(data stored in ACNUC7421 zone)

EMBL: CP000486

ID   CP000486; SV 1; circular; genomic DNA; STD; PRO; 55939 BP.
XX
AC   CP000486;
XX
PR   Project:PRJNA18255;
XX
DT   28-NOV-2006 (Rel. 89, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Bacillus thuringiensis str. Al Hakam, plasmid pALH1, complete sequence.
XX
KW   .
XX
OS   Bacillus thuringiensis str. Al Hakam
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus;
OC   Bacillus cereus group.
OG   Plasmid pALH1
XX
RN   [1]
RP   1-55939
RX   DOI; 10.1128/JB.00241-07.
RX   PUBMED; 17337577.
RA   Challacombe J.F., Altherr M.R., Xie G., Bhotika S.S., Brown N., Bruce D.,
RA   Campbell C.S., Campbell M.L., Chen J., Chertkov O., Cleland C.,
RA   Dimitrijevic M., Doggett N.A., Fawcett J.J., Glavina T., Goodwin L.A.,
RA   Green L.D., Han C.S., Hill K.K., Hitchcock P., Jackson P.J., Keim P.,
RA   Kewalramani A.R., Longmire J., Lucas S., Malfatti S., Martinez D.,
RA   McMurry K., Meincke L.J., Misra M., Moseman B.L., Mundt M., Munk A.C.,
RA   Okinaka R.T., Parson-Quintana B., Reilly L.P., Richardson P.,
RA   Robinson D.L., Saunders E., Tapia R., Tesmer J.G., Thayer N.,
RA   Thompson L.S., Tice H., Ticknor L.O., Wills P.L., Gilna P., Brettin T.S.;
RT   "The complete genome sequence of Bacillus thuringiensis Al Hakam";
RL   J. Bacteriol. 189(9):3680-3681(2007).
XX
RN   [2]
RP   1-55939
RA   Lucas S., Pitluck S., Chertkov O., Goodwin L.A., Han l., Munk A.C.,
RA   Saunders E., Brettin T.S., Bruce D., Challacombe J.F., Gilna P.,
RA   Martinez A.D., Misra M., Tapia R., Thayer N.N., Xie G., Brown N.,
RA   Green L.D., Hill K.K., Jackson P.J., Longmire J., Rubin E., Richardson P.;
RT   ;
RL   Submitted (14-NOV-2006) to the INSDC.
RL   Joint Genome Institute, Department of Energy, 2800 Mitchell Drive, Walnut
RL   Creek, Ca 94598, USA
XX
DR   MD5; d70488cdc739d0f002ac6d3f7a03e704.
DR   BioSample; SAMN02598406.
DR   EuropePMC; PMC1855882; 17337577.
DR   EuropePMC; PMC2504315; 18587153.
XX
CC   Bacillus thuringiensis Al Hakam was collected at a suspected
CC   bioweapons facility in Iraq by the United Nations Special
CC   Commission (Genome differences that distinguish Bacillus anthracis
CC   from Bacillus cereus and Bacillus thuringiensis. Radnedge, L,
CC   Agron, PG Hill, KK, Jackson, PJ, Ticknor, LO, Keim, P, and
CC   Andersen, GL. Appl Environ Microbiol 2003. 69:2755-64). Plasmid and
CC   fosmid libraries were prepared at the Joint Genome Institute in Los
CC   Alamos (JGI-LANL), NM. Shotgun sequencing was performed at the JGI
CC   Production Genomics Facility (JGI-PGF) in Walnut Creek, CA. Draft
CC   assemblies were based on 246217 total reads. All libraries provided
CC   23x coverage of the genome.  The Phred/Phrap/Consed software
CC   package (www.phrap.com) was used for sequence assembly and quality
CC   assessment.  After the shotgun stage, reads were assembled with
CC   parallel phrap (High Performance Software, LLC). Possible
CC   mis-assemblies were corrected manually or by transposon bombing
CC   (Epicentre Biotechnologies) of bridging clones. Gaps between
CC   contigs were closed by editing in Consed, custom primer walk or PCR
CC   amplification. A total of 25321 additional reactions were necessary
CC   to close gaps and to raise the quality of the finished sequence.
CC   The completed genome sequence of B. thuringiensis Al Hakam achieves
CC   an average of 24-fold sequence coverage per base with error rate
CC   less than 1 in 100,000. Gene predictions were obtained using
CC   Glimmer and tRNAs were identified using tRNAScan-SE. Basic analysis
CC   of the gene predictions was performed by comparing coding sequences
CC   against the PFam, BLOCKS and Prodom databases. Gene definitions and
CC   functional classes were added manually by a team of annotators at
CC   JGI-LANL, using BLAST results in addition to information from the
CC   basic analysis.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..55939
FT                   /organism="Bacillus thuringiensis str. Al Hakam"
FT                   /plasmid="pALH1"
FT                   /strain="Al Hakam"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:412694"
FT   gene            complement(665..1603)
FT                   /gene="terS"
FT                   /locus_tag="BALH_p0001"
FT   CDS_pept        complement(665..1603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terS"
FT                   /locus_tag="BALH_p0001"
FT                   /product="phage terminase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88159"
FT                   /db_xref="GOA:A0RLR6"
FT                   /db_xref="InterPro:IPR005335"
FT                   /db_xref="InterPro:IPR018925"
FT                   /db_xref="InterPro:IPR038713"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLR6"
FT                   /protein_id="ABK88159.1"
FT                   /translation="MVNMARQRSPDRDKAFEIYKTSKGEKPLIDIADELNLKPSQIRKW
FT                   KSQDKWDEQMNGNVTIAKRSVTNVKNPKTKEKLKEILEDEELTEKERLFCLYYVKYFNG
FT                   TQAALKAGYSKDGAHVQASRLLRRERVSSYIKELKGELVENVFVEAMDVLKEYIKIAFA
FT                   DITNYVTFGQKEVPVMGLYGPMKDESGKEITRIVNYVDLHEADMVDGSIITEVKLGKDG
FT                   VSVKLADKMKALDKLAQYFDLVPDNFKRQIEEERHKMQMEVQKAQVDKIKADTARIKGE
FT                   DGDDYEDDGFKEALEGKVEEVWDDHDDDSEA"
FT   gene            complement(2151..2975)
FT                   /gene="uvrC"
FT                   /locus_tag="BALH_p0002"
FT   CDS_pept        complement(2151..2975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="BALH_p0002"
FT                   /product="possible excinuclease ABC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88160"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLR7"
FT                   /protein_id="ABK88160.1"
FT                   /translation="MGELKFMSLDEFNNRVHQVDSGVYLITDVEDNIIYVGKGLSIKKR
FT                   VNAHFKGYSKNTQELSYLFNKIAYILEESPLKRSLLEIQFMIEYKTVLNKEVQEEFPDI
FT                   YTEYIKRTNKTCSKVIMKQEIDEAVEQAKIEDVARNLKQEKQLIRKQEKQRIELEKQRL
FT                   EEEKRKKFAAKALELQKKRDRERDKFRKDLLRAVGGKAIFYEVISLLDSGYNPYMLSKA
FT                   LNIDCQAIITIKEHRKDFRVPRNHKRMIKHQDIMYSLNGKEDKGNSRLNHLL"
FT   gene            complement(2988..3599)
FT                   /gene="res"
FT                   /locus_tag="BALH_p0003"
FT   CDS_pept        complement(2988..3599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="res"
FT                   /locus_tag="BALH_p0003"
FT                   /product="resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88161"
FT                   /db_xref="GOA:A0RLR8"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLR8"
FT                   /protein_id="ABK88161.1"
FT                   /translation="MLTDKGEDIMIIGYARVSTQEQNLARQLKQLSDYGCDHVYEEKTS
FT                   GATTNREELQLMLDNLKAGDTIVVTDLTRISRSTKDLFELIEVIKSKGASIKSLKDTWL
FT                   DTTSDNPYSTFLLTVMAGVNQLERDLLKMRQREGIDLAKQRGVYKGRPKKYGDKNPKME
FT                   HALELLANREENGYTVKKICEVTSVSRTVLYERAKEKGIM"
FT   gene            complement(4075..4305)
FT                   /locus_tag="BALH_p0004"
FT   CDS_pept        complement(4075..4305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible phage-related protein, N-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88162"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLR9"
FT                   /protein_id="ABK88162.1"
FT                   /translation="MEEVKCPRNKLDIEVNVDTDEAQERIERLTQAAEKCTKAFEELGD
FT                   AIASLGTLIQIPEVKDHIEFFNKDIANGLND"
FT   gene            complement(4394..4720)
FT                   /locus_tag="BALH_p0005"
FT   CDS_pept        complement(4394..4720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88163"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLS0"
FT                   /protein_id="ABK88163.1"
FT                   /translation="MENTELEERLAHIEFRQQLLFENTGLSRFLFECNVTQLEYRAIMD
FT                   VMDSYRVKIGRGEEVSSHIFEQEIYEAVPSHRGDYHFAEGLAQEFHNERRWEEVFQTLY
FT                   ANRV"
FT   gene            complement(5796..6185)
FT                   /locus_tag="BALH_p0006"
FT   CDS_pept        complement(5796..6185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0006"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88164"
FT                   /db_xref="InterPro:IPR006524"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLS1"
FT                   /protein_id="ABK88164.1"
FT                   /translation="MMEQLAFFPEITNEEYKKIQREVAKALFNYRALKVRMINQEECAA
FT                   ENISSPFVEIRNTKKIKDIKYIQMKRALEHALDPEQREIIERKYLNNGLMSDKAVKAQM
FT                   MMENNWFYTQKRHAIMALAESLLII"
FT   gene            complement(6320..6949)
FT                   /gene="recU"
FT                   /locus_tag="BALH_p0007"
FT   CDS_pept        complement(6320..6949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recU"
FT                   /locus_tag="BALH_p0007"
FT                   /product="recombination protein U (penicillin-binding
FT                   protein-related factor A)"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88165"
FT                   /db_xref="GOA:A0RLS2"
FT                   /db_xref="InterPro:IPR003105"
FT                   /db_xref="InterPro:IPR004612"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLS2"
FT                   /protein_id="ABK88165.1"
FT                   /translation="MGQGNRGMAFEKLINLSNEMYQREGVALINKRPTPVKVLKMVYGR
FT                   VKDGYYESKSTVDYDGVYKGRAIAFEAKSTNEINRFDLKNIAQHQLDYLETAEKMGAIC
FT                   FFLIGFSKDQSVFAVPLSVIQSYVRMSQQPKGKKSIPRADFDIYGYLVEQTERAPVDYL
FT                   QYVDEAVAPVMFDGMIQFDLDHQKIANNIETAKEKMENRKRKLLKA"
FT   gene            complement(7347..7574)
FT                   /locus_tag="BALH_p0008"
FT   CDS_pept        complement(7347..7574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88166"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLS3"
FT                   /protein_id="ABK88166.1"
FT                   /translation="MSFIQGRKRKMKMVRRRTVIRLENQRKSESRFSAVKWNVQMRLGK
FT                   CNYKTKDMLGAYQDMQAIKNKVNELLESER"
FT   gene            complement(8941..9540)
FT                   /locus_tag="BALH_p0009"
FT   CDS_pept        complement(8941..9540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88167"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLS4"
FT                   /protein_id="ABK88167.1"
FT                   /translation="MEYIEKATKDIRENWFGDHVAEIQGEEGLQVIYWGKPGTGMYRAK
FT                   FVLSGYNVFVSGDIGEAVYNLTCPATLENIKGCNLGYFTGKLTAFCEERWNFDQDKAKE
FT                   ELKEFWEEYEMNETEDGKEIYDDIVSAIDESSSMESYHFWVGNVYHNSSLESDTMEYIW
FT                   DFGKRLPRRLIGYWLGLQMAIEQLDKSKPAAEAVTL"
FT   gene            complement(9581..9790)
FT                   /locus_tag="BALH_p0010"
FT   CDS_pept        complement(9581..9790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88168"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLS5"
FT                   /protein_id="ABK88168.1"
FT                   /translation="METYTGFEAIERMKTHWIQRKGAPMALAFTIENCVLTYSPKYKDN
FT                   GRHSDIPLEFFFKNQFVDYEEKEN"
FT   gene            complement(9828..10325)
FT                   /locus_tag="BALH_p0011"
FT   CDS_pept        complement(9828..10325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88169"
FT                   /db_xref="InterPro:IPR014871"
FT                   /db_xref="InterPro:IPR016947"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLS6"
FT                   /protein_id="ABK88169.1"
FT                   /translation="MLNIQKIFEAQDKLDRKVVEVHGLEGQNLTRDVTHAFYVEVSEFA
FT                   NEIEYFKYWKKNKRNNKEKQNDEWADCIHFIASIGNKYGFSHDLPHDAFWVNYVGRQAD
FT                   KTYYELFDKIRENSLDTHASYYCVFASLIAIGEKIGMTYKDMEKAYFEKNQVNYDRLAN
FT                   GY"
FT   gene            complement(10517..10798)
FT                   /locus_tag="BALH_p0012"
FT   CDS_pept        complement(10517..10798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88170"
FT                   /db_xref="GOA:A0RLS7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLS7"
FT                   /protein_id="ABK88170.1"
FT                   /translation="MATKMMIIMYTGENCGKCKGAKVHLENLPAHIKENLVLKERNVDK
FT                   NSKYKYELTEFLKSNTLPTFDVYEGTTRVDILRGFDENIGKIMGHLGL"
FT   gene            complement(10788..11183)
FT                   /locus_tag="BALH_p0013"
FT   CDS_pept        complement(10788..11183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0013"
FT                   /product="possible phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88171"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLS8"
FT                   /protein_id="ABK88171.1"
FT                   /translation="MGATYLKGVARNWRGCWKGMGRMREAIEEYIEQLQLSAVENRKEA
FT                   DKAYEAEDLGLAGFYRGKWIANEGTAIALTTILSKYKNHEKTEFQGNVFANYTTEKGDN
FT                   DMKYTEHGVYEVTQLLAEAKETEENGN"
FT   gene            complement(11250..11963)
FT                   /locus_tag="BALH_p0014"
FT   CDS_pept        complement(11250..11963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88172"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLS9"
FT                   /protein_id="ABK88172.1"
FT                   /translation="MTVYMPVPTEEEYEIAAKNGISKEVVYQRIHYRGKTVEQAITEPL
FT                   QNGLFLKKYQKYIEIAERNGISYRTFHARMTQKTVRKWTPEEAATIPPKKTGRVRKTKA
FT                   NSLTEEDYKKAEKNGISRKNVNQRVDLYDWSIERAITDPVKKRNKKDNNTRMLVIAGQN
FT                   GISASTYYRRIREGMPPRDAAMKPKGHSAYIEVARENGINDICFYKRVERGMHPYLAAT
FT                   KPKDKRGSKKKKQIS"
FT   gene            complement(11975..12238)
FT                   /locus_tag="BALH_p0015"
FT   CDS_pept        complement(11975..12238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88173"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLT0"
FT                   /protein_id="ABK88173.1"
FT                   /translation="MKQLTLDDVVGSFDYAATSTADKFLQHSVTTYEVHFYDQDERQKI
FT                   DWFDVETESEAWSAAVKEHGKGIQKIGINRSERTRKEIMALD"
FT   gene            complement(12235..12522)
FT                   /locus_tag="BALH_p0016"
FT   CDS_pept        complement(12235..12522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88174"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLT1"
FT                   /protein_id="ABK88174.1"
FT                   /translation="MPRLGTDLEKENYTMALQQRKYMKKSRRNLYIALEELDLVFDESE
FT                   VIRLQEMWKEGKGILEIAKELGRHQLEIAALIMDQADKNIIKSRPMGLGA"
FT   gene            complement(12437..12700)
FT                   /locus_tag="BALH_p0017"
FT   CDS_pept        complement(12437..12700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88175"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLT2"
FT                   /protein_id="ABK88175.1"
FT                   /translation="MCACNGTGVIQNDIGTGMYQFGACVCEAGNRSPEEVDRRRHAVMT
FT                   KLREIHQLQLEGKWDAKTWNGFGKGKLYNGVATEEVHEEIAS"
FT   gene            complement(12713..13630)
FT                   /gene="dnaC"
FT                   /locus_tag="BALH_p0018"
FT   CDS_pept        complement(12713..13630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaC"
FT                   /locus_tag="BALH_p0018"
FT                   /product="DNA replication protein, phage related"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88176"
FT                   /db_xref="GOA:A0RLT3"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLT3"
FT                   /protein_id="ABK88176.1"
FT                   /translation="MKKERKNMSVTAMQRVAKSLDLKVNFHSDKCMKHSYEIGGQKFVK
FT                   PVQMIEHKGQVVCPRCVVEENDRVLKEQANNHYKKIDRAKKFNMLTKHSIISNEEILEA
FT                   TLSNYRTECNETRTNKKRVEDIVDSLKVGEVKNVFIVGVQGAGKSHLAYSILRELREHF
FT                   YELSDGEKYGDKLLYKKMKSSLFVEIEQLMRLIKDSFNNKESKYTEEYCVELLTSVDFL
FT                   VLDDLGAESGSMNRTDEASNFIQRVLYAVTNGRQGKVTITTTNLSSGDIFKKYDKKLGS
FT                   RILNKAEAIVFKETSDKRIEHLGF"
FT   gene            complement(13545..14360)
FT                   /locus_tag="BALH_p0019"
FT   CDS_pept        complement(13545..14360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible phage DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88177"
FT                   /db_xref="InterPro:IPR011741"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLT4"
FT                   /protein_id="ABK88177.1"
FT                   /translation="MSNYNTIRTIISQMSGQENIVVVPKLFVKLTGDLTTAILLNQIVF
FT                   YSDKSKRKDGFFYKTYKEWEEEICLTERQVRYSTKKLVASGYVETALKKANGAPTVHYK
FT                   LDFDKLLDSILTNCQNGNLHIVGMEPDKMSESLTEITTETTTKITTLKDNMSSDQKERS
FT                   KDYIPYEDIVSYLNEQAGKSFKHKTAKTRSLIKARFKDGFTIDDFKQVIDIKTAQWLTD
FT                   QNMNQYLRPETLFGTKFEGYLNEKGAKKHVGNSNAKGSKIPGFKGELPF"
FT   gene            complement(14361..14585)
FT                   /locus_tag="BALH_p0020"
FT   CDS_pept        complement(14361..14585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88178"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLT5"
FT                   /protein_id="ABK88178.1"
FT                   /translation="MMFQVPVRRGSMKEMLTAVRDLERRGYDYVTPIKKVYRAEKTFYN
FT                   DGKFKGKDKIRFTGMEDRASYECWMKKVN"
FT   gene            complement(14782..15456)
FT                   /locus_tag="BALH_p0021"
FT   CDS_pept        complement(14782..15456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0021"
FT                   /product="possible recombination protein, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88179"
FT                   /db_xref="InterPro:IPR007499"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLT6"
FT                   /protein_id="ABK88179.1"
FT                   /translation="MNKSETITELAKALVKFNSEVNKIAKDADNPFFKNNYATLDTIID
FT                   EIRPILSKNGLSIMQIPSGDGQNVTLKTLLLHESGEWLESDELTMKPVKNDPQAVGSCI
FT                   TYARRYSLAAFLSLNTGEDDDGNGATYGKGNKPNQKSNGGQAPNKPQGNSSNGKASEKQ
FT                   MKMIHAKIAHISALAKTEKQTIEDTLKGNIGTDNLSEISSQVASKAIEVLMGWEKQYSQ
FT                   AG"
FT   gene            complement(15453..15941)
FT                   /locus_tag="BALH_p0022"
FT   CDS_pept        complement(15453..15941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0022"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88180"
FT                   /db_xref="InterPro:IPR008840"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLT7"
FT                   /protein_id="ABK88180.1"
FT                   /translation="MKMKLYELTSNYRELQMMIEDGVDPSALADTLQAIEESIQDKVQN
FT                   TALVIRNLEADVDAIKAEEKRLAERRKAIENNCKGLKDYLYQQMTATDLKRIKGTIVTV
FT                   GIQKNPASLDIAEDAVVPPEYMIPQPPKVDKKLLLAAVKDGMQWDGITLRQSEGVRIR"
FT   gene            complement(16555..17343)
FT                   /gene="ant"
FT                   /locus_tag="BALH_p0023"
FT   CDS_pept        complement(16555..17343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ant"
FT                   /locus_tag="BALH_p0023"
FT                   /product="antirepressor, phage associated"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88181"
FT                   /db_xref="GOA:A0RLT8"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLT8"
FT                   /protein_id="ABK88181.1"
FT                   /translation="MKGVNQMNEVKIFSHNMFGNLGILIKEGKEFFPATDVAKVLGYSN
FT                   PHKAIKDHCKPEGVNETLVPTNSGVQTKKFINEPNLYRLIVKSKLPQAEQFETWVFEEV
FT                   LPSIRKHGAYMTDQVLEQAVTNPDFAIGLLTKLKEEKEKLAAAQQQIVQQQPLVTFAEA
FT                   CMQSDKSLKVSEVAKLAAKHGVKTGQKRLFATLREWGLIFKNKNEPTQRAIDSGYFEVV
FT                   QGVKEKPNGENFTWLTPYVTPKGQAYIIDRLKKEQEQEAV"
FT   gene            complement(17365..17553)
FT                   /locus_tag="BALH_p0024"
FT   CDS_pept        complement(17365..17553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88182"
FT                   /db_xref="GOA:A0RLT9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLT9"
FT                   /protein_id="ABK88182.1"
FT                   /translation="MKQLKLKRLEKGMSCQDVADKVGITKMHYWYIENEKRTLKIDLAE
FT                   KIAIALEENPKDLFFNN"
FT   gene            17718..18068
FT                   /gene="xre"
FT                   /locus_tag="BALH_p0025"
FT   CDS_pept        17718..18068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xre"
FT                   /locus_tag="BALH_p0025"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88183"
FT                   /db_xref="GOA:A0RLU0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLU0"
FT                   /protein_id="ABK88183.1"
FT                   /translation="MIGEKIKELRKNSKMTQEQLGDAIGVSKMAISYFEKGKKSPGRES
FT                   LEKIADYFGVTTDYLLGRSEDPELNEEEDKTVSEEGKNILAIIESLPEDERKKAWEQLE
FT                   MYVNYMQTKKNS"
FT   gene            complement(18578..19807)
FT                   /gene="yopK"
FT                   /locus_tag="BALH_p0026"
FT   CDS_pept        complement(18578..19807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yopK"
FT                   /locus_tag="BALH_p0026"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88184"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLU1"
FT                   /protein_id="ABK88184.1"
FT                   /translation="MNVVTRFPQKLKNGYNVSFVPARRSKTVQRLLNKLHDDLFAIGIT
FT                   DGELAKQLQVGKSTISETFSGKRDMKFYQFSGALMCAYNDDHDLRRKMIMEYVNLNSEK
FT                   DYGSYRETLEYTSYRGELELLNTMIEKEKGSSYAKNREAATVYEILYKRSLERFNGDEL
FT                   LNQLEDVRKKVKYVENSAMCDLLMCYLLYDTGNYRSILNYVKNAEEKVKQISVRKNRFI
FT                   KSSYNHRIIEILSAIHLLRGNVIECREFSLKLIEQCGSNPQFNIQRVNAFCNLGESYIF
FT                   CDYNKSLKYLQESLENLGDPFNQRLKAKKKLILQTMVFLKIYWDKPVGNLEVHPAEKAY
FT                   LEIKLGNNKKAEDILMDLLKVQGRLSAFQKFYLGLARNDRKLMEESLEIFEEKGNIFYS
FT                   QLPKRYLGYS"
FT   gene            20223..20570
FT                   /locus_tag="BALH_p0026a"
FT   CDS_pept        20223..20570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0026a"
FT                   /product="transcriptional regulator"
FT                   /note="prophage repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0026a"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88220"
FT                   /db_xref="GOA:A0RLU2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLU2"
FT                   /protein_id="ABK88220.1"
FT                   /translation="MKTTVGQNIKNLRKSFDLTQEQLSERTGLSRGQIKNWETDRHEPD
FT                   LESLKILASFFNTSTDALLNFENRKEDALLGLLFNDIQRAYEELDGRQQGRFAKQVSLY
FT                   VKMLQNNKDIL"
FT   gene            20703..21479
FT                   /locus_tag="BALH_p0027"
FT   CDS_pept        20703..21479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88185"
FT                   /db_xref="GOA:A0RLU3"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLU3"
FT                   /protein_id="ABK88185.1"
FT                   /translation="MIVCYDKLGNLTFRPKIIKKGGQNMETLAVLIFLASIVLFVLFII
FT                   AIFKKKPKAKLFISSIVCLVLAMVLIPTKDKEEKPKAKETTQQASKEVKEEPKKEEVKK
FT                   EEPKKKEEPKKEEPKKEEPKKELSKEGESSKVKIAVGSVETVSSVGGEYLNEKAQGVFK
FT                   VVEISITNNQKDAITVDANSFKLMDNQDREFKYSTQAQTAYDIGNGGKSDFFLNQLNPG
FT                   LTQTGKIIFDIPADAQGLVLKARGGMMGKEIKLKVE"
FT   gene            21978..22541
FT                   /gene="yjhA"
FT                   /locus_tag="BALH_p0028"
FT   CDS_pept        21978..22541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjhA"
FT                   /locus_tag="BALH_p0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible extracellular protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88186"
FT                   /db_xref="GOA:A0RLU4"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLU4"
FT                   /protein_id="ABK88186.1"
FT                   /translation="MEVEKKSKIWEYIGWGSFILVGSFLFFCALILVFGDPKTKYQAQE
FT                   VTAQGHEVKDAEKDVKKEYSVGETIKLGDHRLTVTDVKKSSGGEYDKPKQGHEYVLVAV
FT                   NIYNGGKEDISYNPFDFEMRNSQGNITRAVPSIINQNTQLSAGQLAPNGQVAGTVVFEQ
FT                   PIGEKLKLQFTPNFWSKKKIIVNL"
FT   gene            23171..24130
FT                   /locus_tag="BALH_p0029"
FT   CDS_pept        23171..24130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88187"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLU5"
FT                   /protein_id="ABK88187.1"
FT                   /translation="MKKTLGFMLVMGMGISLGFSNTASAETSKTNAHNKLEVKQTEDGR
FT                   VLGVESSEKLSLEQLDNNLIKMGFSFNEISNMQKDLKKELVKQGGKKANLELVEEKQEY
FT                   KSLDGQNYVINNDNKEKIQNIKQQDANKLLNQSSKNDSKIQRMNPPSAVINDELTFNLF
FT                   AIYEGTKGSDYVYKVFSNQMWTKRPYWNTTDTIGVVWEANAHAINGTESARQYWTISNL
FT                   GGGVNEHNTNVGADRSSLYGTQWKLPYKTDSINRGAYTSQKITIPQSYRGSNATVGAAF
FT                   AHPWFAYNFALNFGPGTIAFNDAKGDKWSLRYNMNVGS"
FT   gene            complement(24988..25209)
FT                   /locus_tag="BALH_p0030"
FT   CDS_pept        complement(24988..25209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88188"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLU6"
FT                   /protein_id="ABK88188.1"
FT                   /translation="MRAGGCYPFSDSREKGGDRMDSLFNLLYDAAKVFLTVFATAYANE
FT                   LAKKISSKRNKRTAPNAGKRKGGSKRKK"
FT   gene            complement(25603..26979)
FT                   /gene="xcpC"
FT                   /locus_tag="BALH_p0031"
FT   CDS_pept        complement(25603..26979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xcpC"
FT                   /locus_tag="BALH_p0031"
FT                   /product="possible fusion protein: conserved hypothetical
FT                   protein"
FT                   /note="chromosome assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88189"
FT                   /db_xref="GOA:A0RLU7"
FT                   /db_xref="InterPro:IPR009394"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLU7"
FT                   /protein_id="ABK88189.1"
FT                   /translation="MITGRDDLSLEIIQSLNDKTVRVKDIPHKYNVSLDQAKRLSRYLK
FT                   IKSVANDHLTSLVNEKIDLLGLKVLVIADLFKTEDWEGIEEILTLVNEDTTRDQLKEMV
FT                   LYLEGKRERLKSFLKEVKFKIRSLEGSKEKLKLTMNNLQLLKDESDLLLNKFKKYDKET
FT                   RDFLLEHVGMYQRIERGQTVIDLVLIKRLDSLFQKQLKDSGIITYVSLEFVHVIHSIDE
FT                   FTNAYLKRKKNHGGILWYYDTEAIRSSKKGFSAPFWPDYKEGVQLVGGSILKQIEQTNE
FT                   ELISIEKEIKDTEEEIKRLRKINIKSFSEAVMASNMLSDKEIQAHGELQSKVGKWLYSK
FT                   GYVVGFEVTLPNGRRVDVAGFNENQEIIFVEVKASDNDFQNDKKWKDYLSFCDKFYFFG
FT                   DWTYIPYSKDDKKDAGFLLKHGNTIEINCETKIEHAAKQRDQVIFCISRAISKKITYGY
FT                   "
FT   gene            28635..29465
FT                   /gene="repB"
FT                   /locus_tag="BALH_p0032"
FT   CDS_pept        28635..29465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repB"
FT                   /locus_tag="BALH_p0032"
FT                   /product="replication-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88190"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLU8"
FT                   /protein_id="ABK88190.1"
FT                   /translation="MLKMAITITVGNYKGGVGKTTNAVLNSYEFAKKGKRTLLVDLDPQ
FT                   SNATKSLMLTKSILNPDEIVTVEKTLMKGIQEGNLDGLEVEITDNLYLIPSYVDFQDFA
FT                   KFLYQNCASEAEEDHYFKGLLEKIKHKYDYIFIDVPPMSLEVTKNAVVASDYVLIALQT
FT                   QERSLTGAENYVNELIKLKEQYDLDIEVVGILPVLLKNNGKVDEYIMENAREIFGEENL
FT                   FKNIVPQMERIKRFDVNGITEKDRHDMNVIELYETISDELLSRIDMFEKMKVGV"
FT   gene            29455..29841
FT                   /locus_tag="BALH_p0033"
FT   CDS_pept        29455..29841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0033"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88191"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLU9"
FT                   /protein_id="ABK88191.1"
FT                   /translation="MVCKMARTPGLLGRKKSNFEPTEPYVPEQGQTVAENNEVPATPSQ
FT                   PKTEEKQVTRKEKRNEKTESKKKFKNQQGSIKISNQSKEELEVLMKLTNTKFAYEIIDL
FT                   LIDRYVENELTAEQKRKFKLLTEM"
FT   gene            29957..30316
FT                   /locus_tag="BALH_p0034"
FT   CDS_pept        29957..30316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0034"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88192"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLV0"
FT                   /protein_id="ABK88192.1"
FT                   /translation="MVPLEKKSQSFVVTVTPIEESSSLTIQSDQTNMKKEIQTPEKPDQ
FT                   RLVPSKTAKISPAVLLKLNTLKPFIQEQEGMDKTSINNIIDMLVEHYVDANLKDRHSKA
FT                   YKDMYKRLYEVLENK"
FT   gene            30333..30599
FT                   /locus_tag="BALH_p0035"
FT   CDS_pept        30333..30599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="Bacillus cereus group-specific protein,
FT                   uncharacterized"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88193"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLV1"
FT                   /protein_id="ABK88193.1"
FT                   /translation="MVILDKKYLVTVTPVLDNPVTNKKSPLSATDRKNIKVSPETLSKV
FT                   KAISTMKDMKNYELIDEILDYYITNKLDAHEQNTLNDIVSDRK"
FT   gene            30947..31876
FT                   /locus_tag="BALH_p0036"
FT   CDS_pept        30947..31876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88194"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLV2"
FT                   /protein_id="ABK88194.1"
FT                   /translation="MNSYFSKHKKCCRRLFPAFPPAVPPIIVKAKFLYVSSTDGGIDDD
FT                   TIEIYNIINPKVPVRVGEFASVTSLGPAGLAITGTTLYIANLGDGVEIYNITNPISPIR
FT                   IGEFGTADLNVPDQLTITGTTLYVANGGNNTVEIYNITNPTTPVHVGEFNAGNLNAPSG
FT                   MTTTDSTLYVANTGDNTVEIYNITNPTVPIRVGEFGTGDLNIPAGLAITGTTLYVANFA
FT                   DNTVEIYDISNPTIPVRIGEFNGGNLNGPAVLAITDTTLYIANTGDNTVEIYSITNPTV
FT                   PVRVGEFGAGDLDFPNGLAIFTIFGYNY"
FT   gene            32072..33106
FT                   /locus_tag="BALH_p0037"
FT   CDS_pept        32072..33106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0037"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88195"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLV3"
FT                   /protein_id="ABK88195.1"
FT                   /translation="MNSYFSKHKKCCRRLFPAFPPAVSPIPEPQGPLTIMTWNLYLGAD
FT                   FTPLVLATTQAELRQAVTEVFRQFLATNFPIRVETIARQIVLKKPDIIGLQEAELWQLF
FT                   VPGLQTVTYDFVKLLLSELKKMGLHYEVAALNENNSVQLPSSTGNIVGFLDRDVILIRK
FT                   ESGFKVIQKQEANFEAKLTILVGGQPFTIPRGWSSIDVSANGRIFRVINTHLEPLSPPV
FT                   QVAQGNELLTGPANTNLPLILLGDLNSNANGTGTPTYGNFINAGFQDVWIEVGEGQGFT
FT                   CCQDSDLLNAASSLNRRIDFILFKNGWNPIVADLVGEEQQDRTSTALWPSDHAGVVASL
FT                   ILPS"
FT   gene            complement(33427..34017)
FT                   /locus_tag="BALH_p0038"
FT   CDS_pept        complement(33427..34017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88196"
FT                   /db_xref="GOA:A0RLV4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR025052"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLV4"
FT                   /protein_id="ABK88196.1"
FT                   /translation="MTDEIVYSASEVYKRLGISDSTLRKYMEVLQREGFAVKKDNRGRR
FT                   QYTDSDIMVIEKLIELSKHDGMTLEKAAKMIAQQIEKVNPDLIQEEPEETDLVPFHIKQ
FT                   QLQEQYNVMAQEMNQSMLAMEKRLSDQAKQSNEEIKASVEAHNERVEKRLEARDETLMK
FT                   TLREMQEAKRMMQEFRDEVAAAKEKKKPWWKFW"
FT   gene            complement(34128..34391)
FT                   /locus_tag="BALH_p0039"
FT   CDS_pept        complement(34128..34391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88197"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLV5"
FT                   /protein_id="ABK88197.1"
FT                   /translation="MFKKLVIGTLTTGIIFSGAVGASAAELKTNSNVVETDKSSQLLGT
FT                   YYERAYSNKEDIEKEIEVDGKILTLKSYYFNYNAVLWIALYQ"
FT   gene            34887..36152
FT                   /gene="uvrX"
FT                   /locus_tag="BALH_p0040"
FT   CDS_pept        34887..36152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrX"
FT                   /locus_tag="BALH_p0040"
FT                   /product="DNA-damage repair protein (DNA polymerase IV)"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88198"
FT                   /db_xref="GOA:A0RLV6"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLV6"
FT                   /protein_id="ABK88198.1"
FT                   /translation="MYDYSILPNRIVLCVDLRSFYASVSCIKMGLDPLHTKLAVVGDVN
FT                   RSGSIVLAATPPLKALGVKKMARLYEIPRRKDILVVNPIMSTYIKCSNFITKLALQYVP
FT                   VEDFHQYSIDEFFMDITDSIHLFANDPYEFALKFKREIYAKTRIECTIGIGPNPLMSKV
FT                   ALDVEAKKTKDCIAYWKYEDVPIKLWPIRPLSKFWGISGKTEAKLNRKGIHSIGDLAQY
FT                   PLKYLKQSFGVIGEELHLHSNGIDFSRISEKYVPATTSIGKSQILMRDYTIEEFPIILL
FT                   EHIEEVCYRMRRQNKLAQTIHFSIGYSKNYAGGFRKTHTMNRPTNLTMDIYKICTYFLH
FT                   EFYTGEPIRTINVSLTNLINEGEEQISLFDNVIQREKEMKLTKVMDEIRTKFGKNSILR
FT                   GISYTNSATARYRNTLLGGHKA"
FT   gene            36149..36490
FT                   /locus_tag="BALH_p0041"
FT   CDS_pept        36149..36490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88199"
FT                   /db_xref="InterPro:IPR014962"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLV7"
FT                   /protein_id="ABK88199.1"
FT                   /translation="MNNANMPKGRGMVKWTPFAAMPEQFAGIREIVKEKTKVERPTLTQ
FT                   DEQELIENMLLCSLLSEEEILITYYEGGFLLTNYMTVVDIDPLNKSIICTDAFYNNMTL
FT                   KFIDIIDAK"
FT   gene            36660..37568
FT                   /gene="yqcG"
FT                   /locus_tag="BALH_p0042"
FT   CDS_pept        36660..37568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqcG"
FT                   /locus_tag="BALH_p0042"
FT                   /product="truncated conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88200"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR027797"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLV8"
FT                   /protein_id="ABK88200.1"
FT                   /translation="MVQIKVTPEMLEEVANRASNTRHALESIHNNLCNQIDHLCSQWIG
FT                   ASNQHFVQMFNDAKPKAFTSINSIVQVEEDLKRIAEKFRNTDNQDVTLEEDTAISKPSS
FT                   EEGFDGGKLARDIAGELTGEYDAKRVMEGVDPETGEKLSRWERGLAGVMLVAGLTPVGK
FT                   GIKVVKGAKKVADGIDAAAKLEKQRKTLKANQITGKEYETKMFESIKQQKPKSEITEQI
FT                   TVETKSGVRTRIDIGGKDPNGKIDLVELKSSMTAPLTKNQKKAFPEIEESGAIVKSRNK
FT                   PPFEHLEEIPPTKINVIRKEK"
FT   gene            37581..37934
FT                   /locus_tag="BALH_p0043"
FT   CDS_pept        37581..37934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88201"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLV9"
FT                   /protein_id="ABK88201.1"
FT                   /translation="MALHDTDQVDLVLIDDENENNVYLTIFDALNWENEEIEGEHILLL
FT                   QDKINTYLGFIESEEIYEKVPNTAGRKYFIIQVYAQHVPSYYGKKFYNMVSEQLGEAGY
FT                   GFEFHHKPIESLS"
FT   gene            complement(38131..38892)
FT                   /gene="plyG"
FT                   /locus_tag="BALH_p0044"
FT   CDS_pept        complement(38131..38892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plyG"
FT                   /locus_tag="BALH_p0044"
FT                   /product="N-acetylmuramoyl-L-alanine amidase (endolysin)
FT                   (cell wall hydrolase)"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88202"
FT                   /db_xref="GOA:A0RLW0"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR021976"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLW0"
FT                   /protein_id="ABK88202.1"
FT                   /translation="MRVSSHGGHNAIVPGANWGNRKEHLMDRECNKDFINKLCALGHSV
FT                   EDDTDDVGRTANAIVGNQVRNINDRPNDVGFAWHLNASNGEGHGVEVLCYSAKEAPMAA
FT                   RISAEIAKRTGWKDRGAKIRPDIGVIRSSNCPFFLVEAGFIDNEGDMAKWNVDAITSAV
FT                   IFAYFGQECGVGSSIVAPTQPNKQNIIQTGSFSPYEVPDVAGAMKSLNMTGTFLLQGDG
FT                   LTFVVTDPTSDTQLKAMKEYLDRKGWWYEVK"
FT   gene            complement(39119..39400)
FT                   /locus_tag="BALH_p0046"
FT   CDS_pept        complement(39119..39400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88203"
FT                   /db_xref="GOA:A0RLW1"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLW1"
FT                   /protein_id="ABK88203.1"
FT                   /translation="MTIEIGVLIAVLSLAISYFAYSLNRTKSIKSDGQQSAEMKAELGY
FT                   IRKGVDDIRIDLKASEKQMIALGERVTRVEESSKQAHKRLDNLEKEAN"
FT   gene            complement(39442..40110)
FT                   /locus_tag="BALH_p0047"
FT   CDS_pept        complement(39442..40110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88204"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLW2"
FT                   /protein_id="ABK88204.1"
FT                   /translation="MAKYYGYCYDEEGRFTEMISLAEKEIYEKQTFYREETKEIVTEEK
FT                   LCELHQSIENGTYKYQEDEEPPISKYDCPDCVQYYVRYETIKVPYEEDVVIGYEPDIPA
FT                   NCTLEVCPDGIYYPLFKDGKWVKTVEPKPEEPKPEEPSELEKIKKQLADIQKELEDIKN
FT                   QKPPTLEEPEVPIAFAAPIQDTPDYEHEINKIKQVIPDLGEQIVDLNSRIADLENKEQV
FT                   "
FT   gene            complement(40125..41756)
FT                   /locus_tag="BALH_p0048"
FT   CDS_pept        complement(40125..41756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88205"
FT                   /db_xref="InterPro:IPR018913"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLW3"
FT                   /protein_id="ABK88205.1"
FT                   /translation="MAEILKIREITIDTMQHKEFNVKEEELKLIRFYQNDLNSAKLLIN
FT                   VTHDKVVTDFSSATSVQIAFLKPDCKRVFQDVQNVNQMQGKYYVVLSTQTLIAYGNVIA
FT                   QLRFTFPNNKVIETCKFAFTVDESIMSDDAMKSTNEFPVIQKAIEAGKKLEGVDIDGII
FT                   AAGELAKGAVKKSGDTMTGNLDLDVTSSTKAIRATSGGVRQQGLFFDPSGDFGMYDWAS
FT                   SKGIFKYWKANNLLEFLGNVNVYKKTEIYNGFTTGEGKAISRNDTDLNDLIEAGQYTGQ
FT                   RMKNTPENSTAFFYVEVIRYGAADAYRLQRATNLSGNTIKMYFRVLNNNVWTPWMTIAD
FT                   TTNMQLDISAPNGDASLQARSGEDILAKVLGVGRGFRTFYAAGSALNTPNTLAIRGVSN
FT                   MHGTSYGYAIGVTTDNRVWSNFINGTTWSGWKCVNGNDKDGRANINLTADAELFTGNTV
FT                   IADRRGNTVTLRAPFRKKSGGNTAPMFTLPVDMRPTLTVLQNVSSIDGVQGLFVINSNG
FT                   EVWMQDLGSSSVTGKSFYITSTYVTN"
FT   gene            complement(42051..43898)
FT                   /locus_tag="BALH_p0049"
FT   CDS_pept        complement(42051..43898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible phage endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88206"
FT                   /db_xref="InterPro:IPR010572"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLW4"
FT                   /protein_id="ABK88206.1"
FT                   /translation="MYVRDLENIEYITQTTYLIEEELNGNCVFSAKIPPNKVNLTFLNR
FT                   LSEMWTLVDDNETEYKVVYLKKQGEGKTLTAEIKAVPKFYDDFDNDRVYEEYNQYFTAN
FT                   ACFATIFSGSGYVYQLNGSYNSLQWEGFGGGSTRLEMFKDALNRYGAEFKVLGKVVTIE
FT                   PQIGVDLNVMYRHRLNASNIVQEVDASGFWTYAKGYGDFTEEDGWQGAKLIREYTSPLA
FT                   SIPGIGVRHAPPLKDGRIKLNATMENSLKKIVNESLKISVTADIHDLTKQKYPIAQSGL
FT                   GDRVFLIDERIGLDAEVRVVNRSVLRDWRGNILDVQLTFGNQDITKRYQSNLDHAAKTI
FT                   NDLIEGREKLPINAMAAEVANVTSMILGVTSELDITPQGLIAKDKNNPNYVVVLNSAGL
FT                   GVSTDGGMTFRNAITGRGVVAERILAGEIKGSTLRTDSGSNYVHIEKQFIRLMESNLTR
FT                   MYFGYYWNKNGRMQPTILLHENVDSSVFNDGTMAISQQNLGDYYTASVGVVKGRTITGD
FT                   PAFPSSLYLNSNGNTHLFGDNKTTITGEMGIDFRSFKQITFNAGGSVSFNTQISTQGVN
FT                   IAGGGPDSLGTIKYMNGSKGWGAYLHIGTNGWAFMNISI"
FT   gene            complement(43910..44791)
FT                   /locus_tag="BALH_p0050"
FT   CDS_pept        complement(43910..44791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0050"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88207"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLW5"
FT                   /protein_id="ABK88207.1"
FT                   /translation="MDVQITRMNGQTMKLSDINVQVQDFRVGSIEMRPTYIDVEGASGR
FT                   ISTGSTYGVRNITVPFYFKAQDLLDVAITRDKLFEMILSTEPFYIRELRRLEYQNGDNL
FT                   IVSGKRYKVNMSSTFDIDQQLKYGFGELEFETADLPFAESIGKSSDIQRDGVNPGSGLW
FT                   GAGMGIISDPASRVYKHKAVAGQRFQIFNPGNIPVHPFEQELKITISDVAGSTAGFMLK
FT                   NHTNLSTATITSALYITDTIIYSGPNIGRNGLSFLRNTKKDFIELVPGWNTLEVFNCTS
FT                   ATIEFDFRFYYK"
FT   gene            complement(44791..47517)
FT                   /locus_tag="BALH_p0051"
FT   CDS_pept        complement(44791..47517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0051"
FT                   /product="possible tail length tape measure protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88208"
FT                   /db_xref="GOA:A0RLW6"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLW6"
FT                   /protein_id="ABK88208.1"
FT                   /translation="MATQEELVDQFRAETDQMRREIQQMRREMNDFVTSTSRSSREYRR
FT                   SIENMGNANSEYSRRLRQMKYEQREAMKPHIEELKRTKLAYLDAAMSMATYSGSAQDLI
FT                   AQVNRIGKAEKAANDEIMKLDRMKQASILQTIGMLNNMSTTSSKLQGNLQRMGNPLYNV
FT                   SRGALAATNAMERLANRSSAAQLALEFLGPTANMKQLNDQIRIINQSVMGMGQAFLVVG
FT                   AGAVMFYGKLHKANMEMNPKYAKAYKDMMESLTEALQPMRDAFAALMIPIYNFVNTMAK
FT                   MVIAFNEAHPTLAKFIQGTMMLVPALTLLLLPLGAGMGLLKGYRAAFAALWMIIKPAVM
FT                   VLAMASPVAWALAAAITGLALGFTYAYKNIEPFRNAVNNVITVFKAFWQVLQGNSDGAA
FT                   SMLTSLGMSPENTRAIISFGETVRGVIETIKQVFLSFAVFMQGIFALFAGDEENGTALL
FT                   KSLGMNQATITTVVNTVSSIKQAISEFLSEIWSFMTAIGTQIAQFWLENGSQIKQAFSD
FT                   CWSVASEIIKSVMPIIVAVFQFAWPIIKEIVIGTLEAIRDFIQGILKVILGIVKVFSSL
FT                   FTGDWAGVWEGVKEIWFGALEAIWGYLQLWGAGRVLKWLGKFGNDIGRLFGKFWGDIKK
FT                   IWNDALADLYVFFGSKLETITRLAQSWGGMFKNFFVGIWDAIIGGIQNKMNNVVSAIGW
FT                   VLGQAVNTVQRFVSYFFTIGQQMISGLINGIYSYANKLIDQVFNIGRSIKDTITGFFRI
FT                   HSPSRVMRDIGVYVGQGLDQGMDSMINPLVRTALDMASAVKDGFSSLTESIQMGDILPG
FT                   SVVAPVIPSISGSYKAPSYVSGVNSSSDFGQQAMINSQSANVASQNDNRLVAAAVKNLG
FT                   DKLDNLQVVMEGETVGRIVRPHVNEGNAVENTVRRYF"
FT   gene            complement(47533..47808)
FT                   /locus_tag="BALH_p0052"
FT   CDS_pept        complement(47533..47808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88209"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLW7"
FT                   /protein_id="ABK88209.1"
FT                   /translation="MPSEVMALTPREFENLMIGRNEQHLDELQTNSVFALMMRVAYHHD
FT                   PKKKLKPSDLFDRNKLNGENNQDLTIEEKMQKAQEHMQFLQTLNFN"
FT   gene            complement(47871..48287)
FT                   /locus_tag="BALH_p0053"
FT   CDS_pept        complement(47871..48287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0053"
FT                   /product="possible phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88210"
FT                   /db_xref="InterPro:IPR024410"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLW8"
FT                   /protein_id="ABK88210.1"
FT                   /translation="MRFEIDKKEYELKLTFGNIYELNKKYEGGSNEVVMACMQGDLELF
FT                   VDAIYFGLMHTKEGFTRDKVMENIEKQFEEGKISQEFIEELLNEVVAESTFYQKTTKKL
FT                   RKQMKKQYLAKNPEAAENPEMMEMVEEMFGKVEE"
FT   gene            complement(48353..48826)
FT                   /locus_tag="BALH_p0054"
FT   CDS_pept        complement(48353..48826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0054"
FT                   /product="probable phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88211"
FT                   /db_xref="InterPro:IPR011855"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLW9"
FT                   /protein_id="ABK88211.1"
FT                   /translation="MKNMAETAGTVKNKMYRGDEFIIAAKIKDQTNQTILVRPFDQTED
FT                   SHNIEADEIEAESKDRSYSDYGKRKETRSFSCTLAEGDPYYPAVKAAIRNGEYMEIYEI
FT                   NMRTKEAEAGNYMITSFERSSSNGEFVSYSVEVKLSGSVRTETLTEIPKGAGQ"
FT   gene            complement(48832..49260)
FT                   /gene="yqbJ"
FT                   /locus_tag="BALH_p0055"
FT   CDS_pept        complement(48832..49260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqbJ"
FT                   /locus_tag="BALH_p0055"
FT                   /product="possible phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88212"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLX0"
FT                   /protein_id="ABK88212.1"
FT                   /translation="MGTEWSEIIMYEQIHGSMKAFVYDSLPANTFAYHDQVPEELVIPS
FT                   VYYPILSINDDKTSKDHYTLLYTMVVRFFNATTDKAMQEAEKVANKIRSNSYTVHLRNE
FT                   DGSESIDTIYFRRVTTAPSGVGSAQLTMIFEYQQAYVN"
FT   gene            complement(49712..50104)
FT                   /gene="yqbH"
FT                   /locus_tag="BALH_p0056"
FT   CDS_pept        complement(49712..50104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqbH"
FT                   /locus_tag="BALH_p0056"
FT                   /product="possible phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88213"
FT                   /db_xref="InterPro:IPR024556"
FT                   /db_xref="InterPro:IPR038667"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLX1"
FT                   /protein_id="ABK88213.1"
FT                   /translation="MSLQAMMVHECDIYHLQKETKPGKYGQPGEEVYLYHDTPDIAEQI
FT                   CYFAENVAIARPTAIQSAPNQLNEQHTRVLFMPGTDIKHNDKVIKKNTNVVYYIRNPFP
FT                   VVHPLTGEVSHIKATVERKSEPWLAK"
FT   gene            complement(50104..50502)
FT                   /gene="yqbG"
FT                   /locus_tag="BALH_p0057"
FT   CDS_pept        complement(50104..50502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqbG"
FT                   /locus_tag="BALH_p0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88214"
FT                   /db_xref="InterPro:IPR013514"
FT                   /db_xref="InterPro:IPR036558"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLX2"
FT                   /protein_id="ABK88214.1"
FT                   /translation="MISMPLITAQELIDYTVLPEVKNRPVPLLEQDILEADTEIYNLSK
FT                   IDFSDKTKYPEVPEEVKLACKKLAQYYAYTNADTTAMKGIKSESIGSGDYSYTKDSSSI
FT                   VKPSVLYLLQKFMDHKGKNKVIFKMRAI"
FT   gene            complement(50499..50681)
FT                   /locus_tag="BALH_p0058"
FT   CDS_pept        complement(50499..50681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BALH_p0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88215"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLX3"
FT                   /protein_id="ABK88215.1"
FT                   /translation="MPLVQYKQKTGVLHIGGGRYFYANEPRKVTAKERDELLSTYSDLE
FT                   EVKESKTSSKSQESE"
FT   gene            complement(50698..51615)
FT                   /gene="yqbE"
FT                   /locus_tag="BALH_p0059"
FT   CDS_pept        complement(50698..51615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqbE"
FT                   /locus_tag="BALH_p0059"
FT                   /product="capsid protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88216"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLX4"
FT                   /protein_id="ABK88216.1"
FT                   /translation="MNNGQIIAGGSTDIVLKDVNVPLPQAAAEAFLRDTINKATVLPKL
FT                   NPYYKKAPAGNIDTLSVGKRKLREASKNDTPTGVGSIAPGQIPYAVKKVKWDEWIQNDD
FT                   VWYALASRGQNVEDVIISMIQEQFGTDLQDLAFNGDTSSTDPFVKIIDGFVKKAKASTN
FT                   KTDLAAEEVTVQAFVDHVAILPERFKTRKDIAWFITQKTHDKLMSLLTNRQTNLGDAVL
FT                   VDGKVTKLGGYEVEIVQEMQSGFAMLTPRENLKPVFTRDVRYNRTAQGATAAAKDATYH
FT                   ILFAYLDCVIREVDAVAWMTGEKL"
FT   gene            complement(51631..52818)
FT                   /gene="yqbD"
FT                   /locus_tag="BALH_p0060"
FT   CDS_pept        complement(51631..52818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqbD"
FT                   /locus_tag="BALH_p0060"
FT                   /product="possible phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88217"
FT                   /db_xref="InterPro:IPR027924"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLX5"
FT                   /protein_id="ABK88217.1"
FT                   /translation="MKKRKLKNLQVSHVSFVENGANQRKFFLTKSEEQPNFEKPVKVIK
FT                   SDDEAERLVYGIVYEPDTIDAHGDFADAKTIEKAAHEFMLKYRQIDKNHDFVAGVGEVV
FT                   ESYIAPADMELNGEPVKKGTWILTTKADEETWEAVKKGEFQGYSLAGVAETEVIEEEVS
FT                   KTKDKQMKSFFQLVKGFFGGENVQKGEVRDKFNQNKHRRDVNASFSALEDTFYQSLWNA
FT                   PTADAIDLNRIEAAALEFVEIINELKGTEAVVKEWENKPAISLAVEVEKAGKKISAPNM
FT                   ADIDAAIESLTNLKTRVTPSPEGAGSEEDNMNQEQVEKLLKGLEEMQGEMATIKKHLNI
FT                   EPEKTPEQKMNEKVELLEKQLEELKKSQGISNQQDTDGTTNVQKSASGYAGYFGN"
FT   gene            complement(52865..53815)
FT                   /gene="yqbB"
FT                   /locus_tag="BALH_p0061"
FT   CDS_pept        complement(52865..53815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqbB"
FT                   /locus_tag="BALH_p0061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88218"
FT                   /db_xref="InterPro:IPR006528"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLX6"
FT                   /protein_id="ABK88218.1"
FT                   /translation="MTYWSRCKMQKIDKLLDSLNEWIEKADTDDFTASLPADLEVLDML
FT                   PGYVEEFEKEIAKLLRKQKKHFVDGIKNYTKKDAVEKGIKIKDIIDFVTGSLFGADTFA
FT                   KSLSKAARKFLNYTMKDMTKAFMDAIDPDIQFNIFSKRTTKWIDSWSDELGKIMKINSH
FT                   KAVERILNEGLEKGKGIKEIARELAKLPEFDRKRAKTTAQTEVLAACSASQFESYRQSP
FT                   AVTGKKWRHSGAKNNQPRDNHVAYDGTTVLVEEEFELPGSGERCMFPRDSSLSAKERVK
FT                   CKCVMSPAVDNNILGLSEEEKQKIREETLKELNKK"
FT   gene            complement(53778..55316)
FT                   /gene="yqbA"
FT                   /locus_tag="BALH_p0062"
FT   CDS_pept        complement(53778..55316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqbA"
FT                   /locus_tag="BALH_p0062"
FT                   /product="probable phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BALH_p0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABK88219"
FT                   /db_xref="InterPro:IPR006430"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="InterPro:IPR016753"
FT                   /db_xref="UniProtKB/TrEMBL:A0RLX7"
FT                   /protein_id="ABK88219.1"
FT                   /translation="MTNKRKVSAKVIKAAGTNTQVLSRQQESENEKYAVNGIIEPPYRI
FT                   EDLQQIRENSTILGQCIDAYKRNIAGFGHEMKYKQEDDKETPEMKAEWSLVDTEVIPLF
FT                   SFDKPFKEILETAIDDKETTGNGYIEVIRNLEGKPAELINMLPQYMRVTRKDDEPQEVT
FT                   YLINGKEIKRKKRFRRYVQQVGAVDTYFKEFGDPRFLNKETGEFSDASLGEKNATEVLH
FT                   LKIGNGPYGIPRWVSHVVHMVGARKAEELNLRYFKQGRHIPMAILLKNGILSEDSEAAI
FT                   TDYVSNVEGEDNQHKYLLLQVESAEEGVVGDTQPNVDIELKSLADILQNDALFLEYDEK
FT                   SRQKVQSAFRLPDVYVGYIRDFNRATAESVREITEEQVFEPERNNLEFIINNVLLLPYG
FT                   LKHVYVNLRKSEISNTEDMVKTIEVLADKGGLTFQDIRNIAGNMLNKEFSDYDMPEADQ
FT                   PVALVLERHRKVSGWEKGLSEKLQKSVDSGSNEDLINVMKDLRDLLESMQDAED"
XX
SQ   Sequence 55939 BP; 16476 A; 11457 C; 8766 G; 19240 T; 0 other;
     tcgtttaaag aaaaccccgc tatacatctt gtaataacgt tgctttacct tttcagacaa        60
     agataagtta tcgtccatcg taaagcgaat gtgtagcaag ttcttttctc tcgccttatc       120
     taaccattct gttttaaacc aatgataagg tccaccaggg ttacagttaa accaaacttt       180
     tgaaccttct acagaacaac gtccagttgc ttggttaaca aatgaacgta ccataagcac       240
     aacttcgtca aaaaaacatc ccgctaaagt aataccttgg ataagatctt gtgacgcttc       300
     atctttccca ccaaaaatat aaaagaaatt tgttacgcca tctttagtga tggtaagcat       360
     attctcacta cggtgatcct taaccttata cccgcgagat ttcagcatct ttttaagtgg       420
     cgttataacg ttacgacggt gcgaaccaat cgttttacca cacataccga agttctcacc       480
     ttcaaacgat tccattgccc acataacata ggatagagcc attgatactg tcttaccagc       540
     acgaatggag ccatcacaaa taatcccgtc ataatcttta acgggactgt taggcttcca       600
     ccaggttaat accttcagct gcttcttgga gaatggctta aatttgaatg gagcaggttt       660
     ctttttacgc ttcggaatcg tcgtcatggt catcccacac ttcctctacc ttaccttcta       720
     gcgcttcttt gaaaccgtcg tcttcgtaat catcaccatc ttcaccttta atgcgagcag       780
     tgtcagcttt aatcttatca acttgagctt tctgtacttc catctgcatt ttgtggcgtt       840
     cctcttcaat ttggcgttta aagttgtcag gaactaaatc gaagtactgc gccagtttat       900
     ccagggcttt catcttgtca gcaagtttaa ctgacactcc atctttccct agcttcactt       960
     cagtaattat ggaaccatca accatgtcgg cttcatgtaa gtctacataa ttgacgatac      1020
     gagttatctc ttttcctgat tcatctttca taggaccata taaccccata acaggaactt      1080
     ccttttgtcc aaaagtcaca tagttagtaa tatcagcaaa ggcaatctta atgtactctt      1140
     tcaacacatc cattgcttca acaaatacat tttcaactag ctcgccctta agctctttta      1200
     tataggaaga aactcgttca cgtcttagta atcgactagc ttgcacgtga gcaccatctt      1260
     tggagtaacc agccttcagt gcagcttgcg tgccattgaa gtatttcacg taatacaaac      1320
     aaaagagcct ttccttttcg gtcagctctt catcctctag aatctctttt agtttttctt      1380
     tcgttttggg atttttaaca ttagtaacgc tccttttcgc aatagtaacg ttaccattca      1440
     tttgttcatc ccatttatct tgtgatttcc actttctaat ttgtgaaggc ttgagattta      1500
     actcatctgc aatatcaatt agtggcttct cacctttact tgttttatat atttcaaatg      1560
     ctttgtcacg atctgggctt cgttgcctag ccatattcac cacctcgcgg taatccctaa      1620
     tttattcttg aaattctcta atactcgatg tattatattt ttgtgttttt ctcagttccc      1680
     aagccgagaa tacatcatca cttctgaaag gacccgaact ccagcgggtt ctttttattt      1740
     acttgaactc attttcgaat tattgtatta tattttcggg tcttgctcca tgaatcatta      1800
     tcatgagaat ctgcaagttt gcaggttctc tttatcaaat aaaaacatcc attatatgaa      1860
     cacttcatgt tattatggta aagctgtatt aattcagatt gatatgtagg tgagactaat      1920
     ggaaaataaa gaacctgaac aaaagtacga tttaaccaaa atatacacat acacagaaca      1980
     tcctgataaa atcagtggtc gttgtgataa ttgcggaaat accgcattca aaagttccgt      2040
     taaaaatttc atctatataa gagaatgccg taaatgcggc atgaagaaaa gtatctagcc      2100
     caggtagggc ttttttcttt ataaaataaa aaagcagcgg attcgctact ttaaagtaaa      2160
     tgatttaatc ttgaattccc tttatcttcc ttgccattta aagagtacat tatatcttgg      2220
     tgttttatca ttcttttatg attacgcggt actctaaaat cttttctatg ttctttaatt      2280
     gtaattattg cttggcagtc aatattcagt gcttttgata acatgtaagg attatatcca      2340
     ctgtctaaca atgatattac ttcataaaat atagcttttc ccccaactgc tctcaataag      2400
     tcttttctaa atttatctct ttctctatct cttttctttt gcagttcaag tgcttttgct      2460
     gcaaatttct ttctcttttc ctcttctagc ctttgctttt cgagttcaat ccgttgtttt      2520
     tcttgtttcc ttattaattg tttttcttgt tttaaattcc tagcaacatc ttcaattttt      2580
     gcttgttcca cggcttcatc aatttcttgt ttcatgataa ccttgctaca ggttttattc      2640
     gttcgtttaa tatattctgt ataaatatca ggaaattctt cttggacttc tttatttaaa      2700
     acggtcttat attcaatcat aaattgtatc tctaacaagg aacgctttaa cggactttcc      2760
     tctagtatat aagctatttt attaaataaa taagaaagct cttgagtatt tttagaatat      2820
     cctttaaagt gagcgttaac tcttttctta atactcaagc cctttcctac ataaattata      2880
     ttatcttcta catccgttat taaataaaca ccactatcaa cctgatgaac tcgattatta      2940
     aattcatcaa ggctcatgaa ttttaattct cccatacctt tcccctccta cataatcccc      3000
     ttttctttcg ctctctcata aagaaccgtg cgacttacgc tggtaacttc acatatcttc      3060
     ttaactgtgt agccattttc ttcacgatta gcaagcaatt ctaaagcatg ctccatttta      3120
     gggtttttat caccgtactt cttaggtctt cccttatata cgccacgttg tttagcaagg      3180
     tctatacctt ctctttgacg catcttaagt aaatcccttt ctaactggtt aacaccagcc      3240
     ataacagtaa gtaggaaagt actatatgga ttatcacttg tcgtatcaag ccaagtatct      3300
     tttaatgatt taatcgaagc tcctttactc ttaataactt caatcagttc aaataaatcc      3360
     tttgtactac gactaatacg tgttaaatcg gtaactacaa tcgtgtcacc tgcttttaaa      3420
     ttatcaagca ttaattgaag ttcttctctg tttgttgtcg ctccgcttgt tttctcttca      3480
     tacacatgat cacatccata atcacttagc tgtttcaatt gccttgctaa attttgttct      3540
     tgtgtagaaa cacgagcata accgattatc ataatatctt cccctttgtc cgttaacatg      3600
     ttcggaaatt aattctaagt acataatacc atttattttc cgaacatgta aacaggacgt      3660
     tggtaaatat aattaattcg tttgctctct tatgtccgta tagggtagac ctaaacggga      3720
     catcattaac tatctctatt tttgttactt cattagcctc cgaatgtata tagccaagag      3780
     aaacccaaat tctccaattc atgtacttat accattacaa ggaggttgta ctatgaaaat      3840
     agaaatcaag gataaactaa acattaccgt ttcacctgaa ttcgttgcag ctactggtga      3900
     attaatctca gcccttgctc aactaatcca agctctccac ctagcaggaa tcatttgatt      3960
     cttgcttttc cttttcgttc gttgtgttcg tttgttttgt aacccttatc tttccttaac      4020
     aacaaacaag acgccaccca gatcacggca gcgcctacga taattgctat tggtttaatc      4080
     atttaatccg tttgctatgt ctttattaaa aaattcaata tgatctttaa cctctggaat      4140
     ctgtatcaac gtacccaaac tagcaattgc atctcctaat tcctcaaatg cttttgtaca      4200
     tttctcagca gcttgtgtta atcgttcaat tctctcctgt gcttcatcag tatcaacatt      4260
     aacttcaata tctaatttgt tcctaggaca ctttacttct tccattattc atcctcctat      4320
     gcaacttcac gtttaatgtg taatttctat ataacaaaga aaaaagcacc cgttatggat      4380
     gcacttttct ttactatact ctattcgcat ataaagtttg gaaaacttct tcccatcttc      4440
     tttcattatg aaactcttgt gctaatcctt cagcgaaatg gtaatctccg cgatgactcg      4500
     gtacagcttc atatatttct tgttcgaata tatggctact tacttcttca cctctaccaa      4560
     ttttcacacg ataagaatcc ataacatcca taattgcacg atattctagt tgggttacat      4620
     tacattcgaa taaaaatcgt gaaagacctg tattctcaaa taataactgt tgtctaaact      4680
     caatatgtgc taaacgttct tctaattcag tgttttccat ttctccatct cccttgttct      4740
     aatatataca aatatactta ttcgacataa ttagatacaa tcctctccaa agaaataaaa      4800
     aagccaccac cgaagtgaca gctttctttc aaggggatgg aagagagaaa acaaatggca      4860
     aagtttctct tagtccaagg ctgagtactc tcaaccttct ccaagccacc gcatcaacta      4920
     taatggctac acgccctgtg ttcggtgact gggagaagag caagagcttc ctatatctct      4980
     ttcagcactc atatgttgct ttctcttctc gtttatactc cgtagagtcg aaatgaatcg      5040
     ttcctcgagt caattcattc ctgtttgatc aatctgcgct cagttacgac ggggagcaag      5100
     tcccatacat acataacctc tttcaacata cagtttccta tatgctcaaa gagagctagg      5160
     gactctctta taaaggattt ttaatttata tcaagacgtg tacgtttctt ccgacgcctt      5220
     gtttgaacca gcacatgcat tagacggagg ggacccgttc cgttgtactg gctcaaacaa      5280
     agagcggaac tctttgccct cgttttggtc attaataaga atcgtgagta attactaatg      5340
     tacgagatca cgtatacttt tttagatttt tagaatgcaa gtgtcactca atcatgagca      5400
     accacccccc attccatttt caagaaccga catactagag agtaatagac ttatatttat      5460
     tatcaaccca gaggacgcgt tccgagctga ttgataaata caaattagaa acagcatgac      5520
     gaatgcggta tatctcgcac ccgccacact ggaatatgtc attgtaatac attcattggt      5580
     cttttcgtct taacgcgggt tcttaccgcc ttgcccgccc tactatgcgg tatacgttac      5640
     cgtgacattc tcgcataaga acgtttcact tataggtgta ctaatcctct tcgatatgcg      5700
     gttgtcaaag ggcttgtaag ataataataa tttgaatcgc gcatctactt atccgctcct      5760
     ttatcgttaa tttatccgca ttttatccgt gttttttaaa taataagtag cgattcagcc      5820
     aatgccataa tcgcatgtct cttttgtgta tagaaccagt tgttctccat catcatttgt      5880
     gcttttacgg ctttatcgct catcaatcca ttattaagat acttcctctc aataatctcc      5940
     ctctgttccg gatctagcgc atgttctaac gctctcttca tttgaatgta ctttatatcc      6000
     tttattttct tcgtattacg tatttcaacg aaaggactac tgatattttc cgcagcacac      6060
     tcttcctgat taatcatacg aacttttaaa gctctgtagt tgaataacgc ctttgctact      6120
     tctctctgta tctttttgta ctcctcattc gtgatttctg gaaagaatgc taattgctcc      6180
     atcaataatc cccctatttc tgaatttgtc tttttacatt cacatcaggt acgtgaaatt      6240
     ttactatctc tttgttgaat aagggaaaca tgcatagcga gtagccccca ccatccactc      6300
     tgcatggttc cgttatccat taagccttta ataacttacg tttcctgttt tccatcttct      6360
     ctttcgctgt ttcaatgtta ttcgctatct tttgatggtc cagatcaaat tgaatcatgc      6420
     catcaaacat aactggcgcc actgcttcat ctacgtattg caagtaatca actggtgctc      6480
     gttccgtctg ttctactaag tacccataaa tgtcaaaatc tgctcttggt atcgacttct      6540
     ttccttttgg ttgctgcgac atccttacgt aagattgaat gactgacagt ggtaccgcga      6600
     atactgactg atccttacta aacccaataa ggaagaaaca aattgctccc atcttctccg      6660
     ctgtctccag gtaatccaat tggtgctgcg cgatgttctt taaatcaaat ctatttatct      6720
     catttgtaga cttcgcttca aacgctatag ctcgtccctt gtacacgcca tcatagtcta      6780
     cggtactttt agattcgtaa tatccatctt tcacacggcc ataaaccatt tttaatacct      6840
     tcacaggagt cggacgcttg tttataagcg ccactccctc acgttgatac atttcattcg      6900
     ataaattaat aagcttctca aaagccattc cacgattacc ttgtcccatt tttattcctc      6960
     catttctttc ttacactctt caagaaactc aatcatctct tggacctgct ctttagttga      7020
     gaaactctct atacattcac ccaatacgct atacaatcga atgttcctat cttcctcaaa      7080
     ggtaaccttt aagtcaccag tctctccaaa cctactccgt ttctctggca ttctcccaac      7140
     ctcgctttaa aaggattatt ttgttgagtt tctttccgaa cgcggtgtgt acactaaaac      7200
     aggctctatt ttccctggtg tatacatcac atcatcaccg cagtatgggc aattgttata      7260
     tctttcagaa tctaactctt gtaaactaat tttcccgcaa tcatcatcta cgcacttcat      7320
     ttcatacaaa gctaattcag acataactac ctctcgcttt ctaaaagttc atttacttta      7380
     ttttttatgg cttgcatgtc ctgatatgca cctaacatat ccttagtctt atagttacat      7440
     ttacctaaac gcatttgtac attccattta accgcactaa atctactttc gcttttcctt      7500
     tgattctcca atcgaataac agtgcgccta cgaaccattt tcatttttct cttcctcccc      7560
     tgaataaaac tcaatattcc gtcaataata tagataggcg atagccagaa cccatttaat      7620
     gaagtcccta gcctttctcc tagttccccc ttggagatga gcagttagct tttgctagct      7680
     gcttttttat tcctgatctt tttcataaca ccctctacac tgaaatattc gttcttcact      7740
     tttatctggt gagtatagga aagccggttc cccacacaaa caccatttcc actcatgatc      7800
     atctcgcaac tgtaatacct tgttccctct tctaaagaaa cctaaattac ctttaatcaa      7860
     tttaatccgc tccttagtat gtttacacta agtatcgttg tttcgactat tccttataca      7920
     aaatgaaatt tttatataaa agactcacac ttaaacaaac ataatttcat atgatatatt      7980
     gcttctttct ttttagagtg gatagtcatt acagaagggc acttcccgaa gtgctcttac      8040
     atttccatac caaatagcgt ttttgctcag ttctatcaca ctcaagacat atagacaact      8100
     atatattaag gtgttaaaat gttagtgtga ttcccatatg gtttcacaaa cgactttttc      8160
     tctgttcgtg gggcttttac gtaatagtaa gagccatttt tttatacaaa ttacgatttt      8220
     gttcactttt tcgatacatt tatgaaacat tcatgtgtta tcttcagtac gttctattct      8280
     ttttataaaa tcgtgtgagt tataccaaca caagaagccc tagagcccta actctagggc      8340
     ttcttcattt aaataaagat tttataaata tcgttatttc caaatttaat aatttatgtt      8400
     aaaatcagct catatcaatc tttttacttt cactttaaag atgatacttc aattgtggtc      8460
     ctagtttact agggcctctt ttttattttt tgaattttat ttaaatccat taaccaaact      8520
     catgtttttc catacaatac tactaccttt ctgtataatg tgagctcgtc actttcatta      8580
     taatgaggca taaggagcgc tcttgatcag cgctcttttt atttgttgtc aaataagaat      8640
     tttgtttaaa aattaataac attctctagc ttggtgcacc ctatacctaa aaggagcatt      8700
     tatgaaaatt ttaaaataca tatcccttac tattggatgg attgcattat tatcaatttg      8760
     gtatgtgatt ttctttcctt aacccacaag ttaatttgta cagtatgcgt ttcttttatc      8820
     gcactattta ttagcaacaa catatactta tacggactat aaaaaataca aaatatagtt      8880
     cttggtcgaa gagcaccctt agggcaaatg gtgctctttt tgattaaaat aactattttg      8940
     ttataaagta actgcttctg ctgcaggttt gcttttatct aattgttcaa ttgccatttg      9000
     tagtcctaac caataaccta ttaaacggcg tggcaacctt tttccaaaat cccaaatgta      9060
     ttccattgtg tcagactcta atgaactatt atggtaaacg ttacccaccc aaaaatgata      9120
     agattccata gatgaacttt catcaatcgc tgaaactatg tcatcgtaga tttcttttcc      9180
     atcttcagtt tcgttcatct catactcttc ccaaaattct ttgagttctt cttttgcttt      9240
     gtcttgatca aaattccaac gttcttcaca aaatgctgtt aactttccag tgaagtaccc      9300
     taaattacat cctttaatgt tttctaatgt tgctggacat gtaaggttat acaccgcttc      9360
     accaatatca ccagaaacaa acacgttata tcctgaaaga acaaatttag ctcgatacat      9420
     ccctgttcca ggcttacccc aataaataac ctgcaatcct tcttcacctt gaatttcagc      9480
     tacatgatct ccaaaccaat tctctctaat atctttagtt gctttttcaa tgtattccat      9540
     ttttcatttc cccctttttg ttttcaaata acgcttttgt tcagttttct ttttcttcat      9600
     aatctacaaa ttggttttta aagaagaact ctaacggtat atcagaatga cgcccgttat      9660
     ctttatactt aggtgaatac gtaagtacac aattttcaat agtaaaagca agtgccattg      9720
     gcgcaccttt acgctgtatc caatgtgttt tcattcgttc aattgcttca aatcccgtat      9780
     acgtctccat cttttaacct cgtttcctat aaaattcaaa ttttgtctta atatccgttc      9840
     gctagtcgat catagttaac ttggttcttt tcgaaatatg ctttttccat atctttataa      9900
     gtcatgccga ttttttctcc gattgctatt aatgatgcaa atacacaata ataactcgca      9960
     tgagtatcaa gtgaattttc acggatttta tcaaatagtt catagtaagt tttatcagct     10020
     tgtctcccta cataatttac ccaaaaagca tcgtgaggaa ggtcatgact aaacccgtat     10080
     ttattcccta tacttgctat aaagtgaata cagtcagccc actcatcatt ttgtttttct     10140
     ttgttattac gtttattctt cttccagtac ttgaagtatt ctatttcatt cgcaaactca     10200
     cttacttcca cataaaaagc gtgtgttaca tccctagtta agttttggcc ttctaatcca     10260
     tgaacctcaa ccaccttacg atctaacttg tcctgtgctt caaaaatctt ttgtatgttt     10320
     aacattccat tacgctcctt ttaatgaact ttcaattcgt ttcttacgtg taagtagatc     10380
     ctctaaatta ccttctgttt tcttcctctc aagccctaac atatttaaat gtagtttcat     10440
     gttgcttata tctgaattaa cgctttctaa ttctgattcg agttgaattc tcgtttcttt     10500
     cttcatgcaa tccctcctac agtcctaaat gccccataat ctttccaatg ttttcgtcaa     10560
     agccgcgtaa aatatctact cttgtcgtac cttcataaac atcaaaagta ggtagtgtat     10620
     ttgattttag aaattccgtt aactcgtatt tgtattttga atttttatca acgtttcttt     10680
     cttttaacac aagattttct ttgatatgag caggaaggtt ttcgagatga acctttgctc     10740
     ctttgcattt gccacaattt tcgccagtgt acataattat catcatctta gttgccattc     10800
     tcttcagtct cctttgcttc tgctaacagt tgagttactt cgtacacgcc atgctctgta     10860
     tatttcatat cattatctcc cttttctgtt gtgtaattag cgaatacatt accttgaaat     10920
     tcagtctttt cgtgattttt gtatttagat aagatagttg ttaatgctat tgccgttcct     10980
     tcatttgcaa tccatttccc tctatagaaa ccagcaagcc ctaaatcttc tgcttcgtaa     11040
     gccttatcag cttcttttct gttttccact gctgataact gtaactgttc gatatactct     11100
     tcaatcgctt ccctcattct ccccatccct ttccaacagc cccgccagtt cctcgcaact     11160
     cccttcaaat aagtcgcgcc catccggtag cttgtatatg tgattatcga ttaatttgtt     11220
     gattaaaacg tcttgctcca tgttgcctcc tagctgattt gtttcttttt cttactccca     11280
     cgcttgtcct ttggttttgt tgctgctaaa tacgggtgca tccctctttc taccctttta     11340
     tagaagcaaa tatcatttat tccgttttct ctagctactt ctatatacgc tgaatgtccc     11400
     ttaggcttca tggctgcgtc gcgtggtggc atcccttctc taattcttct gtaataagta     11460
     gaagcgctta tcccattttg cccagcaatc acaagcattc gtgtattgtt atctttctta     11520
     tttctctttt tcaccggatc agttatagct ctttcgatac tccagtcata taaatccact     11580
     ctttgattca cgttttttct agagattccg tttttctctg cttttttata atcttcttct     11640
     gtaagagaat tagctttcgt tttccttact ctccctgttt ttttaggagg aatagttgcc     11700
     gcttcttcag gtgtccattt gcgaactgtt ttttgggtca ttcttgcatg aaatgtccgg     11760
     taagaaatcc cgtttctttc tgcaatttcg atgtacttct gatatttttt cagaaacaat     11820
     ccgttctgca gcggttctgt aatcgcttgt tctacagtct ttcctctata atgaatccgc     11880
     tgatatacca cttctttgct gattccgttt tttgcagcta tttcatattc ttcttcagtt     11940
     ggtactggca tataaaccgt catttcgcac cctcctaatc caatgccatt atttcttttc     12000
     ttgtccgttc agaacgattt atcccaatct tctgaatacc tttaccatgc tctttcactg     12060
     ccgcgctcca cgcttcgctc tctgtttcca catcaaacca atctattttt tgtcgctcat     12120
     cctgatcgta aaaatgaact tcgtacgttg taacgctatg ctgtaagaac ttatccgctg     12180
     tacttgttgc tgcgtaatcg aaacttccca caacatcatc cagtgttagt tgtttcatgc     12240
     ccctaacccc atcgggcgcg atttaatgat gtttttgtct gcctgatcca taatcaaagc     12300
     tgcgatttct aattgatgtc ttcccagctc ttttgcaatt tcaaggattc ctttgccttc     12360
     cttccacatt tcttgcaatc taataacttc actttcatca aataccaggt ccaactcttc     12420
     taaagcgata tacaagttac gacgcgattt cttcatgtac ttcctctgtt gcaacgccat     12480
     tgtataattt tccttttcca aatccgttcc aagtcttggc atcccatttc ccctccagtt     12540
     gtaattgatg aatctctctt agcttcgtca taacggcatg gcgccttcta tccacttctt     12600
     caggactgcg attccctgct tcgcaaacac acgccccaaa ctgatacatt cccgttccaa     12660
     tgtcgttctg aattactccc gttccattac atgcacacat ctcaaatccc ccttagaatc     12720
     ctaaatgttc aatacgttta tctgacgttt ccttaaatac aattgcttca gctttattta     12780
     aaattcgact ccctaacttc ttgtcgtatt tcttgaatat gtcaccactt gataagttag     12840
     ttgttgtaat agttactttc ccttgtcttc cgtttgtaac tgcgtatagt acacgttgga     12900
     taaagttgct tgcttcatcc gttctgttca tagatccact ttctgcacct aaatcatcca     12960
     gtactaggaa atcgacgctt gtcagtagtt ccacacaata ctcttccgta tacttagatt     13020
     ctttgttgtt aaaggaatcc ttgataagtc gcattaattg ttcaatctct acgaacaaac     13080
     tacttttcat ttttttgtag agtaatttgt cgccatactt ttctccatct gataactcat     13140
     agaaatgttc tcttaattcc cttaggattg aataagctaa atggctttta cctgcaccct     13200
     gcacacctac aataaatacg tttttaacct ctcctacttt taggctatct acaatgtcct     13260
     ctacacgctt tttattcgtt ctagtctcat tgcattcagt tctataatta gaaagtgtag     13320
     cttcgagtat ttcctcatta ctaatgatgc tgtgctttgt aagcatgttg aacttcttag     13380
     ctctatcgat ttttttataa tggttgttcg cttgttcttt taacactctg tcgttttctt     13440
     caacaacaca tcttgggcat acaacttgtc ccttgtgttc aatcatctgt acaggtttta     13500
     caaatttttg cccaccaatt tcataggaat gcttcataca tttatcagaa tggaagttca     13560
     cctttaaatc cagggatttt gctacccttt gcattgctgt taccgacatg ttttttcgct     13620
     cctttttcat ttaagtaacc ttcaaattta gtaccaaata acgtttctgg tcgtaagtac     13680
     tggttcatat tttgatcagt aagccattgt gctgttttga tatcaataac ttgtttgaaa     13740
     tcatctatag taaaaccgtc tttaaatcta gctttaatta acgatctagt tttcgctgtt     13800
     ttatgtttaa aagatttacc tgcttgttca tttagataag aaacaatatc ctcataaggg     13860
     atgtagtctt ttgaccgctc tttttggtca gaagacatat tatcttttaa tgtagtaatc     13920
     tttgttgtag tctctgtagt aatctctgtt aaagattccg acattttgtc aggttccatt     13980
     ccaacaatgt gtaagtttcc attctgacaa tttgtaagaa tcgaatctaa caatttgtca     14040
     aaatccaatt tgtagtgaac tgttggcgct ccattcgctt tttttaatgc tgtttctaca     14100
     tatccagaag caacgagctt tttcgttgaa tacctaactt gcctttccgt taaacatatt     14160
     tcttcttccc attccttata ggttttgtag aagaagccgt cttttctttt tgatttatca     14220
     ctgtaaaata cgatttgatt gagaagtatc gctgttgtga ggtcgcctgt taacttaaca     14280
     aacaatttag gtacaacaac tatattttct tgtccgctca tttgagaaat aatagtacgt     14340
     atcgtgttgt aattactcac ttagttcacc ttcttcatcc aacattcgta acttgcgcga     14400
     tcttccatgc ctgtgaatcg aattttgtcc tttcctttaa actttccatc gttataaaat     14460
     gtcttttctg ctctataaac tttcttgatt ggcgtaacgt agtcataacc tcttctctct     14520
     aaatcacgaa ctgctgttaa catttctttc atcgatccac gtcttacagg tacttgaaac     14580
     atcaaacttc acacctttcg cattttgcta taccgttatt tacttccaaa accttatatc     14640
     cgggataacg ctttggtatg cgattgatat acctgcaagc gttccttata atttctcgtt     14700
     cattctttgc gcccttataa acccatactg gaaggacgac gttagatatt gtttgttgat     14760
     tcagcatggg cttctacctc cttatcctgc ttggctatac tgcttttccc atcccattag     14820
     cacttcaatt gcttttgatg caacctgtga gctgatttca cttaaattgt cagtgccgat     14880
     gttacctttt aatgtatctt caatcgtttg cttttctgtc tttgctaaag ctgaaatgtg     14940
     cgctattttc gcatgtatca tcttcatttg tttctcggat gctttaccat tactgctgtt     15000
     tccttgcggt ttgtttggag cttgtccacc gttacttttt tgattaggtt tgttaccttt     15060
     cccataagta gcaccgttac catcatcatc ttcacctgtg ttcaagctaa ggaatgctgc     15120
     taatgaatag cgtcgagcat atgtgatgca acttcctact gcttgcggat cattctttac     15180
     tggtttcatt gttaattcgt ccgattcaag ccattcgcca ctctcgtgta agagaagcgt     15240
     ttttagcgtt acgttttgac cgtcaccact cgggatttgc ataatgctta atccattttt     15300
     agaaaggatt ggtctaattt catctataat tgtgtctagc gttgcgtaat tgtttttaaa     15360
     gaaaggattg tctgcatcct tcgctatttt gttaacttct gaattgaact ttactaacgc     15420
     tttggctaat tcagtgatag tttcgctctt attcatcgta ttctcacgcc ttcactctga     15480
     cgtaatgtaa ttccgtccca ctgcatgcca tctttaaccg ctgcaagtaa taacttctta     15540
     tcaactttag gtggctgagg aatcatatat tcaggtggta caaccgcatc ttctgcgata     15600
     tctaagcttg ctgggttctt ttgaatacct acagttacga ttgttccttt gatacgcttt     15660
     aaatcagttg ctgtcatttg ctgatacaag taatctttta atcctttaca attgttttct     15720
     attgcctttc tgcgttccgc taggcgcttt tcttccgctt tgatagcatc tacatcagct     15780
     tcaaggttgc gaattactaa cgctgtgttt tgcactttat cctgaatgct ttcttcaatt     15840
     gcttgtaacg tgtctgccaa cgctgatgga tctacgccat cctcaatcat catttgtaac     15900
     tctctataat tagaagtaag ttcatataat ttcattttca tatcctccta gaacggcata     15960
     gcgccatgcg gtttatttgt taaaactgta attacatagt cgatatctag ctttcttacg     16020
     ctatcttgtt ccttttcaga catttgtttt aaagtttcga ttgcacgttc tttttgctta     16080
     tctaacacat ctttcatttc cacattcctc cttatttact tagaagaaac gaccatgtta     16140
     taatagaggt agataatatt gcgtcgtttc atcaaccagt cgattagggg taatcggctg     16200
     gttttatttt gttttgatgc tttcacgcat cggaataccc aggaaccttt cggtaaggtg     16260
     gggaccaaca ttagattcct gaatattccg acaagcgaga gcttgtccta tttagctaga     16320
     gttatataat ggtacttctc gatgactttc acacagttat gtagttcttt agtttttaaa     16380
     tctcgtacca ttttgataat atttgctttc tcttctttgt ctcgctgctg tttatccatc     16440
     catttcatcc ttcataaacc ttttgtctat ccaatccatc agataaatga atcctgcggt     16500
     taaaatgaca attaccagaa tcattaaatg tgagaatgtg ctttcttcca tcatttaaac     16560
     cgcctcctgt tcctgttctt tcttcagtcg gtctatgatg taggcttgtc cttttggtgt     16620
     tacgtaaggc gttagccatg tgaagttctc accattaggc ttttctttta caccttgtac     16680
     aacttcaaag taaccactgt cgatcgccct ttgagttggc tcatttttat ttttgaagat     16740
     taatccccac tctcgaagtg ttgcgaataa tctcttttga cctgttttaa caccatgttt     16800
     tgctgctaac ttagcaacct cactcacttt tagtgattta tccgactgca tacacgcttc     16860
     agcgaatgtt actaatggtt gttgctgcac gatttgttgt tgtgctgctg caagcttttc     16920
     tttctcttct tttaatttag tgagaagacc gattgcaaag tctggatttg ttaccgcttg     16980
     ttccaggact tgatctgtca tgtatgctcc gtgttttcta atagaaggaa gcacttcttc     17040
     gaatacccaa gtttcgaact gttccgcttg tggaagtttc gatttaacaa ttaagcgata     17100
     taggtttggt tcattgatga atttttttgt ttgtacacca ctattagtag ggactaacgt     17160
     ttcgttcacc ccttcaggtt tacaatgatc ttttattgct ttgtgtggat ttgaataccc     17220
     aagcactttt gcgacatctg ttgctgggaa gaattctttc ccttctttaa taaggattcc     17280
     tagatttcca aacatgttat gtgaaaaaat tttaacttca ttcatttggt ttactccttt     17340
     cattttgtaa atctctggtt tactttaatt gttaaaaaaa aggtctttcg gattttcctc     17400
     aagagcaatt gctattttct ctgctaagtc tattttcaat gttctttttt cattttcaat     17460
     gtaccagtag tgcatttttg tgattccgac tttatcggca acgtcttggc aagacatccc     17520
     tttttctagt cgttttagtt ttaactgctt caagttattt cctcccttcg ttgcctgtga     17580
     ttttattata agtaaacctt tagtttattt caagtgcttt tttcaaaaaa acacaaataa     17640
     attttatctt gtagtaaaca ctatgtttac tttatacttt atgtattata tacactattt     17700
     aaaaagggga cattaatgtg atcggggaaa agattaaaga actcaggaag aatagtaaga     17760
     tgactcaaga gcaactaggc gatgctattg gcgtatctaa aatggctatt tcttattttg     17820
     aaaaaggtaa aaagtcacct gggcgagaat cattagaaaa gatagctgat tatttcggcg     17880
     taactacaga ttatttatta gggagatcgg aagaccctga actaaatgaa gaagaagata     17940
     aaactgtatc tgaagaagga aagaacatat tagcaataat agagagtctt cctgaggatg     18000
     agcgaaagaa agcttgggag caattagaaa tgtatgtgaa ttatatgcaa acaaaaaaga     18060
     atagctaatc aaagaagact accttatata tggcagtctt ctttttttat gtatttgatt     18120
     tttctttgta tgattcatca aggacaatct ttaaaatatc ctccgcttta ggattcccct     18180
     gttttaaccc taatttcgca gccattctca ctaattgctc tttcgtcatc cccaacatcc     18240
     tccaatatct ccatattagt ttgcgaatca tttcacaaca attctataaa actccatttt     18300
     caaaaataca gaacttcccc agaaagcacg aatgcgattg cccattgata taggcaatcg     18360
     cattctaatt catatatata tatatctatt acaggccgcc gccacctgga tcaaccatca     18420
     tacgttgaac tgcaggtttt tgcgcgtctt gtttaggttc ttcttttttt gtgtcagcag     18480
     agaaagtgaa cattcctgcc attaataaaa taggtaaaag cgctaaaatc ttcttcaatc     18540
     atttcacctc ttctctcaag ataattatac cattttttca agaatagccc aagtatcttt     18600
     taggcagttg agaataaaaa atattccctt tctcctcgaa tatctcaaga gattcttcca     18660
     tgagtttacg atcattacga gcaagaccta aataaaattt ttgaaacgct gaaagtctcc     18720
     cctgcacttt aagcaaatcc atcaatatat cttctgcctt tttgttatta cctaacttta     18780
     tttctaaata ggccttttca gcaggatgga cttctaaatt ccctaccggc ttgtcccaat     18840
     atatttttag aaataccatt gtttgaagaa taagcttctt tttggccttt aaacgttggt     18900
     taaatggatc ccctaagttt tctagtgatt cttgtagata ttttaacgat ttattgtaat     18960
     cacaaaaaat atatgactct ccgaggttac aaaaagcgtt tactctctga atattgaatt     19020
     gcggattgct accgcattgt tcaattaact tcaaagaaaa ctctctgcat tcaatcacat     19080
     taccacgaag taaatgtatc gcagaaagta tttcaataat tcgatgatta tagcttgatt     19140
     ttataaatcg gttttttctc acactaattt gtttgacctt ttcttctgcg tttttcacat     19200
     aatttaggat agatctataa ttgccagtat cgtacaacaa gtaacacatc aacaagtcac     19260
     acatagcact gttttctaca tattttactt ttttacgaac atcttctagc tgatttaaca     19320
     attcatcacc gttaaatcgc tctaaacttc tcttatacaa tatttcatat acagtggctg     19380
     cttcacgatt ttttgcataa gatgagcctt tttctttttc aatcatagta tttaacaatt     19440
     ctaattctcc acgataagaa gtatattcta atgtttctct ataacttcca taatctttct     19500
     cagagttcaa atttacatat tccataatca tctttctcct aagatcatga tcatcgttgt     19560
     acgcacacat aagcgcaccg gagaactgat aaaatttcat atctctcttg ccactaaaag     19620
     tctctgatat tgtactttta ccaacttgta attgcttagc taattcgcca tctgtaatgc     19680
     caattgcaaa taaatcatca tgtagcttat tcaataatct ttgcactgtt ttgctcctcc     19740
     ttgccggaac aaaagacacg ttatacccat tttttaactt ttgaggaaaa cgcgtcacta     19800
     cattcaaaag atgtgttata atttatgtaa gacttgcagt aagtgttttc cctagtctgg     19860
     ttagggaaag cggtactatg gtgttcgctg caccttagta cacgctgtga gtctttttta     19920
     cgtccgttta ttttattatt ttcataatat cacatttttt ccaaaattca gtcgtgttgt     19980
     tatcagaaaa atgttgagaa agttttaaaa tcgctatata acaacatcca acacgcgaaa     20040
     taaaaaataa aaatatacat cgagaataaa acgtatgaag acctcacatg catattttac     20100
     cactaaacaa acatttgttc tatacatatt tatcaaggtt gtaaaaatac ctaaatagtt     20160
     ttaaaaagtc agagtatcga ccaattatgg tatagtgata aggcgattat tatactcaaa     20220
     ctatgaaaac tacagtcgga caaaacatta aaaatctcag aaagtctttc gatttaacgc     20280
     aagaacaatt atctgagaga acaggtttat cacgcggaca aattaaaaat tgggaaactg     20340
     atcgtcatga acctgatctt gaaagtttaa agatacttgc gtcgtttttt aacacctcca     20400
     cagatgctct tcttaacttc gagaacagga aagaagatgc gttgttagga ttactattca     20460
     atgacatcca acgagcttat gaggagctag atggacgtca gcaaggtcgt tttgcaaaac     20520
     aagtttcatt gtacgtgaaa atgttgcaaa acaacaagga tatattgtga tttgatttca     20580
     tgataaaaga aatcatttcc atttgctaga ggtaaaattt tacaaaatat taccattctt     20640
     accaatgagg gctacggctc tcttttttta ttttcattcg acaaaatatg acaatataac     20700
     aattgatagt ttgctatgat aagctcggaa atcttacatt tcgacctaaa attatcaaaa     20760
     aaggtgggca aaatatggaa acactagcgg tattgatttt tctagcttca atcgttctgt     20820
     ttgtattatt tatcattgct attttcaaga aaaaacctaa ggccaaacta tttattagtt     20880
     caattgtatg ccttgtgtta gcaatggttt taataccaac aaaagataaa gaagaaaaac     20940
     ctaaagctaa agaaacaact caacaagctt ctaaagaggt gaaagaggaa ccaaaaaaag     21000
     aagaagtgaa aaaggaagaa cctaaaaaga aggaagagcc taagaaagag gagcctaaaa     21060
     aagaagaacc taaaaaggaa ctttctaaag agggtgagtc ttctaaagtt aaaatcgctg     21120
     taggatctgt tgaaacagta agctccgttg gcggtgaata cttaaatgaa aaagcacaag     21180
     gtgtatttaa agtagttgag atttcaatta caaataacca aaaggatgct atcactgtag     21240
     acgcaaatag ctttaaatta atggataatc aggaccgtga atttaaatat tctacacaag     21300
     ctcaaacagc ttatgatatt ggaaatggtg gtaaatcaga tttcttctta aatcaactta     21360
     accctggatt aactcaaaca ggtaaaatta tctttgatat acctgctgac gcacaaggct     21420
     tagtattaaa agctcgtggc ggtatgatgg gtaaagaaat taaattaaaa gtagaataaa     21480
     ctgtaaagga gtattaaatt gaaacgaaca gctgaatttg tattaggact tattggtggt     21540
     atttttggta ttatttgcgc atttattgct ttattaatcg gtggtatggg cgttgctttc     21600
     gaggcggagg gtgcaaatac aattatcgga ttaggttggg gtgctgtagg cctatcaatc     21660
     ttaggaatcg ttggttctgt tatggtaaga agtaaagcga aagctggcgg tatcatgatg     21720
     actgtcgctg ctattggtgg atttatttgt atttctatat tcttcctatt accaggtgta     21780
     ttattattga tcggtggatt aatgggaatc ttccgtaaag ataaagcaac tgtatctgct     21840
     taatcatacg ttatgttaat caaaatttga gggcaaagct ctcttttttt gtatattcta     21900
     aatatcttgt actcaaataa tgggaatttt gatactattt tattattaaa atctaatata     21960
     taaggggaga aatacgggtg gaagttgaaa agaaatcaaa gatttgggaa tatatcggat     22020
     gggggagctt cattttagtc ggttctttct tatttttttg tgcgttgata ttagtatttg     22080
     gtgatccgaa gactaaatac caagctcaag aagttacagc ccaaggtcat gaagttaaag     22140
     atgctgaaaa agatgtaaaa aaagaatatt ctgttggcga gactattaaa ctaggtgatc     22200
     acagattaac tgttaccgat gttaaaaaat cttccggcgg ggaatatgat aaaccaaaac     22260
     agggccatga atacgtatta gtagcggtaa acatctataa tggtgggaaa gaagatatct     22320
     catacaatcc gtttgatttt gaaatgagaa atagtcaagg taatattacc agagcagtac     22380
     cgtcgataat taaccaaaat acacaattaa gtgctggcca acttgcacca aatggacaag     22440
     ttgcaggaac cgttgtattt gaacaaccta tcggagaaaa attaaagtta cagtttacgc     22500
     ctaacttttg gagtaagaaa aaaattatcg tgaacttgta aaacaaaaaa agcacaggga     22560
     aagggaatcc catgtgcaat aataacttag gtaattacag tataacataa aagttccagt     22620
     atttaggtct tttctttttg tttaaaatat agattttgtt cacttttacg atacatttat     22680
     gaaacattcg tatgttacgt tatataagtc cttttttgaa tcatattcat tctgtcaaaa     22740
     agtcctagtc ccctctaggg ctttttgcgt ttaaataaag agttaccgta cttcacaatg     22800
     acttacatta cttaacatgg taaaataata tttggattgg cgtccaatac atattattaa     22860
     aattaaagtg gttcaagtcg gaggaaggca ccttagggtg tcttttttta taggggatca     22920
     ccccatgtct ataaacctaa cagaaaaggt tgcctcaaaa ctataaaaat gaaactcagt     22980
     gctgcgttct gggggtgata tgagctttta acttgatggg tatgtagtgg gactccactt     23040
     tctcttaaac cttcattaaa ttctattatt ttatgaatat aaaaatatgc aaatatacat     23100
     atcgtaacaa aaattggaat ttttatggta agttatttta tgttgttaaa taacttaagg     23160
     gggatttttt atgaaaaaaa cattgggatt tatgttagta atgggtatgg gaattagttt     23220
     aggtttttct aatactgcat ccgctgaaac ttctaaaaca aatgctcaca acaaattaga     23280
     agttaaacaa accgaggatg gaagggtatt aggagtagaa tcatcagaaa aactaagttt     23340
     agagcaacta gataataatt taataaaaat gggattttct tttaatgaaa tctccaacat     23400
     gcaaaaagat ctaaaaaaag agcttgtaaa acaaggtggg aaaaaagcaa atttagaact     23460
     agttgaagaa aaacaagaat ataaaagttt agatggacaa aactacgtaa taaacaatga     23520
     caacaaagaa aaaatccaaa atattaaaca acaagatgca aacaaacttt taaatcaatc     23580
     ctctaaaaat gacagtaaaa tccaacgtat gaatccacca tcagcagtca taaatgatga     23640
     actaacattt aatttatttg ctatttacga aggaacaaaa ggatcagatt atgtttataa     23700
     agttttctca aaccaaatgt ggactaaacg tccttattgg aatacaaccg atacaattgg     23760
     cgtcgtttgg gaagccaatg ctcacgcaat aaatggtaca gaatcagctc gtcaatattg     23820
     gacaatttct aatctaggtg gcggagttaa tgaacataat acaaatgtag gggcagatcg     23880
     ttctagttta tatggaacac aatggaaact cccatacaaa acagattcaa taaatagagg     23940
     ggcttacaca tcacaaaaaa tcacaatccc tcaaagttac agaggttcaa atgctactgt     24000
     aggtgctgca ttcgctcatc catggtttgc atataatttt gcattgaact ttggtcctgg     24060
     tacaattgct tttaatgatg caaaaggtga taaatggagt ctacgttata atatgaatgt     24120
     aggatcttaa aaaaaaaact ctacgatgta aatatatcgt agagtttttt gataaacaaa     24180
     atattttaaa aaggagaaat caaatgcata aactaataat tattatatta agtctcatat     24240
     taggttttat tacatttatg attcctgcaa tttcagaatg gatacaaaac tcagtatttt     24300
     ggttaatagt aattatttta ttatcttatt cttataaaaa taaataacta agaaataaaa     24360
     tctatataaa aataaaatca taaatacaca gcaagggaat gcttatatac tgatctatac     24420
     tgcattccct tattaagtag caccaacatt taactatttt ttatgttaaa gaaaaatccc     24480
     ttgatataag aatattttca ttaataattt acgcatattt acagcgcact ttattaatgg     24540
     cgaaagaatt gacttagcta ttgttgaaat tgattcagta gcaattttaa gcgattgtgt     24600
     aactagagta ttaagtagcc gtagaaataa aactaaacat tatttggctt tcatttaaga     24660
     gaagtatttt aaaacagcag atgttataaa ttggttagat tatgcacaat ccagcaaagt     24720
     gaaaggaaca ataactgagt tatatgccta ttaatgctga aactgtttgg agtattgtag     24780
     atcattaaat atatcaagtc ggaggaaggc acctttgggc tgcttttttg tacattatat     24840
     ccattacatg ctcattgatt ttttatgtac gtttgatata attattgtaa tagtattaca     24900
     gtaatacctt gtgtatataa taaaaagaag agatgcgcta acatctcttc aagtaactgc     24960
     taccgcaagg tggtcggttg cttaaactta ttttttgcgt ttagaaccgc cctttcgctt     25020
     gccggcattt ggggcggttc ttttatttcg tttactgcta atcttcttcg ccagctcatt     25080
     cgcataagct gttgcaaata ctgtaaggaa taccttagca gcgtcataca ataaattaaa     25140
     taaagaatcc attcggtcac ctcctttctc tctagaatca gagaaaggat agcaacctcc     25200
     cgccctcaca atatacagtt acatacagtc tatcacacaa ttttattaga ggaaatatca     25260
     ttggaataat ctcaaattac atcaagctaa aaatagaata tagattttgt tcacttttac     25320
     gatacattta tgaaacattc gtatgttacg ttatataagt ccttttttga atcatattca     25380
     ttctgtcaaa aagtcctagt cccctctagg gctttttacg tttagataaa gatttaccat     25440
     ctgtatcaat gacttacatt acttaacatg gtaaaataat atttggatgg gagtccaata     25500
     catattatta aaattaaagt ggttcaagtc ggaggagggc accttagggt gtcttttctt     25560
     tattactaac taaaaaaggt accaaaagtg tacggcacac tttcaatacc catatgttat     25620
     tttcttcgat atagcgcgag aaatacagaa tataacctga tcacgttgtt tcgctgcatg     25680
     ttcaatcttt gtctcgcaat ttatttctat ggtatttcca tgtttcaata agaatccagc     25740
     gtctttttta tcgtctttac tatagggaat gtatgtccaa tcaccgaaaa aataaaattt     25800
     atcacaaaac gataaataat ctttccactt tttatcattt tggaaatcat tatctgatgc     25860
     ctttacttcc acaaatataa tttcctgatt ttcattaaaa ccagctacgt caacacgtct     25920
     accattaggc agggttactt caaatccaac cacatacccc tttgaatata accactttcc     25980
     aactttagat tgtaactctc cgtgtgcctg aatttcctta tcggataaca tattggatgc     26040
     cattacagct tccgaaaatg actttatatt gatttttctc aagcgtttta tttcttcttc     26100
     agtatctttt atctcttttt cgatgcttat taattcttca tttgtttgct caatctgttt     26160
     taaaatactt ccgccaacta attgaacacc ttctttataa tcaggccaga atggagcgga     26220
     aaaccccttc ttacttgatc ttatcgcttc tgtgtcatag taccataata taccgccgtg     26280
     attctttttc cgctttagat acgcatttgt aaactcatca atactatgaa ttacatggac     26340
     aaactccaag ctgacgtatg taattatccc cgaatccttg agttgttttt gaaataagga     26400
     atccagacgt tttattaaaa ccaaatctat cacagtctga ccacgttcaa ttcgttgata     26460
     cattcctaca tgttctaata gaaaatccct tgtttcctta tcatactttt taaatttatt     26520
     aagcaataga tctgattcat cttttaaaag ttgtaaatta ttcattgtta attttagctt     26580
     ctctttactt ccttccagag atctaatttt gaattttact tctttcaaga aactctttaa     26640
     acgttctctt tttccttcta aatacagtac catttctttt aactgatccc gagtagtatc     26700
     ttcgtttact aaagttaata tttcttcaat tccttcccaa tcctctgttt taaacaaatc     26760
     agctataact aatactttta atcctaacaa atctattttt tcattcacta aagaggttaa     26820
     atgatcatta gcaactgatt taatctttaa atatctagat aatcgtttcg cctgatccaa     26880
     ggaaacattg tatttatgag gaatatcctt aactctaact gttttatcat taagactttg     26940
     tataatctct agacttaaat catcacggcc agtaatcata tttatccccc cttatataaa     27000
     aagtgcacgg tacacctttt actttaattt taactagtat gtttgtaaaa atctaggtgg     27060
     ataaaattta tacaatatgt gaaatttcac gtactatatc cgttgtgtaa aaccaaattc     27120
     tgcaataagg cctattctat catccgtccc cttatcctct aatcaagcga gtagtaaatc     27180
     ctttatttat tcctctatct tagtaagtca ttcccccagg agttaaacaa tctcatattt     27240
     ttctgctttt ctttgaattt aatgttgact gaagatcttg agggttttta tcatgtggga     27300
     acgattatgg aacacggctg gaaggcagat ttatccccta ctttgaaaga ctacaaaaaa     27360
     agtaatcaat caaaatagat ggataagcgt cttgttttcg ccatgcggtc acttataagg     27420
     tatccgtatg tatagaccct gttcactcag cgattttcac cgcatacatc ctttttctat     27480
     ggcttgtcct tgtaatatcg tccctacacg acaaactgaa tgtactccct agcaccgtaa     27540
     tgctaacgat aaccacccga accttttaga gaatcgtccc tgggtaagtt ctcaccctcc     27600
     ctcaccagaa gaacaggatt ccaatgaggg gtgctgtttt tgtaggcgca tactctgtac     27660
     cccctgcacg accaacagct agccacgcac gtaacacgtt cctcctatat gtatagcagc     27720
     acggaattac ggcttatcag tttttattta cgtggtttca ggcaattcca cgcgaaccaa     27780
     aacaaaaagg catctccaat tcctaaatgg cctgtagatc cacaagactt ctaggtttag     27840
     agatgcccgt tatatatctt ttgactacaa aaaatacaat tctagcattt actagttgaa     27900
     ttttagtcaa acaatagata aaatgggtat atcaaagaag cctcgtgaaa aggcatagtt     27960
     gtttaaggtt agtggtggta cacttcttaa acgttaacac tgtcggttaa tacagttttt     28020
     ttctagtcaa gtggtggtac acttgctaga gcaagtcatt cccgctaatg gttggcgccg     28080
     ttagcatatg ggagtggctt tttgttttgt gttcatattc aattgtcttt aatttatatc     28140
     gttcgatctt catgatcttc gtttatgtaa aatatcaaat tatgttttgt tttgtagaat     28200
     gttgcttgtt gtgtactacg ttacaacaag cattaacctt tgtaaacagc gaatttgcgc     28260
     actttttcaa taatatccct atttccctat ttccctattt ccacttatag atatagggat     28320
     atttcccctt ttccctatat ctatatttcc ctattttctt tgtttttgcc tctactattt     28380
     tctctacgaa attacatatt tatttcttaa ctctctctac ttcatacatc aaaaaaatct     28440
     tttgatatca acgtttttgt tattaattac taactctatg attctattgc ataaccccaa     28500
     tatcattgtt ataatttctt taaagatata gaaatatccc tatttctata gttagaaata     28560
     tccctatttc cctatttcta tttttcccta tttctataaa gggatatagg gaaatttcaa     28620
     aaactataac tggagtgtta aaaatggcta ttacaattac ggtaggtaat tacaaaggtg     28680
     gagtcggtaa aaccacaaat gctgtattga actcttatga atttgctaaa aagggcaagc     28740
     gtacattact tgttgacctg gatccacaaa gtaacgcaac aaaatcttta atgctaacaa     28800
     agtcgatcct taatcctgat gaaatcgtta ctgttgaaaa gacattaatg aaaggtatac     28860
     aagaggggaa cttagatggc ttagaagtag aaattacaga caacttatat ttaattcctt     28920
     cttacgttga tttccaggac ttcgcaaaat tcctttatca aaattgtgct tcagaagctg     28980
     aagaagatca ttactttaaa ggattacttg aaaaaatcaa acataaatac gactacatat     29040
     ttattgatgt tcctccaatg tcgctagagg ttacaaagaa cgccgttgta gcttcagatt     29100
     acgttctcat tgctttgcaa acgcaagaac gttctctaac tggcgctgag aattatgtta     29160
     atgagcttat caaattaaaa gagcaatatg atcttgatat tgaagtagtt ggcattcttc     29220
     ctgttctatt aaaaaataac ggtaaggttg atgaatatat catggaaaat gcgcgtgaaa     29280
     ttttcggtga agaaaaccta ttcaaaaata tcgtccctca aatggaacgt attaaacgat     29340
     ttgatgttaa tggtattact gaaaaagata gacatgatat gaatgtaatt gaactatacg     29400
     aaacgattag tgatgaatta ttatctcgta ttgatatgtt cgaaaaaatg aaggttggtg     29460
     tgtaaaatgg cgagaactcc tggtttacta ggtagaaaga aaagtaactt tgaacctact     29520
     gagccttatg taccagagca aggacaaact gtagcggaaa ataacgaggt tccagctact     29580
     ccttctcaac ctaagactga agaaaaacaa gtaactcgaa aagaaaaaag aaacgaaaaa     29640
     actgaatcaa aaaagaaatt taaaaatcag caaggcagca ttaaaatttc taatcaatca     29700
     aaagaagaac tagaagtatt aatgaaactt acaaacacaa aattcgctta tgaaattatc     29760
     gatttactta tagatagata tgtagaaaat gagctaacag ctgaacagaa aaggaaattc     29820
     aagctcttaa cagagatgta aaaaaaaata tagaaatatc cctatttcta taaagggata     29880
     tttctatatt tttgtattca cctctatata acaagcagaa tagttttatt aatttaaaat     29940
     taaaaactaa ataggagtgg tacctttgga aaagaaaagt caatcttttg tagtaactgt     30000
     gacacctatt gaggaaagtt catctttaac tattcaaagt gatcagacta acatgaaaaa     30060
     agaaatacag acaccagaga aaccagatca acgtttagtt ccatctaaaa ctgctaaaat     30120
     ttcaccagcc gttttgctaa agctaaatac tcttaaacca tttatacagg aacaagaagg     30180
     catggataaa acatcaatta acaacattat tgatatgttg gttgaacact atgtagatgc     30240
     caacttaaaa gatcggcatt ctaaagcata taaagatatg tacaagcgtc tttatgaagt     30300
     attagagaat aaataaaacc ttttaaatag gagtggtcat tttggataaa aaatacttgg     30360
     tgactgtaac gcctgttcta gataatcctg taacaaataa aaagagtccc ttgtcagcaa     30420
     cagacagaaa aaatataaaa gtatcacctg aaacgcttag taaagtaaag gccatcagca     30480
     caatgaaaga catgaaaaat tatgagctta ttgatgaaat attagattac tacattacta     30540
     ataaattgga tgcacatgag cagaacaccc taaacgacat agtttctgac agaaaataag     30600
     ccctactttt tgtagggctt ttcgttttga ggacgctata aaattcttaa gttgatgggc     30660
     atggggtacc gccagtattt cggttaatcc aataacagac aagaacctta aaaccgcacc     30720
     aggataggaa tgtataaaaa aatgcataga tccatagaac aaaaaagacg attcccttgt     30780
     gagagtagga attcgtcttt ttcttcgcta ccaataatgg gacgttatgt taaccttaca     30840
     tgtatagaat atacatcatt aattttatta aataagcata caagctaaat tatttgattt     30900
     gaatataaat aattatattt aatttcaaaa aaggagatga actgttttga actcatattt     30960
     ttcaaaacat aagaaatgct gtcgtagact ttttcctgct tttccacccg ctgtccctcc     31020
     tattattgtg aaagctaaat ttctttatgt atctagtact gacgggggca tcgatgatga     31080
     cacgatagaa atttataata ttatcaatcc taaggttcct gtacgtgtag gagagtttgc     31140
     atcagtaact agtttaggtc ctgcgggatt ggctattaca ggtactactc tctatatcgc     31200
     aaatttgggc gatggtgtag aaatttacaa tattactaac cctatatccc ctatacgtat     31260
     aggggaattt ggtacagcgg atttaaatgt tcctgatcaa ttaactatta caggtaccac     31320
     tctttatgtc gcaaatggtg gtaataacac tgtggagatt tataatatta ccaatcctac     31380
     aactcctgta catgtgggag aatttaatgc aggtaattta aatgctcctt ctggaatgac     31440
     tactacagat tccacgcttt atgttgcaaa cactggggat aacactgtgg agatttataa     31500
     tattactaat cctacggttc caattcgtgt tggagaattt ggtactggag atttaaatat     31560
     tcctgcggga ttagctatta caggtaccac tctttatgtt gcaaattttg ctgataatac     31620
     agtagaaata tatgacattt ccaatcccac aataccagtg cgtataggag agtttaatgg     31680
     aggtaattta aatggccctg ccgtattggc tattacagat actactcttt atatagcaaa     31740
     cactggggat aacacagtag aaatttatag tattactaat cctacggttc ctgttcgtgt     31800
     aggcgagttt ggtgcaggag atttagattt tcctaatgga ttagcaattt tcacgatatt     31860
     cggatacaac tactaataac cttgattatg tgaatacaaa agcccttcat agcacttaac     31920
     tgaagggctt ttgataagct cctaaatata ttgactcccg ataatagggc tttatgttaa     31980
     ctttatatgt ataggatata catacaagct aagttattcg atttgaatat aaataattat     32040
     atttagtttc aaaaaaagga agtgaactgt tttgaactca tatttttcaa aacataaaaa     32100
     atgctgtcgt agactttttc ctgcttttcc acctgctgtc tctccaattc cagaacccca     32160
     aggaccacta acaatcatga cgtggaatct ttatttaggt gcggatttta caccgcttgt     32220
     actcgctact acacaagcag aattacgaca agcggtaaca gaagtgtttc ggcaatttct     32280
     tgcgaccaat ttccctatcc gtgtggaaac aattgccaga caaatcgttt tgaagaaacc     32340
     tgatatcatt ggattacaag aagcagaact ctggcaacta tttgttcccg gtttgcaaac     32400
     agtcacatac gactttgtaa aattgctgct aagtgagttg aaaaaaatgg gattacatta     32460
     tgaagtggca gccctaaacg aaaataactc agtgcaactg ccaagcagta ctggaaatat     32520
     agtaggtttt ttggataggg acgtcatatt gatccgaaaa gaatccgggt tcaaggttat     32580
     tcaaaagcaa gaagccaatt ttgaagcgaa actaacgata ctagttggcg ggcaaccttt     32640
     cactattcct cggggatggt catctatcga tgttagcgca aacggacgta ttttccgagt     32700
     aatcaatacc catttggagc cgctttctcc tccagttcaa gtcgcccaag gaaacgaatt     32760
     actgacaggg ccagccaata caaatctacc gttgatcctt ctaggagatc taaattcaaa     32820
     tgctaacgga actggcacac caacatacgg gaattttatc aatgctggat ttcaagatgt     32880
     ttggatagag gtaggtgaag gacagggatt tacctgttgc caagattctg atctattgaa     32940
     tgctgcgtcc tctctaaaca gaagaataga ttttattttg tttaaaaacg gttggaaccc     33000
     aattgtagcg gatctcgtag gagaagaaca gcaagacaga acttcaactg ctctctggcc     33060
     gtccgatcac gccggagtag tcgctagctt gattcttccc tcctaaaaga agtgagattg     33120
     atacaaaata ttccgaatct tctacaactg tatcgacata tgtcaaatat aaataagttg     33180
     tatttttgaa atgaaaaatt ctacattttt ggctatatca caaagtacaa tttttgacat     33240
     tacgtttaaa tttcttataa attaagtgta ttcccctttt tcaggggggt gagcaaagtt     33300
     acccaatata caaaataact tccaataacg aaaattatgt aaataagctg tccatatgga     33360
     cagcttattg tattttttgc ttagcgtgtt tttcttcaaa aatgctggcg gtatctcttc     33420
     ttactcttac cagaacttcc accacggctt tttcttctct ttcgctgcag caacctcatc     33480
     gcgaaactcc tgcatcattc tcttcgcttc ctgcatctca cgtagcgtct tcataagcgt     33540
     ctcatcccgc gcttctaatc gtttttccac acgttcatta tgcgcttcta cgctcgcttt     33600
     gatttcctcg ttactctgct tcgcttggtc acttaatcgc ttctccattg ctaacatgct     33660
     ttgattcatt tcttgcgcca taacgttata ctgttcctgt aattgctgtt taatgtggaa     33720
     tggcactaaa tccgtttctt caggctcttc ttgaatcaga tccggattaa ctttttcaat     33780
     ttgctgcgca atcatcttcg ctgccttctc tagcgtcata ccgtcatgct tactaagctc     33840
     aattagtttc tcaataacca taatgtcact gtctgtgtat tggcgtctgc cacgattatc     33900
     cttcttcaca gcaaatcctt cgcgttgtaa tacttccatg tactttctaa gggtgctatc     33960
     acttattcct agtcgtttgt atacttcact tgcggaataa acaatttcgt ccgtcataac     34020
     gtcacaacac ctcctagtga cagtattcca tgatggttaa gaaattcctg caaagaaaaa     34080
     aagccctgtg aacacagagc tttttttctt tatatactgt catgcaacta ttggtataat     34140
     gctatccata aaactgcatt gtaattaaaa taataagatt ttagggtcaa tattttacca     34200
     tcaacctcta tttccttttc tatatcttct ttattactgt aagctctttc atagtatgtt     34260
     cctaataatt gtgaactttt gtctgtctcc acaacgttgc tattagtttt aagttcagca     34320
     gctgaagccc ctactgcccc agagaagata ataccagtag ttaacgttcc tattactaac     34380
     tttttaaaca taaaaaagcc ccctttttta taattttata gcttgccatc taatcatatt     34440
     ttcaaaacaa acaattgtaa atatataggt tttttagaaa tataaaacag ttaatttcga     34500
     atgtttagtt aagatatgtt gtttgttaat aacgataaac agttattttt atataaagaa     34560
     aaagccctaa cagtgtagga ctaaatagct ttagcgatct ctacaagcaa tctcataaac     34620
     aatggaatca tttggactac aatatagcca atccctgcac gacttattag cgagaatccc     34680
     cgttcctggc tacctaccat aatgaacaaa ccgcgcataa cgctacagcg gatgcaattg     34740
     gataggacac tgatttgatt agaaaaataa ctgacccaaa accgattata ttgattcgat     34800
     tttatttttt aaaaaaacct cttcataaaa gaacatacat tcgtatataa taagaactaa     34860
     cgttctgtta tttaggggga ataacggtgt atgactattc aatattgcca aatcgaattg     34920
     ttttatgtgt agatcttcgt tcgttctatg caagcgtatc gtgcatcaaa atgggactag     34980
     acccactcca tactaaatta gctgtggtag gtgatgtgaa taggagtggt tcaattgttt     35040
     tagctgcaac tccaccatta aaagcattgg gcgttaagaa aatggcgaga ttgtatgaaa     35100
     taccacgtcg taaagatatc cttgtggtaa atccgattat gagtacttac ataaaatgct     35160
     ctaatttcat cacgaaatta gccctacaat atgttcctgt agaggatttc caccaatatt     35220
     ctatcgatga gttctttatg gacattacgg atagtattca tttatttgct aacgatccat     35280
     atgaatttgc attgaaattc aagcgtgaga tatatgcaaa gacaagaatt gaatgcacga     35340
     tagggattgg tcctaatcct ttgatgagca aggttgcctt agatgtggaa gcaaagaaaa     35400
     cgaaagattg tatagcatac tggaagtacg aagatgtacc cataaaatta tggccaatac     35460
     gaccactcag caaattttgg gggatttcag ggaaaacaga agcgaagtta aaccgaaaag     35520
     gaatacattc tatcggagac ttagcacagt acccactcaa atacctaaag caaagttttg     35580
     gggtcatcgg cgaagaacta cacttacata gcaacggcat tgattttagc cgaatatcag     35640
     aaaaatacgt tccggcaaca acttctattg gtaaaagcca aatacttatg cgtgattaca     35700
     ccatagaaga attcccgatt attctactgg aacatattga agaggtttgt tatcgaatgc     35760
     gaaggcaaaa caaactagct caaactatcc atttttctat tggttacagt aaaaattacg     35820
     ctggtggctt cagaaaaact cacactatga accgaccaac taatttaact atggatattt     35880
     ataagatttg tacatatttt ttacatgagt tttatactgg ggagcccatt agaaccatca     35940
     atgtttcttt aactaactta atcaatgaag gagaagaaca aatctcacta ttcgataacg     36000
     taatacaacg agaaaaagaa atgaaactaa ctaaagtaat ggacgaaata cgcactaaat     36060
     ttggtaagaa cagcatatta cgaggaattt cgtatacaaa tagtgcaaca gcaagataca     36120
     gaaacacatt gttaggggga cataaagcat gaacaacgct aatatgccaa agggaagagg     36180
     aatggttaaa tggactccat tcgcagcgat gccagagcaa ttcgctggta tccgtgaaat     36240
     tgttaaagaa aagacgaagg tagaaagacc tacattaacc caggatgaac aggaacttat     36300
     tgagaacatg ctattatgtt cattattatc tgaagaagaa atactgatta catattatga     36360
     aggtggtttt ttacttacta actatatgac cgtcgttgat attgacccgc tgaataaatc     36420
     tataatttgt acggatgcat tttacaataa tatgacgttg aaatttattg atattattga     36480
     tgcaaaataa aaggcggctc acaatcgtgt ctcttattgt tactttacat acacataagc     36540
     tttatttaca attaaacaga ttttatttca cataaatatt attatactaa tctaaagttt     36600
     ccgtatttac atttttttct ttttatctca taattttaat tgggagaagg aggggaaaaa     36660
     tggttcaaat caaggtaacg cctgaaatgc tagaagaagt tgcaaatcgt gcaagtaata     36720
     ccagacacgc attagaatcc atacataata atttatgtaa tcaaattgat catttgtgtt     36780
     ctcaatggat cggtgcttct aatcaacatt tcgttcaaat gttcaacgat gcgaaaccaa     36840
     aggcttttac atctatcaat tcaattgtac aagtagaaga agatttgaag cgaatcgccg     36900
     agaaatttcg caatacagat aatcaagatg ttacactaga agaagataca gctattagta     36960
     aaccctctag tgaagaagga tttgatggcg ggaaattagc tcgtgatata gccggagaat     37020
     tgactggtga atatgatgca aaacgtgtta tggaaggtgt cgaccctgaa actggtgaga     37080
     aactttcaag atgggaacgt gggcttgcag gggtaatgct tgtagcaggt cttactccag     37140
     ttggtaaagg aattaaagtt gttaaaggcg ctaaaaaagt tgccgatggt atagatgcag     37200
     cagcaaaatt agaaaaacaa cgaaaaacct taaaagcaaa tcagataaca ggaaaagaat     37260
     atgagacaaa aatgttcgag tctatcaaac aacaaaagcc taaatcagaa ataacggaac     37320
     aaataactgt tgaaacaaaa tcaggggtaa gaacacgtat agatatagga ggtaaagatc     37380
     ctaacgggaa gattgattta gtggaattaa aatcatcaat gacagcacct cttacaaaga     37440
     atcagaaaaa agcattccct gaaattgagg aatctggcgc gattgttaaa agtaggaata     37500
     aaccgccatt tgagcattta gaggaaatcc caccaactaa aataaatgta ataagaaaag     37560
     aaaaataagg aggctttcat atggcgctac atgatacaga tcaagtcgat ttagttttaa     37620
     tagatgatga aaatgaaaat aatgtatatt taacgatatt tgatgcttta aattgggaaa     37680
     atgaagaaat agaaggtgaa catattttac ttttacaaga taaaatcaat acatatttag     37740
     gttttattga aagtgaagaa atatatgaaa aagttcctaa tacagctggc agaaagtatt     37800
     ttatcattca agtgtatgca caacatgttc ctagttacta tggtaagaag ttttataaca     37860
     tggtaagtga acaattaggt gaagcaggtt atgggtttga atttcatcat aaaccaattg     37920
     aatctttaag ttaattcgta taaaacaaaa aagagcattg tccaaatgct ctttttttat     37980
     gtatcaaccc atattcgata acacaagagt acaaagaaaa taaaaaggct tttaagaaga     38040
     agggaaaaca agttagaaaa atatctgatt tataataaaa aaagccgtaa aatgacggct     38100
     cttttttgtt catcaaacta ttcttttgtt ttatttaact tcataccacc aacctttacg     38160
     gtcaagatac tctttcattg cttttaattg tgtatcactc gtaggatctg ttactacgaa     38220
     agttaatcca tctccttgga gaagaaacgt acctgtcata ttaagagatt tcatagctcc     38280
     tgctacatca ggaacctcat atggtgagaa cgatcctgtt tggatgatat tctgtttatt     38340
     tggctgagta ggcgcgacaa ttgagcttcc tactccacat tcttgtccaa agtaagcgaa     38400
     gattaccgct gaagtaattg catccacatt ccacttagcc atatcaccct cattgtcaat     38460
     aaaccctgct tctacaagga agaacggaca gttagatgag cggattactc caatatctgg     38520
     acgtatctta gctccacggt ctttccatcc agtacgcttt gcaatttccg ctgagatacg     38580
     tgctgccata ggcgcttcct ttgcagagta acaaagcact tctactccgt gcccttctcc     38640
     gttagatgca ttaagatgcc atgcaaaacc tacatcatta ggtctatcgt taatattcct     38700
     aacttggtta cctacgatag cattagctgt gcgacccaca tcatcagtat catcctctac     38760
     agaatgacct agggcgcaca atttattaat gaaatcctta ttacactcac gatccattag     38820
     atgttcttta cgattacccc agttagctcc tggtacaata gcattatgtc ctccgtggct     38880
     tgatactctc attattcaac atctcctttt tcgttttgat cggtaccatc tccgtgactt     38940
     gtccaaatac ctagtgcaat accaaataaa taaacagctt gctgcacctt ttccaaaatg     39000
     ccttcaaatc cagttactcc aaacactgat aaaatcagtc caaagcatga aaagagcgca     39060
     atccatgtct tccaattgcg caaacgtttt aaaatatttt cttttgttag tggcattttt     39120
     aattagcctc cttttccaaa ttatcaagtc ttttatgagc ttgtttcgaa ctctcttcga     39180
     ctcgtgtaac acgttctcca agagcaatca tttgtttttc actagctttc aaatcaatac     39240
     ggatatcatc aacaccttta cggatataac ccaattccgc tttcatttct gcgctttgtt     39300
     gcccgtcaga tttaatagat tttgttctgt ttaaagagta tgcaaagtag ctaatcgcaa     39360
     gagataatac tgcgattagc acaccgattt caattgtcat tagttcagct ccttttctaa     39420
     aaaataaaaa agaccagtta attaaacctg ctctttgttc tctaaatcag ctattctact     39480
     atttaaatca acaatttgtt ctcctaaatc cggaatgacc tgcttaattt tattaatttc     39540
     gtgttcataa tctggtgtat cttgtatagg tgctgcaaat gctattggca cttctggttc     39600
     ttcaagagtt ggcggcttct gatttttgat atcttcgagt tccttctgaa tatcagctaa     39660
     ttgtttctta attttttcta attcagatgg ttcttcaggc ttgggttctt cgggtttagg     39720
     ttccactgtt tttacccatt ttccatcttt aaataatgga taataaattc catcaggaca     39780
     aacttccaaa gtgcaatttg caggaatgtc tggttcataa cctataacca catcttcttc     39840
     gtatgggact ttaattgttt catatctaac atagtattga acacagtcag ggcaatcata     39900
     tttactaata ggaggttctt catcttcctg atatttatat gtcccgttct caatagattg     39960
     atgtagctca catagtttct cttctgtgac aatttctttc gtttcttctc gatagaatgt     40020
     ttgtttctcg taaatttctt tttctgccaa ggagatcatc tcagtgaatc gtccttcttc     40080
     gtcataacaa taaccgtagt atttagccat gtggtttcct ccttttagtt agttacgtat     40140
     gttgacgtaa tgtagaaact cttaccagtg actgatgaag aacctaaatc ttgcatccat     40200
     acttctccat tagagttgat aacaaacaag ccctgtacac catctattga tgatacattc     40260
     tgcagtaccg ttaatgttgg gcgcatatct actggaagtg taaacatcgg agcggtattc     40320
     cctcctgatt tctttctaaa cggagcccta agcgtaactg tatttccgcg tctatccgct     40380
     atgacggtgt tacctgtaaa taactcagca tctgctgtca agtttatatt agctcgtccg     40440
     tctttatcat taccgtttac acacttccaa cctgaccacg tagttccatt tataaagtta     40500
     gaccatacac ggttgtccgt tgtgacccct atagcatacc cgtaagaagt tccgtgcatg     40560
     tttgaaactc ctctaatggc tagcgtgtta ggagtattca aagcacttcc agccgcataa     40620
     aatgtacgga aacctcttcc gacgcctagc actttagcaa gaatatcctc acctgatctg     40680
     gcttgaagtg aggcatcacc gtttggagct gatatatcta actgcatgtt cgttgtgtct     40740
     gctatagtca tccaaggagt ccacacatta ttgtttaaaa ctcggaaata catcttgata     40800
     gtgttacctg ataagttagt agccctttga agtctgtacg catcagcagc accgtaacgg     40860
     ataacttcta catagaagaa tgcagtgcta ttctctggag tgttcttcat tctctgtcca     40920
     gtatattgac ctgcttctat taagtcgttt aaatcagtat cattcctact tatagcttta     40980
     ccttctcctg tagtgaatcc attgtagatt tccgtcttct tatacacatt aacgttacct     41040
     aaaaattcta aaaggttatt agctttccag tacttgaata ttcctttaga tgaagcccaa     41100
     tcatacattc cgaaatctcc agagggatca aagaataacc cttgttgtct aactccccca     41160
     ctagtggcac ggatagcctt tgtagaagat gtaacatcta agtcaagatt acctgtcatg     41220
     gtatcccctg atttcttaac cgcccccttt gctaattccc cagctgcaat aatgccatca     41280
     atatctacac cttcaagctt cttacctgct tcaatggctt tttggattac tggaaattca     41340
     tttgtagatt tcattgcatc atcagacatt attgattcat ctactgtaaa tgcgaattta     41400
     caagtttcaa ttactttgtt attcgggaaa gtaaatctca attgtgcaat gacattaccg     41460
     taagcaatca gagtttgcgt acttaaaaca acatagtact taccctgcat ttgattcaca     41520
     ttctgcacat cttgaaatac tcgcttacaa tcaggcttta aaaatgcaat ttgtacactt     41580
     gttgcagatg aaaaatctgt tactactttg tcatgagtaa cattgattaa tagtttggca     41640
     gagtttaaat cattctgata aaaccggatg agcttcagtt cctcttcttt tacattgaat     41700
     tccttgtgtt gcatcgtatc aattgttatt tctcttattt taagtatttc tgccaattga     41760
     tttcacctct tttattattg cgatacttgc gttgcttgtt gctgcaagtt agttaaacaa     41820
     tcagagcaca catttaacgt tcctaactta tgcaaatgag cattcttttt gcacaactca     41880
     caaaatgtat ctgttttacg caaataaacc tggtcgtgat ctgagaaaat ctcaactaca     41940
     tcaccaggtt taacaccaat atcggataat ttatctaatg gtacttttac agaaccgtct     42000
     tcagaaatcg ttactgttac tcctaagtat tgatatgtca taaatacctc ctatattgaa     42060
     atgttcataa atgcccatcc gtttgtacct atatgaagat aagctcccca gcctttactt     42120
     ccgttcatgt atttgatagt ccctaaagag tccggtcctc caccagcaat atttactcct     42180
     tgtgtactta tttgagtatt aaacgacact gacccgccag cattgaatgt tatctgttta     42240
     aatgaacgaa aatctattcc catttcaccc gtaattgttg tcttattgtc tccaaataga     42300
     tgagtatttc catttgaatt gagataaagc gaacttggaa acgctggatc acccgtaatt     42360
     gttctgcctt taactactcc cacacttgca gtataataat caccaagatt ttgttgtgaa     42420
     attgccattg ttccgtcgtt aaatacgcta gaatcaacgt tctcatgtag aagaattgta     42480
     ggttgcattc ttccattttt attccagtag taaccgaaat acattcgtgt taaattcgat     42540
     tccatcaagc ggatgaattg tttttctatg tgaacatagt tagagccact atcagtgcgt     42600
     agtgtagaac ctttaatttc tcctgctaat atacgctccg caacaacacc tcggccagtg     42660
     attgcgttcc taaaggtcat tcctccgtca gtacttacac ctaatccggc actattcaag     42720
     actacaacat aattgggatt attcttatcc ttcgcaatta acccttgtgg tgtgatatct     42780
     aattcactag ttacacctaa aatcatgctc gtgacattcg caacttccgc tgccatcgca     42840
     ttgattggga gcttttctcg cccctctatc aaatcattaa ttgttttagc ggcatgatct     42900
     aaattagact gatacctttt ggtaatgtct tgattcccaa aggtcaattg aacatccagt     42960
     atattcccgc gccaatcacg taatacactc cgatttacaa cacgtacttc tgcgtccaat     43020
     ccaattcttt catcaattag aaatacccga tcaccaagtc cactctgagc aatcgggtat     43080
     ttctgtttcg ttaaatcatg tatatcggca gttacgctaa tttttaaact ttcattcaca     43140
     atctttttta aactgttttc cattgttgca tttaatttta tacgaccgtc ttttaaaggt     43200
     ggcgcgtgac gcactccgat tccaggaata cttgcaagcg gtgatgtata ctcacgaatc     43260
     aatttagcac cttgccatcc atcttcttct gtaaaatcac cataaccttt agcgtatgtc     43320
     caaaaacctg atgcatcaac ttcttgaact atatttgaag cattcaatct atggcggtac     43380
     atgacgttta agtcaactcc gatttgcggt tcaatggtta caaccttgcc gagcacctta     43440
     aattctgccc cataacgatt caatgcatct ttaaacattt caagtcgggt agacccacca     43500
     ccgaatcctt cccattgtaa cgaattgtaa ctaccattca attgataaac atagccactt     43560
     ccactaaaaa tagttgcaaa gcaagcattc gcagtaaagt attgattata ttcttcatac     43620
     acacggtcat tgtcgaagtc atcataaaat ttcggtaccg ctttaatctc agcagttaat     43680
     gttttccctt caccctgttt cttcaggtaa acaactttgt attccgtttc attatcatcg     43740
     actaaagtcc acatttctga gagtctatta agaaatgtta aattcacttt attaggaggt     43800
     atctttgcag aaaacacaca attcccattt aattcttctt caattaaata agttgtttgt     43860
     gtgatatact ctatattttc taaatcacgt acatacatat taaatcacct cacttgtagt     43920
     aaaatctaaa atcgaattct attgttgctg aggtgcaatt aaacacttct aaggtattcc     43980
     accctgggac aagctcaatg aaatccttct ttgtattcct taaaaaagat aacccgttcc     44040
     tacctatatt gggacctgag taaataatgg tgtctgtaat atataaagct gacgttattg     44100
     ttgcagtgct aaggtttgta tgattcttaa gcataaatcc tgctgtgcta ccagccacat     44160
     cactaattgt tatttttaat tcttgttcaa aaggatgcac tggaatgtta ccaggattga     44220
     aaatttgaaa tcgttgacct gctacggctt tatgtttata tacccttgaa gcaggatcac     44280
     tgataattcc cataccagct ccccataatc cactccctgg attaactcca tcacgttgaa     44340
     tatctgatga cttaccaatc gattcagcaa atggcaagtc tgctgtttca aattccaatt     44400
     caccaaatcc atatttgagt tgctgatcta tatcgaatgt agaggacata tttactttat     44460
     atcgtttgcc actaacaatt agattatctc cattttgata ctctaatcgt cgtaattcac     44520
     gaatatagaa aggttctgta cttagtatca tctcaaatag tttatctcgc gttattgcta     44580
     catctaataa atcctgcgct ttaaaataaa agggtacagt tatattccgt accccataag     44640
     tagatcctgt gctaattctt ccgcttgcgc cttctacatc tatataggta ggacgcattt     44700
     caatcgatcc cacacggaag tcttgcacct gaacgtttat gtcagatagt ttcatagttt     44760
     gtccattcat tcttgtgatt tgcacgtcca ttagaaatac ctccttactg tgttttcgac     44820
     tgcattccct tcatttacat gaggtcgtac aatacgtcct actgtttcac cttccataac     44880
     aacttgtaga ttatctaatt tgtcacctag atttttaact gcagctgcca ctaatctatt     44940
     gtcattttga cttgcaacat tagctgattg ggagttaatc attgcttgtt gcccgaaatc     45000
     tgatgaggaa ttaacaccag atacatacga tggagcctta taacttcctg aaatagaagg     45060
     tatcacagga gctactacac taccaggaag aatgtcaccc atttgaatag actctgtcaa     45120
     acttgagaat ccatctttaa cagcagacgc catatctaat gcagtacgca caagagggtt     45180
     tatcatacta tccattccct gatctaaacc ttgacctacg tacaccccta tatctctcat     45240
     cacacgtgaa ggagaatgga tacggaaaaa tccggtaata gtatctttta tggaacgacc     45300
     aatattaaac acctggtcta taagtttatt agcataactg taaataccat taataagacc     45360
     agaaatcatt tgttggccaa tcgtgaaaaa gtaacttaca aaacgctgga ctgtatttac     45420
     cgcttgccct agtacccacc caatagccga aaccacatta ttcattttat tttgtattcc     45480
     gcctataata gcgtcccaaa ttccaacaaa gaaatttttg aacataccgc cccaactttg     45540
     cgctagacgg gttatagttt ctaattttga accgaagaat acatatagat ctgcaagagc     45600
     atcattccaa atcttcttta tatctcccca aaatttaccg aataaccgac ctatgtcatt     45660
     tccaaattta ccaagccact ttaggactct cccagcaccc cataattgca ggtaacccca     45720
     aattgcttct agtgctccga accaaatttc cttaacccct tcccaaactc cagcccaatc     45780
     gccagtaaaa agggaagaaa aaactttcac gattccgagt ataactttta gaattccttg     45840
     tataaaatca cgtatcgctt ctagcgttcc aatcacaatc tctttaataa tcggccacgc     45900
     aaattggaaa actgcgacta taatcggcat taccgatttt attatttcac tcgctacgga     45960
     ccaacaatca gaaaaggctt gttttatctg actaccgttt tctagccaaa attgggctat     46020
     ttgggttccg atcgcagtca tgaaggacca gatttcgctt aaaaattcgc ttatcgcttg     46080
     cttgatagac gatacagtat taacaaccgt tgtaattgtt gcctgattca tccctagcga     46140
     ttttaataat gctgttccat tttcttcatc acctgcgaac aacgcaaaaa tgccttgcat     46200
     gaatactgca aagcttaaaa aaacttgttt aattgtttca attacccctc gaactgtttc     46260
     accaaatgat atgattgctc tagtattctc tggtgacatc cctagagaag tgagcatact     46320
     agctgcacca tcactattcc cttgtaaaac ttgccaaaac gctttaaaaa cggttatcac     46380
     gttatttact gcgttcctaa atggttctat atttttataa gcataagtaa accctaaagc     46440
     taaaccagtt atcgcagctg ctagcgccca tgctacagga ctcgccatgg ctaacaccat     46500
     tactgccggt ttaataatca tccataaagc agcaaatgcc gctctatacc cttttaataa     46560
     tcccattcct gcacctaatg gcagcaatag gagtgttaag gctggaacga gcatcattgt     46620
     cccttggatg aatttcgcta aagtaggatg cgcttcatta aatgcaatga ccattttcgc     46680
     cattgtgtta acaaaattat aaataggtat cattaaagcg gcaaaagcat ccctcattgg     46740
     ctgtaaagct tcagtaagtg actccatcat gtctttatat gcctttgcgt atttagggtt     46800
     catttccata ttagctttat gcaatttgcc ataaaacata actgctccag caccaacgac     46860
     taaaaacgct tgtcccatcc ccataacaga ttggttaata atacgaattt gatcatttaa     46920
     ctgcttcata ttcgcagtag gtccaagaaa ttctaacgct agttgagcgg cactacttct     46980
     gttagccaat cgttccattg catttgttgc tgctaaagca cctctagaaa cgttgtataa     47040
     tggattaccc atacgttgca agttaccttg tagtttactt gatgttgtag acatattgtt     47100
     caacataccg atggtttgca aaatactagc ttgtttcatt ctgtctagtt tcataatttc     47160
     atcattcgcg gctttttctg ctttaccaat cctgttaact tgagcaatta aatcctgggc     47220
     actaccagag taagttgcca tgctcatagc agcatctaaa taagcgagtt tagttcgttt     47280
     taattcttca atatgaggct tcatagcttc tcgttgttcg tatttcattt gccttaatct     47340
     acgactatat tcactgttag cattccccat attttcaatg ctacgtcgat attctctaga     47400
     gcttcgactg gttgatgtga caaaatcgtt catttcacga cgcatctgtt gaatctcgcg     47460
     acgcatttga tcagtttcag ccctaaactg atcaactaat tcttcttgtg tggccaaatc     47520
     tctccctcct ttctaattga agttgagagt ttgtaagaat tgcatatgct cttgcgcttt     47580
     ttgcattttt tcttctatcg ttaaatcttg attgttttct ccattcaact tatttcggtc     47640
     gaataaatca gatggtttta atttcttttt aggatcatga tgataggcta cacgcatcat     47700
     aagggcaaac acgctatttg tttgtaactc atcaaggtgt tgctcattcc gacctatcat     47760
     caaattttcg aattcacgag gggtaagcgc cataacctcg ctaggcaata attttaaata     47820
     tctaaaccca tcttgttgaa ctttgtctaa gtcctcgcga gtaaattctc ttattcttcg     47880
     accttcccga acatttcctc taccatttcc atcatctctg ggttctccgc tgcttctgga     47940
     ttcttggcta gatactgctt cttcatttgt tttctcaact tttttgttgt cttttggtag     48000
     aaagtacttt ctgctaccac ctcatttaaa agttcttcaa tgaattcttg agaaattttc     48060
     ccctcttcaa attgtttttc gatgttctcc atgactttat cgcgtgtaaa tccttctttt     48120
     gtgtgcatta atccaaagta gatagcatca acaaacagct ctaaatctcc ttgcatacaa     48180
     gccattacaa cttcgtttga accgccctca tattttttat ttaattcata gatgtttcca     48240
     aaagtaagtt ttaattcgta ttccttttta tcgatttcaa aacgcattta tatcaatctc     48300
     cttttaattg gatgttattt tcaaatttaa aaaggacggt aaaaaccgcc ctttactgac     48360
     ctgcaccttt agggatttct gtgagtgttt ctgttcttac agatccggat aattttactt     48420
     caactgaata agaaacaaat tcaccgttag atgaagaacg ttcaaaagaa gtaatcatat     48480
     agttgccagc ttctgcttct ttcgttctca tattgatttc atagatctcc atatattcac     48540
     catttctaat ggcagcttta acagcaggat aatacgggtc gccttccgct aacgtacaag     48600
     agaacgaacg tgtttctttt ctttttccat aatcggaata tgatctatct tttgactctg     48660
     cttcaatttc atcagcttca atattatgag agtcttcggt ctggtcaaat ggtctaacta     48720
     atattgtctg attagtttga tccttgattt tagcagcgat aataaactca tcaccacggt     48780
     acattttgtt cttaactgtt ccagctgttt cagccatatt tttcacgctc cttaatttac     48840
     ataagcttgt tggtattcaa aaatcattgt taattgcgca gaaccaactc cacttggagc     48900
     agttgttact ctccgaaaat aaatcgtatc aatcgattca ctaccatcct catttcgaag     48960
     atgtactgtg taactgttgc ttctaatttt attagcgacc ttttctgctt cttgcatcgc     49020
     cttatctgtt gttgcattaa aaaaccttac taccattgtg tatagtaagg tgtaatgatc     49080
     ttttgaagtt ttatcatcat ttatagataa aatcggataa tataccgatg gaataactag     49140
     ttcttctgga acttgatcat gataagcgaa tgtattagca ggtaaactgt cgtatacaaa     49200
     agctttcata gagccatgta tttgctcata cataattatc tcgctccatt ctgtacccat     49260
     tgcttaaatt ggcggtcaaa tgaacgttgg aacatgcgct catatattgc tactgcatta     49320
     tcccaatacg gacgaccttc aataaattta gcagtaagca tcattccggt aggtgcatgt     49380
     ggatcatact cgaaattatg tccttcccat ctacctggaa caaatctcct tacctgctgc     49440
     catccatcat tttgtaattt tgcatagctt aagttgctac caatctctaa tgttaatcca     49500
     ccatcagatg agcgccacac gtttccatct ccacccttat caaacgagtt tagcagtctt     49560
     cttgtatcca caaccgctaa tgaaatgatt tgattttgca cctcttctag aaattgaaat     49620
     ccgcttgctt caagccataa agcaacgttc tgatccagtc catttgccat acgattcaac     49680
     ttggcgctaa actcacgaaa tcctctagtc gttatttggc tagccatggc tcactcttcc     49740
     tttctacagt ggcctttata tgtgaaacct caccagtaag tggatgtact accggaaagg     49800
     gattgcgtat atagtaaacg acattagtat tcttcttgat taccttgtca ttgtgtttta     49860
     tatctgtacc aggcataaat aacactcttg tatgttgttc atttaattga tttggcgcag     49920
     attgtattgc agtaggtcta gcgattgcta cattctctgc aaagtagcag atttgttctg     49980
     ctatatcagg agtatcgtgg tataaataaa cctcttctcc tggttgcccg tacttaccag     50040
     gcttcgtttc cttctgcaaa tggtaaatat cacactcatg gaccatcatc gcttgaagag     50100
     acattaaatc gccctcattt tgaatatgac tttattctta cccttatgat ccataaactt     50160
     ttgcaaaagg tataatacag aaggtttcac aatactggaa ctatcctttg tataagaata     50220
     atcaccacta ccaatacttt cagacttaat acccttcatt gcagttgtat cagcgtttgt     50280
     ataagcgtaa tactgtgcca acttcttaca cgctaacttc acttcttctg gaacctcagg     50340
     atatttcgtc ttatcactaa aatctatttt agagagatta taaatctctg tatctgcctc     50400
     aagtatgtcc tgctccaata aaggaacagg acgattcttc acttcaggta gtacagtgta     50460
     atctattaat tcttgagcag taataagtgg catgcttatc actccgattc ttgagattta     50520
     gatgatgttt tgctttcttt tacttcttct aaatcagaat aggtactcag taactcgtcg     50580
     cgttcttttg cggttacttt gcgcggttcg tttgcataga aatagcgtcc tccaccaata     50640
     tgaagaacgc ctgtcttttg tttatattga actaagggca tttagctagc tcctttctta     50700
     cagcttttca ccagtcatcc atgctactgc atctacttcg cggataacgc agtctaagta     50760
     agcaaataag atgtgatacg tagcatcttt agcggccgca gtagcgcctt gagcagtacg     50820
     gttgtatcgt acatcacgag taaatacagg ttttaagttc tcgcgaggcg ttagcatagc     50880
     aaatccagat tgcatttctt gtacaatctc aacctcataa cctcctaatt tagtaacttt     50940
     accatcaact aacaccgcat ctcctaaatt agtttggcga tttgttaata gagacattaa     51000
     tttgtcatgt gttttttgcg taatgaacca tgcaatgtct tttcgagttt tgaaacgttc     51060
     tggaagaata gctacatgat caacaaacgc ttgaactgtt acttcctcgg ctgctaaatc     51120
     tgttttattt gtagatgctt tagccttttt aacaaatcca tcgataatct taacaaatgg     51180
     atcagtagaa gatgtatctc cattgaatgc taagtcctgt aaatctgtac caaattgttc     51240
     ttgaatcatg ctaataatta catcttcaac attttggcca cgagaagcca atgcatacca     51300
     aacatcatcg ttttgaatcc attcatccca ttttactttc ttaacagcgt aagggatttg     51360
     tccaggtgcg atcgaaccaa caccagtagg agtatcattt ttagacgctt cacgtaattt     51420
     acgcttgcct acgcttaaag tatcgatatt accagcagga gctttcttgt agtatgggtt     51480
     taatttaggt aatactgtag ctttattgat tgtatcgcgt aaaaacgctt ctgctgctgc     51540
     ctgtggtaat ggtacattta catcttttaa aacgatatct gtagaaccac ctgcaataat     51600
     ttgtccgtta ttcatatatt cgtttcctcc ttagttacca aagtatccag cgtaaccgct     51660
     agctgatttt tgtacgtttg tagtaccatc agtatcttgt tggttgctga taccttgaga     51720
     ttttttaagt tcttctaatt gtttttctag caattctacc ttttcattca tcttttgttc     51780
     aggtgttttt tcaggctcaa tattaagatg tttcttaatt gttgccatct caccttgcat     51840
     ctcctctaaa cctttgagta acttctctac ttgctcttga ttcatattat cttcctcact     51900
     tcctgcgcct tccggtgacg gtgtgacgcg tgtttttaaa tttgttaatg attcaatagc     51960
     agcatcaata tctgccatat ttggagcgct gattttctta cctgctttct ctacttctac     52020
     agcaagagag atagcaggtt tgttttccca ttcctttaca actgcttctg tacccttcaa     52080
     ctcattgata atctcaacga attcgagtgc agctgcttct atacgattta agtcgattgc     52140
     atcagcagta ggggcattcc ataacgattg atagaaagta tcttctaaag cagagaatga     52200
     agcatttaca tcacggcgat gtttgttttg gttaaactta tccctaacct cgcccttttg     52260
     aacgttttct ccaccaaaaa agcccttcac caattggaag aaggacttca tttgtttatc     52320
     tttagtttta gatacttctt cctcaatcac ttctgtctct gcgactccag caagggaata     52380
     tccttgaaat tcacccttct taacagcttc ccatgtttcc tcatctgcct ttgtagtaag     52440
     gatccatgta cctttcttta caggttcgcc attaagctcc atatcagcag gtgcaatata     52500
     tgattcaaca acttctccaa cacctgctac aaagtcgtga tttttatcga tttggcggta     52560
     cttgagcata aactcatgcg ctgccttttc gattgtctta gcatctgcga aatctccgtg     52620
     agcatcgatt gtatccggct catatacaat cccatagacg agacgttctg cttcatcatc     52680
     ggacttaata accttcacag gcttttcaaa gtttggttgt tcttctgatt tcgttaaaaa     52740
     gaacttacgt tggtttgctc cattctctac aaaagagaca tgtgaaacct gcaagttctt     52800
     cagcttacgt tttttcattt attcacctcc tttcaaatac gaatcatttt agctttagaa     52860
     gtcttcattt cttgttcaac tccttcaaag tttcttccct aatcttctgc ttctcttctt     52920
     ctgataggcc taatatattg ttatctactg ctggagacat aacacatttg cacttaactc     52980
     tctccttagc agatagagaa ctatcgcgcg gaaacataca cctctcacca gaaccgggta     53040
     attcaaattc ttcctctact agcaccgttg taccgtcata cgccacgtga ttatcacgag     53100
     gttggttatt ctttgcaccg ctatgacgcc acttcttacc cgtaaccgca ggggattggc     53160
     gatatgattc aaattgagaa gcagagcatg ctgcaaggac ttcagtctgc gctgtagtct     53220
     tcgctctctt ccgatcaaat tccggaagtt tcgcaagttc tcttgctatt tcttttatac     53280
     ctttcccctt ttctaatcct tcatttaaaa tacgttctac tgctttatga gagttaatct     53340
     tcatgatctt acctaattca tccgaccaac tatcaatcca ttttgtggtt cgttttgaga     53400
     agatattaaa ctggatatcc gggtcaattg catccataaa agctttcgtc atatctttca     53460
     tcgtgtaatt aagaaacttc ctagccgctt tactcaagct tttagcgaag gtatccgctc     53520
     caaataggct accagtgaca aagtcgataa tgtcctttat cttgataccc ttctctacag     53580
     catctttttt cgtatagttc ttaatcccat cgacgaagtg tttcttctgc ttacgaagca     53640
     gtttagcaat ttccttttca aattcctcaa cgtatcctgg taacatgtcc aatacttcta     53700
     gatcagcagg taatgaagca gtaaaatcgt cagtatcagc cttttcaatc cactcattta     53760
     atgaatctaa taacttatca atcttctgca tcttgcatcg actccagtaa gtcacgtagg     53820
     tctttcatta cattgattaa gtcttcattt gaaccgctat caactgactt ctgcaacttc     53880
     tcactcagac ctttttccca accacttact ttacgatgac gttctaatac tagagctaca     53940
     ggttggtctg cttctggcat atcgtaatct gagaactctt tatttagcat attaccagca     54000
     atattacgta tatcttggaa tgttaagcca cccttatcag caagtacctc aatggtttta     54060
     accatatcct cagtgttact aatctcagac ttacgtaaat tcacgtatac gtgttttaaa     54120
     ccatatggga gcagcaggac attattgata atgaactcta agttattacg ttcaggctca     54180
     aatacctgct cctctgtaat ttcacgaaca gattcagcag ttgctctgtt aaaatctcga     54240
     atataaccaa catacacgtc aggtaaacgg aatgctgatt gtaccttttg gcgtgacttc     54300
     tcgtcatact caaggaatag agcatcattt tgcaggatat ctgctagtga tttcaattca     54360
     atgtcaacat taggttgtgt atcgcctaca acaccttctt cagcactttc tacttgtaac     54420
     aaaagatatt tatgttgatt atcttcaccc tcaacatttg aaacataatc ggttatggct     54480
     gcttcactgt cttcggaaag tatcccgttc ttcagtaaga tggccatagg gatatgtctt     54540
     ccctgtttaa aatagcgtag gtttaactct tccgctttcc tcgcaccaac catgtgaacg     54600
     acatgcgata cccaacgcgg aattccatat ggtccatttc caatcttcaa atgcaggacc     54660
     tcagtagcat ttttctctcc taacgaagcg tcggaaaact caccagtctc tttatttaag     54720
     aaacgcggat caccaaattc tttaaagtaa gtatctactg ctcctacctg ttgcacatag     54780
     cgacggaatc ttttctttcg tttgatttct tttccgttaa ttaagtatgt tacttcttgc     54840
     ggttcgtcat ctttacgagt cactcgcatg tactgtggta acatatttat taattcagca     54900
     ggtttcccct ctaaattacg aataacttct atataaccat tgccagtcgt ctctttatca     54960
     tcaatagcag tttcgagaat ctctttgaat ggcttgtcga aactaaataa aggtatgact     55020
     tctgtatcaa ctagcgacca ctctgccttc atttcaggag tttccttgtc gtcctcttgt     55080
     ttatacttca tttcatgccc aaatccagcg atatttcgct tatacgcatc tatacattga     55140
     cctagaattg tactattttc cctaatctgt tgtaagtctt caattctata aggcggttca     55200
     atgatgccat ttacagcata cttttcgttc tcgctctctt gctgacggga taacacttga     55260
     gtatttgttc ccgctgcctt aattaccttc gcactaactt tccttttatt tgtcattaag     55320
     ctgcttcacc tcttttcctt ttcttctttt tacgtaatcc aaatatgatt gtattaatga     55380
     agtatcttgt ttcatccata tggtgatcat tctctttcag cggcttatct tcaccacgtt     55440
     ctacagattt ctcatcccat atataagatg cgaactcttt aaatgtttca ttacagcagt     55500
     cgttaaaata aataatgccc gtgtttagcg caacaccgac attaccaata ccctctttaa     55560
     cattatttcg ggccttatat acttttcgtt tatttctaac taataaagct ataaatgaag     55620
     cagcggacgg gtcaactaca gtgccacgga ttggcaaatc tcctacgaat ttttcaaaat     55680
     cctcgtagta ttcctggtct gttttctgct tttctgtttc tctaccgcta taacggtact     55740
     ctttcacctt gtaccatact tctttatctt tttcgatgca tttaccccac aaaccgtata     55800
     ccatggcatt ctgcgtacca tagtcacagg aaacaaagta ttcaatgtat tccctttgaa     55860
     tcgtaggaac tttatgctta tcctcgtcaa acatatcgaa tataagaccc gaagcagctg     55920
     cccaaagccc taatatata                                                  55939
//

If you have problems or comments...

PBIL Back to PBIL home page