD
FT                   LLRPIRNYFYWEPHCYNIPICWSLRSIFDAMDGVDRLNDELQVLVDNMDRLDALVPELV
FT                   AQFPEYIASMETFRELTLTSYSTFSGLLQQMDEQTEDVTAMGQAFDAAKNDDTFFLPPE
FT                   VFDNPDFKRAMTSFLSPDGKAARFIISHNGDPATPEGISRVDQMQTAAVEALKGTPLTD
FT                   AQVYLAGTAPTAKDWKDGSTYDLLIAGIAAMCLIFIIMLIVTRSFIAALVIVGTVVLSL
FT                   GASFGLSVLLWQYILGIHLHWMVLAMSVIILLAVGSDYNLLLVSRIKEEVGAGINTGIV
FT                   RAMGGTGKVVTSAGLVFAGTMAAMVVSDLRIIGQIGTTIGLGLLFDTMIVRSFMTPSIA
FT                   ALLGRWFWWPQKVRPRPASALLEPYGPRPLVRALLEGPSGAASPGGPGGRLSDDDTPTG
FT                   PMRTR"
FT   gene            complement(431707..432045)
FT                   /locus_tag="MSMEG_0383"
FT   CDS_pept        complement(431707..432045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0383"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72032"
FT                   /db_xref="GOA:Q2YHI6"
FT                   /db_xref="InterPro:IPR016572"
FT                   /db_xref="InterPro:IPR032407"
FT                   /db_xref="UniProtKB/TrEMBL:Q2YHI6"
FT                   /protein_id="ABK72032.1"
FT                   /translation="MIRKSLTRFGVAVGAAALSLGAATGVASAEPDITPLVDSPCNFDQ
FT                   AMTAVRTENPMAAQYLDKYPANIEFIRVFLASPRDQRVNLLNQIKNNPGANVALPVFQQ
FT                   MLTSCVKY"
FT   gene            complement(432229..433095)
FT                   /gene="rfbA"
FT                   /locus_tag="MSMEG_0384"
FT   CDS_pept        complement(432229..433095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="MSMEG_0384"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM TIGR01207"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72771"
FT                   /db_xref="GOA:A0QPF9"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QPF9"
FT                   /protein_id="ABK72771.1"
FT                   /translation="MRGIILAGGSGTRLHPLTIGVSKQLLPVYDKPLVYYPLSTLIMAG
FT                   IRDILVITTPADAPAFRRLLGDGSDFGVNLSYAAQNEPEGLAQAFLIGADHIGNDTVAL
FT                   ALGDNIFYGPGLGTSLRRFEHVSGGAIFAYWVANPSAYGVVEFDADGKAVSLEEKPKTP
FT                   KSHYAVPGLYFYDNTVIDIARSLKKSARGEYEITEVNQIYLNRGQLSVEVLARGTAWLD
FT                   TGTFDSLLDASDFVRTIELRQGLKVGAPEEIAWRAGFIDDDQLATRAKELLKSGYGHYL
FT                   LQLLDRE"
FT   gene            433614..434870
FT                   /locus_tag="MSMEG_0385"
FT   CDS_pept        433614..434870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0385"
FT                   /product="putative glycosyl transferase"
FT                   /EC_number="2.-.-.-"
FT                   /note="identified by match to protein family HMM PF03033"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71089"
FT                   /db_xref="GOA:A0QPG0"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPG0"
FT                   /protein_id="ABK71089.1"
FT                   /translation="MASYGTRGDVEPAVAVARELRRRGHDVCIAVPPDLVRFAEDAGLS
FT                   ATSYGMEVEPQLDAYRDIWTSWARKLWRLQDFVNLCREALGVTISQWEDIGKTLVTLAD
FT                   GADLLTTGVGFEQPAANVAEYYGIPLIALHTFPWRPNGRLVPAIPPLLTRSAMNVYDWL
FT                   GWRLTKQAEDAQRRELGLPMATSAARQRMAERGVLEIQAYDAISFPGLADEWARYGARR
FT                   PFVGTLTMELATADDSEVTSWIAHGTPPICFGFGSIPVESPAETIDMIASACAELGERA
FT                   LVCAGGTDFGDSPRFEHVKVAGTVNYATVFPVCRAVVHHGGSGTTAASLRAGVPTLTLW
FT                   TAGDQPFWGAQLKKLKVGASRRFSATTRDTLVSDLRRILSPEYAVKAREVATRMTNPAE
FT                   SVSRAADLIEQNLDPTRRS"
FT   gene            434928..436061
FT                   /locus_tag="MSMEG_0386"
FT   CDS_pept        434928..436061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0386"
FT                   /product="NAD dependent epimerase/dehydratase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF04321; match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72522"
FT                   /db_xref="GOA:A0QPG1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPG1"
FT                   /protein_id="ABK72522.1"
FT                   /translation="MVENQYRFFTTLQANGRRRLLSNTVLITGGAGFIGSALAQRLTHE
FT                   GYEVAVMDLLHPQVHARGSKVDLPRSVRLFTGDVTHAPDWDAVLRLFQPAQVVHLAAET
FT                   GTAQSLSEATRHSSVNVVGTTQLLDALSRADLVPDQIVLASSRAVYGEGEWRTATDSTF
FT                   YPLPRSHAQLAAGRWDPVGPNGEHAVPLPSCASRTEPRPTNVYAATKLAQEHVLTAWTA
FT                   AHDTKLSVLRLQNVYGPGQSLTNSYTGIVALFARLAREQQTLEVYEDGNILRDFVFIED
FT                   VVEALYAAIRRPADQRRCLDIGSGVGSSIHALAQKVAGICGAPTPKVVGKFRDGDVRAA
FT                   SCDIEPARMELDWRPKWTLDDGLPALLDWIAKSDVSH"
FT   gene            436310..437044
FT                   /locus_tag="MSMEG_0387"
FT   CDS_pept        436310..437044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0387"
FT                   /product="Rmt2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPG2"
FT                   /protein_id="ABK71734.1"
FT                   /translation="MLQALGPDLSRSVTMTADDSVPEETSIGRIFEGTHDVHKLRHYLP
FT                   IYERVLTNAGKMLEIGVDRGGSLEMWRQYLPETTIVGVDINPRAAQYDDPDRRIHVRIG
FT                   DQTNTHFLQAVLDEFGAFDTVLDDGGHTPKQMISSFQYLFPRLKAGGVYVVEDVCANYW
FT                   TSYRDQPESFIDFTRWLMDAMHAPYMRMNSVFQIMEGHQKRLRHVEVPYAATIIDRIEV
FT                   FDSVVVIHRADESKRLPRAAYQ"
FT   gene            437374..438096
FT                   /gene="tylF"
FT                   /locus_tag="MSMEG_0388"
FT   CDS_pept        437374..438096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tylF"
FT                   /locus_tag="MSMEG_0388"
FT                   /product="Macrocin-O-methyltransferase"
FT                   /EC_number="2.1.1.101"
FT                   /note="identified by match to protein family HMM PF05711"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74140"
FT                   /db_xref="GOA:A0QPG3"
FT                   /db_xref="InterPro:IPR008884"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPG3"
FT                   /protein_id="ABK74140.1"
FT                   /translation="MPVGWDWFHRPLFKIGNLMLVRRRPFDPRKRDLGLDWPADALTMI
FT                   GMTRLTSLQQCVETVITEDVPGDLVECGVWRGGASILMRAVLSAYGDESRRVWLCDSFA
FT                   GVPAPDAAKYKADKGDRLHLAAPILAVSEQDVRANFQRYGLLDDQVRFVPGWFKDTLHD
FT                   APIERISILRLDGDLYESTIQALDGLYERLSPGGFCIVDDYHAIDGCRQAVTDYRAKHG
FT                   ISAEIVEIDGTGVLWRKE"
FT   gene            438130..439398
FT                   /locus_tag="MSMEG_0389"
FT   CDS_pept        438130..439398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0389"
FT                   /product="putative glycosyl transferase"
FT                   /EC_number="2.-.-.-"
FT                   /note="identified by match to protein family HMM PF03033"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73165"
FT                   /db_xref="GOA:A0QPG4"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPG4"
FT                   /protein_id="ABK73165.1"
FT                   /translation="MKFVLASYGTRGDIEPSVVVGRELQSRGHTVLMAVPPDLIEFTEA
FT                   ANLRTVAYGLDTKTWLDIYRNFWTFALHRFWKAREIRSLWREMWDLSDECWAQMNATLR
FT                   SVAADADVLFAGQSYQEPAANVAEFYDVPLVTLHHIPMRPNGRLVTFLPPVLARASMTA
FT                   FDWFAWRLNKKVEDAQRRDLGLPKATGPSTQRIADRMSLEVQAYDEVCFPGLAEEWAKW
FT                   GELRPYVGTLTMELTTPADEEVSSWICGGTPPICFGFGSMPVESPADTVAMISSVCAEL
FT                   GERALICAGWSDFSDVALADHVKVVGAVNYATVFPGCRAVVHHGGSGTTAASLRAGLPT
FT                   LVLSMDANQALWGAQIKRLKVGTTRRFSKTNRRTLIADLRTILDPAYAARAQALARGMT
FT                   RPAESVVRAADVIEAFARSRCSA"
FT   gene            439605..440687
FT                   /locus_tag="MSMEG_0390"
FT   CDS_pept        439605..440687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0390"
FT                   /product="putative acyltransferase"
FT                   /note="identified by match to protein family HMM PF01757"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75432"
FT                   /db_xref="GOA:A0QPG5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPG5"
FT                   /protein_id="ABK75432.1"
FT                   /translation="MGKVFDPRNNALNALRLLLAVGVILWHSWPLSGHGVTYKPLEQLL
FT                   EQVWVDGFFAISGFLITSSWLRNPRLRDYATARVLRIFPGLWVCLLIIAFVMAPIGVLL
FT                   QGGSVSGLMSSYAPIEYVLNNAVLNVYYAGINGTPQGIPWPGVWNGSLWTLVFEMICYI
FT                   AVAVLGIVGLLKRRWVIPAIFVLTLCATAYFSYPVFAMQTIPQMVARFAVMFAAGALIH
FT                   QYRDVIPARWSLVGIAVVLVLASGFLSNYRVIGALPLAYAVIVAGALLRNRRLNLRNDL
FT                   SYGVYIYAFPVQQLLAILGFANSQPFLFFVIATAATVPLAALSWFLVEKRAIALKSRLK
FT                   RRRTDTVADTTQKVSDRGAG"
FT   gene            440861..441649
FT                   /locus_tag="MSMEG_0391"
FT   CDS_pept        440861..441649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0391"
FT                   /product="Rmt3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71204"
FT                   /db_xref="InterPro:IPR008884"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPG6"
FT                   /protein_id="ABK71204.1"
FT                   /translation="MANGLSVRARLLTQAVRAEYWLARKLLPDVYSNDALICFNSHAFM
FT                   DDPDFQRAYRRGARALGDNDWYQWHWRVHVGLWAAASASKIDGAFVECGVSYGFLSSAI
FT                   MEYLDWDKLGKTFYLLDTFAGLDPRYVTEAERASGALERSEEHLRNGFYVDSVDSVRAN
FT                   FAQWKNQRIIVGAVPETLAEVDAEAVAFLHIDMNCAPPEVATLRYFWPRLSPGAFVLLD
FT                   DYANRGRDEQRVAMDEVASELGVQICTLPTGQGLLIKPPL"
FT   gene            complement(441687..443201)
FT                   /locus_tag="MSMEG_0392"
FT   CDS_pept        complement(441687..443201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0392"
FT                   /product="putative glycosyl transferase"
FT                   /EC_number="2.-.-.-"
FT                   /note="identified by match to protein family HMM PF03033"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71212"
FT                   /db_xref="GOA:A0QPG7"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPG7"
FT                   /protein_id="ABK71212.1"
FT                   /translation="MFSLHATRSRASTNAFPRAIFEVSRTTRERTTRTEKFSDCDARQH
FT                   LCPAQEPVAAREAIPPNLTRYGPLRAGWAIIPAHANPRGLIRMKFALACYGTRGDVEPS
FT                   VAVGRELQRRGHEVCVAVPPGLVAFAETAGLDAVAYGPELDNFLRDDFLRNFWMQMIRN
FT                   PVGSLRELWAPITRYWNDTSKVLTTLADGADLLSTGINFEQAAANVAEHYDIPFVSLHH
FT                   FPMRPNGKLVPALPASVVRSVGALSEWLFWRSTKEVEDAQRRELGLPRTKVPSPRRIAE
FT                   RGSLEIQAYDAVSVPGLADEWADQNRQRPFTGALTMSLSTEADDDVTSWITSGEPPICF
FT                   ATGSIPVQSPTATIEMISHACDQLGQRALVCAGGTDLRGVPQFDNVKMVGAVNYAAVFP
FT                   LCRGIVHHGGSGTTAASLRAGVPTLILWSTADQPYWGNQLKRLKVGTSRRFSGASRKSL
FT                   VTDLRRILRPEYAVRARELAMRMTPAAESVTIAADLYENAVRQAAM"
FT   gene            443164..443967
FT                   /locus_tag="MSMEG_0393"
FT   CDS_pept        443164..443967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0393"
FT                   /product="Fmt protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70254"
FT                   /db_xref="GOA:Q9RMN9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RMN9"
FT                   /protein_id="ABK70254.1"
FT                   /translation="MEARDRVAWRLNIKVAQQAQKLVYRYATRRLKDDDVVFLNYGYEE
FT                   DPPMGIPLSESDELNRYSIQLYHSTAAQADVEGKRVLEVGCGHGGGASYLARTFRPATY
FT                   TGLDLNSDGINFCRRRHNIAGLEFVQGDAQDLPFPDKNFDAVLNVESSHLYPRFDVFLT
FT                   EVARVLRPGGYFLYTDARPRYDIPEWERALADAPLQMLSQRAINFEVVRGMEKNLDALE
FT                   SVVDRVAPALLRDWIQKYGPARRAYEELRENTTEYRMYCFVKPAE"
FT   gene            444075..444329
FT                   /locus_tag="MSMEG_0394"
FT   CDS_pept        444075..444329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0394"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72275"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPG9"
FT                   /protein_id="ABK72275.1"
FT                   /translation="MNLVQSIERGLDWLAAPKRLPGRLEMETQRGKRLELEVVSFAVRM
FT                   PIAGGAVVRVPLFFMLMPRGSSPIEGTQVSAEDSAVDGK"
FT   gene            444662..444796
FT                   /locus_tag="MSMEG_0395"
FT   CDS_pept        444662..444796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0395"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70525"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPH0"
FT                   /protein_id="ABK70525.1"
FT                   /translation="MLVRPWAPQIRTPRSLAGLIMSAVGDSIRSHRGNCAELGKRPIG"
FT   gene            complement(445187..445585)
FT                   /locus_tag="MSMEG_0396"
FT   CDS_pept        complement(445187..445585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0396"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75135"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPH1"
FT                   /protein_id="ABK75135.1"
FT                   /translation="MSAAGATVTADRDQQSRGSPPERFMSQRASHAVTYNAFFAAAAAP
FT                   PILIGDPARQHGPIRVEALAGHLQPELVEAAESRQVSAGEARPTGSVRHVEVFQMDGVG
FT                   TSIIGRPRPLSRHRRADDLYTLNCEEPV"
FT   gene            445304..446626
FT                   /locus_tag="MSMEG_0397"
FT   CDS_pept        445304..446626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0397"
FT                   /product="IS1096, tnpA protein"
FT                   /note="identified by similarity to GP:150005; match to
FT                   protein family HMM PF01610"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71826"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNX9"
FT                   /protein_id="ABK71826.1"
FT                   /translation="MPDATGRAGFACADLTTFCRLDELGLEVTGQRLDPDRAVLACRVA
FT                   DEDRWCRRCGEEGVVRDSVTRTLAHEPFGWRPTALLVTIRRYRCAGCAHVWRQDASAAA
FT                   EPRARLSRRALRWALEALVCQHLSVARVAEALAVSWNTANNAVLAEGQRVLIADPARFD
FT                   GVAVIGVDEHVWRHTRRGDKYVTVIIDLTPVRDGTGPARLLDMVEGRSKKAFADWLAQR
FT                   PQEWRDRVDVVAMDGFSGFKTAATEELPDAATVMDPFHVVRLAGNALDECRRRVQLATC
FT                   GHRGRSTDPLYRSRRTLHTGADLLTDRQKARLAALFAANAHAEIEATWAMYQRTVAAYR
FT                   EPDRTKGRTMMAALITTLSTGVPTSLTELITLGRTLKKRAADVLAYFDRPGTSNGPTEA
FT                   INGRLEHLRGSALGFRNLTNYIARSLLETGGFRTQLRQPRR"
FT   gene            complement(446634..447335)
FT                   /locus_tag="MSMEG_0398"
FT   CDS_pept        complement(446634..447335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0398"
FT                   /product="IS1096, tnpR protein"
FT                   /note="identified by similarity to GP:150004; match to
FT                   protein family HMM PF07929"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72875"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:A0QNY0"
FT                   /protein_id="ABK72875.1"
FT                   /translation="MSGGSVDLALLQKLMADAGRNVFAGMFDEPTPEVRAVPDRARGFR
FT                   VRVDLMYAKPPIWRRLDLPGDLMLDELHVVLQVVMGWQDSHLHKFGVGADRRTRAYFVT
FT                   GFDLSEGDDGVVEDSVRLDQVVSDKGERLFYDYDFGDGWDHVLVVEDVFDDPPPAAVCL
FT                   TGKMACPPEDCGGLGGYEELAAWVRGGYDPRETPMGLGAQEMRDWLPRGWHPDRFSVAE
FT                   TNDALAALNTR"
FT   gene            447638..447868
FT                   /locus_tag="MSMEG_0399"
FT   CDS_pept        447638..447868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0399"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF03621"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73309"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:Q3L893"
FT                   /protein_id="ABK73309.1"
FT                   /translation="MSINPFDDDNGSFFVLVNDEEQHSLWPSFADVPAGWRVVFGEASR
FT                   ADCLEFIEQNWTDIRPKSLRERLAQGGALDG"
FT   gene            447897..455186
FT                   /locus_tag="MSMEG_0400"
FT   CDS_pept        447897..455186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0400"
FT                   /product="peptide synthetase"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM PF00550; match to protein
FT                   family HMM PF00668; match to protein family HMM TIGR01720;
FT                   match to protein family HMM TIGR01733"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74005"
FT                   /db_xref="GOA:A0QPH5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPH5"
FT                   /protein_id="ABK74005.1"
FT                   /translation="MEPVDGALPLSRGQLDIWLSHESGLAGAEWQLGLLGKIDGVVDHG
FT                   LLQQAIRQALQEAEPARATFFEADGQVFQKPLDYSELEVPLYDVRDADDPEAKAREMAA
FT                   EIQHTPLPLTGRLVKFALFQTRDEQFYLFGLGHHISVDGLGMALVSRRISTIYTSLVTG
FT                   KPVPEAYFGSLRDLVECEMSYESSADYQDDLAYWSENLPPDTGLDQGLAPTPHGKNAYT
FT                   PSASVPMDPAIVGRIKELSKTLRIRRYSVTTAACALLAQSWSSTGDQVALDFPVSRRVS
FT                   PESKTLPAMLAGVAPLVLDAPPQLTVGEFCKHVDIRIRELLQHQRFPVHRLGDGGALRG
FT                   PRQASNRLAVNFIPSRLTLDFAGAEATASYTNHGPMGHFGLFFIGAGEELFLSTAGAGQ
FT                   PFANFEVPELAERLGAIVAAMAADPAMPLAAVRLLAESESDRLATIGNHSALSESAPDA
FT                   VSIPERFAARVAEAPDAAALTFEGRTLTYRELDEAANRFAHALLARGIGPGSRVALMSP
FT                   RTDRSVIAILGAFKAGAAYVPVDPAVPAARVRFILDDASPVAVVTTAELRSRFDGHDLA
FT                   VIDIDDPAIASLPATAVSDPRPDDIAYVIYTSGTTGTPKGVAVTHKNLTHLIAVLEERL
FT                   PKPGVWPLCHSLAFDASVWEISNALLRGGRLVVVPEAVAGSPEDFHDLLVAEQVTFLTQ
FT                   TPSAVAMLSPDGLESMTLAVVGEACPPALVDRWATNRTMINAYGPTETTICVTSSSPLE
FT                   PGSVVVPIGSALPRTALFVLDPWLRPVPTGVAGELYVAGDGVTCGYIGRSGLTASRFVP
FT                   CPFGEPGARMYRTGDLVRWGRDGQLEYLGRADEQVKIRGYRIELGEVQSALAALDGVES
FT                   AAAIMREDRPGDRRLVGYITGTADPVDIRAELADRLPPYMVPTAIVVLPALPLTSSNKL
FT                   DTRALPAPEYANAEKNYRAPSNPVEEVLADIYAQVLGVERIGVDDSFFDLGGDSILSMQ
FT                   VVARARAAGIQCRPRDVFVEQTVARLASVATVATEIGVVDDGTGSAAPTPIIHWLREAG
FT                   GATDEFNQTLVVQAPTGVTEPDVVAVLQALLDRHATLRLRVQDSDGEWSLLVPDAATVD
FT                   ARDCLSVVDTLSDDVVLAARAKLNPAAGAMVSALWVRQTSQLVLIIHHLAVDGVSWRIL
FT                   LEDLNIAWAQHHSGQQVQLPAGGTSFLRWSKRLADHAHTAEVTAQADAWREILAKPAAL
FT                   PAVQPDTDTHASAGRFSATLDPETTRQLLGEVPAAFHAGVQDILLVAFGLAWAEFLNRS
FT                   GTPITVDVEGHGRHEELASDIDLSRTVGWFTTKYPVALTVADVPWAQVVAGEATLGAVV
FT                   KDVKEQLRAVPDGLTYGLLRYLNSEVELGGTEPTIGFNYLGRLGAGAGELSEELWRIEQ
FT                   GSLALTDVVSAVPMPLAHTVELNAGTMDTDKGPSLQASWTWAPSVFDEDKAARLSQLWF
FT                   EALAGICAHVQAGGGGLTPSDIAPARLTQREIDQLTTQFEVADVLPLTPLQQGLLFQAG
FT                   FAEAAGAEAAGVPSDDVYAVQLGITLSGSLDPQQLRDAVQAVIRRHPNLAARFVEQFGE
FT                   PVQVLSVDPEIGWQFVEFDSGDTGVDERVERLCAAERSAVCKLGEQPVFRAALIRTADN
FT                   LHRFVLTIHHIVIDGWSLPVLLQEIFAAYFDQSLPSAAPYRNFVTWLGAQDRDAAQAAW
FT                   GSVLEGFETPTLVAPPAQAGPRGVESFRLSEATTRTLGELARSQHTTVNTVLQAAWAQL
FT                   LMWMTGQRDVVFGTAVSGRPVDLAGADSMVGLLINTVPVRATSGVATTVTDLLGQLQRD
FT                   HNDTVDHEHMALNEIHRLTGHDRLFDTLFVYENYPIDANALLSVQDLAVTDFASREYNH
FT                   YPLSMVATPGHEVVLRVEFDTEIFDAASIEALVDRLRRVLDAMATDPGRRLSTIDLLDP
FT                   QEHDRLDEWGNRAVLTRPAPALESIPASFAESVRRVPDAVALSCGDRSWTYRELDEASN
FT                   RMAHLLAGRGAKPGERVAMLLPRTGEAVVTILAILKTGAAYLPIDPAHPDARIEFVLKD
FT                   AAPVAAVSSADLCTRLIASGVPVIEVDDPAIGAEASTSLPVPAVDDIAYIIYTSGTTGT
FT                   PKGVAVTHRNVAQLLDTLGAQLELGQTWTQCHSLAFDYSVWEIWGPLLNGGRLLMVPDA
FT                   VVRSPEDLHAMLVAEQVSMLSQTPSAFYALQTADALYPERGEQLKLQTVVFGGEALEPH
FT                   RLSGWMHAHPGMPRMINMYGITETTVHASFREIGEADLANSTSPIGVPLEHLSFFVLDG
FT                   WLRQVPVGVVGELYVAGEGLACGYISRSDLTSTRFVACPFGAPGARMYRTGDLVRWGAD
FT                   GQLQYVGRADEQVKIRGYRIELGEVHAALVGLDGVEQAAVIAREDRPATSGWSVMSPAR
FT                   STRSRPGPRSPSGSPRTWCPRRSW"
FT   gene            455186..458191
FT                   /locus_tag="MSMEG_0401"
FT   CDS_pept        455186..458191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0401"
FT                   /product="putative non-ribosomal peptide synthase"
FT                   /note="identified by match to protein family HMM PF00550;
FT                   match to protein family HMM PF00668; match to protein
FT                   family HMM TIGR01720"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75036"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPH6"
FT                   /protein_id="ABK75036.1"
FT                   /translation="MESLPLTVNGKLNTRALPAPEYQDADQYRAPANAVEELLTGIYAQ
FT                   VLGVERVGVDDSFFDLGGDSISSMQVVARARAAGLVCRPRDIFVEQTVSRLAQVVTLAD
FT                   GESGVADTGVGPVVATPIMRWLYSLDGPIDEFNQTVVLQVPAEVTEADVIAVLQAVLDH
FT                   HAMLRLRVADAENGDLTVPEPGSVDACDCLCTVGELTADTLAAVRAQLNPATGSMLTAA
FT                   WVPETRQLALMIHHLAVDAVSWRILLEDLNIAWAQHRSGQPVVLPTPGTSFGRWSRLLD
FT                   QHARTADVLATADVWRTVAAAPAALPAPQPDTDVYANAGQLSASLDVETTGQLLGDVPA
FT                   AFHAGVQDILLIAFGLAWSEYLGSEQGSIGIDVEGHGRTEELFGDADLSRTVGWFTSKY
FT                   PVALDFDRNTGGISWEQVVNGDAALGAVIKKAKEQLRSVPDGLTYGLLRYLNPDVELDN
FT                   PDPTIGFNYLGRLGAGAADLSDDLWRLDPDAVSLTAAGGRVNTPLGHTVELNAGTMDTE
FT                   AGPQLQATWTWAPSALDEEQIQKVSKLWSDALAGICAHVRSGGGGLTPSDVAPARLSQQ
FT                   QIDDLTAQFDMVDVLPLTPLQHGLLFHTGLSQDSEDLYAVQLDISVSGRLDVERMRDAV
FT                   QTVITRRPNVVAHFYEDFGEPVQILPANPELAWQYVDLSGRSDIDAQIAQISAAERAAV
FT                   CRLGDQPPFRAAVLRTGEETYRFVLTNHHIVLDGWSKPILLQEIFVSYFGQRLPAPVPY
FT                   RRFVSWLAEQDNDAARAAWRGVFSGFETPTLVGTPGLALGRRAVESFQVSAETTQALGE
FT                   LARSCHTTVSTVLQGAWAQVLMWLTGQPDVAFGTAVSGRPTDVPGADSMVGLLINTVPV
FT                   RATITPETTVASLMNQLQGAYTDTLDHQHLALNEIHRATGHDQLFDTVFVYENYPIDTA
FT                   ALLGVQELSITDFTNREYNHYPLSVQAVPGHELGLRVEYDTNVFDRQRIKRLVNRLQRV
FT                   LVAMTADMREKS"
FT   gene            458188..465867
FT                   /locus_tag="MSMEG_0402"
FT   CDS_pept        458188..465867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0402"
FT                   /product="linear gramicidin synthetase subunit D"
FT                   /EC_number="5.1.1.-"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM PF00550; match to protein
FT                   family HMM PF00668; match to protein family HMM PF01370;
FT                   match to protein family HMM PF07993; match to protein
FT                   family HMM TIGR01720; match to protein family HMM
FT                   TIGR01733; match to protein family HMM TIGR01746"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70191"
FT                   /db_xref="GOA:Q3L891"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3L891"
FT                   /protein_id="ABK70191.1"
FT                   /translation="MTAEPSTRTLLSFDLLDEDEHDQIEVWGNRAVLTDPGPTPVTIPA
FT                   LFAEQVVRAPDAVALVSGDRSWTYRELDEASNRLAHVLAEHGAKPGATVAFLIPRSGEA
FT                   ILSILSVLKTGAAYLPVDPAHPDARIGFMMSDAKPVAALTTADLRSRLDQYDLAVIDMA
FT                   DPAIDRRPSDALSGPRPDDLAYMTYTSGTTGVPKAVAVTHHNVTQLVSALHADLPSGPG
FT                   QVWSQWHSLVFDVSVWEIWGALLHGGRLVVVPESVGSSPDDLHNLLITEKVSVLCQTPS
FT                   AAGMLSPEGLESTTLIVAGEACPTELVDRWAPGRVMINAYGPTEATIYAAMSEPLTAGT
FT                   GVAPIGAPVPGAALFVLDKWLRPAPEGVVGELYVAGHGVATGYIGRPDLTASRFVACPF
FT                   GETGERMYRTGDLVRWGSDGQLEYLGRADEQVKIRGYRIELGEIQAALAKLDGVDQAVV
FT                   IAREDRPGDKRLVGYITGTADPAQLRTALAESLPAYMVPTAVVVLDTIPLTVNGKLDRR
FT                   ALPAPEYRSAANDYRAPSTPAEQILADVYAQVLGVERVGVDDSFFDLGGDSILSMQVVA
FT                   RARAAGIQCRPRDIFVEQTVAGVARVAVAAGESHVVDEGVGPVVATPIMRWLREVDGPT
FT                   GQFNQTVITQAPAGVTEDDVVVILQALLDRHATLRLRVEDTQEDTDEWSLLVPEAGAVG
FT                   ARECLRTVDALTDDVLVEARNRLDPAAGAMVSAVWVRETSQLVLMIHHLAVDGVSWRIL
FT                   LEDLNIAWAQHCTGQSIELPAGGTSFARWSALLAEHAKTDTVRDLADAWRAVTSVPQAL
FT                   PPVQPDTDTYVTAGQLSASLDVETTRQLLGEVPAAFRAGVQDILLVAFGLAWTEFLNRS
FT                   DTPIGVDVEGHGRYDELASDVDLSRTVGWFTTKYPVALTVENLPWEQVVAGDAALGGIV
FT                   KAVKEQLRSLPEGLTYGLLRYLNPEVDLGGSDPTIGFNYLGRLGAGAGELSEELWRIDQ
FT                   DSLALSDAASAVPMPLMHTVELNAGTIDTDNGPSLRASWTWAPSAFDEEQATRLSRLWF
FT                   EALAGICAHVRGGGGGLTPSDVAPARLTQRQIDELSQRYDVTDVLPLTPVQQGLLFHST
FT                   FARGIGDDVYAVQLDITITGVLDQHRLRDAVHTVVARHPNLAARFVEQFGEPVQVLTAD
FT                   PMIAWRYLDLRGDDLTPDHEIEQLCAAERSAVCDLLERPTFRAALIRTSGNQHRFVLTF
FT                   HHIVIDGWSLPILLQEIFAGYFGHRLPAAAPYRNFVNWLATQDATAAKAAWREVLDGFE
FT                   TPTLVAPPGVPGPRGIESYRVSAETTRALGELARSQHTTINTVLQAAWTQLLMRMTGQR
FT                   DVAFGTAVSGRPADLAGAESMVGLLINTVPIRAKVSADTTVGDLLRQLQSHHNDTLEHE
FT                   HLALNDIHHVSGHEQLFDTLFLYESYPIDTSAFMGVQELAVTEFNNREYNHYPLSVMAL
FT                   PGHELGLRVEYDTSVFDVSEIETLIDRFQRLLEAMIDDPARRLSSMDVVDDDERTQLDE
FT                   WANRAVLTQPVDSPQSIPEVFARQVERDPEAPAVTFEGESLNYGELDEAANQLANLLAV
FT                   YGAAPGKSVALMVPRSADAIVAILAVLKTGAAYLPIDPSVPAARLEFMLGDAKPVAAVT
FT                   TGDLRSRFDGFDLQVVEVDDPAVEIYPSTTLLTPSPDDIAYMIYTSGTTGVPKGVAITH
FT                   GNVTQVLDTLPAELPAGPGAVWSQWHSLVFDVSVWEIWGALLHGGRLVIVPESIAGSPD
FT                   DLHALLVSEGVNVLYQTPSAVRMMSPEGLEGTALVVAGEACPTEVVDRWAVDRVMINAY
FT                   GPTESTIYAAISAPLSPGSDVVPIGSPVPKGATFVLDEWLRPVPPGVVGELYLAGRGVG
FT                   VGYVGRSGLTGTRFVACPFGEPGARMYRTGDLVRWGDDGQLQYLGRADEQVKIRGYRIE
FT                   LGEIQAALSDVDGVDQAVVIAREDRPGDKRLVGYITGTADPAAARSELTNRLPAYMVPA
FT                   AVVTLETLPLTVNGKLDRRALPAPEYQSAQRYRAPETETEKTLAGIFAHVLGVERIGLD
FT                   DSFFDLGGDSISAMRVTAAVNTALDADLSVRTLFEAPTVAKLSLHVEHDAGERTDRVSF
FT                   AAVHGSDVTEVHARDLTLDKFIDAPTLRTATTLPRPDGAVQTVLLTGATGFLGRYLLLE
FT                   WLRQLRRVDDKVICLVRGKSDEDARRRLEATFDTDPLLRKHFNELATERLQVVAGDKGQ
FT                   PNLGLDEQTWQRLAESVDLIVDSAAFVNSVLPYSELFGPNVVGTAELIRFALTSKLKPF
FT                   NFVSTSDVGRQIEPSRFTEQADIRLVSATRKIEVGYANGYGNSKWAGEVLLREAHDHCG
FT                   LPVAVFRSGMIMVDPTYAGQLNVTDTVSRMVLSIVATGVAPGSFYQRGDNGERQRAHFD
FT                   GLPVDFVAQAITKLGWQVARSVTDSTASGFETYHVMNPHDDGIGIDTYIDWLIEAGYPI
FT                   ERIEDFGEWLQRFEAALQGLSDQQRQNSVLQMLTLLKQQAGELQPPVPTRGSFAPADRF
FT                   QAAVRDANIGVEGEIPHVTREVIVKYVTDLQLLGLL"
FT   gene            465884..466702
FT                   /locus_tag="MSMEG_0403"
FT   CDS_pept        465884..466702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0403"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71066"
FT                   /db_xref="GOA:Q3L890"
FT                   /db_xref="InterPro:IPR021315"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3L890"
FT                   /protein_id="ABK71066.1"
FT                   /translation="MWSDILGLALFVSLNPLLLGFILLVLSRPRPVPNLVVFWVGCLIV
FT                   NVPGFLIPLFVLRAVPSFAEFAEDLTTADPSSGIEPFQLGTGIFALAVSAVIALRMWVK
FT                   RRANQPVLVGSGAGDRGPTDDASTLVLDSGAREAREPGAIARMILRMRSALQRLVSRLH
FT                   QEWENGALWVALVFGLAYIPPPPLVLLVDTIIGGSGAPIGTQIIAVFVFIMAMLAVFEI
FT                   TLLSYVIAPRRTQAVLEPLHEWSHRHRQMILLVLFGAVGIWELIVGLGVI"
FT   gene            466804..467214
FT                   /locus_tag="MSMEG_0404"
FT   CDS_pept        466804..467214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0404"
FT                   /product="sigma associated protein"
FT                   /note="identified by match to protein family HMM PF04946"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73727"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q3L889"
FT                   /protein_id="ABK73727.1"
FT                   /translation="MAKYLLLKHYRGAPAAVNDVPMDQWAPDEIEAHLQYMKSLATHLE
FT                   STGEFVDAQALAPTGAWVRYDGEGRPPVTDGPFAETKDLVAGWMIIDVDSYERAVEVAG
FT                   ELSAAPGAGGKPIHEWLEVRPFLGDSDACHGE"
FT   gene            467223..468398
FT                   /locus_tag="MSMEG_0405"
FT   CDS_pept        467223..468398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0405"
FT                   /product="extra cytoplasmic sigma factor"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72986"
FT                   /db_xref="GOA:Q3L888"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3L888"
FT                   /protein_id="ABK72986.1"
FT                   /translation="MDPAALRDLIPGVLAALVRRGVDFATAEDAVQEALIKALETWSTG
FT                   RAPDDPKAWLITTAWRRFIDVARAEAARRSRELRTAVEDPQGPTVPVDDTLQLYFLCAH
FT                   PSLSPASAVALTLRAVGGLTTRQIARAYLVPESTMAQRISRAKRTVSEVRLNRLGNLGT
FT                   VLRVLYLVFNEGYTGDVDLSAEAIRLARQLAAATDAPEVAGLLALFLLHDARRPARTRA
FT                   DGTLVPLAEQDRTLWRHDLITEGVAVLQAALAADRLGEYQAQAAIAALHADARTADETD
FT                   WVQIVEWYDELVALTDSPVARLNRAVAVGEADGPRAGLAALAELDPALPRHTASAAYLH
FT                   ERAGDIARAAQLYVEAADQAHTVPERNHLLLKAATLHQRLGSPGDAKRLPG"
FT   gene            complement(468441..470276)
FT                   /locus_tag="MSMEG_0406"
FT   CDS_pept        complement(468441..470276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0406"
FT                   /product="acyl-coA-dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75628"
FT                   /db_xref="GOA:Q3L887"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:Q3L887"
FT                   /protein_id="ABK75628.1"
FT                   /translation="MSHYKSNVRDQVFNLFEVFGVDKVLGADKFSDLDADTAREMLTEI
FT                   ARLAEGPIAESFVEGDRNPPVFDPETHTVTLPEGFKKSMRALFDGGWDKVGLAEHLGGI
FT                   PMPRALQWALIEHILGANPAAYMYAMGPGMSEIFYNNGTDEQKKWATIAAERGWGATMV
FT                   LTEPDAGSDVGAGRTKAVQQPDGTWHIEGVKRFITSADSDDLFENIMHLVLARPEGAGP
FT                   GTKGLSLFFVPKFHFDHETGEIGERNGVFVTNVEHKMGLKVSATCELSLGQHGIPAVGW
FT                   LVGEVHNGIAQMFDVIEQARMMVGTKAIATLSTGYLNALEYAKERVQGADMTQMTDKTA
FT                   PRVTITHHPDVRRSLMTQKAYAEGLRAIYLYTATFQDAEVAQAVHGVDGDLAARVNDLL
FT                   LPIVKGFGSETAYAKLTESLQTLGGSGFLQDYPIEQYIRDSKIDSLYEGTTAIQAQDFF
FT                   FRKIIRDKGQALAYVAGEIEQFIKNENGNGRLKTERELLATALADVQGMAASLTGYLMA
FT                   AQEDAASIYKVGLGSVRFLMAVGDLLSGWLLARQAAVAIEKLDAGATGADKSFYEGKIA
FT                   AASFFAKNMLPLLTSTRQIIENLDNDVMELDEAAF"
FT   gene            470514..471602
FT                   /locus_tag="MSMEG_0407"
FT   CDS_pept        470514..471602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01113"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74911"
FT                   /db_xref="GOA:Q3L886"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3L886"
FT                   /protein_id="ABK74911.1"
FT                   /translation="MRRIAVWGTGNMGSTAIRSAVAFPGLELAAVITSSQDKVGRDAAM
FT                   FAGLAEPTGVTATDDVDSALGACDAVAYMASGDIRPEEAIADIERCLRSGKHVVTPALY
FT                   SLYDPRSAPEHWVERLTDAATAGNATLLVSGVDPGWANDALAVTAAGLCTRIRSIRCQE
FT                   IFDYSTYDQPYAVRVLCGFGTPMGPDDPVPMMLLPTIPTMVWGGNVRMIGRGLGLQIDD
FT                   ITEKVERLPLAQACENVLGRFETGTQGAFRVQVIGWADGVERVVIDHITRIDPACAPDW
FT                   PQPDQGAGDHRVLIDGDPQLSIVVRADVPGGTRADGGNTTAANRLLGAIAWLAEQKPGI
FT                   YDGLDVPLHPPLSAEAEATRWA"
FT   gene            complement(471613..482571)
FT                   /locus_tag="MSMEG_0408"
FT   CDS_pept        complement(471613..482571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0408"
FT                   /product="type I modular polyketide synthase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF00107; match to protein
FT                   family HMM PF00109; match to protein family HMM PF00550;
FT                   match to protein family HMM PF00698; match to protein
FT                   family HMM PF01370; match to protein family HMM PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73829"
FT                   /db_xref="GOA:Q3L885"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3L885"
FT                   /protein_id="ABK73829.1"
FT                   /translation="MVSAEHPIEPTPSFAIIGYAARFPGAASAEEYWALLRDGREAISD
FT                   VPKDRWDIEEFFDPDPSTPGKVVTRRAGFVDDVTGFDAPFFGMSAREVRLMDPQHRILM
FT                   ETAWRAVEHSGIAPTSLANSNTGVFVGLATHDYLGMASDELTYPEIEAYMAIGTSNAAA
FT                   AGRISYRLGLQGPAVAVDTACSSSLVAIHQACQALRLNECDLALAGGANVLLTPATMIT
FT                   FSNAHMLAPDGRCKTFDAAADGYVRGEGCGVVVVKRLEDAVRDGDRIRAVIRGSAINQD
FT                   GASGGLTVPNGVAQQRVIADALKRAGLRPADVGYLEAHGTGTSLGDPIEAQAAGEVLGA
FT                   GRAPEEPLLIGSAKTNIGHLEAAAGIAGVIKVVMALENETLPKHLNFETPSPHIPWERL
FT                   PIEVVRETVPWQRNGKPRIAGVSSFGFAGTNAHVILEEAPAVGTPATTEPVEDPRRYSV
FT                   LPLSARTPEALVRLAGEYRDWLRAHPQARLADVSHTAGTARAHLEQRAALVVNSRESAI
FT                   ELLGALADDRPAPGLVRGESHEAPKTAWLFTGQGSQYPGMARELFDTEPVFAETVRKCA
FT                   EAVADILEKPLLDVIFDADELDGDTESPLRHTTYAQPALFAVELGLARLWQSWGFEPDV
FT                   VVGHSVGQYSAACVAGVFDVEDGARLIAERGRLFGSLPAGGRMAAVFTAPERAERLTDE
FT                   YPSLSVAAYNGANTVLSGPAKDLESAVATLVADGVRCDWLDTSHAFHSALLDPILDDFE
FT                   SFAQKLEYREPQRILIDNRTGSALGRSTRLDGAYWRRHARQPVEFAKSVRTLADMNCRV
FT                   LLEIGPRPVLTATALAAWPDPATTPQVLASLRPTTADHRQITEAVAAAYAAGHLPDFRA
FT                   FRQPDARKLDLPTYPFEHRQFWFSDNRAIDRDTQTASAGSVTPHRTQAVRLLEDGQIEE
FT                   LAALIDGETVDEQTLRVLNKLAARHNQQRSTHVDPDARYEIRWDAIASAAASTGAAADW
FT                   ILVGDDTAAVLEFADALTAGGHRHQIVALPGSDADEAQLVDTLRAASAGELYVVHIAAG
FT                   DGAAAPMRDLLRVQHRTLGGLRRLFRAANDAELRSPIWLVTRDGQRVTDTDTVVPEQSC
FT                   LWGFGRAAALELPHIWGGLADLSGADTEWPRLIARITSPRDGEDQIALRGDAVYAPRLV
FT                   RRTGEPSDTPLPVREDRTYLVTGGLGAIGLEVAGYLASHGAGHVVLTSRREPGDDARRR
FT                   LDGLREQYACDVRVITADVADAHDVARLMTTVAAELPPLAGIVHAAGEIGTTPLSGLDD
FT                   AEVDRVFAGKVWGAWHLSEALTDLRTDLDFFVSTSSIASVWGGFGQTAYGAANAFLDGL
FT                   AWRLRERGVTAVSVNFGPWAAGMADAESRARLEQRGVRTLSPAEALAGMADVVAGPVQG
FT                   VVAKIDWSRFLPLYQQAGRRAFLSELESELPAAATGAAAPATVPGKPPLVEQLTKAPVQ
FT                   QRKSLITNYLRNAVAEVTRVDADEIRDEAGFFDLGMDSLMAVELRRRIEQGVGKDIPVT
FT                   LVMDHPRLSDAADYLLVEVLGLGEQTNVRQASTVTARTDDPIAVVAVSCRFPGAPDPES
FT                   FWELLAGGVDAIREVPEDRWDIDEFYDPDPDTPGKTYTRFGGFLDGIDGFDPEFFGISP
FT                   REAVWIEPQQRLMLETVWEGLERAGYAPSDLRGSRTGVFTGVAANEYAHLLSAESIDKI
FT                   EPHFITGNALNAISGRVAFALGFEGPAVAVDTACSSALVAVHQACQALQSGDCDLALAG
FT                   GVNVLLSPVTVVAASRARMLSPVGRCKTFDASADGYVRSEGCGVLVLKRLSDAVRDGDR
FT                   VCAVIPASSVNQDGASSGLTVPNGGAQQRLIEATLARAGLSGADVDYLEAHGTGTPLGD
FT                   PIEVQAAAAAYGAGRDADRPLLMGSVKTNIGHTESASGAAGLIKVVLSLQHGVLPQSLH
FT                   FENPSPHIPWDALPVRVIDEPVPWQTNGRVRRAGVSSFGFTGTNAHVLVEEAPPQLHTA
FT                   DAAPVEPAATAEAGTDDSPQVLALSARSPEALVELARRYDDWLSATPGLDIADVCHTAG
FT                   VGRSHFEYRAALVVDSVERAREGLAALAEGRTPAGVVRGEHVHRPTTAWLFTGQGSQYP
FT                   GMARELFDTQPVFAQTVRQCAEAVADMLPRPLLDVLFATDRETADLLQHTSFAQPALFA
FT                   VEMGLARLWQSWAIEPDVVLGHSVGQYAAACVAGVFSLDDGARLMAERGRMFGSLPEGG
FT                   RMVAVFADAEHVEQVAGEFPRVSVGAYNGPNTVLSGPGEDLEEIVERFEDEGIRCTWLA
FT                   TSHAFHSELLDPVLDEFEAYAAQFQFAAPTLPLVCNRTGAVLTGQTPLDAQYWRRHSRQ
FT                   PVQFAESVRTVAALGCSVLMEIGPQPVLTGAAVQVWPEHMAAPRAVASLRKGVADRRQI
FT                   ADALASAYVGGHRPDFAAVHRQPRRPVELPTYPFQRRRFWPKASSIAVDGGTAASGILG
FT                   SGKDLASGDTIYTSRLSVKSQPWLADHVIYGTVVVPGATYAAMALAAVGTPARLKDVFF
FT                   YEPIILPEKASREVQLTLHPADGGSVLSFQIHSRPYGERGADWSLNAEGTVDTAGSDPD
FT                   AAADEQSDPVDEVIERLERMRPQDLFETFADLELAWGPTWSGSLKSLWLGDGEAVGDIL
FT                   VGAELAEQLGSEPMHPVLMDLCTGVAFPAFPALLAAEQGVNDLFLPLRYGQVTLAEKMP
FT                   RRFYCRARWHRSALDSETQVFELEFVDLGGRALGGIREFTVKRAPREALLRGLGGDATR
FT                   LLYTLGWHEVPPPPSADDAVGTWLIAGFDELAAKVPGCVPIDRNTDLQVLGEVLSQAHA
FT                   RGAGFSGVVWRCATPGRKESGSASAESARLEAEITNLLSAVHAAQGPSVKLPGGLWIVT
FT                   EHGVACESGEPVDPVQAALWGFGRTTINEEPALHCRLVDCDGSSEAVDLLAALLAAPGI
FT                   QEPEIAVRQGKLLASRLLPWARSGHLTLPRGGDFVLAPTERGAIDNLRLTETDVPEPDE
FT                   GYVQVRVEAAGLNFRDVLNVLGLYPGDPGPIGGDFAGTVTQLGAGVSGLEIGQRVYGSM
FT                   QGAFASRFNVPAQFLAPIPDGIGAVEAATIPAAALTVRLAFDWAQLKPGDKVLIHAASG
FT                   GVGLAAIQMAQQSGAEVFATASTFKRSTLRRLGVKYVYDSRTTDFADQILADTNGAGVD
FT                   VVLNSLTSAGFVEATLKATAQGGRFAEIAKRDIWSHEQMAEARPDIAYEIVALDTVMFT
FT                   EPDRIRDLLTEVSDGMARGEWTPLPAEIYPITEARSAFRRMQQARHIGKIVLQVPKPLQ
FT                   PQQDRSYLITGGLGAIGLHTAAYLAQLGAGDIVLTSRRDPDESAQRAIDEITERHKCRI
FT                   HTYAADVGDEAQVADLLARIRAELPPLAGIAHLAGVLDDALLSAQNPERFRTTLAPKAY
FT                   GASHLDRLTRDDDLDFFIVSSSVSSLFGSPGQANYATANAMLDGLVAKRRAQGLVATGI
FT                   NFGPWGQGGMASSEAATANITAQGLIPLDPSAALHALAEVIANGSGQATVLKANWQRAA
FT                   KVLGSARPPILDLVLPSAAGEATGDSELLKQLMEIPIPQRAGFVTEFLQREVQNFLRLA
FT                   SPPAASSRFLDLGTDSLMAIELRNRLHSQFGGKFTINATAVFDYPTIGGLAEYLVGQLP
FT                   DAEAPETA"
FT   gene            482813..484234
FT                   /locus_tag="MSMEG_0409"
FT   CDS_pept        482813..484234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0409"
FT                   /product="Condensation domain protein"
FT                   /note="identified by match to protein family HMM PF00668"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73314"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPI4"
FT                   /protein_id="ABK73314.1"
FT                   /translation="MRIGKITVGPLDEWSLKPGTVTSWQPTAAAREVARQAPVSSVPVS
FT                   YMQEQHLRNFCERTAAGLNFSRQIIASCEVPGQCDISAMDHAVNSYLRRHDTFRSWFED
FT                   AGDGKFIRHSIENPDDIEFVPVEHGAMSIDEIHAHVTDIPTPLEWACFTFGVIQSEDHF
FT                   TFFAAMDHVHGDATLIGTTMLEANGMYSALSGGGEALVLPEAGSFDDFCIRERERTADL
FT                   TVDSPEVRAWIEFAEDNNGGFPEFPLPLGNPKKSTSSDMTSEILLDPAQTERFESACNA
FT                   AGARFVGGLFACLAQVEHELTGALTYYGLTPRDSRNATDNFMTQGWFTGLIPITVPIGA
FT                   ASFTEAAGSAQRSFDANLNMAKVPYYRVLELAPSLRWPQPNFPVSNFFHGGAAPLNAVL
FT                   AAADMGLANNIGIYPDGRYSYQLTIYIFRYGEGTAMAIMHPDNSVARKSATRYMETMRS
FT                   VAGQVADSGNWGRVA"
FT   gene            484268..487276
FT                   /locus_tag="MSMEG_0410"
FT   CDS_pept        484268..487276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0410"
FT                   /product="MmpL protein"
FT                   /note="identified by match to protein family HMM PF03176;
FT                   match to protein family HMM TIGR00833"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75741"
FT                   /db_xref="GOA:Q2M5K4"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q2M5K4"
FT                   /protein_id="ABK75741.1"
FT                   /translation="MRKLADLVVRWPLVVIGVWLAMAVALPLSFPSLGEMAEKHPLQVL
FT                   PAEAPSSVTAAKMAEAFQESGNDDLMLVALINDKGLTPDDEAVYRKIVDALRGDLINVV
FT                   SVQDFIGTPQLRPFLTSQDKTTWVLPVSLEGELGTPRAFESFNRVSEIVEHTVDQNAAD
FT                   GALQVHITGPAATVADLTVAGQQDRLPIEIAIAVLVLGVLLLVYRNVVTMLLPLVTIGS
FT                   SLIIAQSVVAGYSELTGSGVSNQSMVFLSAIMAGAGTDYAVFLISRYHDFLRSGHGYDE
FT                   AVRAAMISIGKVIAASATTVGLTFLLLSFAKMGVFRTVGVAAAIGIAVAFLAGVTLLPA
FT                   ILVLAGPRGWVKPRRELTTRFWRRSGIRIVRRPVPHLVGSVLVLALLGGFTLVAHYNYD
FT                   DRKVVSPDASSSIGYAALEQHFPISQSIPEYIFIQSPHDLRNPRALADLEQLASRVAQL
FT                   PDVGLVSGITRPLGEVPPEFRATFQAGIVGDRLADGSTQIDQRTSDLNRLTSGAKTLAD
FT                   SLADVRSQINQIAPSIQSLVDTFSSVRTEYGGDKLVRDVDTAAKLVASVNALGNAMGIN
FT                   LAAVKDMFAWIGPVLAALQGNPVCDANPSCSATRAQFERVLDPSNEGNLNQINQLAQEF
FT                   QGVEDRETLNSAVKKLNAAMANVAKAVDAMGLDKPGGTQKGLKDLQQGASRLAGGSREV
FT                   AGGVDELVKQVKVIAAGLNEASTFLLTMRNNAADPSQAGFNIPPEVFGLEDFKKASAAY
FT                   ISPDGHSVRYLVQTKLNPFSAEAMDQVNQIGDIARGAQPNTTLADAEISMGGFPVALRD
FT                   TRDYYQQDIRFIIIATLIVVLLTLTVLLRTVIAPLYLVGSVVVSYFAAIGLGVLMFQVV
FT                   LGQQLHWSVPPLAFVVLVAVGADYNMLFVSRLRDESPHSVRYGVIRTLGSTGGVITAAG
FT                   LIFAASMAGLLFSSIGLVVQGGFVIGVGILLDTFVVRTITVPAIASLVGRANWWPGQIG
FT                   TSPSNSRAPAEVT"
FT   gene            487386..489095
FT                   /locus_tag="MSMEG_0411"
FT   CDS_pept        487386..489095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0411"
FT                   /product="acyl-CoA synthase"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71017"
FT                   /db_xref="GOA:Q2M5K3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="UniProtKB/TrEMBL:Q2M5K3"
FT                   /protein_id="ABK71017.1"
FT                   /translation="MLHGRASLRPDDIAFTFTDYDGDPSGVAQSLTWSVLARRTINVAR
FT                   EIRRHGAVGDRALILAPQGLEYILAFLGSMQAGLIAVPLPLPHRGSGHDRVSAVFADTE
FT                   PTVVLTTSAAATDVAEFVASSRTDPAIIEIDSLALDSDYSGAETDLGPVGLSDIAYLQY
FT                   SSGSTRLPTGVMISHRNLTANFDQLMRSFFARSPLPQDATLVSWLPFYHDMGLVLGVCA
FT                   PILCGRHAQLTSPVAFLERPARWVRALAENPHAWSSAPNFAFDLAARRTSDEDLAGLDL
FT                   GGVVGIISGAERVESATLRRFVDRFAHFNFRDHMMRPAYGLAEATVFVASGIWDEDAPA
FT                   GYFDAEALSAGRVSPSAPRKGTALVRYQVPQSPSLRIVDVDTRRETPPGVVGEIWVHGD
FT                   NVASGYWGKPADESTFGATLLDPSPGTPDGPWLRTGDLGFVHAGELYVVGRIKDVLIIR
FT                   GRNHYPEDIEATVQAITHGRVAAISVPVNSTEELVTVIELKKPADLDAEAIRRFGEVKS
FT                   NVTAAVANAHGLSVADLVLVPSGSLPTTTSGKIRRAACAEQYRQKQFVRLDG"
FT   gene            489157..490308
FT                   /locus_tag="MSMEG_0412"
FT   CDS_pept        489157..490308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0412"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73879"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="UniProtKB/TrEMBL:Q2M5K2"
FT                   /protein_id="ABK73879.1"
FT                   /translation="MRRRLLAFGTAFTTIGTAGFLGFGVAAADDTKPVDPAPGGAHAEA
FT                   PSMGTPGRGYALGGAHVLGIPYDEYIMRTGADWFPGLDRQIVDYPAGQVQGHTLERLFP
FT                   GIGALGERFMPGLGLDGPSYGESIDVGAPNLINAIRQGGPGTVIGLSEGASVLDEVQAR
FT                   LAYDPAAPPPDSLSFATYGNPVGKHAFGESFLTQMFPVGSVVPSLDYRIPAPVESQYDT
FT                   YQFVSAYDSIADWPDRPDNWISVANAIVGLATGHTAVAFTNPSMVPPQNIRTTVNSRGA
FT                   KDTTIMIPEEHLPLVLPFKYLGVDKDTLNKLDGVLKPYVDAGYSRNDDPLTAPITVDPV
FT                   NGYDPAAVTAPATQAAFGGGTDPVSQLLAGLQYVVNNQPAPKP"
FT   gene            complement(490313..490990)
FT                   /locus_tag="MSMEG_0413"
FT   CDS_pept        complement(490313..490990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72257"
FT                   /db_xref="GOA:A0QPI8"
FT                   /db_xref="InterPro:IPR021315"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPI8"
FT                   /protein_id="ABK72257.1"
FT                   /translation="MWIPLLLMAAVISLEPFRIGMTVVMINRPQPALQLSTFLAGGFLM
FT                   GTAVGMVVLFVMRPALGSAHFTLPRVQIAVGALILANAVLVATGLLGGRRKDPGPPGRV
FT                   RRMLGPAADRTRTLLTGSSLWAAGVAGLGIALPSVDYLAALALIVASGAAASTQFGALM
FT                   LFNVVAFALVEIPLVCYLVAPERTRATLAAVYDWLKARGRRGFATLLAVVGCMLLGVGI
FT                   AAL"
FT   gene            491026..492051
FT                   /locus_tag="MSMEG_0414"
FT   CDS_pept        491026..492051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0414"
FT                   /product="oxidoreductase, 2OG-Fe(II) oxygenase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03171"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69805"
FT                   /db_xref="GOA:A0QPI9"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPI9"
FT                   /protein_id="ABK69805.1"
FT                   /translation="MPIRTLAVAGRLPDDGGVTALSTALPVVDLGDDAAVVTDQLRRVA
FT                   HEVGFFYLVGHGVPQDLVDRVLTAARRLFALPQADKDAIAMVNSPHFRGYTRLGGELTG
FT                   GQVDWREQIDIGPEREPLDDPAEPYLRLQGPNQWPAALPELPAVIAEWDAALAQVGRAL
FT                   LRHWAVALGNPADVFDEAFADTPATLIKIVRYPAQAETSQGVGAHRDAGVLTLLLAEPG
FT                   SRGLQVRGPDGVFIDVDPLPGAFIVNIGEMLEIASGGYLRATEHRVQVSASERISVPYF
FT                   FNPRLDAAIPVLALPDELAAQARGVTADPSNDRIYSVYGRNAWKSRVRAHPDVAAAHGY
FT                   V"
FT   gene            492065..492550
FT                   /locus_tag="MSMEG_0415"
FT   CDS_pept        492065..492550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0415"
FT                   /product="NADH-fmn oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01613"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75020"
FT                   /db_xref="GOA:A0QPJ0"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPJ0"
FT                   /protein_id="ABK75020.1"
FT                   /translation="MSATDLSPTSLREAFGHFPSGVIAIAAEVDGTRVGLAASTFVPVS
FT                   LEPPLVAFCVQNSSTTWPKLKDLPSLGISVLGEAHDTAARTLAAKTGDRFAGLETESRD
FT                   SGAVFIHGTAVWLESAIEQLVPAGDHTIVVLRVSDIVVNDDVAPIVFHRSSFRKLGA"
FT   gene            complement(492595..492756)
FT                   /locus_tag="MSMEG_0416"
FT   CDS_pept        complement(492595..492756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0416"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73685"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPJ1"
FT                   /protein_id="ABK73685.1"
FT                   /translation="MSTRQIHSINDIRTAIRELSARATLARKEGRSEDAAEIEQRIAKY
FT                   REELAARP"
FT   gene            complement(492834..493583)
FT                   /locus_tag="MSMEG_0417"
FT   CDS_pept        complement(492834..493583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0417"
FT                   /product="succinate dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM TIGR00384"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71393"
FT                   /db_xref="GOA:A0QPJ2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPJ2"
FT                   /protein_id="ABK71393.1"
FT                   /translation="MATYDAKLRVWRGDDTGGELHDYTVEVNDGEVVLDIIHRLQATQT
FT                   PDLAVRWNCKAGKCGSCSAEINGRPRLMCMTRMSTFGEDEVVTVTPLRTFPVMRDLVTD
FT                   VSFNYEKARQIPSFTPPKDLQPGEYRMQQEDVNRSQEFRKCIECFLCQNVCHVVRDHEE
FT                   NKENFAGPRFHMRIAELDMHPLDTVDRKEMAQDEFGLGYCNITKCCTEVCPEHIKITDN
FT                   ALIPMKERVADRKYDPIVWLGNKLFRR"
FT   gene            complement(493585..495492)
FT                   /locus_tag="MSMEG_0418"
FT   CDS_pept        complement(493585..495492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0418"
FT                   /product="succinate dehydrogenase flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="identified by match to protein family HMM PF00890;
FT                   match to protein family HMM PF02910; match to protein
FT                   family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71086"
FT                   /db_xref="GOA:A0QPJ3"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPJ3"
FT                   /protein_id="ABK71086.1"
FT                   /translation="MSELERHSYDVVVIGAGGAGLRAVIEARERGLRVAVVTKSLFGKA
FT                   HTVMAEGGCAAAMRNVNTKDSWQVHFGDTMRGGKFLNNWRMAELHAQEAPDRVWELETY
FT                   GALFDRTKDGKISQRNFGGHTYPRLAHVGDRTGLEIIRTLQQKIVSLQQEDKRELGDYE
FT                   ARIRVFHETSITELILDDGKIAGAFGYYRETGNFVLFEAPAVVLATGGIGKSFKVSSNS
FT                   WEYTGDGHALALRAGSALINMEFIQFHPTGMVWPLSVKGILVTEGVRGDGGVLKNSEGK
FT                   RFMFDYIPSVFKGQYAETEEEADQWLKDNDSARRTPDLLPRDEVARAINAEVKAGRGSP
FT                   HGGVYLDIASRMPAEEIKRRLPSMYHQFIELAEVDITKDAMEVGPTCHYVMGGIEVDPD
FT                   TAAGATPGLFAAGECSGGMHGSNRLGGNSLSDLLVFGRRAGLGAADYVRALPDRPKVSE
FT                   AAVEDATRLVLAPFEPKAEPENPYTLHAELQQSMNDLVGIIRKEAEIQEALDRLQELKR
FT                   RYANVTVEGGRVFNPGWHLAIDMRNMLLVSECVAKAALQRTESRGGHTRDDYPEMDANW
FT                   RNTLLVCRVSGGDPVVPDVTVTPEQQVPMRPDLLGCFELSELEKYYTPEELAEHPERKG
FT                   "
FT   gene            complement(495575..496396)
FT                   /locus_tag="MSMEG_0419"
FT   CDS_pept        complement(495575..496396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0419"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70657"
FT                   /db_xref="GOA:A0QPJ4"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPJ4"
FT                   /protein_id="ABK70657.1"
FT                   /translation="MSAPTADRRATGVFSPRRAQIPERTLRTDRWWQAPLLTNLGLAAF
FT                   VIYATIRAFWGSAYWVADYHYLTPFYSPCVSTACAPGSSHFGQWVGDLPWFIPMAFISL
FT                   PFLLAFRLTCYYYRKAYYRSVWQSPTACAVAEPHAKYTGETRFPLILQNIHRYFFYAAV
FT                   LISLVNTYDAITAFHSPSGFGFGLGNVILTGNVILLWVYTLSCHSCRHVTGGRLKHFSK
FT                   HPVRYWIWTQVSKLNTRHMLFAWITLGTLVLTDFYIMLVASGTISDLRFIG"
FT   gene            complement(496449..496745)
FT                   /locus_tag="MSMEG_0420"
FT   CDS_pept        complement(496449..496745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73864"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPJ5"
FT                   /protein_id="ABK73864.1"
FT                   /translation="MSTTTEFAELHNLIGDMRRCVTTLAAKYGDSPAMRRVTNDAERIL
FT                   NDIDRLDIDAEELEMHHGITRTKPGTEKIPVPDTQYGTEFWQDVADEGLGGYR"
FT   gene            496794..496940
FT                   /locus_tag="MSMEG_0421"
FT   CDS_pept        496794..496940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0421"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74266"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPJ6"
FT                   /protein_id="ABK74266.1"
FT                   /translation="MVATSRSERDAHHVSEGRGARCAFPVPFRQGGVEASRQAVSRIGK
FT                   QLR"
FT   gene            497010..497777
FT                   /locus_tag="MSMEG_0422"
FT   CDS_pept        497010..497777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0422"
FT                   /product="transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71310"
FT                   /db_xref="GOA:A0QPJ7"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPJ7"
FT                   /protein_id="ABK71310.1"
FT                   /translation="MGNTRSDGLEAKAEALLALHRPGDPGVLPTVWDAWSARLAVDAGF
FT                   AALTVGSHPVADSIGKSDGENMAFEDLLTRVRQITAAVEVPVSVDIESGYGESPERLIE
FT                   GLLDAGVVGFNLEDTVHKEGKRLRTATEHAELVGQLRAAADAAGVHVVINARTDLFLRN
FT                   DGDDADRVERAIARMSEAAAAGADSLFPAGLRDPEGLARFTSAVSLPVSVTVPPEDTDK
FT                   AALAALGVGRITFGPFLQWALGAQAKEILGLWA"
FT   gene            497860..498360
FT                   /locus_tag="MSMEG_0423"
FT   CDS_pept        497860..498360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0423"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73090"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPJ8"
FT                   /protein_id="ABK73090.1"
FT                   /translation="MCAAASAPVTAVLAMAAVAPMAAADPGSSASGLEMIPLQNVIRQC
FT                   DFVVEQFLMGRGNGTGSGAVEIGSVGDGTVRADVRMQTLRPNTTYRVRLIQLPRPSVAP
FT                   CNPGDPGVATATMFADFAGNGSTTITGRREPGARQAWVVVEGPPVPGGVRGDVYSTVTL
FT                   AKI"
FT   gene            complement(498438..498875)
FT                   /locus_tag="MSMEG_0424"
FT   CDS_pept        complement(498438..498875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0424"
FT                   /product="Hsp20/alpha crystallin family protein"
FT                   /note="identified by match to protein family HMM PF00011"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75025"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPJ9"
FT                   /protein_id="ABK75025.1"
FT                   /translation="MSTLMKTPAVWTRPAWQLDNWVRDFFGPADDWFKGFTPAAEVTRD
FT                   GEDAVVSVELPGVDVGKDVNVEVDRGRLVIHGERRDERSEESDGRTYSEVRYGSFRREF
FT                   KLPAHVTGDAVTASYDAGVLKVRVAGAYAGEQPQRIAIESR"
FT   gene            complement(498953..499888)
FT                   /locus_tag="MSMEG_0425"
FT   CDS_pept        complement(498953..499888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0425"
FT                   /product="putative membrane protein DcsA"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69845"
FT                   /db_xref="GOA:A0QPK0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPK0"
FT                   /protein_id="ABK69845.1"
FT                   /translation="MSDESSATALLSPALSRAGLGWGFLGVAAFSFTVIFTRVALGGLS
FT                   PLFIGAGRAVVAAALAAAALTFTRAALPRGRQWLRLGVVAAGVVAGFPLLTSYALTTVP
FT                   ATHGAVVIALLPAATAVAAVLRCREHPPLAFWAAAGAGALAAVVFAMLHGGGVGQLHWA
FT                   DLLLFGAVIAAAIGYAEGGLLARELGSWQTVSWALVVAAPVMVALTAAAVVDRPPQAGA
FT                   GEWAAFGYLAAVSMFLGFFAWYRGLAIGPMAQVSQVQLVQPVLTICWAALLLHESLTWT
FT                   TACGGAAVVASAGFAVRMRRSPRANSHAGT"
FT   gene            499923..501296
FT                   /locus_tag="MSMEG_0426"
FT   CDS_pept        499923..501296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0426"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72087"
FT                   /db_xref="GOA:A0QPK1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPK1"
FT                   /protein_id="ABK72087.1"
FT                   /translation="MRQWIAGAPPGAQLPSNRVLVAQYGASPVTVASAMRTLRGLGLIE
FT                   TRPGVGTFVRATRSSRSPDYAWQTAALGSPRARIPVLSAPMRYGAPDAVALHSGYPARE
FT                   LLPHRLVRAALTRAARSEAALSRSAVTGLPDLQAWFAQELAEAVPAGRSAPGPRDVVVL
FT                   PGSQSGLSSAFRALVGHGQPLLIESPTYWGAIIAAAQAGVRIVPVPSGVEGPDPDELAR
FT                   AFDDTGARVFYAQPNFANPTGAQWSTERVEQILDVVRTRKAFLIDDNWAHDFGIDSTSR
FT                   PVAAHDDDGHVIYLRSLTKSVSPAMRVAAVIARGPVRERIVADRGAESMYVSGALQAAV
FT                   LDVVTQPAWRSHLRDLRAQLRQRRDHLVACLADHVNVARLEQVPPGGLHLWLRLPDQTD
FT                   LDRLVRDCEAEKVLVAAGTEWFPAEPSGRYLRLNFSGPEPDRFEEAARVIGRSLRRQL"
FT   gene            501440..504019
FT                   /gene="nirB"
FT                   /locus_tag="MSMEG_0427"
FT   CDS_pept        501440..504019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirB"
FT                   /locus_tag="MSMEG_0427"
FT                   /product="nitrite reductase [NAD(P)H], large subunit"
FT                   /EC_number="1.7.1.4"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01077; match to protein
FT                   family HMM PF03460; match to protein family HMM PF04324;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR02374"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71382"
FT                   /db_xref="GOA:A0QPK2"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPK2"
FT                   /protein_id="ABK71382.1"
FT                   /translation="MQSTRNVVVVGHGMVGHRFVEALRARDTEGSWRVTVLGEEREAAY
FT                   DRVGLTGYTEHWDRSLLALPGNEYAGDDLVELHLGSAVVEIDRPARTVRTADGCTFSYD
FT                   ALVLATGSYAFVPPVPGRDLPGCHVYRTLDDLDAIRASAANASKSKSPVGVVIGGGLLG
FT                   LEAANALRQFGLRTHVLEMSPHLMAAQLDEAGGVLLNRMMRDLGIEVHTAVSTQSIAPA
FT                   QKRKPLRRSEIDDSLRVSLDDGTAIDAGVVIFAAGVRPRDELAREAGLDMAQRGGVLTD
FT                   SNCVTSDPNIYAIGEVAAVDGRCYGLVAPGYTTAEVVADRLLGGSAEFPGADMSTKLKL
FT                   LGVDVASFGDAKGITPNCLEVVVNDPVKQTYAKLVLSDDAKTLLGGILVGDASAYGVLR
FT                   PMVASELPGDPLALIAPTTGGDAPGLGVGALPDIAQICSCNNVTKGDLTEAIAGGCCDV
FT                   ADLKKCTLAGTSCGSCVPLLKQLLEAQGVEQSKALCEHFSQSRAELFEIISATEIRTFS
FT                   GLIERFGTGKGCDICKPTIASILASTSSDHILDGEQAALQDSNDHFLANIQRNGSYSVV
FT                   PRVPGGDITPEQLILIGEIARDFGLYTKITGGQRIDMFGARVEQLPEIWRRLVEGGMES
FT                   GHAYGKSLRTVKSCVGSDWCRYGQQDSVQMAINLELRYRGLRAPHKIKMGVSGCARECA
FT                   EARGKDVGVIATDSGWNLYVGGNGGMTPRHAQLLAGDLDDETLIRYIDRFLMFYIRTAD
FT                   RLQRTAPWVEALDGGIDHLRDVVCDDSLGLAEEFEAAMARHVEGYACEWKGVLQDPDKL
FT                   ARFVSFVNAPDTPDPTVSFTERSGRKVPDLRPVSIGMPTIRPLQEMS"
FT   gene            504016..504384
FT                   /locus_tag="MSMEG_0428"
FT   CDS_pept        504016..504384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0428"
FT                   /product="nitrite reductase [NAD(P)H] small subunit"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69527"
FT                   /db_xref="GOA:A0QPK3"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPK3"
FT                   /protein_id="ABK69527.1"
FT                   /translation="MTLTDDRKDVVAQTHSEWTRACAYDFLIPGRGVAVLLADGSQAAL
FT                   FKLDDGSVHAIGNIDPFSGAAVMSRGITGDRGGCLTVQSPIKKQAFALVDGVCLDDPEV
FT                   SLPVYRTRISADGFVEIA"
FT   gene            complement(504399..504641)
FT                   /locus_tag="MSMEG_0429"
FT   CDS_pept        complement(504399..504641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0429"
FT                   /product="putative ferric uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPK4"
FT                   /protein_id="ABK70711.1"
FT                   /translation="MPDPTPAERLRQQLMAVLSDTRQSKSTAQLRDDVRERFGDPVVIE
FT                   AVYRNLTVLERRGDVRRSKSSGRDTHWLAASEHIG"
FT   gene            505025..506392
FT                   /locus_tag="MSMEG_0430"
FT   CDS_pept        505025..506392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0430"
FT                   /product="ISMsm4, transposase"
FT                   /note="identified by similarity to GP:150005; match to
FT                   protein family HMM PF01610"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75391"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPK5"
FT                   /protein_id="ABK75391.1"
FT                   /translation="MSWVFFRHPGQGTRTMVDGSSLLLDLDGVVVESVQRLEDGTRLVQ
FT                   VLTAPQWVGICPECGERSTRSKGWVQTGPRDVVVGPDRPILRWRKRKWLCPSTVCTRKV
FT                   FTESVPGIPARARVTPRAKATMATAVLDEDRSVAAVAGQYRCGWHTVHDEVIATAEDAL
FT                   AGELAPVAVLGIDETRRGKAKWEHNPVLGRRVWVDRWDTGLVDITGDQGLLGQVNGRTS
FT                   AAVIDWLAGQDPDWRAAITHVAIDLSPAYARVAREALPHAILIADRFHLVKKANDMVDA
FT                   VRRRVTWTQRGRRGRKADVEWINRRRLLRGSERLTADQRATLFAKLLSADPNQDIAAAW
FT                   IAKELLRDLLSCADRGGLRYEITTALDRFYRFCAACTVPEVIRLARTIETWQAPIIAAL
FT                   QTGLSNARTEGYNRIVKHVGRIAFGFRNPENQRRRVRWACTRRSRRVTPSRHQRHC"
FT   gene            complement(506807..507502)
FT                   /locus_tag="MSMEG_0431"
FT   CDS_pept        complement(506807..507502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0431"
FT                   /product="secreted protein"
FT                   /note="identified by match to protein family HMM PF01903"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73502"
FT                   /db_xref="GOA:A0QPK6"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPK6"
FT                   /protein_id="ABK73502.1"
FT                   /translation="MSLLLVAHGTRKPGGVAMIADLAQRVAEQLERQVQVAFVDVLGPT
FT                   PRDVLDTMAADRPVVLVPAFLAAGYHVRVDVPAHVSASGHPLVTVTPPLGPCHGTVRVL
FT                   ADRLVESGWQPGDAVILAAAGTSDPYAQSDLRRTAAMLSAVTGDRVELAYAATGAPSVA
FT                   DAVAAQRRRSDRRVVVASYLLAEGLFQDRLREAGADLVTAPLGTHGGMVRLVANRFRRA
FT                   GVLSLPAAA"
FT   gene            complement(507499..508656)
FT                   /locus_tag="MSMEG_0432"
FT   CDS_pept        complement(507499..508656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0432"
FT                   /product="uroporphyrinogen-III synthetase"
FT                   /note="identified by match to protein family HMM PF00486;
FT                   match to protein family HMM PF02602"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74496"
FT                   /db_xref="GOA:A0QPK7"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPK7"
FT                   /protein_id="ABK74496.1"
FT                   /translation="MREPDWAPLTGFRVAVTSARRADELCALLRRRGATVTSAPAITMV
FT                   PLPDDDELRAHTESLITDPPDIVVATTGIGLRGWIAAADGWGLAGELTEALGKARIVSR
FT                   GPKATGALRAAGLPEEWSPDSESSREVVRYLVEHGVDGRRIAVQLHGATDDWDPFPEFL
FT                   DELRVAGAEVVPIRVYRWHPAPPGGEFDQLVAGIAERRFDAVSFTSAPAVASVLMRATE
FT                   LGLTEQVVSALRTDVHAMCVGPVTARPLVRLGIPTSAPERMRLGALARHITDELPLLQS
FT                   RTLRVAGHLLEIRGTCVLVDGVVKSLSPAGMATIRALAHRPGAVVSRFDLLGALPGSGT
FT                   DTHAVETAVLRLRTALGDKSIVSTVVKRGYRLAVDDTDTEMARAL"
FT   gene            complement(508691..510100)
FT                   /locus_tag="MSMEG_0433"
FT   CDS_pept        complement(508691..510100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0433"
FT                   /product="nitrite extrusion protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABK76086"
FT                   /db_xref="GOA:A0QPK8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPK8"
FT                   /protein_id="ABK76086.1"
FT                   /translation="MPTLLKPKRITNWDPEDVAAWEAGNKYVARRNLIWSVVAEHIGFS
FT                   IWSIWSVMVLFMPEAVYGFSAGDKFLLGATATLVGSCLRIPYTLATATFGGRNWTVFSA
FT                   LVLLIPTVMTVVLMANPGLPLWPYLVCAALAGFGGGNFASSMTNINAFYPQRLKGWALG
FT                   LNAGGGNIGVPMIQLVGLFVIATAGNRAPYWVCAVYLVALAVAGLGAALYMDNLEHHKI
FT                   DLGAMKAILGERDTWIISLLYIGTFGSFIGFAFAFGQVLQINFISGGQTPAQASLHAAQ
FT                   IAFIGPLLGSLSRVYGGKLADRIGGGRVTLAVFAGMILGAGLLVAVSTVSDGSSEAATG
FT                   LMMSGYVVGFIALFLLSGIGNGSVYKMIPSIFEARSHSLDVSEDERRHWSRSMSGALIG
FT                   FAGAVGALGGVGINMALRQSYLSSGSATTAFWTFLAFYVLASVVTWFCYVRRPAAMPVT
FT                   GTERHAPAIAG"
FT   gene            complement(510209..510841)
FT                   /locus_tag="MSMEG_0434"
FT   CDS_pept        complement(510209..510841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0434"
FT                   /product="aminoglycoside 2'-N-acetyltransferase
FT                   (AAC(2')-Id)"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70574"
FT                   /db_xref="GOA:P94968"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94968"
FT                   /protein_id="ABK70574.1"
FT                   /translation="MLTQHVSEARTRGAIHTARLIHTSDLDQETRDGARRMVIEAFRDP
FT                   SGDSDFTDDFTDDDWDHALGGMHALISHHGALIAHGAVVQRRLMYRGPDGRGHALRCGY
FT                   VEAVAVREDRRGDGLGTAVLDALEQVIRGAYQIGALSASDIARPMYIARGWLSWEGPTS
FT                   VLTPTEGIVRTPEDDRSLFVLPVDLPDGLELDTAREITCDWRSGDPW"
FT   gene            complement(510873..511757)
FT                   /locus_tag="MSMEG_0435"
FT   CDS_pept        complement(510873..511757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0435"
FT                   /product="allophanate hydrolase subunit 2"
FT                   /note="identified by match to protein family HMM PF02626;
FT                   match to protein family HMM TIGR00724"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75339"
FT                   /db_xref="GOA:A0QPL0"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="PDB:3MML"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPL0"
FT                   /protein_id="ABK75339.1"
FT                   /translation="MGTTLEVLRTGPLALVEDLGRPGLAHMGVTRSGAADRRSHTLANR
FT                   LVANPGESATIEVTFGGFSARVCGGDVAIAVTGADTDPAVNGIPFGTNSIHHVHDGQVI
FT                   SLGAPHSGLRSYLAVRGGIDVTPVLGSRSYDVMSAIGPSPLRPGDVLPVGEHTDEFPEL
FT                   DQAPVAAIAEDVVELQVVPGPRDDWFVDPDILVRTNWLVTNRSDRVGMRLVGMPLEYRN
FT                   PDRQLPSEGATRGAIQVPPNGFPVILGPDHPVTGGYPVIGVVTEEDIDKLGQVRPGQTV
FT                   RLHWAYPRRPFET"
FT   gene            complement(511773..512405)
FT                   /locus_tag="MSMEG_0436"
FT   CDS_pept        complement(511773..512405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0436"
FT                   /product="allophanate hydrolase subunit 1"
FT                   /note="identified by match to protein family HMM PF02682"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73152"
FT                   /db_xref="GOA:A0QPL1"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="PDB:3MML"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPL1"
FT                   /protein_id="ABK73152.1"
FT                   /translation="MTLGTVHNYGDQALLLEFDSTAEVLAWTETLREAELLGVVDIVPA
FT                   ARTVLVKLAGPRYQAPTRQRLGKLRVRPEAITHQPPGDRVDVTIDVVYDGADLHEVASL
FT                   TGMTPAQVIAAHTGTPWRVGFCGFAPGFAYLVDGDARLQVPRRAEPRTSVPAGAVALAG
FT                   EFSGVYPRQSPGGWQLIGHTDAVMFDVNRDKPALLTPGMWVQFRAVG"
FT   gene            complement(512510..513190)
FT                   /locus_tag="MSMEG_0437"
FT   CDS_pept        complement(512510..513190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0437"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="identified by match to protein family HMM PF02592;
FT                   match to protein family HMM TIGR00697"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75782"
FT                   /db_xref="GOA:A0QPL2"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPL2"
FT                   /protein_id="ABK75782.1"
FT                   /translation="MSIPEPEHRGTASVGSAYYPMFVAVFTALVIISNVTATKGVAFGP
FT                   IITDGGFIVFPLTYVIGDVLSEVYGFKAARRAILLGFAMNALAALAFWVTVYLPAADFY
FT                   TNQEHFENVVGAYTQLIVAGLAGFLVGQTINAWVVVAIKQRTKEKHLWARLIGSTFAGQ
FT                   LGDTLVFCAIAAGAIGISTFGDFVTYTALGWFYKTAVEVIMLPVTYRVIAFVKRSEPTY
FT                   QVAV"
FT   gene            complement(513215..514168)
FT                   /locus_tag="MSMEG_0438"
FT   CDS_pept        complement(513215..514168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0438"
FT                   /product="Periplasmic binding protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71591"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="PDB:4MDY"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPL3"
FT                   /protein_id="ABK71591.1"
FT                   /translation="MPRPLTRRGFLAVTAGLALVAACSTDKPGEVADDGSVTVRHAFGD
FT                   TTIPGPPQRVVSAGLTEQDDLLAVGVVPIAVTDWFGGEPFGVWPWAQRQLAGAQPAVLN
FT                   LDNGIPVEEIAALKPDLIVATNAGLDADTYAKLSEIAPTVAQTGSEAFFEPWKDQATII
FT                   GQAVFKNAEMTELIKSVDDRFTTVKTDHPQFSGKKALLLGGTLYRGGVQATPPGWRTDF
FT                   LTQMGLTVLQVPALIPRDEIASVLDGADVLIWTTESDQDRDALLADPIVAQLAATRRDR
FT                   NIFTTKELAGAIAFASPLSYPVVADQLPPELARVLG"
FT   gene            complement(514184..515320)
FT                   /locus_tag="MSMEG_0439"
FT   CDS_pept        complement(514184..515320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03601"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72014"
FT                   /db_xref="GOA:A0QPL4"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPL4"
FT                   /protein_id="ABK72014.1"
FT                   /translation="MTEQRTEEQSGQSGQPRQSGQSALGYAVAGVLVVIALGAATKFLE
FT                   TQVPQWFAGTSFAKAAKSIEFPVYAIALGLIGNAILSKLALRDALSRGFRTEFFIKTGL
FT                   VLLGASINLKVLVTAAGPAIIQALLLISIVFGFTWWLGGRLGLEDKLRALLASAVSICG
FT                   VSAAIAAAGAVQAKKEQLAYAASLVIVFALPSIFLLPWLADVFGLSDAVAGAWIGGNID
FT                   TTAAVAASGAIAGEDALQIATIVKTTQNALIGFVAIALTAYFALKVERRTAADARPSLS
FT                   QFWDRFPKFVLGFIAASIIGTLYLQFAADGKAAIATVNDLRNWFLIFAFVAIGLEFSAR
FT                   GLREAGWRPIAVFASATVVNIVVALGLATVLFGSFTLD"
FT   gene            complement(515317..515415)
FT                   /locus_tag="MSMEG_0440"
FT   CDS_pept        complement(515317..515415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0440"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73107"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPL5"
FT                   /protein_id="ABK73107.1"
FT                   /translation="MNRVNEDWLAVIVGLALLGLILAGAVPGSVIP"
FT   gene            complement(515471..516199)
FT                   /locus_tag="MSMEG_0441"
FT   CDS_pept        complement(515471..516199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0441"
FT                   /product="conserved hypothetical protein, putative"
FT                   /note="identified by match to protein family HMM TIGR03083"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75346"
FT                   /db_xref="GOA:A0QPL6"
FT                   /db_xref="InterPro:IPR010872"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPL6"
FT                   /protein_id="ABK75346.1"
FT                   /translation="MDDNTLLTQLQTDVLAIQSYALGEDADLARAVPTCPGWTVADLLG
FT                   HLWSIESWVRQILRTRELAEEPQPQDEPTQAVADFLDGIPDYLTAMRAVNADEPCWGFG
FT                   PKPRLAGFWIRRQAHEHAVHHADLQHALGADPVGLTPDFCADGVDEVLAMFYPRQVRFG
FT                   RTEPVAAPILFRTADTEHAWTVGGTEPSEPGQAEPVATVTASAEDLYLGLWKRRDLLET
FT                   AKVEGDTAAVQQALNVALTP"
FT   gene            complement(516209..516811)
FT                   /locus_tag="MSMEG_0442"
FT   CDS_pept        complement(516209..516811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0442"
FT                   /product="tetracyclin repressor, C-all-alpha domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02909"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74199"
FT                   /db_xref="GOA:A0QPL7"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPL7"
FT                   /protein_id="ABK74199.1"
FT                   /translation="MGRPSTPILSTDRIATAALDLVNSTGGFTIPGLARRLKVSPSSLY
FT                   NHVAGREQIVELLRERAMSEVNLPDLDTDRPWSDVVADIMRSYRRSFARYPRLIPLLTI
FT                   HAVNSTQAFRMYNALAVTLGRAGFSAADSLRIITLIDNYVLGSALDLAAPDEPWESGTE
FT                   VGPELAAALATGAPKPARADDAFEFGLAVLLRGLTNP"
FT   gene            516901..517893
FT                   /locus_tag="MSMEG_0443"
FT   CDS_pept        516901..517893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0443"
FT                   /product="hydrolase, carbon-nitrogen family protein"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70093"
FT                   /db_xref="GOA:A0QPL8"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPL8"
FT                   /protein_id="ABK70093.1"
FT                   /translation="MITLTATAPESLSRSTASQRPPLRVGLVQHRWRPDAGELVKVLRE
FT                   GIDRAAGEGAKAVFLPEITLLRYPADTPAGPNPGDVAEDLTGGPTFELAAEAARANGIF
FT                   VHASLYEKAPAADGLGYNTAILVSPEGELVGRTRKMHIPISAGYYEDTYFRPGPARPSD
FT                   GDPYPVYSPEGLGARIGLPTCWDEWFPEVARCYSLGGAEIVVYPTAIGSEPVFPAFDTQ
FT                   PLWQQVIVANGISSGLFMVVPNRTGDEGSLSFYGSSFISDPFGRVLVSAPRDEEAVLVA
FT                   DLDLDQRRDWLELFPFLLTRRPESYGALTEPVDPDHPYGAGHAATAVVK"
FT   gene            517901..518923
FT                   /locus_tag="MSMEG_0444"
FT   CDS_pept        517901..518923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0444"
FT                   /product="agmatine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /note="identified by match to protein family HMM PF04371"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69779"
FT                   /db_xref="GOA:A0QPL9"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPL9"
FT                   /protein_id="ABK69779.1"
FT                   /translation="MASYVMPAEGAPQDRVWMAFPCEGYSLGDTEADRHEARSTWAAVA
FT                   HAIAQFEPVTMLVDPAEIGAAKSYVSQDVELIEAPLNDAWMRDIGPTFVHAADGSVAAV
FT                   DWTFNGWGGQDWARWDRDAEIGVTVAELASVPVVSSALVNEGGGIQVDGNGTVLLTETV
FT                   QLDPGRNPGLTREQVERELARTIGGTDFVWLPRGLTRDSERFGTRGHVDIVAAIPTPGR
FT                   LLLHTQRAEAHPDSLVCKEIRAVLEADGRFDIVEMPAPDTLTDAEGPVDYSYINHLVVN
FT                   GGVIACAFGDPRDADAAAILAEQYPGREVVSVDARPLFARGGGIHCITQQQPAPRGKVS
FT                   "
FT   gene            518920..520557
FT                   /locus_tag="MSMEG_0445"
FT   CDS_pept        518920..520557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0445"
FT                   /product="amidohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72089"
FT                   /db_xref="GOA:A0QPM0"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPM0"
FT                   /protein_id="ABK72089.1"
FT                   /translation="MSQRIVPTVNSSTVFRNGVIWSPDGNTTTDALLISGGVVQAVGDA
FT                   AKAGSADVEVDLEGGFLMPSFGDGHAHPLYGGLESAGPAVRKGKSVDEIVAAVKEYADA
FT                   HPEQEWIVGASYDGSLASDGLFDARWLDAVVPDRPVVLRAWDYHTFWVNSAALQRAGIA
FT                   ADTPDPVMGEIPRRADGSPLGTLREWGATDLVSAVMPARDESVRVGALSTAADYYLARG
FT                   VTWVQDAWVEPADVDTYVAAAQQGALRMRFNLAFYADPRHFDEQVTQYAAARDRVRAAG
FT                   SDLLTAQTVKFFADGVVENETGALLAPYCSGLHSHGMQVWEGDSLAQAARRVDDLGLQI
FT                   HIHAIGDAAVRQALDAIEYVVRQNGPRDRRPVIAHAQLVDDADLGRFAELGVIPNMQPL
FT                   WAQMDALMTVLTIPRLGVERAQKQYRIRSLENSGAALAFGSDWPVSSGAPLDGIAVAVS
FT                   RRTADGEPEGGWTPHEILPPEAALASYTGAVAYQAFAEKTWGRIVPGASADLVWLDRDP
FT                   RTVPPLELPAVGVRATYLQGRPAHTAAD"
FT   gene            520569..521912
FT                   /locus_tag="MSMEG_0446"
FT   CDS_pept        520569..521912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0446"
FT                   /product="putrescine importer"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71559"
FT                   /db_xref="GOA:A0QPM1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPM1"
FT                   /protein_id="ABK71559.1"
FT                   /translation="MSSTAEVAEGHLKRALGLPSLVLFGLVYMVPLTVFTTYGIVTQTS
FT                   GGRVPLSYLVTLAAMVFTARSYARMSVAYPVAGSAYTYTQKSFGAPVGFLAGWSLLLDY
FT                   LFLPMINYLVIGLYLSAAIPAIPAWVFILIAIAIVTVLNIVGIVSVARANFVIIAVQAI
FT                   FIVAFLILATSKVFSYGTVDLAAPFTGDGTAPGFSPVLAGAAILCLSFLGFDAVSTLSE
FT                   EAKDPKRTVPRAIMIATLASGLIFVVLSYVAQVVFPSNEFSDVDSGSLDVMMTAGGNFL
FT                   QVFFTAAYVAGATGSAITSQASVARILYAMGRDGVLPRPFFGHVSPRFSTPVYAILAVA
FT                   VISLLAIVIDLGILASVISFGALVAFSAVNLSVIKHYFVDHRERAGAQAINSLVLPLIG
FT                   FALTVWLWFSLDGLALIIGLCWLAIGFVWLAGVTRGFQRPTPVLDMKE"
FT   gene            complement(521987..522406)
FT                   /locus_tag="MSMEG_0447"
FT   CDS_pept        complement(521987..522406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70779"
FT                   /db_xref="GOA:A0QPM2"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPM2"
FT                   /protein_id="ABK70779.1"
FT                   /translation="MTTSTDNVLYTAKTHTTGGRQGESFSSDGNLDIQLTPPGGNGSGT
FT                   NPEQLFAAGWSACFLSAMGVTAPKHNVKLPADTAVDAEVDLLNTDGEFSLRARLNVTIP
FT                   GVDQATAQAIVDDAHQVCPYSKATRGNIDVTVTAA"
FT   gene            522533..522976
FT                   /locus_tag="MSMEG_0448"
FT   CDS_pept        522533..522976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0448"
FT                   /product="transcriptional regulator, MarR family protein"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75328"
FT                   /db_xref="GOA:A0QPM3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPM3"
FT                   /protein_id="ABK75328.1"
FT                   /translation="MSPPRLNLADFLCFSIYSANLAFGKAYKPLLDQRGITYTQYIAIV
FT                   ALYDQDHQTVSGLGEKLFLESNTLTPILKKLESLGYVTRRRDPDDERQVVVSLTEAGRE
FT                   LREQSFELELASATGLTVDEMRTMQKGIAKLRDNLREHVRATR"
FT   gene            complement(522988..524988)
FT                   /locus_tag="MSMEG_0449"
FT   CDS_pept        complement(522988..524988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0449"
FT                   /product="transporter, major facilitator family protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00582;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73630"
FT                   /db_xref="GOA:A0QPM4"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPM4"
FT                   /protein_id="ABK73630.1"
FT                   /translation="MRQGPLAGRYPAVATMVTLALIPYLALSAAIDPLVPIICEQLHMT
FT                   PQEMSLGSGLGNAAYAVGTVLAVQFAQHLPQRRMMIAYAVLLVIGSAVAASAPNGTVFI
FT                   IGHVLQGLSTSMLLIAAAPPLTIGFPREKLRHTAVIMNMCVFGAVALGPFVGGTQAEAH
FT                   AWRPLFWIIAAIALAALVMALLTFEDAPPADRTAPRDIKAIALAAVGCAAAFIGAAQLT
FT                   SHGFDDAAVTVPMLGGLLLIVTLIVYQFRAPRPLLTIRTMLTSSIPVAGVGVALFAAAA
FT                   SVAATALTAEVFLESFNPVHVGLLYLPELGGAVVMAFVFGHVISRRAMHYLPLVGMALL
FT                   AAGVVAFRFALPANQPLALVGSALTGLALGATVAPALFVAGFSLQSNSLQRVFAIIELL
FT                   RAVAAFMVAPIFAHFALTATGGLVQGTGDALWISLGLAIGGALFGVVVYLLSGARPQAP
FT                   DIDRFLDGDDPAWYSPPLLARLRPGLPAPQVPAAVTPSRPAARVVPALTGPVLIAYDGS
FT                   ERAANAIDFAAGRLSGERDALVVCVWQPADVGFTPAGTEPFDADQASEVRRAAERTAAR
FT                   GAELAEAAGFTACSVAVEAAPTWQGIVETAEKHGASMIVIGPHRRSGFLGHLQGSVAAA
FT                   VVAHATTPVLVVPEATPKLTPELLRSVAVPH"
FT   gene            525004..525219
FT                   /locus_tag="MSMEG_0450"
FT   CDS_pept        525004..525219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0450"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69585"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPM5"
FT                   /protein_id="ABK69585.1"
FT                   /translation="MSGSVHALAVKRRAVIALFHLWVVSRPFAQRKHLCLRNDITRNNF
FT                   QGTHSRCAGDGQSGAMLRRRLGWRRW"
FT   gene            complement(525323..525571)
FT                   /locus_tag="MSMEG_0451"
FT   CDS_pept        complement(525323..525571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0451"
FT                   /product="oxidoreductase, FAD-linked"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75262"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPM6"
FT                   /protein_id="ABK75262.1"
FT                   /translation="MSDNSAVARIDEVAPGDVVTLGTGEPTCKVVHKEDTESGLLVTFE
FT                   GDDGETFQREFAAGTPVTRTMESKWESSQSPTPNTSP"
FT   gene            complement(525610..527055)
FT                   /locus_tag="MSMEG_0452"
FT   CDS_pept        complement(525610..527055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0452"
FT                   /product="inner membrane permease YgbN"
FT                   /note="identified by match to protein family HMM PF02447;
FT                   match to protein family HMM PF03600; match to protein
FT                   family HMM TIGR00791"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71248"
FT                   /db_xref="GOA:A0QPM7"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPM7"
FT                   /protein_id="ABK71248.1"
FT                   /translation="MDAIDPAYGTTTLLLIAAAAVAVLLFLIIKVKLHAFVALVLVSLL
FT                   TALAAGIPVADVPSALSSGFSSTLGSVALLVGFGVMIGRLLETTGGAQVLADTLIGRFG
FT                   EKRAPLALGVAALLFGFPIFFDAGLVVFLPIIMTVARRFGGSLLLYAFPAAGAFAAMHA
FT                   LVPPHPGPVAAAELLGANIGLTLIVGVPVAVVSWYVGAFLVSQVIGRRVHIDIPTSLFG
FT                   EINGGRDIDATGTEADADGAGATGASRTATRATPSFLTVLGVLLLPFVLISCNTVVATL
FT                   QTAGVIPEEATWAEYLKLIGTTSIALLITVIVATLVLGLRGRSMATVTDILDNALGPIC
FT                   AIILITGAGGMFGGVLRTSGIGDALSGSLSDLGISLILQAFLISTLLRVAQGSATVALT
FT                   TTAGLLSAAVAAAGLSSLQLTALVMAIAAGATVLSHVNDSGFWLVSRFFGMDVKTTLKT
FT                   WTLLETTLGVTAFVISLGLWAIG"
FT   gene            complement(527092..527604)
FT                   /gene="aroK"
FT                   /locus_tag="MSMEG_0453"
FT   CDS_pept        complement(527092..527604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="MSMEG_0453"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="identified by match to protein family HMM PF01202;
FT                   match to protein family HMM TIGR01313"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75068"
FT                   /db_xref="GOA:A0QPM8"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPM8"
FT                   /protein_id="ABK75068.1"
FT                   /translation="MATPIVVMGVSGSGKSTVGAALAQRLRVPFADADDFHPPANIEKM
FT                   SAGHALDDDDRYPWLEAIGKWLAEHPAGGVMSCSALKRTYRDQLRQHCPDIEFLHLEGS
FT                   METIGRRQASRPGHFMPASLLESQFKTLEPLAPDECGVAIDVDQSIDDIIESYVSATQS
FT                   HTPEEDR"
FT   gene            527730..528464
FT                   /locus_tag="MSMEG_0454"
FT   CDS_pept        527730..528464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0454"
FT                   /product="GntR-family protein transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69951"
FT                   /db_xref="GOA:A0QPM9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPM9"
FT                   /protein_id="ABK69951.1"
FT                   /translation="MLDRPIAGELHGSLVAALGTGIVSGRYQPGHVLNLEGISAEHGVS
FT                   RSVAREAVRVLESMGMVESRRRVGITVQDPEKWNVFDPVLIRWRLQAGDRTAQLVSLSE
FT                   LRLGFEPAAAALAARRASPHQCRVLATAVSDMVMHGRNGDLAAYLAADKLFHQTMLEAS
FT                   GNEMFRALNGAVAEVLAGRTHHGLMPEKPNIDAIALHDEVARAIRMGEADQAERAMRAI
FT                   IDESVSAIVEVGPPGAGTAAQA"
FT   gene            528536..529963
FT                   /locus_tag="MSMEG_0455"
FT   CDS_pept        528536..529963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0455"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71965"
FT                   /db_xref="GOA:A0QPN0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPN0"
FT                   /protein_id="ABK71965.1"
FT                   /translation="MREYLKFYIDGRWVDPVEPRTLDVDNPTTEQVAGRIAIGAAADVD
FT                   AAVEAARKAFTTWSQTSRDERLAVLGAILDEYQKRAIDLADAVGEEMGAPASLAAGPQV
FT                   RMGLGHLTTSIEALKKFQFEEQYGSTLVVKEPIGVCGLITPWNWPINQIACKVFPALAT
FT                   GCTMVLKPSEVAPFSAQIFTEIIEAAGVPAGVYNLVYGDGPGVGSALSSHPDIDMVSFT
FT                   GSTRAGIDVARNAAPTVKRVTQELGGKSPNIVLDDADFAKSVAAGVSAMMTNSGQSCNA
FT                   PSRMLVPNSRMGEAITIARGTAAAVKVGDPSDKKAIGPVASKAQFDKIQGLIQKGIDEG
FT                   ATLVAGGTGRPDGLDTGYYVKPTVFADVTNDMTIAREEIFGPVLCILGYDDLDQAVEIA
FT                   NDTEYGLAGYVSGADLETARAVARRIRAGSVAINHGFDLSAPFGGYKRSGNGREWGHFG
FT                   FDEYLETKAAMGYAPPQ"
FT   gene            complement(529995..532136)
FT                   /locus_tag="MSMEG_0456"
FT   CDS_pept        complement(529995..532136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0456"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABK76234"
FT                   /db_xref="GOA:A0QPN1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QPN1"
FT                   /protein_id="ABK76234.1"
FT                   /translation="MTATLDVPEQNPDLVLDQSADDYWNHYQLTFALYSVSDRAIPSAY
FT                   DGLKPGQRRLLYQMHDSKLLPGNKPQKSSKVCSAVTGNLHPHGGASMYGAAALMAADFQ
FT                   RVKVIDGQGAFPRIQGDIPAADRYTEMRLSAPGAALTAELNDHAVPMVPTFDGEWVEPT
FT                   VLPAQWPVLLCNGAVGIAEGWATKVPAHNPREVMAACRALLKTPNMTDDRLCKLIPGPD
FT                   WGSGASVVGTAGLREYITTGRGHFTVRGTISVEGKNCIITELPPGVASNTVQDRIRALV
FT                   ESGEMSGVADMSDLTDRRNGLRIVVTAKRGHNAEQIRDQLLALTPLESTFAASLVALDE
FT                   NRVPRWWSVRDLIMAFLQLRDSVVLHRSEYRLEKVTARRHLVAGLMKIHLDIDAAVAVI
FT                   RGSETVDEARKGLQERFKIDAEQADYVLSLQLRRLTKLDVIELQAEAEKLDAEFAELND
FT                   LVTNPESRRKVIDKELVETAKLFKGPEYDRRTVLDFDATPVSRGDEDGSRERKVNTAWR
FT                   LDDRGVFSDSHGELLTSGLGWAVWSDGRIKFTTGNGLPFKIRDIPVAPDITGLVRSGVL
FT                   PEGYHLALVTRRGKILRVDPASVNPQGVAGNGVAGVKLAADGDEVIAALPVSCANGEAI
FT                   LSIAEKSWKVTEVADIPVKGRGGAGVAFHPFVKGEDALLAASISKTGYVRGKRAVRPEN
FT                   RAKASIKGSGADVTPAPAE"
FT   gene            complement(532147..534180)
FT                   /locus_tag="MSMEG_0457"
FT   CDS_pept        complement(532147..534180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0457"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /note="identified by match to protein family HMM PF00986;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70935"
FT                   /db_xref="GOA:A0QPN2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QPN2"
FT                   /protein_id="ABK70935.1"
FT                   /translation="MSYTAADITELDDVQHTRLRPAVNLGLDVLNTALREIVDNAIEEV
FT                   ADPGHGGSTVTITLHADGSVSVADDGRGLPVDTDPTTGKNGIVKTLGTARAGGKFSAHK
FT                   DATSTGAGLNGIGAAAAVFISARTDVTVRRDGKTFLQSFGRGYPGVFEGKEFDPEAPFT
FT                   RNDTQKLRGVSNRKPDLHGTEVRILFDPAIAPDSTLDIGEVLLRAHAAARMSPGVHLVV
FT                   VDEGWPGEEVPPAVLEPFSGPWGTDTLLDLMCTAAGTPLPEVRAVVEGRGEYTTGRGPT
FT                   PFRWSLTAGPAEPATVAAFCNTVRTPGGGSHLTAAIKGLSEALAERASRMRDLGLAKNE
FT                   EGPEPQDFAAVTALAVDTRAPDVAWDSQAKTAVSSRSLNLAMAPDVARSVTIWAANPAN
FT                   ADTVTLWSKLALESARARRSAEGAKARARAASKAKGLGTNLSLPPKLLPSRESGRGSGA
FT                   ELFLCEGDSALGTIKAARDATFQAAFPLKGKPPNVYGFPLNKARAKDEFDAIERILGCG
FT                   VRDHCDPELCRYDRILFASDADPDGGNINSSLISMFLDFYRPLVEAGMVYVTMPPLFVV
FT                   KAGDERIYCQDESERDAAVAQLKASSNRRVEVQRNKGLGEMDADDFWNTVLDPQRRTVI
FT                   RVRPDESEKKLHHTLFGGPPEGRRTWMADVAARVDTSALDLT"
FT   gene            534392..535687
FT                   /locus_tag="MSMEG_0458"
FT   CDS_pept        534392..535687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0458"
FT                   /product="two-component system sensor kinase"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM PF07730"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73590"
FT                   /db_xref="GOA:A0QPN3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPN3"
FT                   /protein_id="ABK73590.1"
FT                   /translation="MTSVTTTQRSGRLRQLGVDSAYVLLGFPLATVSFTVIVAMLAAGI
FT                   ATAVLVIGLPILVGTLLVARVLADIERLRLPAVLRRPRIRPAYRKAAPGAGVWNRLGAV
FT                   MADAQSWLDVVHAVVRFPVSLVTFSVVVSWWAAALGGTSTAAWDWAVPRGPDNQSLAQL
FT                   IGLGDSTVARIGFQTAAGLLCLVSLPWVVRGCALLDAGLARTLLCGVSEMRQTITVLAE
FT                   QKSAATSAEAHALRRLERDIHDGPQQRLIRLAMDLGRARQHTQPGALQDIIDEAVVQTQ
FT                   ETLDELRALSRGIAPPVLTDRGLPSALAALAIRCTVPVELNVDPGLGTSAGRPDPAVET
FT                   TVYFAVAEALTNVAKHSEATTCRVTVAAVPPTAQGSARISAEIIDDGRGGAHIAKGHGL
FT                   AGLADRIRAGGGTLDVSSPAGGPSTIAVALPV"
FT   gene            535697..536341
FT                   /locus_tag="MSMEG_0459"
FT   CDS_pept        535697..536341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0459"
FT                   /product="two-component system response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75050"
FT                   /db_xref="GOA:A0QPN4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPN4"
FT                   /protein_id="ABK75050.1"
FT                   /translation="MKVVVADDSVLLREGLIRLLTEGGHEVAAAVGDGPALVQAVDTHR
FT                   PDVSVVDVRMPPSHTDEGLRAAVEARRRVPRSPILVLSQYVEVSYADDLLADGAGAIGY
FT                   LLKDRVMALTQFLDAVQRVASGGTVLDPDVVAQLLVRRRRDDPLRQLSDRELQVLGLMA
FT                   EGRSNTNIARTLVVSDGAVEKHIGNIFAKLALPPDSEQHRRVLAVLAYLRG"
FT   gene            complement(536353..537297)
FT                   /locus_tag="MSMEG_0460"
FT   CDS_pept        complement(536353..537297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0460"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74583"
FT                   /db_xref="GOA:A0QPN5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPN5"
FT                   /protein_id="ABK74583.1"
FT                   /translation="MRHADEVSPLFQRQRPTPSDPPEGTPEWFTAALEHRPQHSTIDFE
FT                   GCRIHLRTWGDPENPPLVFVHGGAAHSGWWDHIAPFFTRTHRVIAPDVSGHGDSGTRSH
FT                   YSLTKWAREVLAVAAAEGPAARPTIVGHSMGGWVTATAAMKYGADIDSILIIDSPLRER
FT                   APEEGRLRNRRSDHPGYPSREEILARFRAVPAQDVTLPFIDRHIASESVRQTDTGWVWK
FT                   FDPAIFSGSLQGQTPAEQEILENTFAQIPCRVGYLRCENGLVPPDMAEQIRSTLQLRGP
FT                   FVELALAGHHPMLDQPLPLVATIRTLLEFWSIT"
FT   gene            537351..537965
FT                   /locus_tag="MSMEG_0461"
FT   CDS_pept        537351..537965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0461"
FT                   /product="CinZ protein"
FT                   /note="identified by match to protein family HMM PF01205"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74487"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPN6"
FT                   /protein_id="ABK74487.1"
FT                   /translation="MAYTLEPAARPYAEAVIKNSRFIARLCRADSEAAAREFIGTARDV
FT                   ERGAGHHCFAYVIGDDESPVERSSDDGEPGGTAGVPILNVLKARELVNVVAVVSRHYGG
FT                   VKLGAGGLVRAYGGTVAAAVDEADLRPRLRWEMLRLAADHADAGWIEAELRRRGFEVTG
FT                   VAYGDRAVLTLATRDTESLIAAIDQITSGRGEHTFAGHVWR"
FT   gene            538102..538545
FT                   /locus_tag="MSMEG_0462"
FT   CDS_pept        538102..538545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0462"
FT                   /product="MmpS4 protein"
FT                   /note="identified by match to protein family HMM PF05423"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABK76187"
FT                   /db_xref="GOA:A0QPN7"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPN7"
FT                   /protein_id="ABK76187.1"
FT                   /translation="MGYAVYRVMKRFWIPLLLVVVVAVGAYAIVRIREAAGAHAPTVAE
FT                   GTALTENFNPKHITYEVTGAGGSANLNYLDENGQPHLVENAPLPWSFTIVTTLPSMSAN
FT                   IMAQGDRNVSGLRCRVTVDGEIRDDRASDDLVEPFIYCLVKSV"
FT   gene            538542..541427
FT                   /locus_tag="MSMEG_0463"
FT   CDS_pept        538542..541427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0463"
FT                   /product="MmpL4 protein"
FT                   /note="identified by match to protein family HMM PF03176;
FT                   match to protein family HMM TIGR00833"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72603"
FT                   /db_xref="GOA:A0QPN8"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPN8"
FT                   /protein_id="ABK72603.1"
FT                   /translation="MTNTHSKSQRPFVGHVIRIFSLPIVLLWVLLVVALGAIFPSLDDV
FT                   AATRSVPLSPTDSQAYQSMLNIGKVFRQYDSDSTAMVVLEGEDKLGDAAHKYYDEIVAK
FT                   LRADHEHVQNVQDFWSDPLTAAGSQSVDGRSAYVQIFLNGPQGTTASYESVAAVRDIVE
FT                   SVPPPPGIKAHVAGTTVLNADTSVAGHQSMARMELISVAVIILMLLAIYRSIVTMLISM
FT                   VIIGLELFAAQSVTATAGHFNLIGLTPYAVSMTTMLALAAGTDYVIFLLGRYHEERSRG
FT                   LDREEAYYVAYRGVSHVILGSGLTIAGACLCLTMTTLPYFQSMALPCAISILVIVIAAL
FT                   TLAPAVLTVASRFGLLDPKRELSTKSWRKVGTAVVRWPIPIILVTGLVAAIGFASLLTY
FT                   VPQYNDQKFTPADMPANVAMAVADRHFSEARMNPELLMLEADHDIRNPADMLVIDRVAK
FT                   YVVHMRGIERVQTITRPLGSPIEHSSIPFLLGAQNAGTMQAAKFNNDNTAQMLEQADEL
FT                   SRTIASMERMYGLTQELTDTTHSMVGRTHDMVEATKEMRDSLADFDDFFRPMRNYLYWE
FT                   PHCYDIPVCQSLRSVFDTLDGIGQLTDEMQGLTIDMDRMDELMPQMLPILRSTIDSMKT
FT                   MRDFMIATHSVMAGTQAQQQELAKNATEIGLYFDQAKNDDFFYLPPDVFDNPDFKRGLE
FT                   MFVSPDGKAVRMIITHQGDPASVDGIAHVRDLRDVVADAVKGTPLANAKVSLAGTASLY
FT                   SDMQDGVVTDLMIAIIASMILIFGIMLVITRSVVAALVIVGTVAASLGTACGLSVLLWQ
FT                   DILGLGVQWVVLPLSIVILLAVGSDYNLLLVSRLKEEIHAGLNTGIIRGMGATGRVVTA
FT                   AGLVFAFTMMAMIVSDLRVVGQLGTTIGLGLIVDTLIVRAFMTPSIAAALGRWFWWPLN
FT                   TFEITRRGRQAPHARSVDGNTQPFPGVTTAP"
FT   gene            541484..542098
FT                   /locus_tag="MSMEG_0465"
FT   CDS_pept        541484..542098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0465"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73758"
FT                   /db_xref="GOA:A0QPN9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPN9"
FT                   /protein_id="ABK73758.1"
FT                   /translation="MKATDSKLRQRTDGRLDRTRDPAILDAALAALAENGYAGTNMDDI
FT                   ASRAGVGKAAIYRRWSSKAALITDALVYWKPALLIDDIPDTGSLEGDLNEIAERAARNA
FT                   DERITYDLILRVAVEAMNDSQLASALDDLTLLRGRRTMTAILKNATARGEIAPDTDWSL
FT                   VPDVLTAMLLMRAIRGERVDANYVRKVIDTVIVPAVRATAY"
FT   gene            complement(542092..542898)
FT                   /locus_tag="MSMEG_0464"
FT   CDS_pept        complement(542092..542898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0464"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73057"
FT                   /db_xref="GOA:A0QPP0"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPP0"
FT                   /protein_id="ABK73057.1"
FT                   /translation="MVDFAYVIAGSEATGGAGLQADLRTFQQLGAYGVGTVTCIVSFDP
FT                   KAGWSHRFVPVEAQVVADQIEAATSAYDLHTVKIGMLGTPATIDVVAEGLRGQQWRHIV
FT                   VDPVLICKGQEPGAALDTDTALRREILPLATVTTPNLFEARTLSGMDEITTVDDLIEAA
FT                   RRIADLGPRHVVVKGGVEFPGSDAVDVLFDRDSDGRNAQVLRAAKVGEARVAGAGCTLA
FT                   AAITAELAKGADVPEAVLRAKEFTTAGIVARVGGNAPFDAVWQGGQ"
FT   gene            543024..543872
FT                   /locus_tag="MSMEG_0466"
FT   CDS_pept        543024..543872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0466"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74102"
FT                   /db_xref="InterPro:IPR025644"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPP1"
FT                   /protein_id="ABK74102.1"
FT                   /translation="MLRSFASALALTALLVAGCSARSDEPSPEKAQTGAGESETVVDAA
FT                   DSDTGAMVVQYEDATTEEAQRGRDLMQKTGVLEQLAEDVTATYKLPYDIPLIGAQCDEA
FT                   NDFWSPDDQAMSMCYEDVDESLKIFGEAGDPDPEESARRVVVASFFHELGHMLIDIYQL
FT                   PATGREEDVADQLAASILLGPDDDGNIDPDYVQAAKDQAREYQIYAQQDEPDEEFFADV
FT                   HTLDRARAYNFECWIYGSDPEANADIVEQGLLPESRAERCQDEFDKLTNAWAELLDPHI
FT                   K"
FT   gene            complement(543882..544481)
FT                   /locus_tag="MSMEG_0467"
FT   CDS_pept        complement(543882..544481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0467"
FT                   /product="membrane transport protein"
FT                   /note="identified by match to protein family HMM PF01810;
FT                   match to protein family HMM TIGR00948"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70776"
FT                   /db_xref="GOA:A0QPP2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004777"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPP2"
FT                   /protein_id="ABK70776.1"
FT                   /translation="MNSPLVLGFLTSMALIAAIGAQNAFVLRQGIRREHVLPVIAVCTV
FT                   SDLLLITAGIAGVGAVITAHPDAVTVTKFGGAAFLIGYGVLAARRALRPSTLNPSERTP
FT                   ARLAEVLVTCLALTWLNPHVYLDTVVLLGTLANEQREQRWLFGAGAVLASAIWFLGLGL
FT                   GAKRLAGLFATPMTWRILDGVIAVTMIALGLGMMLT"
FT   gene            544595..545467
FT                   /locus_tag="MSMEG_0469"
FT   CDS_pept        544595..545467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0469"
FT                   /product="transcriptional regulatory protein PadR"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69793"
FT                   /db_xref="GOA:A0QPP3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPP3"
FT                   /protein_id="ABK69793.1"
FT                   /translation="MSVTSVLRRFNRTYTQRIGVLDESYLGTGRPLNVSRVLFEIGGLG
FT                   AVTIRDLRDRLGLDSGYVTRILTRLENEGLVRVVPDPADGRRRIVELTDAGREAVNELE
FT                   DRSESRAADLVAPLTARQRERLADALATAELLVRAATVRLVEVDQDSDVARTALTHYYD
FT                   ELNRRFPQGFDPGAPSGPEHGAHYIAAISDGQPVGFGGIRPLESGDDGPVAEVKRMWVD
FT                   DRWRGAGLGSRILRHLETLAAEHGFARVRLDTNGNLGEAIALYERTGYAQIDRYNDNPY
FT                   AQFFFEKRL"
FT   gene            complement(545434..546294)
FT                   /locus_tag="MSMEG_0468"
FT   CDS_pept        complement(545434..546294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0468"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74151"
FT                   /db_xref="GOA:A0QPP4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPP4"
FT                   /protein_id="ABK74151.1"
FT                   /translation="MGIALMLSSSASNQAGAGLGAMAFPMIGTVGVVAIRQFTTALVLA
FT                   PTVRPSLRGLRRDQWPPIVGLVLVFSVMNLSLYTAVNRIGLALAVTLEFLGPLTVAIAG
FT                   SRRLLDMGCALIAGAGVVVLTQPGPATDFVGVGLALVAGTCWGTYVLLNRTVGQRLPGL
FT                   QGTATAAVVTALAWTPIAIAWFATHVPTVAAIALATACGVMSSIAPYVADLLALRRVPA
FT                   QMFGTFTSVNPVWAALAGWVLLGQALAAHEWFGIGLIVVSNAVLSARGSRECPAYNRFS
FT                   KKNCA"
FT   gene            546423..547280
FT                   /locus_tag="MSMEG_0471"
FT   CDS_pept        546423..547280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0471"
FT                   /product="transcriptional regulator LysR family protein"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72407"
FT                   /db_xref="GOA:A0QPP5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPP5"
FT                   /protein_id="ABK72407.1"
FT                   /translation="MEWTLRELRVFVTAADTGSFTDAAAQLHVSQAAVSRTIAGLEKIV
FT                   GDRLLRRVPRGCELTAAGQQILPLARRVLAEAESFTEFLHSRHGVLRLGYAWAAVGRHT
FT                   ARLQRDWAQRQADIELELVRHNSPTAGLAEGLCDVAVIRRPTDEKRFASVIVGLERRLV
FT                   AFASDDEQWSGRRQLSMAEIADRTVIIDPRIGTTSSELWEGSGHVPQFIVSTDVDTWLD
FT                   AIAAGRGVGTTAEATAHHHPRHGVTYRPIKDGPRIAVRLAWWRDHRPRGLDELVDAVTR
FT                   LYST"
FT   gene            complement(547268..548872)
FT                   /locus_tag="MSMEG_0470"
FT   CDS_pept        complement(547268..548872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0470"
FT                   /product="para-nitrobenzyl esterase"
FT                   /EC_number="3.1.1.-"
FT                   /note="identified by match to protein family HMM PF00135"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73407"
FT                   /db_xref="GOA:A0QPP6"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPP6"
FT                   /protein_id="ABK73407.1"
FT                   /translation="MTAAQVTVTGGRIEGHNSPDGKVRWFLGIPYAAPPVGDLRWRPPQ
FT                   PVKPWTGVRLTLRYGPSAPQPHVAANSLYHGGEREFSEDCLYLNVWTGPRGEQPRPVLV
FT                   WLHFGAFQFGSASNPLYDGTVLARDGATVVSVNFRLSRLGFFAHPALSAESDHGVSGNY
FT                   GMLDQLAALRWVQDNVEAFGGDPTRVTVAGVSAGGHSVHNLRASDLAAGLIHRAIAQSG
FT                   PGVAPVLDGPSHAANPQSLSAAEQAGTEIADLLGARTAAQLRAVPPETLAAVSLPRAKG
FT                   AWCSDSRPGPSTSTHVVDAAYPVVDGHVLRESPLTAYQSGRALDVPMIVGNVGNERSGS
FT                   RYLACLRDYHDHVRRTYGVHAARLLELYPASSDAEVPAASRALESDRIFVWSSWTAARL
FT                   QARRGNSPLWHYNFLRRPPIPPDSDLIEKSYAAAFHGADVPYLFGTYGVRDWPWTDADR
FT                   TLGRQLRAAWLSFLATGDPSVQGPVSWPQFSEHTPSTLVWDLPSPHIADVPYRDRMAAF
FT                   DEFNQLAAMPEPLSHVE"
FT   gene            complement(548983..549768)
FT                   /locus_tag="MSMEG_0472"
FT   CDS_pept        complement(548983..549768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0472"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70407"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPP7"
FT                   /protein_id="ABK70407.1"
FT                   /translation="MFVLLAAVFALLVGGCGSQSGPAAEESPSATSSAVAQSSAAPAPD
FT                   TQFCAHNRDSKCPAGSYVGPFVAVKSGGGHWDANGAPVNGGPVGADGSTGNNLTQEYCA
FT                   RNEDPACPVGSYVGPNAIRNPDGSPTYVVCEGTICTNPNHGAADPVGTWGPDGRPINGG
FT                   PAGADGSTGNNLTHEYCAKNQDPACPAGTFVAPDAIRNPDGSNGYSPCEGTICTNPNHG
FT                   AGDQPDAVDPPTGDAPDTGDAPPADDSDGVDDGSGEDTP"
FT   gene            550350..551168
FT                   /locus_tag="MSMEG_0473"
FT   CDS_pept        550350..551168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0473"
FT                   /product="transcriptional regulator, LuxR family protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72342"
FT                   /db_xref="GOA:A0QPP8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPP8"
FT                   /protein_id="ABK72342.1"
FT                   /translation="MDMGNVSYAATPSERESVCGHTALYRRRSAPGARTSFSCQDDLRV
FT                   VPDDGVGLLRDTRILVVDDSTLYRDYLAAALAAHGAVAPGVAWDGPSLLASFDATMPRV
FT                   ILLNMATRDSATLLKQALALGPHTRVVVIGIAEDDESAIVACAEAGVAGYHSRSESLDE
FT                   LLELIHKVAVGETLCSPKVSAILLRRLSTLAAQREPAPTELVLTRREIEILRMLEAGRT
FT                   NREIAEQLCIAVHTVKSHVHNLLAKLGVSTRAQAAALSRTMRYTADPQED"
FT   gene            551334..553121
FT                   /locus_tag="MSMEG_0474"
FT   CDS_pept        551334..553121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0474"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69674"
FT                   /db_xref="GOA:A0QPP9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPP9"
FT                   /protein_id="ABK69674.1"
FT                   /translation="MCGIIACRTNRPAADYLRVGLRRLEYRGYDSVGVALQTEAGTVAR
FT                   LRTTSRISALESLLDEWSGPTFDGVGIGHTRWATHGAVTETNAHPHSDCGGRLSLVHNG
FT                   IIENATQLRTELSAAGHRFTSTVDSEVLCHLIEDERSNGADLTCAVQNALAKARGSWAL
FT                   AVLEHGTGRIAVAASGSPLVVANTSHGDFATSDVAAIADWADEFRVLEDGDVVELSVDG
FT                   RWTRAGILSAPPPATRCTLRTRDVELDGYTDFMAKEIDEQLEAVARVLDSMAGRIATGA
FT                   LWRDFGLPSFERLRVIGCGTSLNAGTVIGNLARDLGGIPMATTVASEAAMEVFEAGQLC
FT                   LAISQSGETADVLRAVESPAVSESSLVALTNSGHSTLARLADAVVGCAAGPEIGVAATK
FT                   TFVCQVVSGSALMISALVAMRRLSVASASRLVDELRRLPEQLDAATVTAKSVVPPIAEE
FT                   LAPAGGFLFIARGLGLPYASEGALKLKELTYRWAEHYPAGELKHGPLALVGTGTPVIAV
FT                   GTGDPKIESSISEIQARGGNVVSIGSAGSTVAVTDGPNAPWGPITATVALQILARTMAL
FT                   TLGRDVDKPRNLAKSVTVE"
FT   gene            553181..554419
FT                   /locus_tag="MSMEG_0475"
FT   CDS_pept        553181..554419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0475"
FT                   /product="nucleotide-sugar dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00984;
FT                   match to protein family HMM PF03720; match to protein
FT                   family HMM PF03721; match to protein family HMM TIGR03026"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72163"
FT                   /db_xref="GOA:A0QPQ0"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPQ0"
FT                   /protein_id="ABK72163.1"
FT                   /translation="MITLQRTTIAVVGLGYVGLPTALAFAEMGAEIIGCDLSEDRLTNI
FT                   KTGDVDMLPRDRTRLLRQLDSFKLTTEPSAIGAADAVVVCVPTPVDPHQSPDLRALTAA
FT                   CANVVRYATKGQLLVLTSTTYVGCTHEMLVDPLQAAGFTVGKDIFVAFSPERIDPGVKD
FT                   HAPERTPRVVGGVTPACTARAAALLRHTASSVHTVSSPESAEMTKLVENSFRAVNIALA
FT                   NEFSEVARELSVDVMEVIDAAATKPYGFMPFYPGPGVGGHCIPCDPHYLLWQLRARRFD
FT                   SPLMRTAMTCIAARPRDVVSRAREMLAERGKPTQGARVLVVGVTYKPGVADLRESPALA
FT                   IIDDLTAAGAVVSFTDPLVPMLRTPQAGTLTNHRSPEHDEWDLVLVHHWAEELRDWVSA
FT                   QPVVLDTTFGRRG"
FT   gene            554422..555717
FT                   /locus_tag="MSMEG_0476"
FT   CDS_pept        554422..555717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0476"
FT                   /product="chitin synthase"
FT                   /note="identified by match to protein family HMM PF00535;
FT                   match to protein family HMM PF03142"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71469"
FT                   /db_xref="GOA:A0QPQ1"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPQ1"
FT                   /protein_id="ABK71469.1"
FT                   /translation="MATIAAADRTVTSVRPAELGVKVVIVMALLLIVMLIFAYKVVSLH
FT                   NMKDEPFWAAYGLIITAFIFTRFGLAALYRPPRRDTGNYWPVVAIIVPAYNEPDIARTL
FT                   LHCVGVDYPRELLRVVVVDDKSSDDTLRRITDFAAEHPNLTVIPHEVNGGKRRAMATGM
FT                   AAADDADLFVFIDSDSQVTRDAIRVIASYFADSSVGAVCGHTDVTNISHNILTRMQAMQ
FT                   YYIAFRIYKSAEALFGSVTCCSGCFSAYRADAVRPVADKWLNQTFLGRPSTFGDDRSLT
FT                   NYLLRDWRVLYAPDAQAYTNVPEHLKQFLRQQLRWKKSWLREAPRAMCAVRRKNPVMVV
FT                   MFALSIVLPLIAPQVVMRAFVVQPHFISQLPFWYFGGVAAIAVIYGLFYRLHRPVKRWY
FT                   QGIFFTMFYTIILVLQMPYAMVTIRDSKWGTR"
FT   gene            555747..557249
FT                   /locus_tag="MSMEG_0478"
FT   CDS_pept        555747..557249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0478"
FT                   /product="secreted protein, putative"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73804"
FT                   /db_xref="GOA:A0QPQ2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPQ2"
FT                   /protein_id="ABK73804.1"
FT                   /translation="MALTAVSASLVAAYLAAPSYWQWHRAEERQQRLEIVQVDTPSGAV
FT                   DRRLVRELRDATVSSQSAPIIITYHDIGYNESPYTVSPERFATQMQLIHDAGWTTLTID
FT                   QLDGWLDGDPLPPHSVLVTFDDGAKGVWRYADPVLERLGMHAAVFLITGFVGTHQPYYM
FT                   TWDEIGRLHSSGRWDVQAHTHLGHVEVPVDAAGNQAPFLTSLQWLADQSRKETQQEYQR
FT                   RVLQDLSECKRQFRAHGLPEPSYFAYPFSAHEGESEETEPLQEIVTSLYRMALLDDALE
FT                   IRTSSSSDVQAGMIQRMDIVAATSTDLLVDKLEQASPIDPKASRPFADPTGWVDGTNNP
FT                   APVDLDADTLQINPDPGEEVIRTYAPIRSTMWTDYTIEFDVSGFAPEDWTTAGVTVLKP
FT                   SRAPFDGNVSQQVDVRIRGNAFGIGRSSKEFADHPLQQENSHHVVIDVTPQQVTVGVDG
FT                   DTPQVIHLEGNRSRGVGGGVSFWAYRQSEASPPIVFSNLTIR"
FT   gene            complement(557246..557977)
FT                   /locus_tag="MSMEG_0477"
FT   CDS_pept        complement(557246..557977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0477"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70793"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPQ3"
FT                   /protein_id="ABK70793.1"
FT                   /translation="MRLCASLQRRHRDVCETEFGVVATDPDTAAAQRCTADTVVDRAHR
FT                   DPVTRGVDVHRAVRVIADGHRDVLPFPERNGYVMHETVQVVVRPAVVGAARALLLDGHG
FT                   GITAVDTHGVQRDIGLVAHPDVRAVVVLRRRSCGRRHGVDAHRQRHLQVVEPADHRDHP
FT                   EDLRARGLVWRTGPRGAVVPEQGSAGDDPLVARLHRRALGRDHTVGTGEIVGEAQPLRT
FT                   RVTTRRATQRAQGDQSFHPHP"
FT   gene            557252..557959
FT                   /locus_tag="MSMEG_0479"
FT   CDS_pept        557252..557959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0479"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74182"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPQ4"
FT                   /protein_id="ABK74182.1"
FT                   /translation="MRMKRLIALGALCCAACGHSGAQGLGLSDDFTGPDGVIAAEGTPV
FT                   QPGDKWIVTSGTLFRDNGTAWTGPPDESTGSEVFRMVSVVRGFNDLQMSLAMRVDAMST
FT                   TARTPAQDYDGAHIWVRYQSDVALYAVSVDRRDATMTIKKKCAGGTDNGGTYYDLNGFV
FT                   HDVPIPFWEWQHITVTVRDHPDGSVHIDAARDGITMSAVDDGVGCAPLRGGGVGIRGDN
FT                   AELRFADISVTSL"
FT   gene            complement(557995..558654)
FT                   /locus_tag="MSMEG_0480"
FT   CDS_pept        complement(557995..558654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0480"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75964"
FT                   /db_xref="GOA:A0QPQ5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPQ5"
FT                   /protein_id="ABK75964.1"
FT                   /translation="MTSEPQNKSDQAFVEIERMIVLGEIAPGSLVSEKQLMELTGLGRT
FT                   PVREAVQRLSRERLLEIHPNRGVLVPPTSVEAQLKLLELRRILEPFAVRVAASRATDSQ
FT                   RQAARELAEDVVSGDKTVTDFSNFLRKAHALVVAATHNEYIEVAMAPLQGLSRRFWFGH
FT                   LSDPVEELRRAAQLHHDILAAIAAGNAEAANGASLALSDYLFEFAYATLPRHNQPA"
FT   gene            558749..560095
FT                   /locus_tag="MSMEG_0481"
FT   CDS_pept        558749..560095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0481"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72125"
FT                   /db_xref="GOA:A0QPQ6"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039649"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPQ6"
FT                   /protein_id="ABK72125.1"
FT                   /translation="MGDHRLPVVADVDVAVVGAGAAGVAAATVAAEAGLSVVVVEKYGF
FT                   AGGAAVAGMSGTICGMYLASDSASRPERVVHGFTERFAGELTVRGGLTAPQRYGKTFTV
FT                   AHDPLVWREVADDLMTAAGVRILYHTQVIDVLIEGDDYQGLVLASNAGVGVVRAARIID
FT                   ASGDGAVVARAGGGYRFGDHGRIQNPTMFFRLGNVDLHAFWSAWGPNTISPQWVSDAIE
FT                   QARTAGLDLPRNKIWIFDTTRPGELLVNATRLTAPDGRMLNVIDPADFTIAEVEGRRQV
FT                   RAYARFLAENVPGCGHAFVVDTGVEAGIRQTRTVDCIETLRDGDVVDGAKRDDSICRSP
FT                   WPIELHDGEKPKLHWLLDDYYDVPYGALVPQRGENIIVAGRCLSAEHQALASARVTAQC
FT                   FEYGHAAAVATALSLDRGTAYRDLDPAGIQARMIASGSALRTPQRQDVP"
FT   gene            560092..561786
FT                   /locus_tag="MSMEG_0482"
FT   CDS_pept        560092..561786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0482"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="identified by match to protein family HMM PF00920"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71627"
FT                   /db_xref="GOA:A0QPQ7"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPQ7"
FT                   /protein_id="ABK71627.1"
FT                   /translation="MTDNFERAGAPGELRSNFTPGSTRWAVRRAQWSAMGIDWRDQEKP
FT                   KIAIVNTSSKLSVCFAHLDDVAVRVAEAVRAAGGLPFEIRTTAPSDFVTSAGRKARYLM
FT                   PTRDLIVNDVEAAVEGAVLDGVVFLSSCDKTTPAHLMAAARLDLPAIVVIGGYQRGGTW
FT                   SGCSVDIDTVYESVGALTAGTMTVDQLGELADQAIEGPGVCAGLATANTMHCLAEALGM
FT                   TVAGSAPVRANSDRMLDNAAAAGHHIVKMVEQNLTARQVITEKSIENAIEVALALGGSV
FT                   NCIRHLAAICAEADLDLDVVGMFEKHGGDAVQLAAIRPNGAHQVWDLDGVGGIQTVMRT
FT                   LLPRLHGDALTVDGRTVSERAADAQPADGDVLHPLDDPINDEPGLIILRGSLAPDGSIV
FT                   KVAGVGKATRRQFNGPAKVFVGEDDAIAALGDGRIQRGDVIVLRGMGPRGGPGTVFAAS
FT                   FVAALNGAGLGGHVAVVTDGELSGLNHGLVVGQVMPEAADGGPLAGLQNGDTVAIDLDA
FT                   RRIDSHPIRDGEPVRATGEHPERGWLGQYAALVGPVQRGAVLRRPRN"
FT   gene            561813..563186
FT                   /locus_tag="MSMEG_0483"
FT   CDS_pept        561813..563186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0483"
FT                   /product="shikimate transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74832"
FT                   /db_xref="GOA:A0QPQ8"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPQ8"
FT                   /protein_id="ABK74832.1"
FT                   /translation="MSRAGNDAAEKPPNQARKAGIAALVGTTLEWYDFLIYGTAAALVL
FT                   NSQFFPGVNPTAGTLAAFASYAVGFLARPLGGIVLGNMGDRLGRKRMLVFTIVLMGVAT
FT                   TLIGVLPNYDAIGVFAPILLIVLRLLQGFGAGGEYAGAVVLSVEHGDQKRRGMAGAWAP
FT                   TGFAIATLLSTGVFQLATLLPDDAFHTWGWRVPFLLGAVLLVVGYFIRRSIDETQAYED
FT                   AVAAEAEGTAEQTKIPVLDAIRRSPRSFLVVVGSRLAENGFAYLFPVFAVGFAVNSLGV
FT                   SSSTTLLAVVIASAVQIGAIPVWANVSDRIGRRPVYAAGALISVLWLVPFFLLLESLSP
FT                   ALLVLGFVVGLGILYPAMLAPQAAYYAELFDTRTRLSGFAFAREIGSVLAGGFLPLIAT
FT                   ALIAAFGHWWVIVVYLAVLTLLTLVALAYGPETNRRDIVSPNETDATASGTEVRVAPR"
FT   gene            complement(563191..564300)
FT                   /locus_tag="MSMEG_0484"
FT   CDS_pept        complement(563191..564300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0484"
FT                   /product="formamidase"
FT                   /EC_number="3.5.1.49"
FT                   /note="identified by match to protein family HMM PF03069"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73843"
FT                   /db_xref="GOA:A0QPQ9"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPQ9"
FT                   /protein_id="ABK73843.1"
FT                   /translation="MNVTHEITVDLDRPLIADPRAGHNRWHPDIPAVLRCVPGDIVAID
FT                   TRDGYDGQFGRASTADDVLRADLARIHPLTGPIHIEGAEPGDLLVVDVLSVDTGNFGAT
FT                   LNIPGFGFLREEFTEPHIVRWEIADGFAHSADLPGVRLPGAPFMGVMGVAPSRALFDRT
FT                   KAAEQRAAQGGGLVELPNPTSAVPPDRAADPGRRTISPTEAAGNVDIKHLTAGSRVHLP
FT                   VWVPGALFSVGDGHFAQGDGESCGAAVETTARVVLRFDLRKGAAAAQDSPHLSFERLTP
FT                   GPPDVASRPHFAVTGIPVDSAGEIHPENLNMATRNALRLMVDHLSVDRGFTRQQAYALC
FT                   SVAVDLRLSQIVDAPNILVSALIPTDIFV"
FT   gene            complement(564297..565826)
FT                   /locus_tag="MSMEG_0485"
FT   CDS_pept        complement(564297..565826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0485"
FT                   /product="amidase"
FT                   /note="identified by match to protein family HMM PF01425"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70548"
FT                   /db_xref="GOA:A0QPR0"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPR0"
FT                   /protein_id="ABK70548.1"
FT                   /translation="MPSQTPGVTELSPIADAYGLGLSEGELAEFVPHVSEVLRSWDLVD
FT                   ELYERERPDAVTRTWAEPEHNPFGAWYVTCDITESTDGPLAGRRVAVKDNTAVAGVPMM
FT                   NGSAALEGFIPDTDATIISRMLAAGATIAGKAVCEDLCFSGASHTSATGPVRNPWDPTR
FT                   TSGGSSSGSAALVAAGIVDIATGGDQGGSVRLPAAFTGIVGHKPTHGLVPYTGAFPIEQ
FT                   TLDHLGPMTRTVADAALLLGVLAGRDGLDPRQPTRVAVPDYVAELKRPVAGMRVGVLCE
FT                   GFGHPEAVPGVDDAVRRAVDVLRAQGMQCENVSIPWHRHGRKIWDVIAVEGATTQMVDG
FT                   NAYGMNWQGAYDPALIEFFGSRRQADGTLLPDTVKLVLLTGRHTIRRHHGAHYAKARNL
FT                   VPRLRAAYDDALSRFDVLVMPTTPLVATPIPESDAPRDEYLARALEMMANTAGLDVSGH
FT                   PACSVPAGLVDGLPTGMMIVGRHFDDATVLRVAHAYEEATGGFLPAKVSAP"
FT   gene            complement(565863..566894)
FT                   /locus_tag="MSMEG_0486"
FT   CDS_pept        complement(565863..566894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0486"
FT                   /product="putative ABC transporter, periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69569"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPR1"
FT                   /protein_id="ABK69569.1"
FT                   /translation="MNGKRLRSPAAALVVLTMLLVSGCAGSAPQRTDGKTAVRISQAFQ
FT                   SLLYLPLYVAKEKGYFEEQNIHAEISTGGGGTQSWTAVLGGSADFSIQDPVFVPKSHEN
FT                   GGPGVVVAAIQNAPSVFVIGRENNDGTLDNSSIFEGKKVAVSPEPDTSWAFMTYLIEQD
FT                   TLRDVSLVNVALGSELAAVASGQADYALSFEPTVSQAVVDQNLDVVYSFAANPSWNPFA
FT                   FSSLTSTDRYLQQNPEAAQGVVTAIAKAARFIYSEPEATVDIATEYFPDLSREVIEAAV
FT                   QREIEAKGYAEDVTVTRQSWDNNMRISLFTKNIAAYPSDATSYENNVNTDLAANARTAL
FT                   ATD"
FT   gene            complement(566907..567740)
FT                   /locus_tag="MSMEG_0487"
FT   CDS_pept        complement(566907..567740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0487"
FT                   /product="ABC transporter permease"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74846"
FT                   /db_xref="GOA:A0QPR2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPR2"
FT                   /protein_id="ABK74846.1"
FT                   /translation="MTTVLPQRAATVPQSPRRRTSTPSPGRRRVILHALQGGIVLSALA
FT                   AWELGARSGSISSFLFGSPSAVWNVLYKRAVSGELWSDIGVTSSEVILGFLVGAVGGSA
FT                   LGLLLWYSQFVADLTAPFIAAIGSIPVLAVAPLTIIWFGTEMTSKVVIVAFSCVVVSLT
FT                   TSYSGARRTDPDLVNLMKSFGATRSQIFRKLVVPSAMSWVVSGLKLNIGFALVGAIVGE
FT                   YISSDAGVGHMILRGSSNFTITLVIAGIAIVMVMVLVFNILVAGLERILGRHQKS"
FT   gene            complement(567784..568551)
FT                   /locus_tag="MSMEG_0488"
FT   CDS_pept        complement(567784..568551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0488"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74310"
FT                   /db_xref="GOA:A0QPR3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPR3"
FT                   /protein_id="ABK74310.1"
FT                   /translation="MEVVGIDKEYPAATGPIQILRGLSLRADRGEFVSIVGPSGCGKST
FT                   LFNIITGLVPPTAGSVLVNGEDVTGSTSRHIGYVLQKDLLFPWRTVLENVVLGLEVRGV
FT                   RKKDARTRARSLFATYKLEGYEDKYPSDLSGGMKQRAALMRTMVTDPDIILMDEAYKAL
FT                   DYPLKIALESELLETARTTGKTVVAVTHDIEEAVTMSDRVYVLKARPGEVVSEFPIDLG
FT                   TTSTDINERRLAPRFNEFYEKIWRGIGQKPGAA"
FT   gene            568865..570037
FT                   /locus_tag="MSMEG_0489"
FT   CDS_pept        568865..570037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0489"
FT                   /product="racemase"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74842"
FT                   /db_xref="GOA:A0QPR4"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPR4"
FT                   /protein_id="ABK74842.1"
FT                   /translation="MSLLEGVRVVSFTHFLQGPSATALLADLGATVIKVEPPSGAFERS
FT                   WSAPDAYLNGESVFFLLGNRNVESVVVDLKDPEWLEVVLRLLDEADVLIESFRPGVMDR
FT                   LGLGWERLRERNSRLVYCSLSGYGSDGPYKDRPGQDVLLQSMAGIASVTGTADRPPTPV
FT                   GASLVDQHGAVLGAFGILAALHGRDRTGQGTRVESNLLSAAMDLQIEPLSYFLNGFDGI
FT                   RSATGISSPYYKSPYGVFATADGYLTLSLNALEKLAELFEDNWFRSIGEQSSYARREEI
FT                   NERVAVHLGKRSTEEWTTLLAAAQMWFAPVNGYAEVVDDPQVNHNGSVIEIQHPRAGAV
FT                   KLLAHPITYDGQRPGVRSTPPELGGSNRKVLAELGYSTEHIDRLQAKVQK"
FT   gene            570034..570816
FT                   /locus_tag="MSMEG_0490"
FT   CDS_pept        570034..570816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0490"
FT                   /product="enoyl-CoA hydratase"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70881"
FT                   /db_xref="GOA:A0QPR5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPR5"
FT                   /protein_id="ABK70881.1"
FT                   /translation="MTIQDSVAQKQSEVRIQLDRSVLHVLLDRPRKRNALDLTMIRSIS
FT                   RAIDGRPTDTRVVVISGGAFFSAGADIATYKRGDQGEIGEITRAAGAVIDTMTTAPIPV
FT                   IAAVEGMALGGGFELAMGADIVVAGESAKLGLPEVALGLIPGWGGTQRLSAQIGIRRAK
FT                   QIIMLQQTISAEDAWTLGLVNEVVPDGTSLNRALEMAHQLAASSATALAATKRLVSGIE
FT                   RNLAYSDERAALMELFGSPDGIEGVTAFVEKRPANFGR"
FT   gene            complement(570847..571875)
FT                   /locus_tag="MSMEG_0491"
FT   CDS_pept        complement(570847..571875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0491"
FT                   /product="transcriptional regulator, LacI family protein"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70082"
FT                   /db_xref="GOA:A0QPR6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="PDB:3KKE"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPR6"
FT                   /protein_id="ABK70082.1"
FT                   /translation="MGTLADVARAAGVSVSIASRALSGDTRARMSEATRARVLAAADEL
FT                   NYVPNARARALRHSRSGTIGLIVPDVNNAVFADMFSGVQMAASGHSTDVLLGQIDAPPR
FT                   GTQQLSRLVSEGRVDGVLLQRREDFDDDMLAAVLEGVPAVTINSRVPGRVGSVILDDQK
FT                   GGGIATEHLITLGHSRIAFISGTAIHDTAQRRKEGYLETLASAGLRSEAAWVVDAGWEA
FT                   DAGSAALNTLYRGANLGKPDGPTAVVVASVNAAVGALSTALRLGLRVPEDLSIVGINTT
FT                   WVSDTVYPALTTVRLPLQRLGEVAADVLMEHLGGRALTDTVVTQPTPELLVRETTAPPT
FT                   RD"
FT   gene            complement(571918..572553)
FT                   /locus_tag="MSMEG_0492"
FT   CDS_pept        complement(571918..572553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0492"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72181"
FT                   /db_xref="GOA:A0QPR7"
FT                   /db_xref="InterPro:IPR009793"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPR7"
FT                   /protein_id="ABK72181.1"
FT                   /translation="MTEARGFLLIISLAATTALTLALGFTDPAAPLSYPTKFLVWNLFL
FT                   AWIPMLCAVAFDLAERRFWLIPLGLVWLAFLPNAPYLVTDLVHLGEGYELWRHVLQYGF
FT                   AAWTGILLGVVSLLLVHTRISREFGGAWGWLAAVLSVGLCAIGVVIGRFQRWNSWDLVT
FT                   QPDAVVAATFDWMRAPLAYVQSTGVAIAVAAFFGLAYLTVWSIRGLAL"
FT   gene            complement(572636..572803)
FT                   /locus_tag="MSMEG_0493"
FT   CDS_pept        complement(572636..572803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0493"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72016"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPR8"
FT                   /protein_id="ABK72016.1"
FT                   /translation="MKKFGFATTIATGFAAAIFALAAPAQADSAHHDWVHSTQQQATVG
FT                   AVQPVFGNGR"
FT   gene            complement(573002..573169)
FT                   /locus_tag="MSMEG_0494"
FT   CDS_pept        complement(573002..573169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0494"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73091"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPR9"
FT                   /protein_id="ABK73091.1"
FT                   /translation="MKKFGFASAIATGFAAAVFGLAAPAQADISHHDWVHNTQQHATVG
FT                   SVQPVFGNGR"
FT   gene            complement(573276..574849)
FT                   /pseudo
FT                   /locus_tag="MSMEG_0495"
FT                   /note="glycerol dehydratase reactivase chain A, putative;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error"
FT   gene            complement(574846..575205)
FT                   /locus_tag="MSMEG_0496"
FT   CDS_pept        complement(574846..575205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0496"
FT                   /product="coenzyme B12-dependent glycerol dehydrogenase
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70278"
FT                   /db_xref="InterPro:IPR003207"
FT                   /db_xref="InterPro:IPR036091"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPS0"
FT                   /protein_id="ABK70278.1"
FT                   /translation="MTITSHSGRSIDEVTVEAARGGDLTLDDIRISRDTLISQAEAAER
FT                   TGSEQLGLNLRRAAELTALSSDDMLAAYEALRPGRSTFSELEALAQRLAAQEAHTCAQL
FT                   VREAAAAYRRRGLLR"
FT   gene            complement(575202..577466)
FT                   /locus_tag="MSMEG_0497"
FT   CDS_pept        complement(575202..577466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0497"
FT                   /product="glycerol dehydratase large subunit"
FT                   /note="identified by match to protein family HMM PF02286"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72195"
FT                   /db_xref="GOA:A0QPS1"
FT                   /db_xref="InterPro:IPR003206"
FT                   /db_xref="InterPro:IPR003208"
FT                   /db_xref="InterPro:IPR010254"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036999"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPS1"
FT                   /protein_id="ABK72195.1"
FT                   /translation="MHLNSTEVDSRLGRIRLLDRQRVNLDGFADVDAELGMISHLSPND
FT                   PEPSWVVADDGTVLEMDSKPAEDFDTIDEFIVKYAIDHEQAPRSMAMTDLDLARMIVDP
FT                   GRPREEILRVCSGLTPAKMARVVASLQPVEIQMAMMKMRARRTPANQAHVTNRLDDPLL
FT                   IAADAATAVVYGFRELEATVPVLDDAPAVAVGLLIGSQVPAPGALTQCSVEEARELELG
FT                   VRGLVSYAETVSVYGTEQVFTDGDDTPWSKAFLTSCYASRGIKMRLSSGAGSEVLMGQA
FT                   EGKSMNYLEARCVALARGIGAQGVQNGGVDGAAITASVPGGVKELHAENLMVMLRGLES
FT                   CSGNDSLMSESTMRRTSRTLPTLLSGSDFIFSGFGSVVSYDNMFGPSNFNAADLDDYLV
FT                   LQRDWGVDGGLRSVDPTTLESMRREAAEATRAVFEYLGLADFDDDHVEAVVGAEGSKDL
FT                   PQDDGVKVLSAARMIDQSGLTVLDIVSALAETGFTHIADRVLGMARARVTGDYLQTAAI
FT                   FDEEMNVLSALHDPNDYRGPGTGYRPTPERQAQIDAVRQARSVADLVKEQATSAQPDRL
FT                   RVLGAATVGEDPREVVIGVSPAFGTKLFRTLSGMTIYDVLEQILAGLEEEHCVPRLVRI
FT                   TDSIDLGAIGKSAAQLSGSGIGVGLQAKGTTLIHRRDLPPLANLELLSVAPLITPEMYR
FT                   LIGINAGRHAKGATPSPMRNAYTDEAITARYHTKVVSMVAIEREESERRETGNVELEIT
FT                   R"
FT   gene            complement(577603..577719)
FT                   /locus_tag="MSMEG_0498"
FT   CDS_pept        complement(577603..577719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0498"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73688"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPS2"
FT                   /protein_id="ABK73688.1"
FT                   /translation="MVLLCQRDRDRRPRQIPGNLARRNAAAARGERRFPTSC"
FT   gene            577723..579150
FT                   /locus_tag="MSMEG_0499"
FT   CDS_pept        577723..579150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0499"
FT                   /product="amino acid permease-associated region"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74985"
FT                   /db_xref="GOA:A0QPS3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPS3"
FT                   /protein_id="ABK74985.1"
FT                   /translation="MSEVVDDRPGSDAPPGSEKLRGNLGIPAIVLMVVAAAAPLSTIGG
FT                   NVPIGMALGDTTGIPVAFVVAGVIFLLFSASFVAMSKYVTDAGAFYAYIQRGLGRAAGT
FT                   GAAVLALPAYMCTLLGVSAYDGVILGGLIERFGGPQIPWWILTALVLAAVAWLGYRDID
FT                   LSAKVLGVFLVSEVAILVVLDLVIVLRGGEQGITGDSFTPQGLAGGVGIALLYALWGFV
FT                   GVEATSVFRDEAKDPDRTVPRATYWAVGIVASFYAFSSWALIEGNGGHDAIQVAKDDPD
FT                   NFMVNTAQQYLGMLGRDLTTLFWFVSVFACALAFHNITARYAFVLGQNNVFPKQLGKVH
FT                   HRFGAPSNASLAVTVASFVIMAILAGLGLDPVLQIFGPLGGVGVLALAILWLLTTISVV
FT                   IFFRRRGGATRIVVLASAATLALGAGLVLIVSNLPLVVGGSPTLAVILGIAPVVVFGIG
FT                   MVLSRRATGTLSEAKSE"
FT   gene            579284..580351
FT                   /locus_tag="MSMEG_0500"
FT   CDS_pept        579284..580351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0500"
FT                   /product="regulator of polyketide synthase expression,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF07905"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABK76158"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPS4"
FT                   /protein_id="ABK76158.1"
FT                   /translation="MSRDLPLTVAAALTVPPLDLGSVVAGQRGLTREVLWVDIMHAPAE
FT                   SFVRPGDLVLTTGADVRQPGVLDFLTYVVTSAAAGVVISPPPEAAVDELLVTLVPYAEQ
FT                   HEFPVVVLPWEVAFSAVQRSLLPLLTPLAPDELVQMVIGRRERDDAGWNDFAEVFAKNL
FT                   QELALAAGVTVRSSVTDDLVMSHFSPAPSSSTVSALVEAAKRLNAIQQTAVSWVLLPPQ
FT                   EAVNAAATTAPRTPAPEGPVGPVQFADVLRQHPQCMAIVLQTLQPLIDYDRTRRGQLVR
FT                   TLEVLLNEATNISAAARTLYLNRHSLLYRIKLIEELTGLSLKNPADRFQLEVSVRVHQI
FT                   NEARTTAGRAARLTT"
FT   gene            complement(580361..581107)
FT                   /locus_tag="MSMEG_0501"
FT   CDS_pept        complement(580361..581107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0501"
FT                   /product="glucosamine-6-phosphate deaminase 1"
FT                   /EC_number="3.5.99.6"
FT                   /note="identified by match to protein family HMM PF01182"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70672"
FT                   /db_xref="GOA:A0QPS5"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPS5"
FT                   /protein_id="ABK70672.1"
FT                   /translation="MTPTVDITADTRAAGEAVAARIAALIRTTPDAVIGVATGSSPLPV
FT                   YTALAGYVDAGLDVTRVTWCALDEYLGLPTHHPQSYRAELERALVAPLHLDPASLRVPD
FT                   GAADDPDKAAADYEAFLAERGVDLQILGIGRNGHIGFNEPGTSFTSTTHRARLTESTRK
FT                   ANARFFSGLDEVPHECLTQGLATIMRARRIELIAGGEQKADAVARALHGPITEQCPASI
FT                   LQRHPDVHVTLDAGAASLLVEHSARR"
FT   gene            complement(581104..582480)
FT                   /locus_tag="MSMEG_0502"
FT   CDS_pept        complement(581104..582480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0502"
FT                   /product="glucosidase"
FT                   /note="identified by match to protein family HMM PF02056"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69877"
FT                   /db_xref="GOA:A0QPS6"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPS6"
FT                   /protein_id="ABK69877.1"
FT                   /translation="MKLAILGGGGFRTPYVWQALIRDQGTPRVTEVALYDVDETRLATV
FT                   TTICEQLALGFDDTPALRTYTELEPALEGADFVFAAIRVGGVEQRCCDEHVALDLNVLG
FT                   QETTGPGGIAYALRTVPVMLDIAETVKRVAPQAYFLNFTNPAGIITEALQTVLGDRALG
FT                   ICDTPSGLGRRVAGVLGYDHTRIQMDYVGLNHLGWMRRVLVDGVDVLPNLLADEHRLSR
FT                   MEETQIFGAEWIHSLGVIPNEYLYYYYFNRDAVRRILESPQTRGDFLLETQGKFFTEAA
FT                   ENPDTAAKLWGEAVDERGASYMAEAKGGVQGNPTVERERETDPAHLGYAGVALGVMAAI
FT                   SRDERRTMILNVRNRGTIAGLPTDAVVEVPTTVDANGVHPLTLDSQPDLHQLGLMQQVK
FT                   AVERHAISAAVNGSTDEALKAFALHPLVDSVTVARQLLAGYIAANPDLARVLAKSSLAA
FT                   "
FT   gene            complement(582477..583253)
FT                   /locus_tag="MSMEG_0503"
FT   CDS_pept        complement(582477..583253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0503"
FT                   /product="DeoR-family protein transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72812"
FT                   /db_xref="GOA:A0QPS7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPS7"
FT                   /protein_id="ABK72812.1"
FT                   /translation="MFLAERHERILAELADGGQSVVQLAEALGVSESTIRRDLDILAKS
FT                   GRLKRLYGGAMLTSGSRANITDSGAVEEPYTFESRPDFALRKRVAAEAARLVSDGDVIV
FT                   LDIGSTTPLVARELRGRPVTVITSNLAVLDEIRDDDTVEVVLLGGVLRRNQQSLVGPLT
FT                   EQLIGQLSADLMFLSCTGVRGGRVVDNMAVEAPIKQALIAASQRIVLLASEVKFPGTGA
FT                   LRLCTLDEVDVLITTSGTPEDEIAKRREAGRKVIVA"
FT   gene            583427..584413
FT                   /locus_tag="MSMEG_0504"
FT   CDS_pept        583427..584413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0504"
FT                   /product="carbohydrate kinase"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71892"
FT                   /db_xref="GOA:A0QPS8"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPS8"
FT                   /protein_id="ABK71892.1"
FT                   /translation="MTEREIDVLVAGRVYSDLVFTGVNAPAPGEEVYADGFAISPGGAA
FT                   NRAVAAARLGAHTALVTELGDDPIGCIVARSLQKEPNLDLRYAVQHPGYQIPISVAITD
FT                   GHDRSFVTYEHSGHLPSWPEDIPVRVAHVGLGRGPVPAEAAHLRAQGTLLVGGVGWDPS
FT                   GEWSEELLDHLAGVDVLIVNEIEALLYTRAATVEEALEVLAGAVETAVITLGPDGAIAA
FT                   QGATRLRVPAIAVEAVDPTGAGDAFTAAFMVATAWEWELADRLRLASACATCSVRGAGG
FT                   ARSAPHPADIADLLADCCADPDWTPVREWAGRHRQSTVPATPGALTS"
FT   gene            584410..585780
FT                   /locus_tag="MSMEG_0505"
FT   CDS_pept        584410..585780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0505"
FT                   /product="probable sugar ABC transporter, substrate-binding
FT                   protein, putative"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70962"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPS9"
FT                   /protein_id="ABK70962.1"
FT                   /translation="MTRTRLFRFGSAVASTLTVAALALSACAPGPSGDSGSSPAPTGEV
FT                   SKDIASAGPVTLTVWDQNTDGGIREAQEKLNAQFQEMYPNVTIKRTVESFSDLKTTLRL
FT                   ALSSNTPPDVVQANQGYPDMGAFVAAGMLRPMSDYAELYGWNTYYPEALLKQNSFSSDG
FT                   KTWQGDTLYGVSQTGEVVGIFYNRELLSSLGLEVPKTLDDLNAAMEAAKAKNILPMAFG
FT                   NLDKSPGIHVYGVVQAALAGAPAVNDLVSGKGGAWTDEPSLKAAQQIADWSTKGYLTPG
FT                   ANGVSRDDAIAEFGRGGALFTITGTWMQQPLQDALGDKAGFTTLTSDQGEPATTGGQGL
FT                   AWAITSKSAHPDVAAAYIDFITNAKASQLLLDTGNLPTVLPSGYEPEAGTVAADIATQY
FT                   RDVQEANGEVPYLDYATPTFYDTITAAMQELVGGQATPEQFVDTLQKDYADFLASQK"
FT   gene            585885..586739
FT                   /locus_tag="MSMEG_0506"
FT   CDS_pept        585885..586739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0506"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74801"
FT                   /db_xref="GOA:A0QPT0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPT0"
FT                   /protein_id="ABK74801.1"
FT                   /translation="MKPYLYVAPAFVVFAVFLGAPVLQTVQYSFYNWDGLGVATVAGLK
FT                   NYVAVFGDERLRDSFLHAGVLMLFYAAAPVFIGLVLSALISRAHGLRSMSFFRTVLFLP
FT                   QVIATVVIATIWISIYSRDGLFNQTLRLVGLDSITRVWLGDHTFALIAIGLIGTWLNIG
FT                   LCLVLFLSGIGNIPPELFEAARLDGAGRVREFVAITLPSLRGQIAVALTLTVVSALKTF
FT                   DLVFITTRGGPGNATSVPAFEAYNRAFNTGQVGLASAMAVVLTIVIVVLTVLISRIAPR
FT                   EAE"
FT   gene            586736..587560
FT                   /locus_tag="MSMEG_0507"
FT   CDS_pept        586736..587560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0507"
FT                   /product="probable sugar ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70489"
FT                   /db_xref="GOA:A0QPT1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPT1"
FT                   /protein_id="ABK70489.1"
FT                   /translation="MKLTRTERIVNQLILGVFALFAVIPLVGVLFSSITPPSENHGGFA
FT                   VPRSVDLGNYGAAWTRGNFSSYLLSSVIVTVAVVILSVVLATFAGYAFARMKFFGSSVL
FT                   FYLLLLGLTLPTEAFIIPLYFNMRTVGLTDTYWALILPQTAQSLAFAVFWMRNQFRGFP
FT                   GEIIEAARLDGASDLRALWRIVVPTSLAPMMTMAVIITMWTWNEFLLPLVMVVSDNKRT
FT                   APLGLAFFQGQHLTDYSLLAAAGVMVALPIAVLFFALQKRFINGMVGGISVR"
FT   gene            587587..588657
FT                   /locus_tag="MSMEG_0508"
FT   CDS_pept        587587..588657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0508"
FT                   /product="glycerol-phosphate porter"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF03459"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73052"
FT                   /db_xref="GOA:A0QPT2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPT2"
FT                   /protein_id="ABK73052.1"
FT                   /translation="MAAIRFEKAQLRYPHAPTPAVAELDLDIADGEFMVLVGPSGCGKS
FT                   TTLRMLAGLEDLTSGSIYLDDRDITTTPPQDRDIAMVFQNYALYPHMTVAGNMEFCLKN
FT                   AGLSKDERRRRVAAAAETLGLTEYLNRKPKALSGGQRQRVAMGRAIVRNPQVFCMDEPL
FT                   SNLDAKMRVQTRTDIAKLQRELGVTTIYVTHDQTEAMTMGDRVGVMKDGVLQQVGAPMD
FT                   LYDRPANAFVAGFIGSPAMKFFDAQLGDRTVGVAGHDMAVQCAADLRGPVLIGVRPEGW
FT                   RLTAPDAGIAVKVGVVEVLGADSYLYGTAIHAGADVDVVVRVSTRDGIRADDTVHVTAD
FT                   PDAIHLFDNETGVRLN"
FT   gene            complement(588742..589527)
FT                   /locus_tag="MSMEG_0509"
FT   CDS_pept        complement(588742..589527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0509"
FT                   /product="transcriptional regulatory protein"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF01022; match to protein
FT                   family HMM PF08220"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74941"
FT                   /db_xref="GOA:A0QPT3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPT3"
FT                   /protein_id="ABK74941.1"
FT                   /translation="MSIKRTDRMREVLSLLRERGEVTSQVLCTELRISAATLRRDLSEL
FT                   EEQGLLVRTHGGARAVDPSDSEIPVRLRDHRMVAIKRRIAQHAAALVPPGQQAVALTGG
FT                   ITTGEVARALRGRPQITIVTNSLTIAADCAVDAHMKVIMTGGVVRSKSLEAVGPMSEHA
FT                   FQVITVGTAVLGADGMSAGIGATTFDEGEARTAIAMASNAQRVVVAVDGSKIGKVTLAK
FT                   MVPLDQIDHLVTDSTADHAELDRITAAGVQVHVVDVSDG"
FT   gene            589666..590988
FT                   /locus_tag="MSMEG_0510"
FT   CDS_pept        589666..590988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0510"
FT                   /product="D-tagatose-bisphosphate aldolase, class II,
FT                   non-catalytic subunit"
FT                   /EC_number="4.1.2.40"
FT                   /note="identified by match to protein family HMM PF08013;
FT                   match to protein family HMM TIGR02810"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75808"
FT                   /db_xref="GOA:A0QPT4"
FT                   /db_xref="InterPro:IPR012062"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPT4"
FT                   /protein_id="ABK75808.1"
FT                   /translation="MTSHWIRETIAQHKTGDPVGVYSVCSAHPTVVTAAVMQAAADNSF
FT                   VLVEATSNQVDQFGGYTGMRPADFRDLVHDIADEQGFDRDRVVLGGDHLGPNRWQDQPA
FT                   AVAMTNADALIAAYVEAGYRKIHLDCSMRCADDPEVLSDEVVADRSARLLRVAEQTANR
FT                   LGIEPPVYVIGTEVPVPGGAHETLTRLTPTPAEHARRTIEAHQAAFAAAGFEYVWPRIA
FT                   ALVVQPGVEFDHVNVIDYERTATAQLRRVLDTEDHMVFEAHSTDYQKPDQLRELVEDHW
FT                   AILKVGPGLTFAMREALFALSHIEAELVDPASRANLIDVVERRMLAEPRYWHSYYEGDP
FT                   VTQRTARRYSYSDRLRYYWADAEVDAARRTLLANLDRTGIPAPLISQFLPTQYERFRAG
FT                   ELDPDPRSLVIDRIRDALRPYAAACRTTDHHATALTTGVAR"
FT   gene            590985..592127
FT                   /locus_tag="MSMEG_0511"
FT   CDS_pept        590985..592127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0511"
FT                   /product="putative sugar isomerase, AgaS family protein"
FT                   /note="identified by match to protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74800"
FT                   /db_xref="GOA:A0QPT5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035464"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPT5"
FT                   /protein_id="ABK74800.1"
FT                   /translation="MTSPQAHHAEIPAQSAGGATILEIGQQPDVWREIAGRSDAETSEF
FT                   LRPIVERPDLRVILTGAGSSAFIGEIVAASLRRNLKRRVEAIATTDIVAVPLDHLERDT
FT                   PTLLVSFGRSGNSPESVATTELADELVTDVWHLIFTCDPAGTLARTHEGRANSRVVHMP
FT                   ARTNDTGFAMTSSLTSMLLSCLLTLGGVRPESAEALAAAAEHVSGLSSDIRDLARAKKQ
FT                   RFVYLGSGPLTGLARESALKLLELTAGEVVTYFDSSLGFRHGPKSVLDSDTLAIVYVST
FT                   DPYTRRYDLDIIAELREQLGQEAVKAISAEPIPDALGPALVLPGLGGLDDAQVALPYLV
FT                   FAQYLALFSSLEYGKTPDNPFPSGEVSRVVKGVTIHPMER"
FT   gene            592124..593104
FT                   /locus_tag="MSMEG_0512"
FT   CDS_pept        592124..593104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0512"
FT                   /product="BadF/BadG/BcrA/BcrD ATPase family protein"
FT                   /note="identified by match to protein family HMM PF01869"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70986"
FT                   /db_xref="GOA:A0QPT6"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR039758"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPT6"
FT                   /protein_id="ABK70986.1"
FT                   /translation="MTDMSRYLGVDGGGSKTAFALIDDRGRILARATAPTSYYFNDGFD
FT                   VVERVLAQGVSEVCAQAGCTSADIDAAFFGIPGYGEASADIARLDAVPARVLGHDRYRC
FT                   DNDMVCGWAGSLACADGINVISGTGSMTYGERQGVGHRVGGWGELFGDEGSAYWVATQG
FT                   LNAFTRMSDGRLPRGPLHAMLKERLELTGDLDVVSLVIEKWSGNRSKIAALATTVCDAA
FT                   RDGDEAAAQILSAAVDELVELVDTTARLVGFTEHETVPVSYSGGMFSGAEFLQMFTTAL
FT                   EKRLTKYDLKRPLLDPALGAALYAAKHIGHPLDADALHQLATSTH"
FT   gene            593126..594091
FT                   /locus_tag="MSMEG_0513"
FT   CDS_pept        593126..594091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0513"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71934"
FT                   /db_xref="GOA:A0QPT7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPT7"
FT                   /protein_id="ABK71934.1"
FT                   /translation="MTMSQSNSPKASARHPRSWIFYATLLVIFWGVWGAFSALPATWYG
FT                   YPDEMIYCIWALTMIIPAVFALRGERFDRRPKAAVYGLLIGLTGAGGQLLLFQALTMGP
FT                   AYLIFPIVSISPAITVLMAMVLLRERISGLAAVGLIAALAAIVLFSITGGESDVSSGPW
FT                   LPLAVLICVAWGVQAYFMRKTATIGVNEATTFGWMAITAIALIPVAVISMGGIPTGFPW
FT                   QAPVLTAGTQVLNAVGALFLVMALSRGKATIVAPTTNALAPALTIVVSLIAYQTLPTPY
FT                   GAVGIVLALLGSTLMVYSDEKRGEAPTAAVTAPEATRSRA"
FT   gene            594088..595401
FT                   /locus_tag="MSMEG_0514"
FT   CDS_pept        594088..595401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0514"
FT                   /product="alpha-galactosidase"
FT                   /EC_number="3.2.1.22"
FT                   /note="identified by match to protein family HMM PF02056"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70975"
FT                   /db_xref="GOA:A0QPT8"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPT8"
FT                   /protein_id="ABK70975.1"
FT                   /translation="MKPTVAIIGAGSVEFTRELLGDILSFPELATTRIVLHDINTERLE
FT                   TAEAIARATARAADADPEISATTDRRRALDGADYVINVIQVGMHEATVRDFEIPARYGL
FT                   NQSIGDTIGIGGIFRGLRTFPVLAGIARDMQEVCPDAWLLNYTNPMAMNVTYLHHIAPR
FT                   LKVLGLCHSVYWTMVGLCELIDVPYEEVSYWSAGVNHQAWVLRWERNGQNLYPELDRRI
FT                   AADAELQRRVRVDMYRRLGYYPTETSEHSSEYVPWYVHHRQEIDRLRINVGEYVSISKA
FT                   NLAEYARIREELADADSLPIDTGSTEYAPQVIHSLETGTTRVISANVANQGLITNLPDG
FT                   LAVEVPTTLDALGAHPMRVGDLPPQCAALNRNFLGPVDLTVRAAIDGDPRLVRAAAMVD
FT                   PNTAATLTVDQIWDLCDELTSAHGDLLPEPLRSAVCNP"
FT   gene            595444..596721
FT                   /locus_tag="MSMEG_0515"
FT   CDS_pept        595444..596721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0515"
FT                   /product="probable sugar transporter sugar binding
FT                   lipoprotein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75191"
FT                   /db_xref="GOA:A0QPT9"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPT9"
FT                   /protein_id="ABK75191.1"
FT                   /translation="MIRRWLCLAVVTAVACLLTACGGGSSSSGPVEIAVWHGYQDTEGE
FT                   AFKGLIDQYNKEHPDVHVTDLYSSNDLVLQKVLTAVRGGSAPDVAYMFGSWSPNIAKIP
FT                   QVVDMSDVVSQSDWNWDDFYPAEREAATVGDKIVGIPALVDNLAIVYNKKLFADAGIAP
FT                   PTADWTWDDFRAAAAKLTDPAKGQYGWLIPADGSEDTVWHYVPMLWEAGGDILTPDNEK
FT                   AAFNSEAGVTALTMLQDMAVTDKSLYLDTTNENGPKLMNSGKVGMLITGPWDLSQLSDI
FT                   DYGVQVMPTFAGSSGAHQTISGPDNWVVFDNGDKRKQASIDFVKWLTAPEQVKAFSLQT
FT                   GDLPTRSSVGDDQAVRDQLDQKLPGSSVFVENLNNAKKARPAVEQYPAISEALGQAIVA
FT                   VMLGKEQPAAALNSAAEAADSALAGK"
FT   gene            596736..597647
FT                   /locus_tag="MSMEG_0516"
FT   CDS_pept        596736..597647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0516"
FT                   /product="sugar transport system"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74128"
FT                   /db_xref="GOA:A0QPU0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPU0"
FT                   /protein_id="ABK74128.1"
FT                   /translation="MTGHVATRHSWRDRLGHSEHVAGWTLVSPAVVLIGVFGLLPVLMS
FT                   LTLSFQHSDLLTPETPWVGLENYRKLADDPVFVDAIKHTIIYTALFVPGTMIVGLLVAA
FT                   ALNRSVRFISVYRTAAYVTMAVSTISQGIIFLWLTDRDYGLVNAALNTVGISSQPFLAS
FT                   PSQALYVIVAMTIWGWTGFSVIVYLAALQGVPAELHEAAAIDGASAFTRFRTITVPLLG
FT                   PANIFLVVWLTINALQLFDEVYATTRGGPLRATTVIVYYLWDRAFVQFDAGYAAAMAYV
FT                   LFVVILVITAVQFRLARRYVHT"
FT   gene            597644..598570
FT                   /locus_tag="MSMEG_0517"
FT   CDS_pept        597644..598570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0517"
FT                   /product="sugar binding-protein dependent transporter
FT                   system permease"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74214"
FT                   /db_xref="GOA:A0QPU1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPU1"
FT                   /protein_id="ABK74214.1"
FT                   /translation="MTTTPHITAPVAESTEPTVVEDFSPRRRTRLRLPFSPWHLVLIPV
FT                   TFLLILPLLWMLVTSLQTEGEANRFPPVLLPESPRFENYTEAWATAPFGHFFLNSFAVT
FT                   GVVLVSNLVVCSLAGYAFARIRFLGRGALFITLMATLMVPFQVTMIPVFLIVKWFGDNV
FT                   WEGLGINHIGALMLPNLATAFGIFFLRQFFLTVPVELEDAARVDGTSRLGVLFKIILPL
FT                   SLPALSTLAALTVLTSWNDFLWPLIVITSQDQMTVPLGLSYFQGAHRVKWPLLMAANVM
FT                   SLLPMLLVFIGAQRYFVQSVASTGLKG"
FT   gene            598612..599718
FT                   /locus_tag="MSMEG_0518"
FT   CDS_pept        598612..599718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0518"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein, sn-Glycerol-3-phosphate"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72241"
FT                   /db_xref="GOA:A0QPU2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPU2"
FT                   /protein_id="ABK72241.1"
FT                   /translation="MAEVEFRDVTRSYPGGVQALKGLDLTVADGEFLILVGPSGCGKST
FT                   ALRMLAGLDKPTAGEIRIGGAVVNHLSPGQRDIAMVFQNYALYPHMSVYRNLAYGLRQR
FT                   RTPRAEIDRRVRETAELLQITEFLDRKPGQLSGGQRQRVAMGRALVREPQAFLLDEPLS
FT                   NLDAKLRNQVRGDLKRLHREVPVTSIYVTHDQVEAMTLGDRLCVMSQGEVQQIGTTDDI
FT                   YNRPANTFVAAFMGSPPMNLMPGIVRQGVLHVGGESVTPVSCPEGPVTVGARPEHLELS
FT                   PVWGDGMVPARVDFVEPLGSHSLVTALLGDDPASTTRVIVQAPADTDLPSGTRIGLTLP
FT                   PQRTYFFDAESGDALTAASMGRERISLA"
FT   gene            599806..599922
FT                   /locus_tag="MSMEG_0519"
FT   CDS_pept        599806..599922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71059"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPU3"
FT                   /protein_id="ABK71059.1"
FT                   /translation="MIMDPNPDYDASDEIEYFFNWLPWALRGVYPPPAYPPV"
FT   gene            600086..600733
FT                   /locus_tag="MSMEG_0520"
FT   CDS_pept        600086..600733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0520"
FT                   /product="porin"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73437"
FT                   /db_xref="GOA:A0QPU4"
FT                   /db_xref="InterPro:IPR015286"
FT                   /db_xref="InterPro:IPR036435"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QPU4"
FT                   /protein_id="ABK73437.1"
FT                   /translation="MTAFKRVLIAMISALLAGTTGMFVSAGAAHAGLDNELSLVDGQDR
FT                   TLTVQQWDTFLNGVFPLDRNRLTREWFHSGRAKYIVAGPGADEFEGTLELGYQIGFPWS
FT                   LGVGINFSYTTPNILIDDGDITAPPFGLNSVITPNLFPGVSISADLGNGPGIQEVATFS
FT                   VDVSGPAGGVAVSNAHGTVTGAAGGVLLRPFARLIASTGDSVTTYGEPWNMN"
FT   gene            complement(600745..601814)
FT                   /pseudo
FT                   /locus_tag="MSMEG_0521"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which is not the result of sequencing error"
FT   gene            601925..602077
FT                   /locus_tag="MSMEG_0522"
FT   CDS_pept        601925..602077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0522"
FT                   /product="pp24 protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74075"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPU5"
FT                   /protein_id="ABK74075.1"
FT                   /translation="MDPKHNDDQGDRPGDTGYDPDADPEMMQQQAHPQPNQAEGADDPA
FT                   ETGEG"
FT   gene            complement(602113..603006)
FT                   /locus_tag="MSMEG_0523"
FT   CDS_pept        complement(602113..603006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0523"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71742"
FT                   /db_xref="GOA:A0QPU6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPU6"
FT                   /protein_id="ABK71742.1"
FT                   /translation="MSDRKTELAEFLSARRARLTPEEVGLEQPGTRRRVPGLRREELAL
FT                   LAGVSVDYYTRLEQGRSRSASADVLDALAAALQLDDAERAHLHTLAKPQPAQRKRRSKP
FT                   QMVDPVTLRLLELLDQSHSPAFVLGRRLDVLAHNRLAGALITEFRELPAPQRNQARFVF
FT                   FDPHARELYADWDEVAADTVAMLRLDAGRYPDDDKLSALVGELSIRSEEFRSWWSDHTV
FT                   KQRTVGTKAYHHPLVGDLAVTYQALNPSGDPDQTLFIYTTEPGSPDETALRLLANWHEG
FT                   GEQGSRAASARKSSEA"
FT   gene            complement(603036..603863)
FT                   /locus_tag="MSMEG_0524"
FT   CDS_pept        complement(603036..603863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0524"
FT                   /product="short chain dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75937"
FT                   /db_xref="GOA:A0QPU7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPU7"
FT                   /protein_id="ABK75937.1"
FT                   /translation="MTVWFITGASRGLGAQIARTALDHGADVAVGVRNPDLLPSDIAER
FT                   AFAVRLDVTHDADISAAVAAVVERFGRIDVLVNNAGRGLLGALEEVTDAEARSLFDLNV
FT                   FGLINVTRAVLPHMRASGGGKLVHIGSRSGFEGEPGVGLYSASKFAVAGISEALSAELA
FT                   PFGIQSMVVEPGVFRTDFLDGSSLSMPANRIDAYDGTPAHDTLDWVDDANHTQLGDPVK
FT                   GAALIYEVANEDKLPRHLLLGRDAVERWRVKAAQMADDVTAWEMKSLATAHLA"
FT   gene            603897..604079
FT                   /locus_tag="MSMEG_0525"
FT   CDS_pept        603897..604079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0525"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABK76184"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPU8"
FT                   /protein_id="ABK76184.1"
FT                   /translation="MSSVNAARQRETVAIRAQRIRGQRVPPFRKNRGIGPSATRKLYDR
FT                   TALLQLEPISRGIAA"
FT   gene            604076..605674
FT                   /locus_tag="MSMEG_0526"
FT   CDS_pept        604076..605674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0526"
FT                   /product="oxidoreductase, GMC family protein"
FT                   /note="identified by match to protein family HMM PF00732;
FT                   match to protein family HMM PF05199"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72612"
FT                   /db_xref="GOA:A0QPU9"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPU9"
FT                   /protein_id="ABK72612.1"
FT                   /translation="MTSYDYIIAGAGSAGCVLANRLSEDPRIKVLLLEAGGSDRNPLFS
FT                   IPKGSGKLFDSEKHMWHYSTEPFGPNPHAEQWMRGKVLGGSSSINGMIYNRGTRADYDG
FT                   LERLGNKGWGWDDILPIFKRFEDNEFGPSATRGVGGPLHISIPRDPDPLCEEMLAAAEA
FT                   SGLTRVQDINEHDTERIGYATSTIRNGRRVSAATAFLKPALGRPNLTVRTSATVGRILF
FT                   EGTRAVGVDVTGTSGTTQVRASREVIVSLGSLNSPVLLQLSGIGPREVLRSAGVQVFIE
FT                   HDRVGRGLREHRCATLRFDLIEDLGYNKQLASSVAQALTGLRYLATRRGPLGAPSFDIV
FT                   GFVKTRADVDRPDGQIMMGPYTLPPYNVGEPVTIQRQAGLSCLGMVLRPTSEGALEITS
FT                   SGPRPSVRIEPNYLGSEHDRTATADLLRRMRAVFAESPIAERISHETFPGPGVATDDEL
FT                   VDSALDGGYCGYHAVGTCAMGPGDDAVVDDRLRVRGVDGLRVVDCSVLPTMVAGNLNGP
FT                   IMAVAWRAADFILDR"
FT   gene            605757..606500
FT                   /locus_tag="MSMEG_0527"
FT   CDS_pept        605757..606500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0527"
FT                   /product="2-hydroxycyclohexnecarboxyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73358"
FT                   /db_xref="GOA:A0QPV0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPV0"
FT                   /protein_id="ABK73358.1"
FT                   /translation="MSRVAAVTGAGSGVGRATALQLARDGHRVAVMDLDGQAAEEAAAK
FT                   IESHGGRALAVAVDVADESAVAAGFEAARQAFGPIGIVVTSAAMGGFTRFDKITLDEWN
FT                   RYLAVNLTGTFLCIRAALPDMVKAQWGRIVTISSAAGQRGAPAQGHYSATKGGVIAMTK
FT                   TLALDYAAKGITANTIPPFVIDTPMLREQQAAGLLPQAEHLTKAIPAGRLGSGDDVAAM
FT                   CSFLCSDAAGYVTGQVIGVNGGAVL"
FT   gene            606524..607450
FT                   /locus_tag="MSMEG_0528"
FT   CDS_pept        606524..607450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70757"
FT                   /db_xref="GOA:A0QPV1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019910"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPV1"
FT                   /protein_id="ABK70757.1"
FT                   /translation="MRIGLSGGAANVDDIVRQAQRAEEDGFSSLWYASGVAGDPLTAMA
FT                   IAGRATTSIELGTAVLQTYPCHPLLQANRVAAAANAMGRPGLTLGLGPSHEPVVRGVLG
FT                   LSYDRPGTNAEEYLRIVSALLRGETVDHDGREWTAHSDGRMVAVDHRVPILLSALSPRM
FT                   LRIAGTFADGVVLWMASAEAIRSHIVPKLTVAATAAGRPAPRVVAGLPVVVHDDPVAAR
FT                   AAVDAASTSYASMTNYRRIIEAGGGSAAGDVAVSGDETAVQTKLRELLDAGATDIWAQP
FT                   VAVGTDRAERVASLRRTRALLRELARA"
FT   gene            complement(607494..610940)
FT                   /locus_tag="MSMEG_0529"
FT   CDS_pept        complement(607494..610940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0529"
FT                   /product="probable serine/threonine-protein kinase PknK"
FT                   /EC_number="2.7.11.1"
FT                   /note="identified by match to protein family HMM PF00069;
FT                   match to protein family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71316"
FT                   /db_xref="GOA:A0QPV2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016236"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPV2"
FT                   /protein_id="ABK71316.1"
FT                   /translation="MVRNDPLPTQRDLPAGIPAELVAAGFEDPDEIGRGGFGVVYRCVQ
FT                   RALDRTVAVKVLTTDLEPDNLERFMREQVAMGKLSGHPNIVNIFQVGTIASGRPYIVMQ
FT                   YHPHGSLSAKIQAAGPLGWRGALRIGVKMAGALETAHQRDTLHRDVKPANILLTEYGEP
FT                   QLTDFGIARIAGGFETAEGAIMGSPAYTAPEVLLGESPTVASDVYSLASTVFTASTGHA
FT                   VFERGKGEQMVAQFLRITRHPAPNLRDADLPADLSAAIEQAMSRTISDRPESAQAFGEQ
FT                   LRELQRRHGLPVDDMPIPIAPPTDRPSSIASPTPSSGYPVRTLTPPAPATRFQMPSSAK
FT                   RLVERARLIDVLRAQRDKKLTVIHGPTGFGKSTLAVQWAKQLAADGVAVAWLTVDDDDN
FT                   NVVWFLSHVIEAIRSVMPALASDLGDVLEEHGDDAERYVLTSLINDIHSSGRRMTLVID
FT                   DWHRVTDPATIAALRYLLDNVASGLTVVVTSRTQSGLPMSRMRMQGEIVEIDATALRFD
FT                   VSESGSFLVDLAGLDLDQTDVEELTEKTDGWVAALQLASLTLRDRDDPVQLIETMTGRH
FT                   HVISEFLAENVLETLEPSTLDFLLATSIPERICGGLASALTDVPDGQAILEKIEERDLF
FT                   LRRIDDQWFRYHQLFRDFLRHRLSRERVCDLHRRACRWYAGQRLVREAVDHALAAGDET
FT                   EAVRLVENDGLYLVSGGQMATLIGLTAKLPQDIVRSNPRLQLALAWANIVLHRVPAARD
FT                   ALARVEATMADAGLSEDEIADMRAEADVVRAIADLRSDRLSGIDEHVAACLQRRDRMPP
FT                   FSVATAATVATFAAAYRYDLDEVERIQTWAAPYYERSGDAFSIVNGLCFCGIAHHLMLN
FT                   NAVAEQTLRRALRIAKRSGGIHSYAGRLASSLLGEILYEKGDLAEAERLLDEGYKLGPE
FT                   GGSVDFKIARYVISARIKALQGDRLGAAQRLDEATRVARSLSLNRLQALAEHERIRLGL
FT                   PPHPEFGPMPVVSYDARREPVDAMDAIALQFEEASAIRRLMASDDPAARDLACRWAREW
FT                   VDRLSALNRPQALLRARRLLGACLAADGRTAEAKAMVATVAAQCAQLRMLRYLVDGGPQ
FT                   VVATLVELRADQEAGRWSPEWPEVPADFLQDAINSVAPQRY"
FT   gene            complement(611055..611756)
FT                   /locus_tag="MSMEG_0530"
FT   CDS_pept        complement(611055..611756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0530"
FT                   /product="short chain dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70564"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPV3"
FT                   /protein_id="ABK70564.1"
FT                   /translation="MQQDTTARVALITGASRGIGAEVAQQLATSGTHSIVNYRANAERA
FT                   EGIAETIRAAGGQASTIRADIADEASTAAMIDDIGRRFGRLDALVLTALGGPRVGLDPR
FT                   HAMRLNRDAQRRLARLALPLMPAGGHIVFVTSHQAHFFPHKAVPKGYGPIAASKRAGET
FT                   ALYAMRPEFDRHGVHFTVVSGAMLDEMTIADLWQRREPEAEFASAVVHAATAPKPSGIV
FT                   FVGRAEYLMTA"
FT   gene            complement(611979..613190)
FT                   /locus_tag="MSMEG_0531"
FT   CDS_pept        complement(611979..613190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0531"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69704"
FT                   /db_xref="GOA:A0QPV4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPV4"
FT                   /protein_id="ABK69704.1"
FT                   /translation="MTFSLQLSDDVIEVRDWVHQFAAEVVRPAAAEWDEREETPWPVIQ
FT                   EAAKVGLYSPELFAQQAAEPTGIGMLTVFEELFWGDAGIALSILGTGLAAAALAGNGTP
FT                   EQLGQWLPEMFGTADEPKLGAFCSSEPDAGSDVGAIRTRARFDEATREWVLNGTKTWAT
FT                   NGGIANVHIVVASVYPELGSRGQATFIVPPGTHGLVQGQKFKKHGIRASHTAEVVLDNV
FT                   RLPEDMILGGREKFEERIARVKSGASAGGHAAMKTFERTRPTVGAMAVGVARAAYEYAL
FT                   DYACQREQFGRKIGEFQAVAFKLADMKSRIDAARLLVWRAGWMARNNQQFDSAEGSMAK
FT                   LVASETAVYVTDEAIQILGGNGYTRDYPVERMHRDAKIFTIFEGTSEIQRLVISRALTG
FT                   LAIR"
FT   gene            complement(613219..613836)
FT                   /locus_tag="MSMEG_0532"
FT   CDS_pept        complement(613219..613836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0532"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71704"
FT                   /db_xref="GOA:A0QPV5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPV5"
FT                   /protein_id="ABK71704.1"
FT                   /translation="MSAARDRLMAAALKLFAAKGYAATSVAEIQQQAGLAPGSGALYKH
FT                   FGSKRELLEAAITHRIDNIVAAREQYDAEKPRTVEDAVRSAGQLIWTNLTQSEELLRVM
FT                   LREPDELGDLDEKTWQVITDNAYQRFADELAASNRAGRTEIPDPEATAAVAIASLSYVA
FT                   TLHALNGRTPGNVDHDRFFEAWVAQTVAAIEQHRTDNQTDNR"
FT   gene            complement(613901..614440)
FT                   /locus_tag="MSMEG_0533"
FT   CDS_pept        complement(613901..614440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0533"
FT                   /product="gp236 protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72652"
FT                   /db_xref="GOA:A0QPV6"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPV6"
FT                   /protein_id="ABK72652.1"
FT                   /translation="MMVWLADALRAEGLDVDEIDGWRANGDGDFDDIWGIMCHNTAGDD
FT                   IATDAIALGTGERPGPLSNVLIRRDGTVAVVAAGVAHHAGPGYHPDLPRDDVDTRTIGI
FT                   HAEMRRRQKYPREQYLSYVRCCAAILRHINRSASHVLGHQEWDTGKVDPCLSMDQLRAD
FT                   IVAHLSSHAHSDSRVV"
FT   gene            complement(614551..615804)
FT                   /locus_tag="MSMEG_0534"
FT   CDS_pept        complement(614551..615804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0534"
FT                   /product="permease, major facilitator family protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69663"
FT                   /db_xref="GOA:A0QPV7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPV7"
FT                   /protein_id="ABK69663.1"
FT                   /translation="MTATATPSETQHRSHRLRPWVAVAAAAFCIGWGGNQFTPLLIAYT
FT                   QHSGYTRVDVDVLLGAYVLGLIPGLLVASTLSDRYGRRPVMALGVASSALGSVILAIGE
FT                   YWGFSALFAGRLLSGAAVGIAMAVGSAWITELSRAPFDDAAPGSGARRASICLSLGLGV
FT                   GPLCAGLLTEYAPLPLVLTYLVHAGLCLPALWAIRHRTIETRSGTPSVGVIEGLRVPAA
FT                   AHRRFVRVVMPMAPWIFGSAAIAYAIVPALVADRLGHWALLYTAGLTVLTLGCGVAVQP
FT                   IARRLDDHSSARAVVVSMVLMALGVFAAVATAVTRSIGMAVVVAMLLGCAYGIAIVSGL
FT                   LEVQRIAEPDELAGISGVYYSLAYAGFLLPAILAALARFFSYPAMLTVVGLLAAACTAL
FT                   CASGWSKHLEPRTVTARV"
FT   gene            complement(615801..616439)
FT                   /locus_tag="MSMEG_0535"
FT   CDS_pept        complement(615801..616439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0535"
FT                   /product="GntR-family protein transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71189"
FT                   /db_xref="GOA:A0QPV8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPV8"
FT                   /protein_id="ABK71189.1"
FT                   /translation="MDTTSNSQRAYQATKDRILSGGIRGGQLLSEVEVAGELGLSRTPV
FT                   HEAFLRLAAEDLLELLPRRGAVVVPVPPQEGTDLLEMRLALETAAVRRLCRTPDVVDSL
FT                   FTELNDLVDQQRRLAETNDAHAFAVADDTFHRRIVEVAGNPIGQRFYGSLSDRQRRMMA
FT                   DAARSDSARLAALIGEHARLAEAIERRDVEEFESTLLSHLEATYRVTLK"
FT   gene            complement(616498..617064)
FT                   /locus_tag="MSMEG_0536"
FT   CDS_pept        complement(616498..617064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0536"
FT                   /product="intracellular protease, PfpI family protein"
FT                   /note="identified by match to protein family HMM PF01965;
FT                   match to protein family HMM TIGR01382"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74328"
FT                   /db_xref="GOA:A0QPV9"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPV9"
FT                   /protein_id="ABK74328.1"
FT                   /translation="MTHALDGKKVAILATDGVERRELVEPREALEQAGARTELLSLQTG
FT                   SIDARDHDLEPAGTYTVDRLVSEAKGDEFDALVVPGGTVNADKLRSDAKAVAFVHDFVN
FT                   SGRPVAVICHGPWTLIEAGVAKGRTLTSYASLRTDLRNAGATVLDEEVVVDGNLITSRS
FT                   PEDIPAFNKALIDALAQQPQAQAQQ"
FT   gene            complement(617136..617564)
FT                   /locus_tag="MSMEG_0537"
FT   CDS_pept        complement(617136..617564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73443"
FT                   /db_xref="GOA:A0QPW0"
FT                   /db_xref="InterPro:IPR035197"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPW0"
FT                   /protein_id="ABK73443.1"
FT                   /translation="MAAERKKDRPNLLQYIAYSYGRRLPDSMREWVAHDLADHGAVRRH
FT                   MIRMAIPPALVLAPFWLLPASLYVHIEMTVPIYIWSLLMALALNKVWRRHRLAQHGLDP
FT                   NLVDEIRYKKQAHIHEDYIRRFGPRPESAKFQSNSSPF"
FT   gene            complement(617579..618070)
FT                   /locus_tag="MSMEG_0538"
FT   CDS_pept        complement(617579..618070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0538"
FT                   /product="regulatory protein, MarR"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71303"
FT                   /db_xref="GOA:A0QPW1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPW1"
FT                   /protein_id="ABK71303.1"
FT                   /translation="MASPSSVDVDPLALERQVCFALAVTNRAVLSIYRPLLEPLGLTHP
FT                   QYLVMLALWDHHKIRSAGVDPLSVKQIAATLQLDSATLSPMLKRLEALGLITRTRSVGD
FT                   ERATDIRLTEAGIALRERALAIPPKVVERLGVDMAELEELHRVLTRVNTAALAANGVNH
FT                   "
FT   gene            complement(618144..618818)
FT                   /locus_tag="MSMEG_0539"
FT   CDS_pept        complement(618144..618818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0539"
FT                   /product="transcriptional regulator, Crp/Fnr family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00027;
FT                   match to protein family HMM PF00325"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73796"
FT                   /db_xref="GOA:A0QPW2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPW2"
FT                   /protein_id="ABK73796.1"
FT                   /translation="MDEVLARAGIFQGVQPSAVAALAQQLEPVSFSRGQVVFTEGEPGE
FT                   TLYIITSGKVKIGRKSVDGRESLLTLMGPSDMFGELAIFDPGPRTSTVTALSDVQAVMM
FT                   HRKVLRNWIADRPEIAEQLLRVLARRLRRTNDNLSDLIFTDVPGRVAKQLLHLAQRFGT
FT                   REGNSLRVDHELTQEEIAQLVGSSRETVNKALSDFAQRGWIRVQGKSILIDNTERLARR
FT                   AN"
FT   gene            618988..619611
FT                   /locus_tag="MSMEG_0540"
FT   CDS_pept        618988..619611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0540"
FT                   /product="transcriptional regulator, putative"
FT                   /note="identified by match to protein family HMM PF04299"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75587"
FT                   /db_xref="GOA:A0QPW3"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPW3"
FT                   /protein_id="ABK75587.1"
FT                   /translation="MYLPPKFALSPERIDAVLAEAGFAQLVSHTTAGLVVTPLPLLYDA
FT                   ERHALLGHVARANDHWRAAGAESVAIFTGPQAYVSPSFYPTKAETGKVVPTWNYEVLNV
FT                   YGTLRVHDDPDWLLDLVTRLTDRHEAGRDRPWQVADAPASYTRAQLNGIVGVELPVERV
FT                   EAKAKMSQNQPARNRAGVITGLAASQSALDAQVSDRVAAFDPDH"
FT   gene            619744..620037
FT                   /locus_tag="MSMEG_0541"
FT   CDS_pept        619744..620037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0541"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75066"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPW4"
FT                   /protein_id="ABK75066.1"
FT                   /translation="MYCSAACRQKAHRARTARRVDALRSLRSGRNEVRRPVGIRSDIAQ
FT                   SIARAREQIAESRRLCRVSAERLQRLEDLQRELAKPREVRATTPMSYAKWAR"
FT   gene            620034..620738
FT                   /locus_tag="MSMEG_0542"
FT   CDS_pept        620034..620738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0542"
FT                   /product="antar domain protein"
FT                   /note="identified by match to protein family HMM PF03861"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72806"
FT                   /db_xref="GOA:A0QPW5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPW5"
FT                   /protein_id="ABK72806.1"
FT                   /translation="MTTAPEDDDTAAAVQALTGGTPQQMGWFRFYFADQHWEWSAEVQR
FT                   MHGYEPGTVTPTTELVLSHKHPDDRDQVAVDINDMMTGRRAFGRRHRIIDTSGTLRQVI
FT                   VVSDQLHGFDGDVIGIRGFYIDVTPPRSRQEDAVITAEVAKITERRAVIEQVKGMLMLI
FT                   YGIDENAAFDLLKWLSQENNVKLRVLADQVAKDFTALGDTGVLSRSKFDQLLLTAARRA
FT                   VSSDDDSMSTSA"
FT   gene            620809..621762
FT                   /locus_tag="MSMEG_0544"
FT   CDS_pept        620809..621762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0544"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70623"
FT                   /db_xref="GOA:A0QPW6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPW6"
FT                   /protein_id="ABK70623.1"
FT                   /translation="MQLSARMPDLMALEVLLAVARKGSLSAASRECGLTQQAISARIAA
FT                   LERQTGVRLVTRTKTGSRLTSSGVLAAQWADRLLDVAHEVDAGLATLRDNSKTQLRITA
FT                   SLTVAEQLLPRWLVSWREAVTRQGGPAPDLILTAANSEHVLAAVRGDHADLGFIESRGA
FT                   PRGLRSSVVAHDELVVVVPPGHTWARRSRPIAPEELAATPLVTREQGSGTREFLASVLK
FT                   GVAGAEQVRPALELSSAAAVRAAVLADAGPAVLSRLAVADDLQLGRLRAVDVTGLDLRR
FT                   ALRAVWLGTRTPPAGAARDLLSHIASVCKGSPRHAP"
FT   gene            complement(621750..622790)
FT                   /locus_tag="MSMEG_0543"
FT   CDS_pept        complement(621750..622790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0543"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75405"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPW7"
FT                   /protein_id="ABK75405.1"
FT                   /translation="MSSAHLRWTVIGAGPAGIATVGRLIDNGIRHDEIAWVDPGFAVGD
FT                   FGTKWSVVPSNTRVSGFVHFLQASAAFQFHRGPDFAIRELDPRQTCSLAMVTEPLQWIT
FT                   DQLAERVTAVKALATRLELHGRHWEVRTDIATLVSDNVVLAIGSEPRRLDHPGIQEIPL
FT                   DVAVAPHKLATESLDGATVAVFGSSHSTMLVLPNLLRRPVARVVNFYQHPLRYAVDFGD
FT                   WTLFDDTGLKGHAAQWARENIDGTLPERLRRCLVSDPRFDELLAQCDRVVYTVGFQPRR
FT                   IDAPQLGSLLHNPANGIIAPGLFGVGIAFPGFRTDPTGLGEHRVGLQKFMEQLATCMPI
FT                   WLRYGA"
FT   gene            complement(622986..623513)
FT                   /locus_tag="MSMEG_0545"
FT   CDS_pept        complement(622986..623513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0545"
FT                   /product="transcriptional regulator, LuxR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75485"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPW8"
FT                   /protein_id="ABK75485.1"
FT                   /translation="MTEKLSTGTKTLLMARVDRAEELWQTELDQTIAAIPWLRASMAHL
FT                   IALNDGTLQRDASDSFVAAFDRASDAVMCALDLQLAPLEPFALCIGVHAVEHTDSADSD
FT                   GAARLRDIARGGQTLISAAAAALVSARMPAHAALTPLRDRVRHEPVYQLNHPGLRTEAD
FT                   EVPHLPYGRVVR"
FT   gene            complement(623786..624613)
FT                   /locus_tag="MSMEG_0546"
FT   CDS_pept        complement(623786..624613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73637"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPW9"
FT                   /protein_id="ABK73637.1"
FT                   /translation="MVEDWRTLNLANWEARVPLHVSPGGYDLDSFSDPRHLSGVVRYDL
FT                   PRLGDITGLDVVHLQCHIGTDTVSLARLGPRSVTGLDFSPSAIAAANDLAARAVAAVRF
FT                   VESDVYDAAVVLGRESCDLVYTGIGALCWLPDIRRWATVVAQLLRPGGRLFMREGHPML
FT                   DTIDETRSDDLLVVHYPYFETAGSPFTETTTYGGEGTVSAPKGVSFNHGLGEVFTALTE
FT                   AGLTVTALEEHREAPWKALVQGMIESTEFEGEYVLAEHPERLPLTYTIQARKP"
FT   gene            624722..625600
FT                   /locus_tag="MSMEG_0548"
FT   CDS_pept        624722..625600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0548"
FT                   /product="chromosome replication initiation inhibitor
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00126"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74448"
FT                   /db_xref="GOA:A0QPX0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPX0"
FT                   /protein_id="ABK74448.1"
FT                   /translation="MQIDGQQLAAFAAVIELGSFDAAAARLHVTPSAVSQRIKALEQRV
FT                   GQVLVVREKPCTATPAGVPLLRLAAQTALLESEALAEMGGGSSHRPRMALAVNADSMAS
FT                   WFTGVFRRLPDVLFDIRIEDQDLSARFLREGVVMGAVTTERTPVSGCRVHPLGAMRYIP
FT                   VASAEYMARYLPDGFNREAAAAAPSLAWNRDDRLQDQLVRKVFRRDVTRPVHFIPTAEG
FT                   FGAAVRAGLGWGMYPEDLVDASFVPITEHHLDVPLFWQCWKLDSPLVQAITDAVLAASA
FT                   RLRGRRTAAER"
FT   gene            complement(625597..626658)
FT                   /locus_tag="MSMEG_0547"
FT   CDS_pept        complement(625597..626658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0547"
FT                   /product="ISMsm5, transposase"
FT                   /note="identified by similarity to GB:CAD18826.1"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74147"
FT                   /db_xref="GOA:A0QPX1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPX1"
FT                   /protein_id="ABK74147.1"
FT                   /translation="MPSSTLVISSEDRVTLESWTRSSTVPAGRVERARIVLAVADGAGT
FT                   SGAARQVGVSRPTVIKWRDRFAAFGIEGLDDEPRSGRPKTVDDAEILATTLEPPPESLA
FT                   VTHWSSRLLGKHLGIGDATVARAWRRYGVKPWRRETFKFSTDPELEAKVRDVIGLYLNP
FT                   PEKAVVLCVDEKSQIQALNRTQPILPLRPGLPERATHDYQRNGTATLFAALEIATGKVT
FT                   DRCYERHGKAEFLDFLKTVARAYPRRKLHVVCDNYHTHKHADINAWLVKNPRVTLHFTP
FT                   TSGSWLNLVEVFFSIITRQAIRRGSFNSVKELIAAISAFIEGWNQRAHPFVWTKTADEI
FT                   LPHTRKQTSDARH"
FT   gene            complement(626702..627430)
FT                   /locus_tag="MSMEG_0549"
FT   CDS_pept        complement(626702..627430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0549"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71685"
FT                   /db_xref="GOA:A0QPX2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPX2"
FT                   /protein_id="ABK71685.1"
FT                   /translation="MGLIVPVALLVIWHLVAKRGAFSPSQLPPPGDVLEALGELLRRGD
FT                   LWTHLQTSVSRVFAGYLAGAAVALVLGSLIGLSATVRRLFAPTVAALRTVPSLAWVPLL
FT                   LLWFGIGETPKVTLVAIGAFFPIYTTTASALSHVDAQLLEVGRAYGRRGAALVTTVMLP
FT                   AAAPALVNGLRLGLANAWLFLVAAELIASSKGLGFMLIDSQNTGRTDIMLLAIGLLAGL
FT                   GKLTDSLFGIFEARLVRKRS"
FT   gene            complement(627472..628440)
FT                   /locus_tag="MSMEG_0550"
FT   CDS_pept        complement(627472..628440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0550"
FT                   /product="sulfonate binding protein"
FT                   /note="identified by match to protein family HMM TIGR01728"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69573"
FT                   /db_xref="GOA:A0QPX3"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPX3"
FT                   /protein_id="ABK69573.1"
FT                   /translation="MRIRHLATLLTAVALAATSAACSSEGSESSDKDIRLDYAYYNPLS
FT                   LVVRDQKLLENQGYNVTWILSAGSNKANEGVRSNALDFGSTAGSAALVARANGTPLKVV
FT                   DVYSQPEWTALVVAKDSPVKSVADLKGKKIAVTKGTDPYFFLLQALDANGLSASDVEIV
FT                   NLQHADGKTALERGDVDAWSGLDPFMAQTVQEQGARLLYRNPEFNSYGVLNVREDFSAA
FT                   HPDTVQAVVNSYEEARTWALEHPAELTTLLAQEAKISQSVAEEEMERTALDIDPVPGAA
FT                   QKAVLEKIVPIAVADGDIKSEQAAQEALGTLLDPQFAQNAD"
FT   gene            complement(628489..629271)
FT                   /locus_tag="MSMEG_0551"
FT   CDS_pept        complement(628489..629271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0551"
FT                   /product="ABC nitrate/sulfonate/bicarbonate transporter,
FT                   ATPase subunit"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71465"
FT                   /db_xref="GOA:A0QPX4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPX4"
FT                   /protein_id="ABK71465.1"
FT                   /translation="MTSTDLAPARVSVRNVGRTFGTHTVLRDIDLEIEPGEVIALLGSS
FT                   GSGKSTLLRLIAGLDLPTEGLIEIDGDAIRETDPRCAIVFQEPRLFPWRSLAGNVAYGL
FT                   PRGTSRTEGAETVRHWLEVVGLQEFADHRPRQVSGGMAQRAGLARALARRPRVLLLDEP
FT                   LAALDALTRLQMQMLLDKVQQEAGTTTILVTHDVEEAVILADRVLLLRADNDGTAGLAA
FT                   SFDVTIPKPRDRGDPRVIELRDLLLDELGVPRTAPEAT"
FT   gene            629360..629854
FT                   /locus_tag="MSMEG_0552"
FT   CDS_pept        629360..629854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72405"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPX5"
FT                   /protein_id="ABK72405.1"
FT                   /translation="MAADRGPRTHRYEVEVTWTGNTGSGTSGYRAFERDHEVAGVGVTG
FT                   KPVIAGSSDPAFRGKEQRWNPEELLVASLSQCHMLWYLALCAQAGIVVTAYRDRPAGTM
FT                   TESSGGSGAFVDVTLHPEVTLADGSRREDAAALHEKAHEMCFIANSVNFPVRAEPEFIV
FT                   D"
FT   gene            629922..631274
FT                   /locus_tag="MSMEG_0553"
FT   CDS_pept        629922..631274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0553"
FT                   /product="probable sugar ABC transporter, substrate-binding
FT                   protein, putative"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70513"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPX6"
FT                   /protein_id="ABK70513.1"
FT                   /translation="MTSPAFTRRRALQLLGLAGGAAMLAPALAACGSSGGNSALAADAP
FT                   VSGRFEGVTLKLLVNQPHVTSFRDVLAPAWQEATGGTLDVTAAPYDQLTSKQILDVQSG
FT                   TGEFDVFDYFYFGLGDLVDADALVELTDWIDNRQGELDVSGYLKSIYDPYTLLDGKRYG
FT                   LPYDGDIHILFYNAELFDRYKVEPPTTWDEYDEVAAKITKDARGTAYGAIVSGQQVPMI
FT                   LGCSYINRLTGYGGNLFDENGKPALTSDASIAALEHLVAVTPAALPTPLQIGFDQANTA
FT                   FLSGQGAMLDTWTDMALRAEDPTASKIAGRWGAVSLPVGGANTTPRTALDAGFGLGIST
FT                   ASENTDAAAAFIAWATAAPQNLAVSSTAGAGIDPVRGEVLDSDGYAKVVTNAVAPIRQG
FT                   LGGDPLVWPKQAGAPKLLQDLVDQLALAIAGTQTVEQSLEQAQASWDSASS"
FT   gene            631271..632140
FT                   /locus_tag="MSMEG_0554"
FT   CDS_pept        631271..632140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0554"
FT                   /product="ABC transporter permease protein, putative"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72462"
FT                   /db_xref="GOA:A0QPX7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPX7"
FT                   /protein_id="ABK72462.1"
FT                   /translation="MSKRVPLWLAVPAMAGLALFLVYPMGYLVALALTKSSLAKPLRGF
FT                   VGGDNFTAAFASPAFTPSLVRSSVFAVVAAIVTTTLGLAIALLLRQKGSRFGIIGALFL
FT                   LPLVTAPVLVGVAWKLLLAPVGGGLAGVFDSVGLHGFNPLGSGTGAFVVLLLIHIWQWT
FT                   PFAVLIAFAALGVVRPELLESARIDGANSWRTFTTVTWPAIAPTLLAVVLLELVIGYKV
FT                   FDLIVVVTAGGPGFSTSLSPYVIYQTGLRGSFDMGTAAAQTLVFGLVVGAVSTVVTTLR
FT                   ARALKGDG"
FT   gene            632137..632928
FT                   /locus_tag="MSMEG_0555"
FT   CDS_pept        632137..632928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0555"
FT                   /product="ABC transporter permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72330"
FT                   /db_xref="GOA:A0QPX8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPX8"
FT                   /protein_id="ABK72330.1"
FT                   /translation="MKARAALVFAVLVALMPVGYLVSLALRPAEDVLNSSLFPTSLTLS
FT                   NFVKVFDTIELGTMLQNSWVAAVGGALLAVLIAAPAAYFTARHTRGERLLTVLLASYCA
FT                   PPIVAIIPLFFLLRHVGLTNNLAGLILVNGIANVPVAVWLLDGFVRRIPIEIDEAAVID
FT                   GLSVAAAFRKIILPLLWPGIVAALLVAFFLSYNDFLFAVYLAVTKESQTLTVGLSLFQG
FT                   DRNVQFGQQAAAGLLGLAPVYVLALAAQRHLVGGLTTGATK"
FT   gene            632925..633980
FT                   /locus_tag="MSMEG_0556"
FT   CDS_pept        632925..633980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0556"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71632"
FT                   /db_xref="GOA:A0QPX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPX9"
FT                   /protein_id="ABK71632.1"
FT                   /translation="MSTIELSGITKTYGGSAVVDGLDLTLRDGTLTVLVGPSGCGKSTT
FT                   LRIVAGLETADKGAVRIAGRDVTSATPRERDVAMVFQNYALYPHLTVAGNVGFPLRNSG
FT                   VAKTEVEQRVAQAAERVGITALLDRKPRQLSGGQQQRVAIARALVRTPSAFLFDEPLSN
FT                   LDAKLRVELRSEIRRLQTETGITSLYVTHDQEEAMTIADQLVVLDAGSIAQVGTPEELY
FT                   RRPANTFVAGFIGSPSMNLVPGRLRAGRFEADGLTLVVAGDDRDDVTLGVRPEDLLVAP
FT                   DPSGPGRVELVELLGPRYVLIIRAGAHRLTAVAEAATVSEWAGVPAAGDPVSVQARPGR
FT                   THLFDSTGARI"
FT   gene            634165..634302
FT                   /locus_tag="MSMEG_0557"
FT   CDS_pept        634165..634302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0557"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73176"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPY0"
FT                   /protein_id="ABK73176.1"
FT                   /translation="MDTSNLFSHPEKHETMPPEKRTAEPVTGPLFSDRPHQQRADKRPS
FT                   "
FT   gene            634299..634826
FT                   /locus_tag="MSMEG_0558"
FT   CDS_pept        634299..634826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70118"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPY1"
FT                   /protein_id="ABK70118.1"
FT                   /translation="MNGLVGSRRLASPVRLTLAKRLGRDIDGAWWPRSASVAKELPELV
FT                   EVLQRPLGEIVDININWSPGEGQLDLNTIAAGSRTQAAFKPTRPRVMSVAGRAECVKLL
FT                   VVPHMTSEALGGIVMRCAAGMLIESTVRSTPLYDTAVRIMGAAQQESARWLGRRAEGAG
FT                   VPTASVESPAGA"
FT   gene            complement(634899..635102)
FT                   /locus_tag="MSMEG_0559"
FT   CDS_pept        complement(634899..635102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0559"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF00313"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72599"
FT                   /db_xref="GOA:A0QPY2"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPY2"
FT                   /protein_id="ABK72599.1"
FT                   /translation="MAQGTVKWFNGEKGFGFIAPDGGAPDVFVHYSEISGSGFRSLEEN
FT                   QRVEFEITQGAKGPQAVGVTAV"
FT   gene            complement(635220..636284)
FT                   /gene="dapB"
FT                   /locus_tag="MSMEG_0560"
FT   CDS_pept        complement(635220..636284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="MSMEG_0560"
FT                   /product="dihydrodipicolinate reductase, N-terminus domain
FT                   protein"
FT                   /EC_number="1.17.1.8"
FT                   /note="identified by match to protein family HMM PF01113"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71097"
FT                   /db_xref="GOA:A0QPY3"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPY3"
FT                   /protein_id="ABK71097.1"
FT                   /translation="MPDTTGYRVVQWTTGNVGKSSVAAIAKNPTLELVGCYAWSGDKVG
FT                   KDVGELCGIEPLGVSATDDVDALLALKPDVVVYNPMWIDVDELVRILESGVNVVSTASF
FT                   ITGHNQGTGRDRIAEACTRGGSSMFGSGISPGYVNQLSVVAAGICDRVDKITVNEAADT
FT                   TFYDSPATEKPVGFGQPIDHPDLQAMTAQGTGVFGEAVRMIADALGIELDEVRCDAEYA
FT                   QTTEDLDLGSWTIPAGCVAGVYASWKGIVAGHTRVEINVRWRKGQTLQPDWKIDQDGWV
FT                   IEVAGRPTVTMKVGFLPPPDFEATTLEEFMVLGHIMTATPPLNAIPAVVAAPPGIVTYN
FT                   DLPLILPRGVVPTP"
FT   gene            636421..637101
FT                   /locus_tag="MSMEG_0561"
FT   CDS_pept        636421..637101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0561"
FT                   /product="putative TetR family protein receptor protein"
FT                   /note="identified by match to protein family HMM PF00440;
FT                   match to protein family HMM PF02909"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73103"
FT                   /db_xref="GOA:A0QPY4"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPY4"
FT                   /protein_id="ABK73103.1"
FT                   /translation="MTAGRAEDGARRRRRGRPRRIDRDQIVAAARQIAPESLTMQAVAD
FT                   ALGVDRTALHYYVGDRDGLLELVVADLFDAELGAIDLPADAAWQDVLRAYANAIHQGVL
FT                   KYGATRMNFRISGVGGAASLGLTERVLTTLTAVGFGIDDAGRILTLVSGLAMSAAHDVL
FT                   GAADSRLHHQMPEVARALQDFDADHFPLLGAVVARRTEASATDLDFNLGIVVAGLERML
FT                   ERGD"
FT   gene            637149..637904
FT                   /locus_tag="MSMEG_0563"
FT   CDS_pept        637149..637904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0563"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71850"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPY5"
FT                   /protein_id="ABK71850.1"
FT                   /translation="MALIPMPHVDVADEQVAAVLSRAVGPIGLILDAVADLDPLGLRRR
FT                   THYLGEGDGVVGTVLDRIACVLDCADIPGTRSWEGKDRAERIGWWVHGVGALDTVVVAF
FT                   PGVFGVVADRLPLQDLLGFTNQALVLCAVAREYGVTDHDTQVRMLAAVLCGRDLAQTPQ
FT                   AQTEDESGDMSLVQRVWHLAGILNAIGDELGRRPHPRAPFRYLGMLPWVGAVADYLGEY
FT                   GALVRAADAGQKWIAQHGAAADDRAPLRV"
FT   gene            complement(637893..638879)
FT                   /locus_tag="MSMEG_0562"
FT   CDS_pept        complement(637893..638879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0562"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05661"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72825"
FT                   /db_xref="GOA:A0QPY6"
FT                   /db_xref="InterPro:IPR008526"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPY6"
FT                   /protein_id="ABK72825.1"
FT                   /translation="MSAGLFGLLDDVAALARLAAASVDDIGAAAGRATAKAAGVVIDDT
FT                   AVTPQYVHGITAERELPIIKKIAIGSIRNKIVFILPAILLLSQFVPVLLTPILMVGATY
FT                   LCYEGAEKVWGWFPGHHGHDPHATPSAVTGADAEKSVVSGAIRTDLILSAEIMVIALNE
FT                   VASEAFLPRLAILVVVAFVITAGVYGVVAAIVKMDDIGLHLAQRSSRIARKIGRGLVAG
FT                   MPKLLSALATIGTVAMLWVGGHILLVGTDTLGWHSPYGVVHHLEEAVHHAVPGVGAVLA
FT                   WLVNTGISAVVGLVVGAIVVLVMHLLPFGKKDAKKDAKKDDKGASHA"
FT   gene            complement(638914..640326)
FT                   /locus_tag="MSMEG_0564"
FT   CDS_pept        complement(638914..640326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0564"
FT                   /product="xanthine/uracil permease"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM PF00916"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72060"
FT                   /db_xref="GOA:A0QPY7"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPY7"
FT                   /protein_id="ABK72060.1"
FT                   /translation="MNRLDRFFDITARGSTLTAEIRGGVVTFIAMAYIIVLNPVILSSA
FT                   PDVDGNNLEFAQVSAVTSLAAGVMTILFGLVARLPFAFAAGLGINSFLATTVVGSVTWP
FT                   EAMGLVVINGLIIVLLAATGLRRLVFDAVPMQLKLAITAGIGLFILFIGVVDAGFIGST
FT                   GLPSPPVGLGAGGEGSINTVPTVVFVFTLLVTGILVARRVRGGILIGLVAGTVVAVVIE
FT                   AIWHLGSAVEKPGGWGLSVPSLSGSPFAMPDLSLVGEVSLGSFSRIGALAAIMLVFTLV
FT                   FANFFDAMGTMTGLSREAGLSDPQGTFPRLKSALIVEGTGAVVGGASSASSNTVFIESG
FT                   AGIEEGARTGLANLITGVLFLAAMFVAPLASVVPTEVAAAALVVVGAMMVSHLRHIDLS
FT                   EFSVALPVVLTVATMAFSYSIANGIGVGFVAWVVLRSAAGKFREISPLLWVVALGFVLY
FT                   FARGWIESFIGM"
FT   gene            complement(640338..641435)
FT                   /locus_tag="MSMEG_0565"
FT   CDS_pept        complement(640338..641435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0565"
FT                   /product="putative glycosyl transferases group 1"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69577"
FT                   /db_xref="GOA:A0QPY8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR023986"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPY8"
FT                   /protein_id="ABK69577.1"
FT                   /translation="MMRVALLTYSTKPRGGVVHTLYLAEAMARLGVDVTVWSLARSGDR
FT                   GFFREINPAVTVRLVEFVDHPGDTVTDRILRSIETLRDAFTPADYDIVHAQDCISANAV
FT                   GPCIRTIHHLDQFKTPVLAECHEKAIAEPYARICVSAAVAAEVRAGWGFDPVVIPNGVD
FT                   AQRFSAAAAQEAGIRRWRDELGSYVLTVGGIEPRKGTLDLVEAYAMLRQRHPEVSLVIG
FT                   GGETLFDYRDYRSAFERRCTELGVEPVILGAVADDELPGLVAGCDVFAFPSTKEGFGLA
FT                   AMEALAAGRPVVTRDLPVLREVFGDTVGFAADPAGFAREMTAALEEPADPAPGRTLAAA
FT                   MTWTQAAKTHVNFYRTLRTQDGPHP"
FT   gene            complement(641432..642280)
FT                   /locus_tag="MSMEG_0566"
FT   CDS_pept        complement(641432..642280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0566"
FT                   /product="aliphatic amidase"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70485"
FT                   /db_xref="GOA:A0QPY9"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPY9"
FT                   /protein_id="ABK70485.1"
FT                   /translation="MAPVTLGAVAAHFGRDLDRGVTKVVGIIESAARDGVDFLVFPDAC
FT                   LGGYIGDFHRPDPDDPPPALTLDGPEIAAVVSAAGPMTVCVGYAESAPGGGRYNAAVCV
FT                   CGDGVLGTYRKVHQPVGESLTYLAGDTFSTFDTPVGRVGMLIDYDKTFPEAARTLAMGG
FT                   ADIIAALSVWPASVTDRASRLPADRQSRLFDLYDCARAAENQVVLVSSNQTGVMGNLRF
FT                   LGQAKVVGPGGDILATTRSKGGLAKVEIDVHAEITRARRVLNHLTELRPGSYHVASEAD
FT                   R"
FT   gene            complement(642290..643711)
FT                   /locus_tag="MSMEG_0567"
FT   CDS_pept        complement(642290..643711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0567"
FT                   /product="selenophosphate synthetase"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM PF02769"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70770"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011413"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023911"
FT                   /db_xref="InterPro:IPR024035"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPZ0"
FT                   /protein_id="ABK70770.1"
FT                   /translation="MIEFDVSTPSLPGDLSILAGSRPTAPFLIRPAENADDLASYRRLR
FT                   RDSFVVDQGMFSGSDHDDIDDDPRVVVLIAAAADGSVLGGVRLAPVGGVDLGWWTGSRL
FT                   VVDRSTRITGIGAALVRAACAYAESAGVLRFEATVQRRYQPMFTALGWDPLGDVEIAAR
FT                   PHVWMRRQINPFDALAAATKSFLGAALNPLRAVDGALGPAGFVGDDGSPVPGTDLVAAC
FT                   DAIIPSLVERDPEWAGWCSVLVNINDLSAMGATPTGLLDAVAAPTRAVLDRIIGGIAAA
FT                   SSAWAVPVLGGHTQLGVPAALSVTALGHTVSPVPAGGGVAGDRVRLTADTTGRWRRGYT
FT                   GRQWDSTTSRNSAELASMAGLVARMAPRAAKDVSMAGVVGTVGMLAEASGTGAELDVAT
FT                   IPRPASAGMAPWLTCFPGFGMLTVGGALGSAAVPAGVASSECGSLTAEPGVRLRWPDGV
FT                   TTTALTSPVTGLGKA"
FT   gene            complement(643711..644760)
FT                   /locus_tag="MSMEG_0568"
FT   CDS_pept        complement(643711..644760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0568"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71776"
FT                   /db_xref="GOA:A0QPZ1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016779"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPZ1"
FT                   /protein_id="ABK71776.1"
FT                   /translation="MSTRVDLALLGFRGRPPVHRNAGAGPSADGHLVIDGLNAAIPRNP
FT                   LSPFVFDGTRVLLDGEDTGLDVEVIDRPRFYDLTTGDGVPYEKLARLHGRNVLATTVVQ
FT                   TCIRYSPDQRCRFCTIEESLRSGATTAVKRPAELAEVAAAAVRLDGVTQMVMTTGTSAG
FT                   TDRGARHLARCVRAVKAAVPALPIQVQCEPPADLAVLSELRAAGADAIGIHVESLDDEV
FT                   RSRWMPGKATVALDAYRAAWREAVRVFGRNQVSTYLLVGLGENPDELVAGAGELIDMGV
FT                   YPFVVPFRPQSGSLATDVDGAIAPDSGLVEKVSRAVADLLRQAGMSGADQRAGCAACGA
FT                   CSVLQNLGA"
FT   gene            complement(644774..646045)
FT                   /locus_tag="MSMEG_0569"
FT   CDS_pept        complement(644774..646045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0569"
FT                   /product="flavoprotein involved in K+ transport"
FT                   /note="identified by match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74414"
FT                   /db_xref="InterPro:IPR024000"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPZ2"
FT                   /protein_id="ABK74414.1"
FT                   /translation="MTTHVPVAVIGGGQAGLSVSWYLVRAGIEHIVIESKTPMHAWADT
FT                   RWDNFTLVTPNWHCRLPGYPYAGPDPDGFMTRDEVVDWLAGWLDTFDPPLRNHTQVTRL
FT                   QNRAGGGFEVTLRDESGQSTLTCDHAVIATGGYPVPVIPSYAAQLDETILQIHSEQYRN
FT                   AGTLPDGAVLVVGTGQSGAQIAEDLHLAGRRVHLAVGGAPRVARFYRGRDCMTWLADMG
FT                   VYDRPAQQYPGGQAAIEKTNHYVTGRDGGRDVDLRQFATEGMRLYGTLADGKDSTLRFE
FT                   PTLAEALDHADSVYNSICSDIDAHIERNGIDAPPASRYEPVWKPETETTTLDLAAAGIT
FT                   SIVWAIGYRPDYRWIAASAFDGAGRPMQTRGITNVAGLSFVGLPWMHTWGSGRFLGIDR
FT                   DARHIAATIISSYHESVLRLAMKV"
FT   gene            complement(646042..646338)
FT                   /locus_tag="MSMEG_0570"
FT   CDS_pept        complement(646042..646338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75524"
FT                   /db_xref="InterPro:IPR023846"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPZ3"
FT                   /protein_id="ABK75524.1"
FT                   /translation="MPEMTFEVRWPDGSTQRCYSPSLVIHDHLTAGTHYAVDDFVERSS
FT                   RALAEASERVRAKYGFACTSAAETRQRIVNVARRFSGDAVLEVVAMHPEPGPS"
FT   gene            complement(646331..647233)
FT                   /locus_tag="MSMEG_0571"
FT   CDS_pept        complement(646331..647233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0571"
FT                   /product="hydrolase, carbon-nitrogen family protein"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74129"
FT                   /db_xref="GOA:A0QPZ4"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPZ4"
FT                   /protein_id="ABK74129.1"
FT                   /translation="MMTTLAAVSANFTRDLEQNFALIADLAEQAREKGVDFLVLPEAAI
FT                   GGYLSSLGNHGDTVRATSRSLPPAIRLDGPEIARVQQIVGDLVVAIGFCELADDGETRY
FT                   NAAAVLDRFDVYGSYRKVHQPLGEGMSYSAGSDYGVFDTPVGRVGLQICYDKAFPEAAR
FT                   LMALGGAQIIASLSAWPAARTATAQNLQDDRWTYRFNLFDMARALDNQVFWVASNQSGS
FT                   FGSLRYVGNAKVVDPGGNVLATTLLDSGMAVAEVDIDETFRTMRAGMFHLRDRRPDVYA
FT                   PLTDSDGPRTAKWRELAHA"
FT   gene            complement(647243..647764)
FT                   /locus_tag="MSMEG_0572"
FT   CDS_pept        complement(647243..647764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0572"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69987"
FT                   /db_xref="InterPro:IPR023847"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPZ5"
FT                   /protein_id="ABK69987.1"
FT                   /translation="MPFDESITENIKSSLAEIPHPALPKGSSIYGGTKIFPDYQAEDGE
FT                   SYFTLVHGIAHESSVAFVAVLQATRALRKGFESAIYFYGPGSINCLATRGFPKTGDSGF
FT                   PGEQNINDALATFIKEGGTVFCCRFGLGLHGGREEDLIEGVIPAHPLDVQDALIYYARK
FT                   GAIINSTYMV"
FT   gene            648080..648733
FT                   /locus_tag="MSMEG_0574"
FT   CDS_pept        648080..648733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0574"
FT                   /product="putative ECF sigma factor RpoE1"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72641"
FT                   /db_xref="GOA:A0QPZ6"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPZ6"
FT                   /protein_id="ABK72641.1"
FT                   /translation="MKEFTPHRQWQERVMAVTAEAQVTDHGSSAERFERDALPLLDQLY
FT                   GVARRYTRNQADAEDLVQETMVKAYGSFHTYRDGTNIRAWLFKILTNTWINAYHTAQRR
FT                   PDVVVTDTISDAQLAAVATRSETELASAELAALESMGDSEVRDAVAALPEHQRMAVYYA
FT                   DVVGMRYQEIADVLGVPVGTVMSRLHRGRRRLREHLIGFAYQSGYLARPAGSAA"
FT   gene            complement(648700..649296)
FT                   /locus_tag="MSMEG_0573"
FT   CDS_pept        complement(648700..649296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0573"
FT                   /product="putative ECF sigma factor RpoE1"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72319"
FT                   /db_xref="GOA:A0QPZ7"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPZ7"
FT                   /protein_id="ABK72319.1"
FT                   /translation="MRIDNVHSSAASARDATEFIATALPFVEAIERGARRLTTNRYDAE
FT                   DLVQETLLKAYNGFHTFEGGTNMQAWLFRIMRNTWISNFRAQQRNPVEQLCEDFTDAQL
FT                   SAGLRHGADGARSAENEALAHLPDDAVLEALRAIPQANRMVVYYADVEGYPYREIATLM
FT                   DTPIGTVMSRLARGRARLRVLLADHQAALPAGRAR"
FT   gene            649562..649978
FT                   /locus_tag="MSMEG_0575"
FT   CDS_pept        649562..649978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0575"
FT                   /product="MmpS1 protein"
FT                   /note="identified by match to protein family HMM PF05423"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74632"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPZ8"
FT                   /protein_id="ABK74632.1"
FT                   /translation="MLKQAWIPLVLAVVLPVSGLVVWRLHEKFGSEDLNANAGAGIEIV
FT                   QFNPKILVYEVYGPPGSTAQISYFDTDANVHSVNTTLPWSVTLSTTLPTVSANLMALGS
FT                   NDEIGCRVTVNGIVREEKSANGIDAQTYCLVKSA"
FT   gene            649975..652866
FT                   /locus_tag="MSMEG_0576"
FT   CDS_pept        649975..652866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0576"
FT                   /product="MmpL4 protein"
FT                   /note="identified by match to protein family HMM PF03176;
FT                   match to protein family HMM TIGR00833"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73756"
FT                   /db_xref="GOA:A0QPZ9"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A0QPZ9"
FT                   /protein_id="ABK73756.1"
FT                   /translation="MIQGLHNRSDSRPLLPHALRVLAIPVILFWVAFAAVVNIIAPQLE
FT                   IVGEEHSAPMAPEDAPSLTGMHRMGGNFQEFDSNSTVMVVIEGQEPLGPDAHAYYDEII
FT                   RKLRQDPEHIQHIQDFWGDTLTAAGAQSADGKAAYVMLNLAGEQGQTLANDGVQEVRQV
FT                   IADTPAPPGVQAYAAGPAALTDDLHVIGNASLGKITLFTLVAIAVMLLIVYRSIVTTLI
FT                   QLVLTGVGLLASRGLISVLATHDVFGLTTFAGNILTMLAIAAATDYGIFLFGRYREARG
FT                   AGEDPETAYYTTFKSVSPVIVGSGLTIAGATYCLSFARLPYFSTMGAPVAIGMIVVVAS
FT                   SVTMGPAVLFLGSKVGLYEAKRAAKGRFWRRVGTAVVRWPAPILVASAFIVLIGVVAVP
FT                   GYRPAYNDRWYLPDDAPVNIGFAAADRHFTQARMNPDILMVEADHDMRNPADMLVLDRV
FT                   AKNVLRTQGIAMVQSITRPLGIPIQHSSIPFQTAIQGQTSNLNLPFQRAQLDNQLKMVE
FT                   ATNQSIAIMEKQYELSLRQTKLTQDSAEKSRELLEVTKQLRDNIANFDDQFRPLRNYFY
FT                   WEPHCFDIPMCAAARSLFDSLDTVDELTDRTSAVQVNTDELADLAPQLTALLPQTIASM
FT                   KTSRDLSLASYNSQKALLDQMQAMNDTALAMGQSFDEAKNDDFFYLPPEAFQNPDFERG
FT                   LKMFLSPDGKSARMFITHQSDPATPEGIARVNAERTAAQEGLKMSSLSDAKIFLGGTAA
FT                   TYKDMSDGARYDLMIAVVSALTLIFMIMLILTRSAVAALVIVGTAASSIAASFGISVLL
FT                   WQDLFGVEVHWLVMLMSVIILLAVGSDYNLLLVSRFKDEIHAGLKTGIIRSMAGTGGVV
FT                   TSAGLVFAATMAAMLGSELVVLAQMGSTIAIGLLLDTLIVRSLLMPSIATLLGRWFWWP
FT                   QVVYPRGDNHFRRPTAVSRGTGDEDTAALPVPS"
FT   gene            652908..654131
FT                   /locus_tag="MSMEG_0577"
FT   CDS_pept        652908..654131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0577"
FT                   /product="major facilitator superfamily protein, putative"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABK76167"
FT                   /db_xref="GOA:A0QQ00"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ00"
FT                   /protein_id="ABK76167.1"
FT                   /translation="MEMAYLGELRTHWQALTAATAGLSAGLALSAYTNAAMGPQFLAAF
FT                   GWERSDFALTGVITLLTFVFLPVYGRLTDLFGVRRIAVVGVAGLPVCWLGYALMSGPIW
FT                   QYFAINVAVIALGVTTTPAIYSRVVATRFDRARGLALAIAISGPPLLGAVSAPVVAAVN
FT                   RIFGWRAGCVAIAVMIAVIGVVALLLMPADQARPPRERRTGDYRMIAGTPVFWILLAGV
FT                   LLCNLYHSVTTSQLGVMLDDSGAGDRIALLVTVFATSVIVGRFVCGVALDRLPPQAVAA
FT                   VAMALPGLGCLLVASSWDGFGVLVIAVCCLGAAWGAEGDVIAYLVARRFSLSVYSTVLG
FT                   ILSALIGVSSALGALILSRMLAESDSFNGFLLVAGSAAVIGGTLFLLVRPQRKASGAAL
FT                   QKPAKMSR"
FT   gene            654135..655271
FT                   /locus_tag="MSMEG_0578"
FT   CDS_pept        654135..655271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0578"
FT                   /product="acyl-CoA dehydrogenase, middle domain protein"
FT                   /note="identified by match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71672"
FT                   /db_xref="GOA:A0QQ01"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ01"
FT                   /protein_id="ABK71672.1"
FT                   /translation="MDFSRVELSDEDTRFRDELRAFLAEIVTDEVIRRDRETGENFDES
FT                   VHLALGGAGYLAADYRCADDGGFSAVRRRIWELEIGRAHTPWFHWGTTAMAAHTVEKFG
FT                   TPELVEEVLPGVLSGRVRICLGYTEPEGGSDVATCKTRAVRDGDAWIINGSKMFTSNAH
FT                   NAQYVFLVTNTDPEAPKHNSLTMFLVPLGTPGVEIQGIRTVDGDRTNITYYSDVRVSDR
FT                   YRVGDVNGGWGVLRGALDVEHGTFERDTHGLQKIATMTEHITLMAEALDLVAAQAPGDG
FT                   ASRFRLGRGIACTEAAMSTPDMYGRVAIAQTMRDVTPDLMDILGPAGALTDGVEYIFRL
FT                   AGPTGIYGGTLEVFRNMIAQHGLGLGKPNYAQPVKKVS"
FT   gene            655294..656088
FT                   /locus_tag="MSMEG_0580"
FT   CDS_pept        655294..656088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75437"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ02"
FT                   /protein_id="ABK75437.1"
FT                   /translation="MSVFDKAIDLQPAGDGHFQGSTVPEWANMVGPFGGITAAALIRAI
FT                   QLHPQCHGQPIALTVNYVAPIADGDFDVDTKLVRTNRSNQHWIVEQSQGGEVKTTATAV
FT                   FGLRRDTWSDAEATPPTAPEPDGLEQAASPLTWFANYDIRYVDGAVPAAEGPGSDSSTT
FT                   TLWVRNNPARPLDFAALTAVGDIFFPRVFLRRGQFLPAGTVTLTIYYHANAAQIDSAGD
FT                   DFVLGTARAHQFTRGYFDQTAHLWSRDGVPLATSHQYVYFKG"
FT   gene            complement(656078..657565)
FT                   /locus_tag="MSMEG_0579"
FT   CDS_pept        complement(656078..657565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0579"
FT                   /product="helix-turn-helix, Fis-type"
FT                   /note="identified by match to protein family HMM PF02954;
FT                   match to protein family HMM PF07905"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75624"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ03"
FT                   /protein_id="ABK75624.1"
FT                   /translation="MVSVSEVVGVRALGLRGVLMGRGDADIRWVATSELPDPTPFLEGG
FT                   EILLTTGIETRTWGREWDDYVRRLAGAAVAAVGFGIGLTHERTPTALIAACREHDVNLF
FT                   EVPRRTTFVAISREVARLLSEQESAATQAALQTQRKLISAATKRHPATAVITALAQALD
FT                   GAACLMSPDGRALTGPVGPRRGEFPFDDAAADVRRLQTQAGRSAATQSRPALSLSVQPI
FT                   GLRGRPAAYLATMGPVRLSDAERDALTTSVAVLGLVDEQRRSRSTTRQHLHSRAIELLA
FT                   GNDSRTAQLILEVDAPALVIPERIRFLRATGGDSEITDAVTALERRGILAGTYADELCT
FT                   VAVPERAEAAGESMVDAGLQVGVGAAVPSDDGASGYRTAGLALAQTTPTAALVVWDRVV
FT                   NDGPLGLIDPQRAAAFAESWLSGLDSEQLETLRCFLRHHGSRLKVAEELGLHRNTVRNR
FT                   LDAIEALLPGRLDDPQTRVSAWIALQSLPPENRPVSP"
FT   gene            657676..659022
FT                   /gene="gabT"
FT                   /locus_tag="MSMEG_0581"
FT   CDS_pept        657676..659022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="MSMEG_0581"
FT                   /product="4-aminobutyrate transaminase"
FT                   /EC_number="2.6.1.19"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00700"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69652"
FT                   /db_xref="GOA:A0QQ04"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="PDB:3Q8N"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ04"
FT                   /protein_id="ABK69652.1"
FT                   /translation="MTIAEIAGRTLTQERRLVTAIPGPISQELQARKQSAVAAGVGVTL
FT                   PVYVVAAGGGVLADADGNQLIDFGSGIAVTTVGNSAPAVVDAVTQQVAAFTHTCFMVTP
FT                   YEGYVKVAEHLNRLTPGDHEKRTALFNSGAEAVENAVKIARAYTRRQAVVVFDHAYHGR
FT                   TNLTMAMTAKNQPYKHGFGPFANEVYRVPTSYPFRDGETDGAAAAAHALDLINKQVGAD
FT                   NVAAVVIEPVHGEGGFVVPAPGFLGALQKWCTDNGAVFVADEVQTGFARTGALFACEHE
FT                   NVVPDLIVTAKGIAGGLPLSAVTGRAEIMDGPQSGGLGGTYGGNPLACAAALAVIDTIE
FT                   RENLVARARAIGETMLSRLGALAAADPRIGEVRGRGAMIAVELVKPGTTEPDADLTKRV
FT                   AAAAHAQGLVVLTCGTYGNVLRFLPPLSMPDHLLDEGLDILAAVFAEVK"
FT   gene            659025..660479
FT                   /locus_tag="MSMEG_0582"
FT   CDS_pept        659025..660479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0582"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72728"
FT                   /db_xref="GOA:A0QQ05"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ05"
FT                   /protein_id="ABK72728.1"
FT                   /translation="MNYQDAIAGLDAKHGILIDGNARGADATFDVHDPATGEVIAAVSD
FT                   GSAADAVAAVDAAQKAFGAWAATSPRERSEILRRAYELILADIDRLSALVCAENGKSQA
FT                   DARAEVTYAAEFFRWFSEEAVRTDGAFGSNPAGNARTLVTHKPVGVAALVTPWNFPAAM
FT                   ATRKIAPALAAGCTVVLKPAAETPLTALAIAAILTDAGVPAGVVNLVPTSDAGAVVSAW
FT                   LADARVRKISFTGSTGIGRVLLKQAADRVVNASMELGGNAPFVVTADADIAKAVEGAML
FT                   AKFRGAGQVCTAANRFYVHASVHDEFVAAFAAKIEALRVGPAADPASEIGPLVSPRAAQ
FT                   RVSAAIDAAVADGAVVAAKAPTPTEGWFVAPTLLTDVAPDAAILTDEIFGPVAPVVAWE
FT                   DEDELLRWANDTEYGLAAYVFAGRLQDALRIAERIDAGMVGVNRGAVSDPSAPFGGMKQ
FT                   SGLGREGAREGLQEFQETQYFSVAFD"
FT   gene            complement(660492..660752)
FT                   /locus_tag="MSMEG_0583"
FT   CDS_pept        complement(660492..660752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0583"
FT                   /product="probable membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70789"
FT                   /db_xref="GOA:A0QQ06"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ06"
FT                   /protein_id="ABK70789.1"
FT                   /translation="MGVGIAATRLRELADGAPAAAGELADVEFAFVATELRHDEQLARI
FT                   RRGKRACVSCLITVAVGVLMIVSLISMVLLLFSLILHSTPY"
FT   gene            complement(660999..662471)
FT                   /locus_tag="MSMEG_0584"
FT   CDS_pept        complement(660999..662471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0584"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73678"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ07"
FT                   /protein_id="ABK73678.1"
FT                   /translation="MAERPAAPPAPSLTTAVDRTLRPGPRALRQHRRHARDRAETGPLP
FT                   AGILRNTAKWLSDITSDSGFVCLFSIRRRNPQFSGDRAHVLEFPDSVPVQPQLHEHHLG
FT                   VLGGLRGARGLQRFMVELHGSAHHAERFAAVGRLDLDDHVVGDGLLVGRQVDQALERRP
FT                   LSLHGLEVPAPVLERPAADRLGDALGGLCGVLDERQHVAEPRIVGEFGQAEMLESVPDV
FT                   AGGAHDAQVDGAAVGRLVVPQERVDRGPDRVGHLGTHGLAGLHALRDARARGPPRGGQQ
FT                   GHVDLERLARAVAVEQRRGDPARDVHPADRVAERGDPLRQRAAEFLGCQGVPHTAAGPE
FT                   RGAVEPAGEPLGPLVAVRAAARVDDVRVHRPDVLDVELVLLPGLRHVVGEEDIRHLRQL
FT                   VEHLLPLGLGHVDADAALAAVGMLDQRMPVGVELEPAHVDEAPLGVAPHRMLNLDHVGA
FT                   PVGEDRSGRGNERELRDLQHPYTLHDLDQGGP"
FT   gene            661011..662237
FT                   /locus_tag="MSMEG_0585"
FT   CDS_pept        661011..662237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0585"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75597"
FT                   /db_xref="GOA:A0QQ08"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ08"
FT                   /protein_id="ABK75597.1"
FT                   /translation="MIKVMQGVRVLEVAQFTFVPAAGAILADWGADVIKVEHPVRGDTQ
FT                   RGFINMGGFQLDPNRHPLIEHPNRGKRSVGIDVSKPEGQEVLYELAQVSDVFLTNYMPQ
FT                   AREKNKFDVEHIRAVNPNIIYARGSAYGDKGPERLAGGFDGTAFWTRSGVGHALTPEEL
FT                   GGALSQGIPAFGDSIGGMNIAGGIAAALFHRDRTGEALEVDVSLLSTAWWAAGASVTQG
FT                   METGETMRSQMPDTIGPTVNPFLGNYQTSDGGTINLCIVSPTGYIRDTFEHLGLAELAD
FT                   DPRFCDVLPLIEHAAEAAERIAEAIRSRPFEYWRRHLKTMKGQWAPFQSLVDLATDEQA
FT                   IANDMVVEVEAADGGEPFRVVRGPVQFNHEPLETTRAPQASEHTEVVLMELGLDWDRIG
FT                   KLKDVGAIA"
FT   gene            complement(662508..662897)
FT                   /locus_tag="MSMEG_0586"
FT   CDS_pept        complement(662508..662897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0586"
FT                   /product="stas domain, putative"
FT                   /note="identified by match to protein family HMM PF01740"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71446"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ09"
FT                   /protein_id="ABK71446.1"
FT                   /translation="MVCDGASMRAHHRQLATVVTVKGAIGSENLDQISAYVRRLVIPEK
FT                   SIVLDLSGVNSFAPQAVSLFYAIDARCGELGVDWAVVASGAVLAELDDDDAGVPLTASV
FT                   PDALHHFAEGTMARRRLLPLLVKSA"
FT   gene            663229..663549
FT                   /gene="rhaU"
FT                   /locus_tag="MSMEG_0587"
FT   CDS_pept        663229..663549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaU"
FT                   /locus_tag="MSMEG_0587"
FT                   /product="L-rhamnose 1-epimerase"
FT                   /EC_number="5.1.3.-"
FT                   /note="identified by match to protein family HMM PF05336"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75129"
FT                   /db_xref="GOA:A0QQ10"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ10"
FT                   /protein_id="ABK75129.1"
FT                   /translation="MQRVCFVLQLRPERMDEYLTAHEQVWPEMLEALSEAGWHNYSLFV
FT                   RESDGLVVGYLETDDFASAQKRMAETDVNARWQANMAEFFVSDGSNPDQLMTPLFEYFH
FT                   LA"
FT   gene            663590..664921
FT                   /locus_tag="MSMEG_0588"
FT   CDS_pept        663590..664921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0588"
FT                   /product="putative rhamnose tranport protein, MFS family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69896"
FT                   /db_xref="GOA:A0QQ11"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ11"
FT                   /protein_id="ABK69896.1"
FT                   /translation="MKLGARSTTGWRATIAVAMSNYIEAGSIIAIATSLGFWQTAFGIS
FT                   NFAVGLLAALSANAFGAAIGAILGGPLCDRFGRKAIYTYDLLVYMAGVLLAACAVNYAM
FT                   LLAAFIITGIAVGAGVPASWTYIAEQAPSVERAKHVGTAQLAWSVGPLIGFALAAALAP
FT                   LGLLGSRLIFIHLFVVAGVVWWVRQGLAESQIWTDEAKNETQAETKAVASAVGLRGLRG
FT                   LFSKRVNITALLFLGGIYLFWNTVAGQAGIFMPRVYDTAGLHSPVAQNLLQVLVWGCTV
FT                   AATYFGFMRYADRVSQRLLYVGGAALGIVGWIVLVAFTDGGVPTMLAFAVLWGVSAGIG
FT                   AQAFYSLWASELFATPYRASAQGVMFFVVRTMTGVLSYFFPTLLAVTGLTAVGVLLVVL
FT                   LTIAMLIGAFGAPATRGKTLREIEVERYGAPVSPTAEDKERTPA"
FT   gene            664918..666081
FT                   /gene="rhaI"
FT                   /locus_tag="MSMEG_0589"
FT   CDS_pept        664918..666081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaI"
FT                   /locus_tag="MSMEG_0589"
FT                   /product="L-rhamnose isomerase"
FT                   /EC_number="5.3.1.14"
FT                   /note="identified by match to protein family HMM TIGR02635"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABK76014"
FT                   /db_xref="GOA:A0QQ12"
FT                   /db_xref="InterPro:IPR009308"
FT                   /db_xref="InterPro:IPR013457"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ12"
FT                   /protein_id="ABK76014.1"
FT                   /translation="MSAINVHPALDNLAIELPSWAFGNSGTRFKVFGTPGTPRTVEEKI
FT                   ADAAMVHRMTGLAPRVALHIPWDTVDDYAALGVYAREQGVELGTINSNTFQDDDYKFGS
FT                   LTHTDKGVRQKAIDHHLACIEIMNQTGSRDLKIWLADGTNYPGQGDIRGRQDRLAESLA
FT                   AIYQHIGPDQRMVLEYKFFEPAMYMTDVPDWGTAYAQVSALGERAVVCLDTGHHAPGTN
FT                   IEFIVAQLLRLGKLGSFDFNSRFYADDDLIVGAADPFQLFRILFEVIRGGGLDPSSGVA
FT                   LMLDQCHNVEAKIPGQIRSVLNVAEMTARALLVDTEALAEAQENGDVLGANGIFMDAFY
FT                   TDVRPALAKWRVDRGLPGDPMAAYAASGYQDTINAERVGGTQSSWGA"
FT   gene            666069..668123
FT                   /gene="rhaD"
FT                   /locus_tag="MSMEG_0590"
FT   CDS_pept        666069..668123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaD"
FT                   /locus_tag="MSMEG_0590"
FT                   /product="rhamnulose-1-phosphate aldolase/alcohol
FT                   dehydrogenase"
FT                   /EC_number="4.1.2.19"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF00596; match to protein
FT                   family HMM TIGR02632"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73634"
FT                   /db_xref="GOA:A0QQ13"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013454"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ13"
FT                   /protein_id="ABK73634.1"
FT                   /translation="MGSMSMNAEQTVAELIARSNRLGSDPKNTNYAGGNTSAKGTDTDP
FT                   VTGQPVELLWVKGSGGDLGTLTENGLAVLRLDRMRALVDVYPGVEREDEMVAAFDYCLH
FT                   GRGGAAPSIDTAMHGLVDAAHVDHLHPDSGIALATAADGEALTKQIFGDRVVWVPWRRP
FT                   GFQLGLDIADIKRRNPQAIGTILGGHGITAWGSTSAEAEAHSLEIIETAERYIAENGRP
FT                   EPFGAPLAGYGALPDDARRAKAAQLAPFIRGLVSTDRPQVGHFTDDPRVLEFLSASEHP
FT                   RLAALGTSCPDHFLRTKVKPLVLDLPADATVDECKNRLAELHEAYRVDYQAYYDRHATP
FT                   DSPAIRGADPAIVLIPGVGMFSYGKDKQTARVAGEFYLNAINVMRGAEAISTYAPIDEA
FT                   EKFRIEYWALEEAKLQRMPKPKPLATRIALVTGAASGIGKAIATRLAAEGACVVIADLD
FT                   GAKAESAAAEIGNTDVAVGIAADVTDEAAVQAAVDATVLAFGGIDIVVNNAGLSLSKSL
FT                   LDTTAEDWDLQHNVMARGSFLVSKAAARALIEQKLGGDIIYISSKNSVFAGPNNIAYSA
FT                   TKADQAHQVRLLAAELGEHGVKVNGINPDGVVRGSGIFAGGWGAKRAAVYGVPEEELGK
FT                   YYAQRTLLKREVLPEHVANAAFALCTSDFSHTTGLHVPVDAGVAAAFLR"
FT   gene            668184..669641
FT                   /gene="rhaB"
FT                   /locus_tag="MSMEG_0591"
FT   CDS_pept        668184..669641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaB"
FT                   /locus_tag="MSMEG_0591"
FT                   /product="rhamnulokinase"
FT                   /EC_number="2.7.1.5"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM PF02782"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75860"
FT                   /db_xref="GOA:A0QQ14"
FT                   /db_xref="InterPro:IPR013449"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ14"
FT                   /protein_id="ABK75860.1"
FT                   /translation="MSAIQVAAVDLGATSGRVMVADIDGDRLDMRTVARFPNDPVTLWN
FT                   GTGDELRWNVPTLYGHVIDGLTRAGRDCDSLVGVGVDSWAVDYGLLREGRLLSLPMHYR
FT                   DARTARGVELVHDVLDAPELYRRNGIQFLPFNTVYQLAAERASGLLDLADTVLLVPDLL
FT                   TYWLTGQRVAERTNASTTGLLALDGTWDRDLMTRLDLPHTLFPPIVEAGSRRGPLLPSV
FT                   ARQIGLTGKAGAEVVSVASHDTASAVAAIPMDPDHAAYISCGTWGLVGVELGRQVATDA
FT                   AREANFTNEVGADQRIRFLHNVMGLWLLSETLRQYERDGHDVDLADLLAGAAQAPAPPV
FT                   VFDTDDPRFLPPGDLPARISAWYVERGHTPPADPVQMVRAILESLAAAFASAVCTAAEL
FT                   SGVDVRTVHMVGGGSQNELLCQLTADRIGMPLLAGPVEATALGNVLLTARARHVISGDL
FT                   ASLRARVAQWFPPRRYLPRTSRTTAMV"
FT   gene            669649..670650
FT                   /locus_tag="MSMEG_0592"
FT   CDS_pept        669649..670650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0592"
FT                   /product="putative rhamnose catabolism operon
FT                   transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71795"
FT                   /db_xref="GOA:A0QQ15"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ15"
FT                   /protein_id="ABK71795.1"
FT                   /translation="MVSMREVAAAASVSVGTVSNVLNAPDKVAPATVARVQAAIDKLGF
FT                   VRNDAARQLKAGRSRSVGLVVLDIGNPFFTDIARAAERRAGEHNLTVLLGTSDDDATRE
FT                   RAYVDAFDEQRVYGLLVSPVGEDLNRLVALRERGTPVVLVDRDGGGTPFDSVAVDDVAG
FT                   GCLAVQHLCATGRRKIAFVGGPGTLRQIRDRRRGAADAVGRTPGATLEIIDTDAPSVLA
FT                   GRAVGEQLRRRARQDRPDAVFCANDLLAIGVLQALSLTGDLRVPDDMALVGYDDIDFAR
FT                   SAVVPLTSVRQPTGEIGTTAVDLLIGAAEDATGRNPEHVVFQPELVVRDSTS"
FT   gene            complement(670737..671384)
FT                   /locus_tag="MSMEG_0593"
FT   CDS_pept        complement(670737..671384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02589"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73015"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ16"
FT                   /protein_id="ABK73015.1"
FT                   /translation="MVEPHARGRFAMTGTDGRAAVLGRIRSALAAVPPQPVTVPREYHR
FT                   EPLSGPADVERFAEAVAEYRARVHRVAASDIAGLVRELTGSDATVVVPPDVPAEWITGV
FT                   RILSDDPVLTVEQLDAADAVLTGCAVGIAATGTIVLDAGATQGRRALTLVPDHHICVVR
FT                   TDQIVDIVPQGFAALGTERPLTFISGPSATSDIELERVEGVHGPRTLDVLIL"
FT   gene            complement(671348..672817)
FT                   /locus_tag="MSMEG_0594"
FT   CDS_pept        complement(671348..672817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0594"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /note="identified by match to protein family HMM TIGR00273"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75442"
FT                   /db_xref="GOA:A0QQ17"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ17"
FT                   /protein_id="ABK75442.1"
FT                   /translation="MSTTFLGSPGLGNLRGDESFPHAARGALANSQLRRNIGHATQTIR
FT                   GKRLRAVAECDDWEDLRAAGSALKQDVMARLPELLEQLESNVTARGGVVHWARDADEAN
FT                   RIVTDLIRATGSDEVVKVKSMATQEIGLNEHLEAQGIAAFETDLAELIVQLGHDKPSHI
FT                   LVPAIHRNRSEIREIFSREMPDAGELSDDPRVLAMAARAHLRRKFLTARVAISGANFGV
FT                   AETGTLAVVESEGNGRMCLTLPETLITVMGIEKIVPTFADLEVFMQLLPRSSTAERMNP
FT                   YTSMWTGVHPGDGPQEFHLVLLDNGRTRVLADEVGRAALHCIRCSACLNVCPVYERTGG
FT                   HAYGSVYPGPIGAILSPQLTGTTGHDDPNASLPYASSLCGACFEACPVRIDIPSILVHL
FT                   RAQQVDSERGGLPGGQDIAMKAAGWAMSDAKRFSLAEKALAAGRVIAGKDHRISTLPWP
FT                   ASKWTSSRDLPEPPKETFRQWWNRTHEGGSR"
FT   gene            complement(672814..673551)
FT                   /locus_tag="MSMEG_0595"
FT   CDS_pept        complement(672814..673551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0595"
FT                   /product="glycolate oxidase"
FT                   /note="identified by match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69602"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ18"
FT                   /protein_id="ABK69602.1"
FT                   /translation="MRIALFATCLADALFPPAAIATVQLLERLGHEVVFPSQQTCCGQM
FT                   HINTGYFKEAVAVVRNHVESFESARCDAVVAPSGSCVGSVRHQHAMVARRAGDEDLAVR
FT                   AEKIAERTYELSEFLVDVLGVDDVGAYYPHRVTYHPTCHSLRMLGVGDKPLRLLRNVRG
FT                   LTLVELPAAESCCGFGGTFALKNSDTSTAMLADKMTHILETGAEVCSAGDSSCLMHIGG
FT                   GLSRLRSGVRTVHLAEILAGAEA"
FT   gene            673641..674327
FT                   /locus_tag="MSMEG_0596"
FT   CDS_pept        673641..674327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0596"
FT                   /product="bacterial regulatory protein, GntR family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74264"
FT                   /db_xref="GOA:A0QQ19"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ19"
FT                   /protein_id="ABK74264.1"
FT                   /translation="MRAHELVLERIERDLVAGAITVGDRLPPERALAESLSVSRASVRE
FT                   AIRVLEAMGVIRTAAGSGPDAGAIVTADAATSIGSALRLHTATRALPIEDLVSTRILLE
FT                   ASALRDAAALSPRPDLAGINARLDAMDDPDLGPEEFHRLDAEFHVALTALAGNVVVEAM
FT                   MAALRGAIQGYILAGVPRLADWGGVAANLRCEHRRIVTALSRGQGNKAAELARAHIEGY
FT                   VDLIKS"
FT   gene            674388..674783
FT                   /locus_tag="MSMEG_0598"
FT   CDS_pept        674388..674783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0598"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71072"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ20"
FT                   /protein_id="ABK71072.1"
FT                   /translation="MAAVVPACTSPERQPEMQESPERAVHRHIAAAKTGDVATLRSGAC
FT                   GRLASVIRPRSDAEIRDEFIALYEVGPDVLSVDSEEDGPQRIVTGYYSEVADLDISFIV
FT                   EDHGGWKVCEIRRGNGVFGPLPGPFED"
FT   gene            complement(674780..676060)
FT                   /locus_tag="MSMEG_0597"
FT   CDS_pept        complement(674780..676060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0597"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72575"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ21"
FT                   /protein_id="ABK72575.1"
FT                   /translation="MTTIAVAGSHYDVMMAGALTLELDGLTVSVTNPDKVIFPEYDGRA
FT                   AVTKLDLVNYYRAVADGALRGVFGRPMILKRFVKGIATEAIFQKRAPEKRPDFIEVAEL
FT                   KYRSGTSAKEAVLRNTAGLAWAVNLGCVDLNPHPVRADDLDHPDELRVDLDPMPGVEWQ
FT                   QILDVAMVAREVLSDHGLTAWPKTSGSRGFHIYARISRDWPYAKVRLAAQTVAREVERR
FT                   APDLATAHWWKEEREGVFVDFNQNAKDRTVASAYSVRATPDARVSTPLRWDEVPTCRPE
FT                   EFTIATVPDRFAEIGDPWEGMDTAVGGLDGLLALAEELGPAEKAPKGASRDGRRASTMP
FT                   LIEIARTKTKDEAMAALDIWRERYPEVSKKLEPVDILVDGMRGPSSIWYRIRINLQHVP
FT                   EGERPPQEELIADYSPWENYSGAQWRR"
FT   gene            676104..677750
FT                   /locus_tag="MSMEG_0599"
FT   CDS_pept        676104..677750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0599"
FT                   /product="acyl-CoA synthase"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75979"
FT                   /db_xref="GOA:A0QQ22"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ22"
FT                   /protein_id="ABK75979.1"
FT                   /translation="MTAKAKEYAERGVAELHYARKMFEAGALRLEPPQHMLALVADIRT
FT                   WGEIGMIPALNARRHPNRVAVIDDEGEFTFGELDAAAHALANELLARGVRGGDGVGILA
FT                   RNHRWFLVSLYGAARVGARIIMLNTEFSGPQIKEVAAREGARVIIYDDEYTAAVAQAET
FT                   ELGKLRALGTNPDKEEPSGSTDETLAEVIARSGKRPAPKASRHASIIILTSGTTGTPKG
FT                   ANRAAPPSLAPIGGVLSHVPFKAGEVTALPAPMFHALGFLHATIAMMLGSTLVLRRRFK
FT                   PATVLEDIEKHKVTAAVVVPVMLSRMLDHLEKMPQKPDLSSLRIMFVSGSQLGAELATR
FT                   ALKELGPVIYNLYGSTEIAFATIARPQDLSRNPATVGPVVKGITVKILDDNGKELPQGE
FT                   VGRIFVRNTFPFKGYTGGGGKQIIDGMMSSGDVGYFDEHGLLYISGRDDEMIVSGGENV
FT                   FPAEVEDLISGHPEVIEATAIGVDDKEWGARLRAFVVKAAGSSLTEDDVKAYVRDHLAR
FT                   YKVPREVIFLDELPRNPTGKILKRELRNIDA"
FT   gene            677821..678603
FT                   /locus_tag="MSMEG_0600"
FT   CDS_pept        677821..678603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0600"
FT                   /product="dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75040"
FT                   /db_xref="GOA:A0QQ23"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ23"
FT                   /protein_id="ABK75040.1"
FT                   /translation="MNIDLTGKTALVTGSTQGIGLAIAETLARSGARVAINGRTASRVD
FT                   ETVAQLGDLDVVGVAADVATQKGTEALLEQLPSVDILVNNLGIFGAEPAREITDEQWRK
FT                   YFDVNVLAAVRLIRSYLPGMIEKGWGRAIQIASDSAIVIPEEMIHYGVSKTALLAVSRG
FT                   FAKDAAGTGVTVNSVIAGPTHTAGVEDFVYQLVDKSLPWDEAQREFMRKHRPQSLLQRL
FT                   IEPEEIANMVAYLASPLASATTGGALRVDGGYVDAILP"
FT   gene            complement(678620..678928)
FT                   /locus_tag="MSMEG_0601"
FT   CDS_pept        complement(678620..678928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0601"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72249"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ24"
FT                   /protein_id="ABK72249.1"
FT                   /translation="MIMTNDVEKRWRDPATFRSAVAYVLSVVAIAGVALIFYVMDRTLL
FT                   PAILVPTIMFVGGVGAFIRTYQVWRAEGTWPIWHGAGWFLLALSLFCLAFPGAALTS"
FT   gene            complement(678969..679124)
FT                   /locus_tag="MSMEG_0602"
FT   CDS_pept        complement(678969..679124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0602"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71287"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ25"
FT                   /protein_id="ABK71287.1"
FT                   /translation="MNGVVPGNPYVVNCNLPQRSPKVRGAAPDAGAIIACRHWPGCLSW
FT                   YVNNPH"
FT   gene            complement(679378..681582)
FT                   /locus_tag="MSMEG_0603"
FT   CDS_pept        complement(679378..681582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0603"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71155"
FT                   /db_xref="GOA:A0QQ26"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ26"
FT                   /protein_id="ABK71155.1"
FT                   /translation="MPIAILSEHIDLADSVKSFVARVAPSDVLHEALETPLETPRANPP
FT                   SYWKAAADQGLQGVHLSESVGGQGFGILELAIVLAEFGYGAVPGPFVPSAIASALISAH
FT                   DPDAKVLSELASGDAIAAYALDSTLTATRQGDGLVIRGEVRAVPAAAQASILVLPVAID
FT                   SGEEWVVLDADQLEIEPVRSVDPLRPLAHVRANAVEVADERVLSNLSRPLARALMSTLL
FT                   SAESIGVARWATDTAAGYAKIREQFGRPIGQFQAVKHKCANMVAVTERATAAVWDAARA
FT                   LDEVREKGTEGTHFGFAAAVAATLAPAAAQQCTQDCIQVHGGIGFTWEHDTNVYYRRAL
FT                   LLAACFGRAADHPQQVVDTATATGMRPVDIDLDPETEKLRDEIRAEVAALKAIPSEERT
FT                   AAIAEGGWVQPHLPKPWGRDATPVEQIIIAQEFTTGRVKRPQMGIASWIIPSIVAFGTD
FT                   EQKQRFLPPTFRGEMIWCQLFSEPGAGSDLASLTTRAVKVDGGWRITGQKIWTTGAQFS
FT                   AWGALLARTDPDAPKHQGITYFLLDMKSPGVEVKPLRELTGNAMFNTVFIDDVFVPDDM
FT                   VLGEVNRGWEVSRNTLTNERVSIGSSEPPFLANLDQFVQFLRDGQFDQIEQNHAGQLIA
FT                   EGHAAKVLNLRSTLLTLAGGDAMPNAAISKLLSMKTGQGYAEFAVSTFGTDAAIGDPQE
FT                   EPGRWAEYLLASRATTIYGGTTEVQLNIIAERLLGLPRDP"
FT   gene            complement(681693..682661)
FT                   /locus_tag="MSMEG_0604"
FT   CDS_pept        complement(681693..682661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0604"
FT                   /product="glyoxylate reductase"
FT                   /EC_number="1.1.1.26"
FT                   /note="identified by match to protein family HMM PF00389;
FT                   match to protein family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70809"
FT                   /db_xref="GOA:A0QQ27"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ27"
FT                   /protein_id="ABK70809.1"
FT                   /translation="MAVNPGTVRVLAHFAPSNTVLDFLAPHLDWLDVRFCGEEDDETFY
FT                   RELGDADVLWHVLRPITGDDLNRAPRLRLVHKLGAGVNTIDVETATQLGILVANMPGAN
FT                   APSVAEGTVLLMLAALRRLPQLDRATRAGRGWPTDPTLGDTVRDIGGCTVGLVGYGNVA
FT                   KRVERIVLAMGAEQVLHTSTRDTGHPRWRNLPDLLAASDIVSLHLPLTDTSRGLLGPEA
FT                   IAAMKPGAVLVNTARGPIVDEAALIEALRGGRLAAAGLDVFDTEPLPADHPLLGLDNVV
FT                   LTPHVTWYTADTMRRYLSIGVENCRRIRDGEPLAHLVNEAR"
FT   gene            complement(682652..683758)
FT                   /locus_tag="MSMEG_0605"
FT   CDS_pept        complement(682652..683758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72141"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ28"
FT                   /protein_id="ABK72141.1"
FT                   /translation="MIREFVGLESPTARRAGAGGHPCQGIYYRGVGRKPKVAMIATHYQ
FT                   IDFSEHYLADYMATRGIGFLGWNTRFRGFESSFVLDHALVDIGVGVRWLREVQNIETVV
FT                   LLGNSGGGSLMAAYQAQAVDPHITPMEGMRPAVGINDLPRADAYVASAAHPGRPDVLTA
FT                   WMDGAVLDENDPVATDPDLDLFDERNGPPFSPDFVARYREAQIARNEAITDWAELELKR
FT                   VQAAGFSDRPFTVMRTWADPRMVDPTIEPTRRQPNLCYAGVPVKANRSARGIAAATTLR
FT                   NWLGMWSLRHAQTRAEPHLARITCPALVINADQDTGVYPSDAQRIFDALAGSDKTLCSI
FT                   DTDHYFTTPGARSEQADTIARWIAKRWR"
FT   gene            complement(683791..684420)
FT                   /locus_tag="MSMEG_0606"
FT   CDS_pept        complement(683791..684420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0606"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72706"
FT                   /db_xref="GOA:A0QQ29"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ29"
FT                   /protein_id="ABK72706.1"
FT                   /translation="MTVSPRDQLPTARGRQTQAAIDAAARAVISRKGILATTIADIAAE
FT                   ANRSTASFYNYYDSKEAMVHEWALRFRDEARDRAQAAREPGLTNWERSYQAVSAHWATY
FT                   RHRLAEIISVSQLAMVSDDFAQYWAEICELPISLITDMIKHAQRQGFCPDDDPHLTAVA
FT                   LVSMLNQFCYTKLSGGNADDVDDTACITTLANVFYRTIYHRGVPQP"
FT   gene            684535..685134
FT                   /locus_tag="MSMEG_0608"
FT   CDS_pept        684535..685134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0608"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72515"
FT                   /db_xref="GOA:A0QQ30"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ30"
FT                   /protein_id="ABK72515.1"
FT                   /translation="MIRPDNPNSEFEFGGINHVALVCSDMERTVDFYSNVLGMPLIKSL
FT                   DLPGGIGQHFFFDAGNGDCIAFFWFRDAPDGVPGLTAPAAIPGIGEIVSATGSLNHIAL
FT                   HVPAEKFDEYREKLKAKGVRVGPILNHDNSEMQVSPTVHPGVYVRSFYFFDPDGITLEF
FT                   ACWTKEFTDADTHAVPKTAADRRPKTAQPGLVASTK"
FT   gene            complement(685104..685946)
FT                   /locus_tag="MSMEG_0607"
FT   CDS_pept        complement(685104..685946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0607"
FT                   /product="methyltransferase, putative, family protein"
FT                   /note="identified by match to protein family HMM PF02409;
FT                   match to protein family HMM TIGR00027"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75874"
FT                   /db_xref="GOA:A0QQ31"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ31"
FT                   /protein_id="ABK75874.1"
FT                   /translation="MGDTPNPDAGRAVADTGLLVAAIRAAESRREDRLFEDPFAEKLAG
FT                   ETGRRMLEEALATTGDKSTLQIVVRTKFWDEALLRATTHVDQVVLLAAGMDARAFRLAW
FT                   PAGTVVYELDQPEVIAAKSGLLADASPRCRWTALGVDLTRDWTTALRSTTFDPARPAVW
FT                   LAEGLLQYLDETAVHTLFDRVDAMSAPGSVLLYDVVGKTLLDAAMLAAVRESMARSGAP
FT                   WRFGTDAPGELSTRLGWSANVTDIAEPGNAYGRWFTPAVPLDVPGVPRGYFVEATKPG"
FT   gene            complement(685955..686830)
FT                   /locus_tag="MSMEG_0609"
FT   CDS_pept        complement(685955..686830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0609"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74831"
FT                   /db_xref="GOA:A0QQ32"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ32"
FT                   /protein_id="ABK74831.1"
FT                   /translation="MTSERLGEFLRARRAQLNPEDVGLRDFGGRRRVAGLRREELAQLA
FT                   GVSVSYYTRLEQGQAVNASDAVLDALADALQLNVHERKHLRDLATQRAQPVRKPPAERV
FT                   SPLTRDLLRALGDVPAMVVGRRTDVLAWNEAGHALLAGHVDREAVERPAERPNLARMMF
FT                   LDPHTRELYADWPRKARAVVGNLRYVAGRHPEDALLAALIGELTVKSEEFVTLWADHRV
FT                   KRCEADTYDLRHPIVGPVTITQQNLVVARSPEQSLCIITTAAGSASEDAMKLLIRASRS
FT                   GQRHPAPQRA"
FT   gene            686934..687842
FT                   /locus_tag="MSMEG_0610"
FT   CDS_pept        686934..687842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0610"
FT                   /product="beta-lactamase"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70884"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR039344"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ33"
FT                   /protein_id="ABK70884.1"
FT                   /translation="MNEIVLGDVTVTRVMEYYGSVRLSPQTFFPESEPAAWQRNEHWLV
FT                   PDFVDPDADVCVSAIQSWVLRSGGATIVVDTGVGNNKERPDTPVWHRLQTDYLDNLAAA
FT                   GVQPADVDYVINTHVHVDHVGWNTYLDNGHWAPTFPNATYLIPRADFEFWNPENRPSSS
FT                   VDHRNLFMDSVAPIHAAGQALLWEDSFDINADLRLQAAPGHTPGSSIVTLESGSDRAVF
FT                   VGDMLHTPLQFVEPDVNSCFCEDPAQARATRRRVLGWAADTRTLVVPAHLGGHGAAELA
FT                   RDGDTFAIKEWAPFERVTTHV"
FT   gene            687835..689295
FT                   /locus_tag="MSMEG_0611"
FT   CDS_pept        687835..689295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0611"
FT                   /product="para-nitrobenzyl esterase"
FT                   /EC_number="3.1.1.-"
FT                   /note="identified by match to protein family HMM PF00135"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75576"
FT                   /db_xref="GOA:A0QQ34"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ34"
FT                   /protein_id="ABK75576.1"
FT                   /translation="MSEVTAELVATGAGTVRGLLAADHRVFYGIPYAAPPQGRARFTAP
FT                   EPYEPWPGVRDATTPGPTAPQAQRDGFGRLDMSPFFGPGWVRDPDYLTVNVWTPRTERA
FT                   PGHPVMVFVHGGGFVSGSTRSPLYDGSAFARDGVVLVTVTYRLGITGFLDIAGAPRNRG
FT                   LLDVLGALRWVRDNIAAFGGDPGNVTLFGQSAGATLTAGVLAEPQAQQLIRRVIIQSGN
FT                   PYGAFTGEQAARVTHAAADALGVDPVLEDFEGISDERLIGAAGGLGGLDLRTADGFDPL
FT                   VGLSPFSLVCDEQPAVGAHPDVGVLIGTTLEEGNLYLVPQGQFGTSTREDVHALAARVH
FT                   ADPVALVQEYRERHPDADWDRLRSAILGDALFRAGSERFALSRNAYRYEFGWRSTAVDG
FT                   LLGAAHAVELPFVFDRLDAEVLRGPDALLGPGDVPQALADEMHGAWVRFATTGDPGWAP
FT                   GEVRRFTEIEVRDSKRADRVPHGNLGVR"
FT   gene            complement(689301..689912)
FT                   /locus_tag="MSMEG_0612"
FT   CDS_pept        complement(689301..689912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0612"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70413"
FT                   /db_xref="GOA:A0QQ35"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ35"
FT                   /protein_id="ABK70413.1"
FT                   /translation="MTPVRPYRGIEAADRLAQRRGQLLAAGLDLLGDENAEVTVRAVCQ
FT                   RAGLAARYFYESFGDKDAFVSEVYDWVIAEIAASTQAAVASVPLAEQTTAAMTNIVRTI
FT                   ADDPRIGRLLFSAKLSNEVVVRKRVEGIGFFAGLLGQHTVDALRLPENDQLRATAHFAV
FT                   GGVTQTISAWLGGEVSFTPDELVQQLRSLLDALANLQSRK"
FT   gene            689985..690890
FT                   /locus_tag="MSMEG_0613"
FT   CDS_pept        689985..690890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0613"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69638"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ36"
FT                   /protein_id="ABK69638.1"
FT                   /translation="MAMTVSEPIPYVERGMSESAGPAPVRRRRRKATFDDGLMGVALLA
FT                   GPANVIMQLANPGVGYGVVESRVDSGRTDLHPVKRARTTFTYLAVATRGTEAQKAAFRR
FT                   AVNKAHAQVYSTEDSPVQYNAFDKNLQLWVAACLYKGGVDVLRMFVGEMDDETADRHYR
FT                   DSVTMGTTLQVPAEMWPADRAAFDRYWNEQIEKVHIDDTVRAYLYPIAAGRPKATKLPR
FT                   FIQKRLDGIALLITTGFLPQRFRDEMRLPWDEKRQQRFDRLIAVLRFVNDLLPAPVRAF
FT                   PFNALLKDLDWRIRTGRSLV"
FT   gene            690921..691814
FT                   /locus_tag="MSMEG_0614"
FT   CDS_pept        690921..691814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0614"
FT                   /product="methyltransferase"
FT                   /note="identified by match to protein family HMM PF02409;
FT                   match to protein family HMM TIGR00027"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABK76063"
FT                   /db_xref="GOA:A0QQ37"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QQ37"
FT                   /protein_id="ABK76063.1"
FT                   /translation="MRTDNDQWDITISVGQTALFVAASRALEARKPHPLAVDHYAEVFC
FT                   RAAGGDWVAAVEGTDPEHPLQTEFGVDFVNFQGARTKYFDDYFRRVADAGVRQVVLLAA
FT                   GLDSRAYRLPWADGTVVYELDVPKVLEFKREVLRRHGATPTAERREVPVDLRDDWPAAL
FT                   RANGFDASQPSAWIAEGLLIYLPADAQELLFAGIDALSAPGSFVAIEESAPMPMDVFEV
FT                   KRAEALASGDPNSFFALVFNEQCAPGEQWFSERGWTASTTTLNECLHEVGRPAPAPDSE
FT                   AAQMTGSISLMWARKG"
FT   gene            691998..693767
FT                   /locus_tag="MSMEG_0615"
FT   CDS_pept        691998..693767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0615"
FT                   /product="ATPase, AAA family protein"
FT                   /note="identified by match to protein family HMM PF00004"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69981"
FT                   /db_xref="GOA:A0QQ38"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023835"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QQ38"
FT                   /protein_id="ABK69981.1"
FT                   /translation="MVSRFATCCRALGLTVNDRQRPADLTAARAGFAGLTHLAHDQCDA
FT                   WIGLAAAGEVTPAVVDAVWRTVASAGVLQREIGLAAGELGFTYDTGWYLQFRATEPDDF
FT                   QLAYAARLYEAGEFGEADGLVGEILARRPGWFDARWLQVAINHRAQRWSDVVRLLTPVV
FT                   TLPSLDDVTSHAVRTALGISLARLGMFAPAMSYLEDPAGPIEVAAVDGALAKALTLRAQ
FT                   GEDDEATEVLQDLFATHPENTQVEQALLDTSFGLVTTTSARIEARSDPWDPETEPSEAE
FT                   FVDPGAKDRKAHLLLEAEAELAEFIGLEEVKFQVARLKSSVAMAIRRQERGLAVAQRTN
FT                   HLVFAGPPGTGKTTIARVVAKIYCGLGLLKKETVREVHRADLIGQHIGETEAKTNAIID
FT                   SALDGVLFLDEAYALVSTGAKNDFGLVAIDTLLARMENDRDRLVVIVAGYRKDLDAFLD
FT                   TNEGLRSRFTRSIDFPSYTAPELVEIAVRMAEKRDSVFEKAAHDDMERLFTHLAQATTP
FT                   DANGVERRSLDIAGNARFVRNLVERSEEEREYRLDHSDQEDFTDEEMMTITAGDVQRSA
FT                   APLLRGLGLSVPA"
FT   gene            693764..695320
FT                   /locus_tag="MSMEG_0616"
FT   CDS_pept        693764..695320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0616"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05108"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75660"
FT                   /db_xref="GOA:A0QQ39"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QQ39"
FT                   /protein_id="ABK75660.1"
FT                   /translation="MTGPVNPDDRRSFSSRTPVNENPDGVQYRRGFVTRHQVSGWRFVM
FT                   RRIASGVALHDTRMLVDPLRTQSRAVLTGALILVTGLVGCFIFSLFRPGGVPGNNAILA
FT                   DRSTSALYVRVGEQLHPVLNLTSARLISGSPDNPTMVKTSEIDKFPRGNLLGIPGAPER
FT                   MVQNAATDAEWTVCDAVGGANPGVTVIAGPLGADGERAAPLPPDHAVLVHSDAEPNPGD
FT                   WLLWDGKRSPIDLADRAVTDALGLGGQALAPRPIAAGLFNAVPAAPALTAPVIPDAGAA
FT                   PQFELSLPVPVGAVVVAYDADNTARYYAVLSDGLQPISPVLAAILRNTDSHGFAQPPRL
FT                   GPDEVARTPMSRGLDTSAYPDNPVTLVEASAHPVTCAHWTKPSDAAESSLSVLSGAVLP
FT                   LAEGLHTVDLVGAGAGGAANRVALTPGTGYFVQTVGAEPGSPTAGSMFWVSDTGVRYGI
FT                   DTAEDDKVVAALGLSTSPLPVPWSVLSQFAAGPALSRGDALVAHDAVSTNPNSARMEAS
FT                   R"
FT   gene            695317..699294
FT                   /locus_tag="MSMEG_0617"
FT   CDS_pept        695317..699294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0617"
FT                   /product="ftsk/spoiiie family protein"
FT                   /note="identified by match to protein family HMM PF01580"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70420"
FT                   /db_xref="GOA:A0QQ40"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QQ40"
FT                   /protein_id="ABK70420.1"
FT                   /translation="MSRLIFEHQRRLTPPTTRKGTITIEPPPQLPRVVPPSLLRRVLPF
FT                   LIVILIVGMIVALFATGMRLISPTMLFFPFVLLLAATALYRGGDNKMRTEEVDAERADY
FT                   LRYLSVVRDNVRAHAAEQRAALEWSHPEPEVLATIPGTRRQWERDPRDRDFLVLRAGRH
FT                   DVPLDAALKVKDTADEIDLEPVAHSALRGLLDVQRTVRDAPTGLDVAKLARITVIGEAD
FT                   EARAAIRAWIAQAVTWHDPTMLGVALAAPDLESGDWSWLKWLPHVDVPNEADGVGPARY
FT                   LTTSTAELRERLAPALADRPLFPAESGAALKHLLVVLDDPDADPDDIARKPGLTGVTVI
FT                   HRTTELPNREQYPDPERPILRVADGRIERWQVGGWQPCVDVADAMSAAEAAHIARRLSR
FT                   WDSNPGYIRSTSTGSATFTTLLGIPDASALDVASLWAPRPRDEELRVPIGVTSTGEPLY
FT                   FDLKDEAEGGMGPHGLMIGMTGSGKSQTLMSILLSLLTTHPADRLIVIYADFKGEAGAD
FT                   IFRHFPQVVAVISNMAEKRSLADRFADTLRGEVARREQILKEAGRRVQGSAFNSVAEYE
FT                   SAIAAGHDLPPMPTLFVVADEFTLMLAEHPEYADLFDYVARKGRSFRIHLLFASQTLDV
FT                   GRIKDIDKNTSYRIGLKVASPSISRQIIGVEDAYHIESGREHKGEGFLVPAPGAVPIKF
FT                   RSTYVDGIYDPPRAEKSIVVHALPQPQVFTAGRVEPEPDTVIATGDVEVHTAPPRKLIA
FT                   TIGDQLAAYGPKAPQLWLPPLDEPIALADVLAGADVEPGQLRWPLGEIDKPFEMRRDVL
FT                   VYDAHTAAANVLIHGGPRSGKSTALQAFVLSAAALHSPRAITFYCLDYGGGKLADLADL
FT                   AHVGSVATPLEPERIRRTFGELEQLLRARQRQGAVNRTGSYTDGYGEVFLVIDNLYAFS
FT                   RDNTDTFNTRNPLLAKVTELANSGLAYGIHVVITTPNWLEVPLAMRDGLGLRLELKLHD
FT                   SHDSIVRVAGALRRPADSVPADQPGRGLTMAAEHFLFAEPALSDIAVINARYPGVSAPP
FT                   VRLLPTDLSPDALAPLYPAPETVVIGQREEDLAPVAVDFANHPLLMVFGDSKSGKTTLL
FT                   RHIIRTVRENSTPDQVAFTVIDRRLHLVDEPLFPDNEYTANIDRVLPAMLGLSALIEKR
FT                   RPPAGLSAQELSRWTYTGHTHYLIVDDVDQIPDTPAVSGPFVGQRPWTNIVGLLAEAAD
FT                   LGLRVIVTARATGSAHAVMTAPLLRRLNDLQATTLMLSGNPTDSGKIRGHRFARFPAGR
FT                   GLLLTDTDTPDHIQLVNPLGDAALSGNIGNNGNHNRGGEYR"
FT   gene            699291..699602
FT                   /locus_tag="MSMEG_0618"
FT   CDS_pept        699291..699602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0618"
FT                   /product="pe family protein"
FT                   /note="identified by match to protein family HMM PF00934"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72989"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ41"
FT                   /protein_id="ABK72989.1"
FT                   /translation="MTLRVVPEGLTAASSAVEALTARLAAAHAAAAPMISTVLPPAADA
FT                   VSLQTAAGFSANGAQQSAVAAQGVEELGRSGVGVGESGVSYATGDAQAAASYLTARGL"
FT   gene            699604..701175
FT                   /locus_tag="MSMEG_0619"
FT   CDS_pept        699604..701175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0619"
FT                   /product="ppe family protein"
FT                   /note="identified by match to protein family HMM PF00823"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABK70912"
FT                   /db_xref="GOA:A0QQ42"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ42"
FT                   /protein_id="ABK70912.1"
FT                   /translation="MTAPIWMALPPEVHSSLLSSGPGPGSLLAAAGAWQSLSAEYAAAA
FT                   AELTSVLSAVQAGSWEGPSSEQYVAAHAPYLQWLAQQSANSAAAAVQHETAAAAYSTAL
FT                   ATMPTMAELALNHTMHGVLVATNFFGINTIPIALNEADYVRMWIQAATTMSTYQAVSGA
FT                   AVAAAPVSAPAPFLLKPGVGEAGSASASVQQMSAQATAAESGSSLDLSSIISDLLNQYL
FT                   QGVPGGQAILDFLKDPLGNLGRLLTDFMTNPAGALATWWPFLFGVAYQVFFNLVGWPTW
FT                   GMIFASPFLIPALAALGITGLVLLIDHVLNNPVDVPAEDEAPQEVAAAPRTDQPLAVGI
FT                   SPAGVPGSAATAAAPAPAPAGTTVAAPAPAAATFVPYAVANRDPGEGFTPTLGNKSQVA
FT                   APASGVPAAASGVAASLASRRKRRRKKGAQIEERGYADAYMDYEEPDEDPAPQPEPRVR
FT                   ASERGSDAMGFTGTVTRHDVTAAGLTTLTGDTFDDRPVTPMLPGTWDGDENPAPSPDDP
FT                   EGGPRR"
FT   gene            701225..701518
FT                   /locus_tag="MSMEG_0620"
FT   CDS_pept        701225..701518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0620"
FT                   /product="pe family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71673"
FT                   /db_xref="GOA:A0QQ43"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="PDB:3Q4H"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QQ43"
FT                   /protein_id="ABK71673.1"
FT                   /translation="MSLLDAHIPQLIASEANFGAKAALMRSTIAQAEQAAMSSQAFHMG
FT                   EASAAFQAAHARFVEVSAKVNALLDIAQLNIGDAASSYVAQDAAAASTYTGI"
FT   gene            701553..701840
FT                   /locus_tag="MSMEG_0621"
FT   CDS_pept        701553..701840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0621"
FT                   /product="low molecular weight protein antigen 7"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72724"
FT                   /db_xref="GOA:A0QQ44"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="PDB:3Q4H"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QQ44"
FT                   /protein_id="ABK72724.1"
FT                   /translation="MSQIMYNYPAMLAHAAEMNTYSGALHAVGADIAAEQHALASAWQG
FT                   DTGMTYQAWQAQWNQAMEELVRAYRAMATTHEQNTMAMSARDQAEGAKWG"
FT   gene            701853..702734
FT                   /locus_tag="MSMEG_0622"
FT   CDS_pept        701853..702734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0622"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABK72998"
FT                   /db_xref="GOA:A0QQ45"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="PDB:4L4W"
FT                   /db_xref="PDB:4RCL"
FT                   /db_xref="PDB:4W4J"
FT                   /db_xref="PDB:5SXL"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QQ45"
FT                   /protein_id="ABK72998.1"
FT                   /translation="MGPNAVELTTDQAWCLADVLGAGSYPWVLAITPPYSDHSQRSAFL
FT                   AAQSAELTRMGVVNSAGAVDPRVAQWITTVCRATQWLDLRFVSGPGDLLRGMVARRSEE
FT                   TVVALRNAQLVTFTAMDIGHQHALVPVLTAGLSGRKPARFDDFALPAAAGARADEQIRN
FT                   GAPLAEVLEFLGVPPSARPLVESVFDGRRTYVEIVAGEHRDGHRVTTEVGVSIIDTPHG
FT                   RILVHPTKAFDGEWISTFTPGSADAIAMAVERLTASLPSGSWFPDQPLTRDFDEDAATH
FT                   REPVLQRRTQKA"
FT   gene            702737..704164
FT                   /gene="snm"
FT                   /locus_tag="MSMEG_0623"
FT   CDS_pept        702737..704164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="snm"
FT                   /locus_tag="MSMEG_0623"
FT                   /product="secretion protein Snm4"
FT                   /note="identified by match to protein family HMM PF04600;
FT                   match to protein family HMM TIGR02958"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74115"
FT                   /db_xref="GOA:A0QQ46"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QQ46"
FT                   /protein_id="ABK74115.1"
FT                   /translation="MSENTVMPIVRVAVLAAGDDGGRLTEMALPSELPLREILPAVQRI
FT                   VQPARENDGAADPAAAPNPVRLSLAPIGGAPFSLDATLDTVGVVDGDLLALQAVPSGPP
FT                   APRIVEDIADAAVIFSEARRRQWGPTHIARGAALALIGLILVGTGLSVAHRVITGDLLG
FT                   QFIVSGIALATVIAALAVRNRSAVLATSLAVTALVPVAAAFALGVPGDFGAPNVLLAAA
FT                   GVAAWSLISMAGSPDDRGIAVFTATAVTGVGVLLVAGAASLWVISSDVIGCALVLLGLI
FT                   VTVQAAQLSAMWARFPLPVIPAPGDPTPAARPLSVLADLPRRVRVSQAHQTGVIAAGVL
FT                   LGVAGSVALVSSANASPWAWYIVVAAAAGAALRARVWDSAACKAWLLGHSYLLAVALLV
FT                   AFVIGDRYQAALWALAALAVLVLVWIVAALNPKIASPDTYSLPMRRMVGFLATGLDASL
FT                   IPVMALLVGLFSLVLDR"
FT   gene            704172..705551
FT                   /locus_tag="MSMEG_0624"
FT   CDS_pept        704172..705551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0624"
FT                   /product="subtilase family protein"
FT                   /note="identified by match to protein family HMM PF00082"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71297"
FT                   /db_xref="GOA:A0QQ47"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR034061"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="PDB:4KG7"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ47"
FT                   /protein_id="ABK71297.1"
FT                   /translation="MIHKSLGVVATAGLVLLIGCPSAGAVSPPQVDPQIAPPPGTAGPA
FT                   QPMMQRSECITTSVLPGTDPGAVSPNQLALNLSGAWQHSRGAGQTVAVIDTGVQPGPRL
FT                   PNVEAGGDYIESTDGLTDCDGHGTSVAGLIAGQPGPDGFSGVAPEARLISIRQNSPRFA
FT                   PRTPGADSEATRAASDAETLARAVVRAADMGARVINISLVTCLPADRTIDQSVLGAALR
FT                   YAALEKDAVIVAAAGNNRGGVSTGAACESNPLPSGTPGDPRNWNGVTSVSIPSWWQPYV
FT                   LSVGAVDSTGQPSSFTMAGPWVGIAAPGENIVSVSNAPDGGLSNALPSERDRLVPLTGT
FT                   SYAAAYVSGVAALVRSKFPDLTARQVVHRLTTTAQGAARSPSNLIGAGMVDPVAALTWD
FT                   VADVPLDGPAAPEGRPIAAPPEPEPRDNTPRIIAFVGTGVLAAAVGAAFYATYRRKDKT
FT                   T"
FT   gene            705548..706477
FT                   /locus_tag="MSMEG_0626"
FT   CDS_pept        705548..706477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0626"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73896"
FT                   /db_xref="GOA:A0QQ48"
FT                   /db_xref="InterPro:IPR021368"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QQ48"
FT                   /protein_id="ABK73896.1"
FT                   /translation="MTARIALASLFVVAAVLAQPWQTTTQRWVLGVSIAAVIVLLAWWK
FT                   GMFLTTRIGRALAMVRRNRAEDTVETDAHRATVVLRVDPAAPAQLPVVVGYLDRYGITC
FT                   DKVRITHRDAGGTRRSWISLTVDAVDNLAALQARSARIPLQDTTEVVGRRLADHLREQG
FT                   WTVTVVEGVDTPLPVSGKETWRGVADDAGVVAAYRVKVDDRLDEVLAEIGHLPAEETWT
FT                   ALEFTGSPAEPLLTVCAAVRTSDRPAAKAPLAGLTPARGRHRPALAALNPLSTERLDGT
FT                   AVPLPAVVRTSVKGSVEHEAAQEAGHPA"
FT   gene            complement(706433..707632)
FT                   /locus_tag="MSMEG_0625"
FT   CDS_pept        complement(706433..707632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0625"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73177"
FT                   /db_xref="GOA:A0QQ49"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ49"
FT                   /protein_id="ABK73177.1"
FT                   /translation="MEPSSVDPVDPPIPIPDVPGADATSRGLPRRIDLTLRQKAIVDAS
FT                   AAADIALRTGVASVVAASMLPRTAATILRRRDSRIEHEHMRFYADLAEAKDPERSFPRP
FT                   TEPPRVSSRPANPVAEWVAHGRVENIRFQSSFRAVNPALRERCRGHVRNNIVRAQHWRH
FT                   NDGPHPTLCVIHGFMGSPYLANGLFLSLPWFYRAGYDVLLYTLPFHGLRAERFSPFSGY
FT                   GYFANGLAGFAEAMAQAVHDFRSVMDHLEFTGVDRIALTGISLGGFTSALLASVDHRIQ
FT                   AVIPNVPVVTPDRTVDEWFPANMLVALERHIAHTDPELTEAAARYASPLHYQPLVAKER
FT                   RLIITGLGDRLAPPQQAELLWEHWDRCAFHWFPGNHLLHVSQPDYLRRMTRFLRGFMFD
FT                   "
FT   gene            complement(707650..709398)
FT                   /locus_tag="MSMEG_0627"
FT   CDS_pept        complement(707650..709398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0627"
FT                   /product="glycosyl transferase, family protein 39"
FT                   /note="identified by match to protein family HMM PF02366"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71325"
FT                   /db_xref="GOA:A0QQ50"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ50"
FT                   /protein_id="ABK71325.1"
FT                   /translation="MTTSRWERVGLVTLLTVTAVLYLWHLSINGYGNDFYAAAAQAGAQ
FT                   SWSAWFYGALDAHDFITVDKPPAALWITGLSVRLFGMSPWSVLAPQAVMGVAAVTVLYA
FT                   TVRRTLTGTRHAAAGALLAGAVLAFTPAAALMFRFDNPDALLVLVLVAAAHCLTRAVGS
FT                   AAVWWVVAAGAALGAAFLTKMLEGLIVAPAFALTYLLLAPTTWRRRAVHLLAGAAAVVI
FT                   AAGWWIVVVQLVPPGERPFVGGSTDDNELELALGYNGIDRIVSGGHTAHTGVARLFTGE
FT                   IGVEIGWLLPAAVVAAVVGSFLAVRGHLPRTQLAALVMWTAWLLSGAIVFGYMRGMVHA
FT                   YYTVLLAPAVGALVALGSVWGWQRRARVDGRAALALLGASAAITASVLLHRNAFSPPRQ
FT                   LAVFAGAAAFAVLGLLAARRSAPVAAVLCAVVAVLPTAVVTAATAVTPHHGSQPLAVQQ
FT                   ERGDGWLGDLASNRQLADLLATATTAWSAATNGSQAAAALEIASGTSVMAVGGWRGDPV
FT                   PTLPEFIDDVHARRVTFYVEAGRPQHGEVIRSANHTRAHTREIADWVAAHHAGVRIGST
FT                   TVYRLL"
FT   gene            complement(709441..710328)
FT                   /locus_tag="MSMEG_0628"
FT   CDS_pept        complement(709441..710328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0628"
FT                   /product="amidohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF04909"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75356"
FT                   /db_xref="GOA:A0QQ51"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ51"
FT                   /protein_id="ABK75356.1"
FT                   /translation="MMDEIAAVRSIWSDLGLPGLIDVHTHFMPKNVMDKVWQYFDSQGP
FT                   LIGREWPITYRADEQQRLATLREFGVRRFSSLVYPHKPDMAAWLNQWAREFARNTPDCL
FT                   STATFYPEEQAGRYVAEAIDAGTQIFKAHIQVGAYDPNDPLLDEVWGMVEDAAVPVVIH
FT                   CGSGPAPGEYTGPERVEKLLARHPRLVLIIAHMGMPEYSEFLDLAERFDGVRLDTTMAF
FT                   TPFSEAMMPFPPADRARLYDLGERILFGSDFPNIPYGYADALRHTVDLPGIDDTWRRNV
FT                   LHDNAARLFGVASR"
FT   gene            710373..711137
FT                   /locus_tag="MSMEG_0629"
FT   CDS_pept        710373..711137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0629"
FT                   /product="trans-aconitate 2-methyltransferase"
FT                   /EC_number="2.1.1.144"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71573"
FT                   /db_xref="GOA:A0QQ52"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ52"
FT                   /protein_id="ABK71573.1"
FT                   /translation="MWNPETYLNFADHRGRPFFELLARIGARTPRRVVDLGCGPGNLTE
FT                   TLTQRWPGAQVEALDSSPEMVAAARERGVDARVGAIEDWQPTPDTDVVISNAALQWVPS
FT                   HRELIVAWVQSLPAGAWLAFQVPGNFDSPSHRAVRTVARSEAFADALRDMPWRDAHQVD
FT                   DPLDYAGLLTDAGCTVDAWETTYVHELTGETPVLDWITGTALTQVRSRLDDTAWQRYRE
FT                   AIIPLLAEAYPRRPDGITFFPFRRVFVVAQIR"
FT   gene            complement(711186..711989)
FT                   /locus_tag="MSMEG_0630"
FT   CDS_pept        complement(711186..711989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABK69637"
FT                   /db_xref="GOA:A0QQ53"
FT                   /db_xref="InterPro:IPR015124"
FT                   /db_xref="InterPro:IPR024628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:1TEX"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0QQ53"
FT                   /protein_id="ABK69637.1"
FT                   /translation="MSDHPTAYLVLASQRSGSTLLVESLRATGVAGEPQEFFQYLPNTS
FT                   MSPQPREWFADVEDQSILRLLDPLIEGKPDLAPATIWRDYIQTVGRTPNGVWGGKLMWN
FT                   QTPLLVQRAKDLPDRSGSGLLSAIRDVVGSDPVLIHIHRPDVVSQAVSFWRAVQTRVWR
FT                   GRPDPVRDARAEYHAGAIAHVITMLRAQEEGWRAWFTEENVEPIDVDYPYLWRNLTEVV
FT                   GTVLEALGQDPRLAPKPVLERQADQRSDEWVERYRRDAQRDGLPL"
FT   gene            complement(712068..713446)
FT                   /pseudo
FT                   /locus_tag="MSMEG_0631"
FT                   /note="sulfatase family protein, authentic frameshift; this
FT                   gene contains a frame shift which is not the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00884"
FT   gene            complement(713531..714025)
FT                   /locus_tag="MSMEG_0632"
FT   CDS_pept        complement(713531..714025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0632"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABK74078"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ54"
FT                   /protein_id="ABK74078.1"
FT                   /translation="MALFLRKLLRIGELPDALRAEAEAEGVLFLAEYVPVTRRFSGAIP
FT                   GKRAANSVSSYAGSVMLTEQRALATLATLPKLAGRTVDQPWSAPQNGAVTAELSAHGLV
FT                   IEADLARVDGHRYGHFEGHLSLHYKVAIPEDVLARLPRRSLAFDVGPEYVFRAVGVQYH
FT                   P"
FT   gene            714093..714764
FT                   /locus_tag="MSMEG_0634"
FT   CDS_pept        714093..714764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0634"
FT                   /product="PAP2 superfamily protein"
FT                   /note="identified by match to protein family HMM PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73525"
FT                   /db_xref="GOA:A0QQ55"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ55"
FT                   /protein_id="ABK73525.1"
FT                   /translation="MERTRGLLIASALVAVAVYALMWIGYRSGWPWLVSFDDAGLDPAF
FT                   RFGTEHPAWVTAWNVFCTVLGPYSFRAVFAVFIVVALIRRHFRPAVFALLSVELSGLVT
FT                   QLAKLASDRPRPPTALVYASWTSFPSGHALGVMVCVPALLALVWPLLRGAWRGWAVAAG
FT                   ALVIVAIGVGRVVLNVHHPSDVVAGWALGYAFFVVCLLLAPPYPDVRARGEIPEVRGIA
FT                   T"
FT   gene            complement(714718..716181)
FT                   /locus_tag="MSMEG_0633"
FT   CDS_pept        complement(714718..716181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0633"
FT                   /product="PAP2 superfamily protein"
FT                   /note="identified by match to protein family HMM PF00781;
FT                   match to protein family HMM PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71683"
FT                   /db_xref="GOA:A0QQ56"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ56"
FT                   /protein_id="ABK71683.1"
FT                   /translation="MDVPKIGRGLGTLDREVFEAVAESPSPLLDSLMPKLTRAADHSKL
FT                   WFVIAAGLGAVGGNSARRGAVRGIASLAVTSLVTNQIAKRIWRRPRPDRSIIPLIRQTR
FT                   RVPTSHSLPSGHSSSAAAFAVGVGLESAPIGLPLALLAGLVGLSRVATGAHYPGDVFAG
FT                   FGIGATIAILGARIVPTIPAASLPTSEPLRYKTAPRPEGSGVTLVINPASGSGTGARVV
FT                   EEVREALPQAEVVELDEDDDIEEVLREAASRCEVLAVGGGDGTVACAAGIAVEAGLPLA
FT                   VFPGGTFNHFAKDIGCDTVARTVEAIRQGSAAYVDLVCLNDKHMVLNTASIGAYPKFVR
FT                   IREKLEHRLGKRVAAAYALYLTLRRDEPVRITYDDKTVETSLFFLGNSVYFPSGFAPSL
FT                   RPRMDDGLIDVRILETGKRFGRLRIATSMLLGRLERSPLYHEMQVPQFHFETVDGPTVL
FT                   AHDGEVGEPYTEATFTSRYRALPVFRPLP"
FT   gene            716288..716914
FT                   /locus_tag="MSMEG_0635"
FT   CDS_pept        716288..716914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0635"
FT                   /product="putative conserved exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75368"
FT                   /db_xref="GOA:A0QQ57"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ57"
FT                   /protein_id="ABK75368.1"
FT                   /translation="MAAVALACAPSAAAVENPWFARSVGTATQVISVVGVGGSKAKMDV
FT                   YQRTAAGWQPVGVGIEAWIGANGMAPQTHDGEMKTPMGIFTLDFAFGTAPNPGGGLKYV
FT                   QVGPDHWWDGDMKSPTYNTMQVCKKAQCPFDTDPRSGTENLNIPQYRHAVVMGVNKARV
FT                   PGNGGAFFVHNTDGGPTAGCVAIDDATLVQIIRWLRPGALIAVAK"
FT   gene            complement(716920..717405)
FT                   /locus_tag="MSMEG_0636"
FT   CDS_pept        complement(716920..717405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0636"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABK75868"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ58"
FT                   /protein_id="ABK75868.1"
FT                   /translation="MGDNLRVNDDIDIKDIERVKYRYLRALDTKNWDEFADTLTEDVRG
FT                   DYGQSLGEALHFTDRAALVDYMRQSLGPSIITEHRVAHPEITVDGDEATGTWYLQDRVI
FT                   APDFNFMLIGAAFYRDTYRRTTDGWKISATGYDRTYDATMSLENLNFHLKPGAALHI"
FT   gene            complement(717434..719002)
FT                   /locus_tag="MSMEG_0637"
FT   CDS_pept        complement(717434..719002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0637"
FT                   /product="iron-sulfur binding oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00355;
FT                   match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABK73463"
FT                   /db_xref="GOA:A0QQ59"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ59"
FT                   /protein_id="ABK73463.1"
FT                   /translation="MSGRSFRFGHDGYREAMTAATSLWLAGRAERPTPPYLDETNCTAD
FT                   VVVVGAGITGLITAVLLARAGKDVLVLEAYTAGAGTTGNTTAKVSLLQGTKMSKILRKH
FT                   GAKVAGQYVQGNLEGQEWLAGYCDANGLSLQREDAYTYAQSEKGLASARAEYDACREVG
FT                   LDADWVDAADAPDVPFPFAGGVRLPDQAQFDPMPLLDKLIVELDERNGRLVEGTRVLGV
FT                   SQDSSGLKIKVRSHTGTELDVRAGQCVLATGIPILDRGGFFARLSPHRSYCLAFRVPGA
FT                   VTRGMYISTDSPTRSVRYAPTADGDRLIVGGAGHTVGRRSHPSDDVDELASWAKVHWPG
FT                   AIQTHYWSAQDYTPVDELPYVGPLLPGNEKVFVATGFDKWGMTNGTAAALALSSRILGG
FT                   RMDWSQAFDSWSPHELSGIPTALKVNLEVGFNMAKGWVTPILRRGDGVPDDGGVVAGPP
FT                   WRMEACSVVDGVERRVSPVCPHLGGIVEWNDSDEAWECPLHGSRFAPDGTLLEGPATHG
FT                   LTPAP"
FT   gene            719172..721103
FT                   /locus_tag="MSMEG_0638"
FT   CDS_pept        719172..721103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MSMEG_0638"
FT                   /product="conserved hypothetical proline and threonine rich
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MSMEG_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABK71946"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:A0QQ60"
FT                   /protein_id="ABK71946.1"
FT                   /translation="MSDPLGLSIGTTNLVAARVGNQPEIRRSVLTLSADRTPQVGVPES
FT                   GAGVTLTGFVERVGDPVPLVAPDGASYPADTLLVEALDAMVEAAGGPSQQLVIAVPAHW
FT                   GPTTLRALRNALRTNPSLSHGGMPARLVPDAVASLAALRVNPGLPTGGVVALVDFGGSG
FT                   TSITLADAASGFEPIDETTRHPDFSGDQIDQALLTHVLDGIAEAGGIDPAGTAAVGSLA
FT                   RLREECRAAKERLSALTATDLAVELPGYSATIRVTRDELETLMRPPLTGVLDTLDNALE
FT                   RNGFDWSAVAAVVTIGGGASIPLVTQQLSEHSRAVVVTTPQPALDAAVGAALIAAGVTA
FT                   SAAADAEAMTGAAPTLGVAAVSDTTGPDAATASAPAVGATPDQEGSSTFRALAWSEDEP
FT                   ADDVVPYAGPDVVNPYAANPYANPYAGDTSARPAVQYVPPTGPVEEPAGGWKRLPLTVF
FT                   GIAVAAVLVAVGGVTYALTSSTSSTPTTEVRTAEPKPLTPEPEPSAVAPPPVAEPPPPV
FT                   TEAPPPPPPVTITEVAPPPPVTETHVVTQTTTPPTTTTTTTTSPTTTEPTTTTTTPTTT
FT                   ETTTTTTTPTTTTNPMTTTYITVPFVPVPIPIQVPSREQPQPQYPPQYPQQYPQNPQYP
FT                   QNPFQPYP"
FT   gene            complement(721104..722114