(data stored in SCRATCH9089 zone)

EMBL: CP000488

ID   CP000488; SV 1; circular; genomic DNA; STD; PRO; 1160782 BP.
XX
AC   CP000488;
XX
PR   Project:PRJNA16841;
XX
DT   04-DEC-2006 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica), complete
DE   genome.
XX
KW   .
XX
OS   Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)
OC   Bacteria; Proteobacteria; Gammaproteobacteria; sulfur-oxidizing symbionts;
OC   Candidatus Ruthia.
XX
RN   [1]
RP   1-1160782
RX   DOI; 10.1126/science.1138438.
RX   PUBMED; 17303757.
RA   Newton I.L., Woyke T., Auchtung T.A., Dilly G.F., Dutton R.J., Fisher M.C.,
RA   Fontanez K.M., Lau E., Stewart F.J., Richardson P.M., Barry K.W.,
RA   Saunders E., Detter J.C., Wu D., Eisen J.A., Cavanaugh C.M.;
RT   "The Calyptogena magnifica chemoautotrophic symbiont genome";
RL   Science, e1252229 315(5814):998-1000(2007).
XX
RN   [2]
RP   1-1160782
RG   US DOE Joint Genome Institute
RA   Newton I.L.G., Woyke T., Auchtung T.A., Dilly G.F., Dutton R.J.,
RA   Fisher M.C., Fontanez K.M., Lau E., Stewart F.J., Richardson P.M.,
RA   Barry K.W., Detter J.C., Wu D., Eisen J.A., Cavanaugh C.M.;
RT   "A window into the hydrothermal vent endosymbioses: the Calyptogena
RT   magnifica chemoautotrophic symbiont genome";
RL   Unpublished.
XX
RN   [3]
RP   1-1160782
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Dalin E., Tice H., Pitluck S., Saunders E.,
RA   Brettin T., Bruce D., Han C., Tapia R., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Richardson P.;
RT   ;
RL   Submitted (29-NOV-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; ce2bda3af68662a5cecff81a45c5cd15.
DR   BioSample; SAMN02598375.
DR   EnsemblGenomes-Gn; EBG00001173069.
DR   EnsemblGenomes-Gn; EBG00001173070.
DR   EnsemblGenomes-Gn; EBG00001173071.
DR   EnsemblGenomes-Gn; EBG00001173072.
DR   EnsemblGenomes-Gn; EBG00001173073.
DR   EnsemblGenomes-Gn; EBG00001173074.
DR   EnsemblGenomes-Gn; EBG00001173075.
DR   EnsemblGenomes-Gn; EBG00001173076.
DR   EnsemblGenomes-Gn; EBG00001173077.
DR   EnsemblGenomes-Gn; EBG00001173078.
DR   EnsemblGenomes-Gn; EBG00001173079.
DR   EnsemblGenomes-Gn; EBG00001173080.
DR   EnsemblGenomes-Gn; EBG00001173081.
DR   EnsemblGenomes-Gn; EBG00001173082.
DR   EnsemblGenomes-Gn; EBG00001173083.
DR   EnsemblGenomes-Gn; EBG00001173084.
DR   EnsemblGenomes-Gn; EBG00001173085.
DR   EnsemblGenomes-Gn; EBG00001173086.
DR   EnsemblGenomes-Gn; EBG00001173087.
DR   EnsemblGenomes-Gn; EBG00001173088.
DR   EnsemblGenomes-Gn; EBG00001173089.
DR   EnsemblGenomes-Gn; EBG00001173090.
DR   EnsemblGenomes-Gn; EBG00001173091.
DR   EnsemblGenomes-Gn; EBG00001173092.
DR   EnsemblGenomes-Gn; EBG00001173093.
DR   EnsemblGenomes-Gn; EBG00001173094.
DR   EnsemblGenomes-Gn; EBG00001173095.
DR   EnsemblGenomes-Gn; EBG00001173096.
DR   EnsemblGenomes-Gn; EBG00001173097.
DR   EnsemblGenomes-Gn; EBG00001173098.
DR   EnsemblGenomes-Gn; EBG00001173099.
DR   EnsemblGenomes-Gn; EBG00001173100.
DR   EnsemblGenomes-Gn; EBG00001173101.
DR   EnsemblGenomes-Gn; EBG00001173102.
DR   EnsemblGenomes-Gn; EBG00001173103.
DR   EnsemblGenomes-Gn; EBG00001173104.
DR   EnsemblGenomes-Gn; EBG00001173105.
DR   EnsemblGenomes-Gn; EBG00001173106.
DR   EnsemblGenomes-Gn; EBG00001173107.
DR   EnsemblGenomes-Gn; EBG00001173108.
DR   EnsemblGenomes-Gn; EBG00001173109.
DR   EnsemblGenomes-Gn; EBG00001173110.
DR   EnsemblGenomes-Gn; EBG00001173111.
DR   EnsemblGenomes-Gn; EBG00001173112.
DR   EnsemblGenomes-Gn; Rmag_R0001.
DR   EnsemblGenomes-Gn; Rmag_R0002.
DR   EnsemblGenomes-Gn; Rmag_R0003.
DR   EnsemblGenomes-Gn; Rmag_R0004.
DR   EnsemblGenomes-Gn; Rmag_R0005.
DR   EnsemblGenomes-Gn; Rmag_R0006.
DR   EnsemblGenomes-Gn; Rmag_R0007.
DR   EnsemblGenomes-Gn; Rmag_R0008.
DR   EnsemblGenomes-Gn; Rmag_R0009.
DR   EnsemblGenomes-Gn; Rmag_R0010.
DR   EnsemblGenomes-Gn; Rmag_R0011.
DR   EnsemblGenomes-Gn; Rmag_R0012.
DR   EnsemblGenomes-Gn; Rmag_R0013.
DR   EnsemblGenomes-Gn; Rmag_R0014.
DR   EnsemblGenomes-Gn; Rmag_R0015.
DR   EnsemblGenomes-Gn; Rmag_R0016.
DR   EnsemblGenomes-Gn; Rmag_R0017.
DR   EnsemblGenomes-Gn; Rmag_R0018.
DR   EnsemblGenomes-Gn; Rmag_R0019.
DR   EnsemblGenomes-Gn; Rmag_R0021.
DR   EnsemblGenomes-Gn; Rmag_R0022.
DR   EnsemblGenomes-Gn; Rmag_R0023.
DR   EnsemblGenomes-Gn; Rmag_R0024.
DR   EnsemblGenomes-Gn; Rmag_R0025.
DR   EnsemblGenomes-Gn; Rmag_R0026.
DR   EnsemblGenomes-Gn; Rmag_R0028.
DR   EnsemblGenomes-Gn; Rmag_R0029.
DR   EnsemblGenomes-Gn; Rmag_R0030.
DR   EnsemblGenomes-Gn; Rmag_R0031.
DR   EnsemblGenomes-Gn; Rmag_R0032.
DR   EnsemblGenomes-Gn; Rmag_R0033.
DR   EnsemblGenomes-Gn; Rmag_R0034.
DR   EnsemblGenomes-Gn; Rmag_R0035.
DR   EnsemblGenomes-Gn; Rmag_R0036.
DR   EnsemblGenomes-Gn; Rmag_R0037.
DR   EnsemblGenomes-Gn; Rmag_R0038.
DR   EnsemblGenomes-Gn; Rmag_R0039.
DR   EnsemblGenomes-Gn; Rmag_R0040.
DR   EnsemblGenomes-Gn; Rmag_R0041.
DR   EnsemblGenomes-Tr; EBT00001740027.
DR   EnsemblGenomes-Tr; EBT00001740028.
DR   EnsemblGenomes-Tr; EBT00001740029.
DR   EnsemblGenomes-Tr; EBT00001740030.
DR   EnsemblGenomes-Tr; EBT00001740031.
DR   EnsemblGenomes-Tr; EBT00001740032.
DR   EnsemblGenomes-Tr; EBT00001740033.
DR   EnsemblGenomes-Tr; EBT00001740034.
DR   EnsemblGenomes-Tr; EBT00001740035.
DR   EnsemblGenomes-Tr; EBT00001740036.
DR   EnsemblGenomes-Tr; EBT00001740037.
DR   EnsemblGenomes-Tr; EBT00001740038.
DR   EnsemblGenomes-Tr; EBT00001740039.
DR   EnsemblGenomes-Tr; EBT00001740040.
DR   EnsemblGenomes-Tr; EBT00001740041.
DR   EnsemblGenomes-Tr; EBT00001740042.
DR   EnsemblGenomes-Tr; EBT00001740043.
DR   EnsemblGenomes-Tr; EBT00001740044.
DR   EnsemblGenomes-Tr; EBT00001740045.
DR   EnsemblGenomes-Tr; EBT00001740046.
DR   EnsemblGenomes-Tr; EBT00001740047.
DR   EnsemblGenomes-Tr; EBT00001740048.
DR   EnsemblGenomes-Tr; EBT00001740049.
DR   EnsemblGenomes-Tr; EBT00001740050.
DR   EnsemblGenomes-Tr; EBT00001740051.
DR   EnsemblGenomes-Tr; EBT00001740052.
DR   EnsemblGenomes-Tr; EBT00001740053.
DR   EnsemblGenomes-Tr; EBT00001740054.
DR   EnsemblGenomes-Tr; EBT00001740055.
DR   EnsemblGenomes-Tr; EBT00001740056.
DR   EnsemblGenomes-Tr; EBT00001740057.
DR   EnsemblGenomes-Tr; EBT00001740058.
DR   EnsemblGenomes-Tr; EBT00001740059.
DR   EnsemblGenomes-Tr; EBT00001740060.
DR   EnsemblGenomes-Tr; EBT00001740061.
DR   EnsemblGenomes-Tr; EBT00001740062.
DR   EnsemblGenomes-Tr; EBT00001740063.
DR   EnsemblGenomes-Tr; EBT00001740064.
DR   EnsemblGenomes-Tr; EBT00001740065.
DR   EnsemblGenomes-Tr; EBT00001740066.
DR   EnsemblGenomes-Tr; EBT00001740067.
DR   EnsemblGenomes-Tr; EBT00001740068.
DR   EnsemblGenomes-Tr; EBT00001740069.
DR   EnsemblGenomes-Tr; EBT00001740070.
DR   EnsemblGenomes-Tr; Rmag_R0001-1.
DR   EnsemblGenomes-Tr; Rmag_R0002-1.
DR   EnsemblGenomes-Tr; Rmag_R0003-1.
DR   EnsemblGenomes-Tr; Rmag_R0004-1.
DR   EnsemblGenomes-Tr; Rmag_R0005-1.
DR   EnsemblGenomes-Tr; Rmag_R0006-1.
DR   EnsemblGenomes-Tr; Rmag_R0007-1.
DR   EnsemblGenomes-Tr; Rmag_R0008-1.
DR   EnsemblGenomes-Tr; Rmag_R0009-1.
DR   EnsemblGenomes-Tr; Rmag_R0010-1.
DR   EnsemblGenomes-Tr; Rmag_R0011-1.
DR   EnsemblGenomes-Tr; Rmag_R0012-1.
DR   EnsemblGenomes-Tr; Rmag_R0013-1.
DR   EnsemblGenomes-Tr; Rmag_R0014-1.
DR   EnsemblGenomes-Tr; Rmag_R0015-1.
DR   EnsemblGenomes-Tr; Rmag_R0016-1.
DR   EnsemblGenomes-Tr; Rmag_R0017-1.
DR   EnsemblGenomes-Tr; Rmag_R0018-1.
DR   EnsemblGenomes-Tr; Rmag_R0019-1.
DR   EnsemblGenomes-Tr; Rmag_R0021-1.
DR   EnsemblGenomes-Tr; Rmag_R0022-1.
DR   EnsemblGenomes-Tr; Rmag_R0023-1.
DR   EnsemblGenomes-Tr; Rmag_R0024-1.
DR   EnsemblGenomes-Tr; Rmag_R0025-1.
DR   EnsemblGenomes-Tr; Rmag_R0026-1.
DR   EnsemblGenomes-Tr; Rmag_R0028-1.
DR   EnsemblGenomes-Tr; Rmag_R0029-1.
DR   EnsemblGenomes-Tr; Rmag_R0030-1.
DR   EnsemblGenomes-Tr; Rmag_R0031-1.
DR   EnsemblGenomes-Tr; Rmag_R0032-1.
DR   EnsemblGenomes-Tr; Rmag_R0033-1.
DR   EnsemblGenomes-Tr; Rmag_R0034-1.
DR   EnsemblGenomes-Tr; Rmag_R0035-1.
DR   EnsemblGenomes-Tr; Rmag_R0036-1.
DR   EnsemblGenomes-Tr; Rmag_R0037-1.
DR   EnsemblGenomes-Tr; Rmag_R0038-1.
DR   EnsemblGenomes-Tr; Rmag_R0039-1.
DR   EnsemblGenomes-Tr; Rmag_R0040-1.
DR   EnsemblGenomes-Tr; Rmag_R0041-1.
DR   EuropePMC; PMC2642828; 19055818.
DR   EuropePMC; PMC3035367; 21304746.
DR   EuropePMC; PMC3202245; 21966992.
DR   EuropePMC; PMC4612132; 26371554.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000488.
DR   SILVA-SSU; CP000488.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000245
CC   Source DNA and bacteria available from Colleen M. Cavanaugh
CC   (cavanaug@fas.harvard.edu)
CC   Contacts: Colleen M. Cavanaugh (cavanaug@fas.harvard.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1160782
FT                   /organism="Candidatus Ruthia magnifica str. Cm (Calyptogena
FT                   magnifica)"
FT                   /strain="Cm"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:413404"
FT   gene            39..1331
FT                   /locus_tag="Rmag_0001"
FT   CDS_pept        39..1331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: cbu:CBU_0001 chromosomal replication initiator
FT                   protein DnaA; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA; PFAM: Chromosomal replication initiator, DnaA
FT                   C-terminal domain; Chromosomal replication initiator, DnaA;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01805"
FT                   /db_xref="GOA:A1AV48"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV48"
FT                   /protein_id="ABL01805.1"
FT                   /translation="MSQTWSQCLNTLRDSIPLSQYSVWIQPLKALENNNTLSLLAPNSQ
FT                   VLNYINKHLKAQIKNAVAQHNKNLKIFISIASNQNTQQHITPLFEDYTFDNLILGNANQ
FT                   MAYGATKQIAENIKTSPYNPFIIYGGSGLGKTHLMQAAGHLSKEKNQNIKVIYVPLMDF
FT                   VRNITSSLRHNTIENIKTFYQSADLLLVDDIHLIAGKEKSQEEFFHIFNFLFNGKKQII
FT                   FTCDQSPKNIKSLENRLKTRFSQGLNLHLTPPELEMRAAILLKKSQNKRININLTEDTA
FT                   LFIATHIASNVRDLEGALLKLKAFVDFSKINHDFISKEIVETALGDLIKPQIKNIDIND
FT                   IQKEVAKHYALTISDLSSKSRKQHMVLARQMAIFICHELSSLSLSKIGKHFGNRDHSTV
FT                   LHAIKKIKEKHLENIEIKNDYELIKLKLANL"
FT   gene            1543..2646
FT                   /locus_tag="Rmag_0002"
FT   CDS_pept        1543..2646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: mfa:Mfla_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01806"
FT                   /db_xref="GOA:A1AV49"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV49"
FT                   /protein_id="ABL01806.1"
FT                   /translation="MNIQLTVKELLTPLQIVISVVEKKQKLPILSHVLIQLKDNLLTLT
FT                   TTDMEIEIRASQIIKNQEEISFTIYAKDLIDIIKKLSEDIIIEFIIESSKIYIKVNKNS
FT                   FELNTSNHQDFPSLPKIKNSDIIKIKRHVLKDLIENTSFSMGSQDIRTYLNGLYLEIDK
FT                   NSIVVVATDGHRLSIGKVKQTHNLSNKKSVILPRKAVFELTKLLNKNGYKEIDIHLSDN
FT                   YFYLISNNTTIISRLIDGNFPNYLQVLPTNFNNIIIINRLAFLNSLQQASIFVEERTKG
FT                   VKLVFKNSKLHIFSHSERGQAKTQINIKNFDKEIEIAFNINYLISILEKLHTNEINMIV
FT                   PDGKSQSCLLSSMNDDIYQYVVMPMRI"
FT   gene            2946..5354
FT                   /locus_tag="Rmag_0003"
FT   CDS_pept        2946..5354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0003"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: tcx:Tcr_0012 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01807"
FT                   /db_xref="GOA:A1AV50"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV50"
FT                   /protein_id="ABL01807.1"
FT                   /translation="MSEKQSQEYQASSIKILKGLDAVRKRPGMYIGDTDDGTGLHHMIF
FT                   EVVDNAIDEALAGFCSKINITLHEDLSISVNDNGRGIPVDIHPKEGISAAEVIMTMLHA
FT                   GGKFDDNSYKISGGLHGVGISVVNALSEWVELTVYRNGKIYFQHYNIGVPNEPIKVIGK
FT                   SDKTGTTIHFKPNVDIFSITEFKYDILVNRIRELSFLNLGVHIQVKELSTGKKDFFKYK
FT                   GGIKEFVRYLNKAKNPIFNNIITINAQRDDIEINVALQWSDSYQENIYCFTNNIPQKYG
FT                   GGHLAGFRGALTRTFNNYINNSSIAKKEKISITGEDTREGLTAIISIKIPNPKFSSQTK
FT                   DKLVSSEVRAPVESALNEKLSDYLLENPIEAKIIIRKILDASHARNAARKAREIIRRKG
FT                   MLNIADLPGKLSDCQTKDPTKSEIFLVEGDSAGGSAKQGRDRHTQAILPLKGKILNVEK
FT                   VRFEKILSSIEVGTLITALGCGIGKEEYDITKLRYHKIVIMTDADVDGAHIRTLLLTFF
FT                   YRYLPELIENGYLYIAQPPLYKIKKGKQECYLKDNQELNDYLLQEAINDAYFFLSKETP
FT                   AISGMALESLVKEYYKINTIIDKLYKRYNLALLKVIASSTPIDDLTNQKNMNTWCANLT
FT                   EKLNKDITPAQKHIVTFNAISNEVEHTLCVYGVNTEHKTLNAAFFSSLDYQAIKDFSKK
FT                   IESMITQESYIEKKNKQVKVDRFSHVVDFLIKDAKKGQSFQRYKGLGEMNPEQLWETTM
FT                   DPEQRTLLKVKIEDSIVANEVFSTLMGDKVEPRRNFIENNALLVDNLYF"
FT   gene            5385..6272
FT                   /locus_tag="Rmag_0004"
FT   CDS_pept        5385..6272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0004"
FT                   /product="Phosphoribulokinase"
FT                   /EC_number="2.7.1.19"
FT                   /note="PFAM: phosphoribulokinase/uridine kinase; KEGG:
FT                   tbd:Tbd_2447 phosphoribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01808"
FT                   /db_xref="GOA:A1AV51"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV51"
FT                   /protein_id="ABL01808.1"
FT                   /translation="MSKKHPVIVVIGSSGAGTTFIKRAFEHIFRKESINPLILEGDSFH
FT                   KYDRTSMKENVKKQEDLGNNFFSHFGPDANLFEKIEQTFKDYGKTGKCDRRYYLHSEEE
FT                   AVEYNQRLSTYLSPGEFTPWKKVDDTTDLLFYEGLHGAVVTDDIDMAQHGDLKIGVVPS
FT                   VNLEWIQKIHRDNAERGYSEEEIVDTILRRMPDYINYITPQFSQTDINFQRVATVDTSN
FT                   PFIARDIPTPDESFVVIRFNDLNKTPVDFVYLCSMINNSFMSRRNTIVVPGGKMSIAME
FT                   IILYPIIKKMIKNK"
FT   gene            complement(6904..9354)
FT                   /locus_tag="Rmag_0005"
FT   CDS_pept        complement(6904..9354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0005"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="TIGRFAM: leucyl-tRNA synthetase; KEGG: noc:Noc_2665
FT                   leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01809"
FT                   /db_xref="GOA:A1AV52"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AV52"
FT                   /protein_id="ABL01809.1"
FT                   /translation="MNSEYNAQKIEAQAQKYWQENKSFEVSEDTSKEKYYCLSMFPYPS
FT                   GSLHMGHVRNYSIGDVISRYQKMQGKNVMQPIGWDGFGLPAENAALENKVSPAKWTYEN
FT                   IDYMRDQLSKLGFGYDWSREIATCHQKYYRWEQWLFIKLFEKDLVYKKNAIVNWDPVDQ
FT                   TVLANEQVIDGRGWRSNALIEKKKISQWFMRITNYADELIYGLDKLDGWPDAVKTMQKN
FT                   WIGKSVGLEVDFPRHNADSIKVYTTRPDTLMGVTYLVISSEHPIALEAGKNNPQVQAFI
FT                   DECKTIQITKETMKTIDKKGIDLGVKCIHPITSDDVPIWIANFVLIGYGTGAVMSVPAH
FT                   DKRDYEFAKKYGIAIKKVINENISIDKNAMTDKGVLFNSGEFNGLNFDQAFNEIAKTLT
FT                   DKNLGRKKTNYRLQDWGISRQRYWGCPIPIINCQNCGIVVVPEADLPVVLPEVMSFDSV
FT                   GSLIKKMPEFYQTTCPKCGKMAQQETDTLDTFFESSWYFARYTCKDNNDKMLDKRANYW
FT                   LANGGVDQYIGGIEHAILHLLYARFFNKLLRDEGFIKNDEPFKNLLTQGMVLKDGAKMS
FT                   KSKGNTVDPAQMIEKYGADTVRLFILFAAPPTQNLEWSDSGLEGVHRFINKVYRLIMDF
FT                   IQDHKSHAIGTLNNFDKAQKDIRLKTHQTLSKITDNMSRRYLFNTVIAALMKLCNTLSK
FT                   FNDTSKTSMAIRQESIHILLKTLSPIAPHLCHYLWKKLGNIKAIINEPWPNVDKSALVQ
FT                   DKMQIIVQVNGKLRTKLMFSTDVDNAQIEAQTLANENITKFTKGKIIVKVIIVPNKLVN
FT                   IVVK"
FT   gene            complement(9387..10325)
FT                   /locus_tag="Rmag_0006"
FT   CDS_pept        complement(9387..10325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0006"
FT                   /product="dihydroorotate oxidase B, catalytic subunit"
FT                   /EC_number="1.3.98.1"
FT                   /note="TIGRFAM: dihydroorotate dehydrogenase family
FT                   protein; PFAM: dihydroorotate dehydrogenase; KEGG:
FT                   noc:Noc_2822 dihydroorotate dehydrogenase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01810"
FT                   /db_xref="GOA:A1AV53"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033888"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV53"
FT                   /protein_id="ABL01810.1"
FT                   /translation="MLNNLKTLFCGLSLNSPIVLLSGCVGFGEEYTRIDGFSNTDVGAI
FT                   CLKSTTLEPRLGNIPHRVCETPSGMINAIGLQNPGTDVVINDIIPNLDKTETHFIINIS
FT                   GSSIEEYGEITKRFDNTNIDAIEINISCPNVREGGVTFGNDPDISYRVVDICRKNTSKP
FT                   IITKLSPNQTDIALNAQRCIDAGTDALAVINTLMGMSIDTKTKKPIIGNNQGGLSGPAI
FT                   KPIALLKVHQVYQVSKHYNVPIIGQGGITTANDAIEFIIAGAATIGIGTALFYDPLVCH
FT                   KINDGISEYLNENNLNNIGDLVGILELNSSI"
FT   sig_peptide     complement(10239..10325)
FT                   /locus_tag="Rmag_0006"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.613) with cleavage site probability 0.560 at
FT                   residue 29"
FT   gene            10365..11006
FT                   /locus_tag="Rmag_0007"
FT   CDS_pept        10365..11006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0007"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG: tcx:Tcr_0261
FT                   dethiobiotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01811"
FT                   /db_xref="GOA:A1AV54"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AV54"
FT                   /protein_id="ABL01811.1"
FT                   /translation="MKGLFISGSGTNVGKTFVAQYLIRLLSNTLKVSARKPVESDCENK
FT                   NGRLIPKDALLLSKACNINEPIDKVCRYKLESCSSAQMASQDSGLKLTLDDLVDACMSD
FT                   EFVIVEGTGGLLSPIARQALNSDLIQALDMPVVLVIKDELGAVNQALLSINSAQSCGLS
FT                   ISMLVLNQIQPNFLKNAQAIKQHTDIDINVFNQNHLASFERKVKKILLVI"
FT   gene            complement(11289..11918)
FT                   /locus_tag="Rmag_0008"
FT   CDS_pept        complement(11289..11918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0008"
FT                   /product="Glutathione S-transferase, N-terminal domain"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   KEGG: hch:HCH_05897 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01812"
FT                   /db_xref="GOA:A1AV55"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV55"
FT                   /protein_id="ABL01812.1"
FT                   /translation="MLTKPNPSSTTLYSSPQDIQSHAVRFIMAEKNIERGVLNLKLEEI
FT                   PEEILELNPYQSLPTLFDRGIVLYDLSVVMEYLDERFPFPPLLPVDPIEKSEKRLLIFR
FT                   FTRAPGCLFELVNNIELGIKKDANKARKILKNNLIELVPLFAYKAFFKSDNMTIVDACL
FT                   GALLWRLKKLDIVLGTPGKAVTNYANRLFSRESFKISLTDCEREYN"
FT   gene            complement(11997..12860)
FT                   /locus_tag="Rmag_0009"
FT   CDS_pept        complement(11997..12860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0009"
FT                   /product="ubiquinol-cytochrome c reductase cytochrome c1
FT                   subunit"
FT                   /note="KEGG: lpf:lpl2631 ubiquinol-cytochrome c reductase
FT                   cytochrome c1 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01813"
FT                   /db_xref="GOA:A1AV56"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV56"
FT                   /protein_id="ABL01813.1"
FT                   /translation="MKKQLHVILIISIITFYFNVLASTEVHLDHANTDINDKKSLQRGV
FT                   KLFMNYCSGCHSIQFMRYNRIGKDLFLDDVIAAYEKAKIAVLNNQSLKHDDFVALSRAL
FT                   DSEITSPDQAKSFLKKISKEEIEENLMKATDKEVEKNLIFTNEKVGSLITSAMSISNAK
FT                   QWFGSNPDLSLVSRSKDVDWIYSYLRGFYKDDSRVFGVNNHILENASMPDVLWQLKQNK
FT                   SSKEFEQDIRDISNFLDYVGEPAKLVRFDLGIKVLGFLFILFIFSYLMKKEYWKDIKYG
FT                   KWRTKN"
FT   sig_peptide     complement(12792..12860)
FT                   /locus_tag="Rmag_0009"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.981 at
FT                   residue 23"
FT   gene            complement(12864..14087)
FT                   /locus_tag="Rmag_0010"
FT   CDS_pept        complement(12864..14087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0010"
FT                   /product="Cytochrome b/b6, N-terminal domain"
FT                   /note="PFAM: Cytochrome b/b6, N-terminal domain; Cytochrome
FT                   b/b6, C-terminal domain; KEGG: tbd:Tbd_1832 cytochrome b
FT                   subunit of cytochrome bc1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01814"
FT                   /db_xref="GOA:A1AV57"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV57"
FT                   /protein_id="ABL01814.1"
FT                   /translation="MNNNKNWINQRFPLTKVWNEHLAEYYTPRNFNFWYFFGSLAMLVL
FT                   VMQIVTGIFLTMHFKPDAIHAFASVEYIMRDVNWGWLIRYLHSTGASAFFIVIYLHMYR
FT                   GLLYGSYKAPRELIWILGMVLYIALMAEAFMGYVLPWGQMSYWGAQVIISLFGSVPVFG
FT                   PDILTFILGDYAVGDPVLNRFFSLHVITLPLILVILVFLHIVALHTVGSNNPDGIEIKK
FT                   NKNKDGIPKDGIPFHPYYSVKDIVGVIVFLMIFSAVVFFAPAMNGYFLENANFVEANPL
FT                   KTPSHIAPLWYLTPFYSVLRAIPPMFSSQFPGVVGMFSALLILIALPWLDKSSVKSIRY
FT                   RSWPYKVALGIFVISFVILGYLGMQPVTPINALLARIFTVTYFGFFILMPWFTSIGKTK
FT                   IVPTRVTE"
FT   gene            complement(14101..14697)
FT                   /locus_tag="Rmag_0011"
FT   CDS_pept        complement(14101..14697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0011"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /EC_number="1.10.2.2"
FT                   /note="KEGG: noc:Noc_0299 ubiquinol-cytochrome c reductase,
FT                   iron-sulfur subunit; TIGRFAM: ubiquinol-cytochrome c
FT                   reductase, iron-sulfur subunit; PFAM: Rieske [2Fe-2S]
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01815"
FT                   /db_xref="GOA:A1AV58"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV58"
FT                   /protein_id="ABL01815.1"
FT                   /translation="MSKQEIDLKKRRFLTGATSVIGAVGVGFVLVPFLSSWMPSAREKA
FT                   AGAPVDVDISKLDNGQLVRVLWRKKPVWIFKRDKTTIENLSTLNSILTDPDSNKLSQQP
FT                   EYAKNIYRSINPNIAVIVGVCTHLGCSPTYRPKLGSADLGGDTWKGGFYCPCHGSKFDL
FT                   AGRVYAGVPAPTNLVIPPYYFVADSLIRIGINPKA"
FT   gene            complement(14802..15107)
FT                   /locus_tag="Rmag_0012"
FT   CDS_pept        complement(14802..15107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01816"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV59"
FT                   /protein_id="ABL01816.1"
FT                   /translation="MCQYKALTNLASFMPSGQLGQLFAQAKTYNQINIELAKLLQDTLK
FT                   PLELCLIRDNTATLITHNQAIAFRAQKQLVTLLELLIQIPALVSITHVEIKININK"
FT   sig_peptide     complement(15033..15107)
FT                   /locus_tag="Rmag_0012"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.630) with cleavage site probability 0.395 at
FT                   residue 25"
FT   gene            15160..17838
FT                   /locus_tag="Rmag_0013"
FT   CDS_pept        15160..17838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0013"
FT                   /product="protein translocase subunit secA"
FT                   /note="TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   helicase domain protein; SEC-C motif domain protein; SecA
FT                   DEAD domain protein; SecA Wing and Scaffold; SecA
FT                   preprotein cross-linking region; KEGG: vfi:VF2193 protein
FT                   translocase subunit SecA"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01817"
FT                   /db_xref="GOA:A1AV60"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AV60"
FT                   /protein_id="ABL01817.1"
FT                   /translation="MSILNKVLSKIIGSRNDRFIKVLYKTVDKITELESKMQALSDEQL
FT                   KSKTQEFKDRINNKETLDSILVEAFAVIRETSTRVLDLRHHDVQLIGGMVLNDGNIAEM
FT                   GTGEGKTLVATLPAYLNALSGKGVHIVTVNDYLATRDAQWMGKVFDFLGMSVGVIVSNM
FT                   AHEDKQSAYLCDIAYATNNELGFDYLRDNMAFTSEQKVQRILNFAIVDEVDSILIDEAR
FT                   TPLIISGPVDDYAQIYQTINHMIPNFTKQIENGEGKEIVIEVAGDYTVDEKHKQVFLTD
FT                   DGHGKAEHLLIDAEALPEGVSLYDASNILLMQHINSALRAHILFQKDVDYIVQDDEVVI
FT                   VDEFTGRTMPGRRWSEGLHQAIEAKEGVSIKKENQTLASITFQNYFRLYTTLSGMTGTA
FT                   DTEAVEFQDIYGLETLVVPPNKPSARADKSDKIYLTTQEKFEAIAFDVANCQQIGQPVL
FT                   VGTSSIENSELISTLLEKNNIKHEVLNAKQHEREAIIIANAGSIGAVTIATNMAGRGTD
FT                   IVLGGKLSEEATDKQKVDWKIQHDDVIKAGGLHIVGTERNESRRVDNQLRGRAARQGDV
FT                   GSTRFYLSLEDNLMRIFASKKMASMMQKLGMEKGEAIEHKMVNRAIENAQRKVEGMNYD
FT                   ARKHLLEYDDVASDQRKVIYQLRDDLMSVSDVQDRFISIRVKVIEQFFADYISAELMEE
FT                   DWDVEGLHNALKLDYSADFPLKQWLDEGIDIDELQLRIIQGLSTICDHKEKIVGTKPMR
FT                   EFEKSVMLQTLDHYWKEHLAAMDYLRKSVNLRGYVQKNPTQEYKHESFAMFTSMLDTIN
FT                   IEIVKSLSSVTINENTNVSDVEQENNEGVQVQHEEVETLGVNDAELEIAKQNKFQKRKK
FT                   KVGRNDPCSCGSGKKYKKCHG"
FT   gene            17831..18889
FT                   /locus_tag="Rmag_0014"
FT   CDS_pept        17831..18889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0014"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   vfi:VFA0492 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01818"
FT                   /db_xref="GOA:A1AV61"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV61"
FT                   /protein_id="ABL01818.1"
FT                   /translation="MANYIGLMSGTSLDGVDGVIINGMGRKVLTQAYLPYSDKLKKSLL
FT                   ELTQNSKTLLENLANIDIQVANCFSDTVYLLLQQAGLKVKNIKAIGSHGQSIFHKGGKY
FT                   SMQIGHGALIAEQTSITTVADFRMQDVAAGGQGAPLTPLYHQHILNGKDGVIINLGGIA
FT                   NITHSFNGGVVGFDTGPANTLLDNWIKKNKGLDYDQDGVWSRSGLVNESLLNSMLADDY
FT                   FYQGYPKSTGPEYFNLDWLSQHLNGTEQPEDVQRTLIELSVMSISANIPLGADTYLCGG
FT                   GVHNLFLFERLVYQNPDSKVTLTNDLGVFVDYVEAAAFGFFAQRTLAGLPSNLPSVTGA
FT                   KSERVLGAIYAI"
FT   gene            18879..19913
FT                   /locus_tag="Rmag_0015"
FT   CDS_pept        18879..19913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0015"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="KEGG: pst:PSPTO4157 dihydroorotase, homodimeric
FT                   type; TIGRFAM: dihydroorotase, homodimeric type; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01819"
FT                   /db_xref="GOA:A1AV62"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV62"
FT                   /protein_id="ABL01819.1"
FT                   /translation="MQFKMIQPDDWHLHVRSGAALKSIIGMTAAQMGRAIIMPNLNPPV
FT                   TNALQACTYKEEILSALPKGSKFNPLMVLYLTDNTTPKDIQEAIDNSVVAAKLYPAGVT
FT                   TNSDSGVTNIAKLYPTLESMQKLDIPLLVHGEVTRAEVDIFDCEAVFIDEVLNQVVSDF
FT                   PELKIVFEHITTKDAVDFVLASHHKIAATITPHHLLLNRNDMLMGGIKPHYFCLPVLKR
FT                   KNPHQLALLDVVTSGNSKFFLGTDSAPHTKANKESACGCAGIFTAHCAIELYAMVFECQ
FT                   NSIDKLEGFASKFGADFYNLPYNIQTITLKKQDWTVPESYPFAYSDIVPFMATKTLSWK
FT                   LIGS"
FT   gene            complement(20251..21153)
FT                   /locus_tag="Rmag_0016"
FT   CDS_pept        complement(20251..21153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0016"
FT                   /product="FMN adenylyltransferase / riboflavin kinase"
FT                   /EC_number="2.7.7.2"
FT                   /EC_number="2.7.1.26"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibF; PFAM:
FT                   Riboflavin kinase / FAD synthetase; KEGG: son:SO3533
FT                   riboflavin biosynthesis protein RibF"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01820"
FT                   /db_xref="GOA:A1AV63"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV63"
FT                   /protein_id="ABL01820.1"
FT                   /translation="MKLIRGLQNLKSHFGSVVTIGNFDGVHIGHQKIIKTLVKKAQIMN
FT                   LPSVLISFSPTPQHFFGHMQATLSSFKQKHALLTNLGLEEYLLINFNTPFSQLSADAFI
FT                   QQILLKKLNIKHCIVGDDFRFGANRTGDFSLLQTFDFEVEKTPTVLHNFHRVSSSKIRQ
FT                   SLKKGDFNLANQLLGREFSISGKIIHGQKQGRAIDFPTINILIKRKISPLLGVFAVNVE
FT                   LNGKIYNGVCNLGKRPTIGGEIILLEAFLFDFNSQIYGENAKTVFKYKIRDEQKFDSFS
FT                   ALKRQIKSDVKDAKNFFGL"
FT   gene            complement(21165..22172)
FT                   /pseudo
FT                   /locus_tag="Rmag_0017"
FT   gene            complement(22172..23227)
FT                   /locus_tag="Rmag_0018"
FT   CDS_pept        complement(22172..23227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0018"
FT                   /product="homoserine O-succinyltransferase"
FT                   /EC_number="2.3.1.46"
FT                   /note="PFAM: homoserine O-succinyltransferase; KEGG:
FT                   noc:Noc_2703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01821"
FT                   /db_xref="GOA:A1AV64"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV64"
FT                   /protein_id="ABL01821.1"
FT                   /translation="MPLIAHSNLPAFSRLKDEGETILSKDRANNQVIRELHIGLLNMMP
FT                   DAALETTERQFFRLVGHSNQIAQFYLHPFTLLSIKHGKTTSKHVKQHYQTFVDIKTQGL
FT                   DALIITGAHIEQEDLQKAPFYEELKEVVDWSYNHVTSTLCSCLATHAVLEFRYGQKRQA
FT                   IGEKCWGVFPHQVLDRQHPLMNGVNTRFDVPHSRFNEISKTQFDTTGVKILVESKIGVH
FT                   LGVSEDLLRIVFFQGHPEYDTISLLKEYKRDIIAFLKKTRDDYPPFPEHYLTEQSKAIL
FT                   NEYKTKLLSSEFSITDFPEQLISKTLNNTWSNATNVIINNWIGCVYQVTHEDIDKPFMD
FT                   GINPHDPLNLK"
FT   gene            complement(23227..24063)
FT                   /locus_tag="Rmag_0019"
FT   CDS_pept        complement(23227..24063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_2702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV65"
FT                   /protein_id="ABL01822.1"
FT                   /translation="MKLSAIKFKNSSHKCLTLLGMSGVGKTHLAKLLSYQDKYFHYSGD
FT                   YRIGAEYLNDKILDNIKNYIRQDKWLKDLLDNESISIQNHITFDNLSSVSAFLGKAGNP
FT                   ELGGTPIGTFIARQTMHLNAETKAMLDVPQFIQKAKTQGFNHFINDAGGSLCELDNEQV
FT                   YQTLANNTVILYIRASKTNETALVECAQTHPKPLYYQANFLKQQLSIYLQKNQLIYVAQ
FT                   IDPNEFVRWVFPRLLEHRKPKYEAIAKKYGYTIDSEGLYRCKNADEVFELIYGAMN"
FT   sig_peptide     complement(23974..24063)
FT                   /locus_tag="Rmag_0019"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.664) with cleavage site probability 0.632 at
FT                   residue 30"
FT   gene            complement(24091..25278)
FT                   /locus_tag="Rmag_0020"
FT   CDS_pept        complement(24091..25278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0020"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   hch:HCH_01778 aspartate/tyrosine/aromatic aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01823"
FT                   /db_xref="GOA:A1AV66"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV66"
FT                   /protein_id="ABL01823.1"
FT                   /translation="MNDDFPRIKRLPSYVFAVTNELKTKARARGEDIIDFGMGNPDQPT
FT                   PDHIVEKLVEAARRKDTHRYSTSRGIPRLRKAIANWYKRRFDVDIDPETEAIVTIGSKE
FT                   GLSNLAQAVVGSGDTVLVPNPAYPIHPYGFVIAGADIQHVPCGPDDDFLTELERSIKNT
FT                   WPKPKIMVLNYPSNPTTQCAELDFLKKVIKIAKEHKIWVVQDLAYADIVFDDYIAPSIL
FT                   QVEGAKKIAVEFFSLSKSYNMPGWRVGFMVGNLTLVDALAKIKSYLDYGMFTPIQIAAI
FT                   EALEGDQSCVKEISNMYQDRRDVLCGGLRSVGWVVTPPKATMFVWAKIPEFYQYMGSLE
FT                   FTKKLLKIAKVGVSPGIGFGSYGDQYVRFGLIENEHRTRQAIRGIREMFRQDGLL"
FT   gene            complement(25334..25639)
FT                   /locus_tag="Rmag_0021"
FT   CDS_pept        complement(25334..25639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0021"
FT                   /product="peptidylprolyl isomerase, FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase, FKBP-type; KEGG:
FT                   tbd:Tbd_2152 peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01824"
FT                   /db_xref="GOA:A1AV67"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV67"
FT                   /protein_id="ABL01824.1"
FT                   /translation="MANLKIQNLETGTGAICKVGDSVSMHYTGWLTNSKKFDSSIDRNK
FT                   PFDFKLGVIQVIAGWDQSINGMRVSGKRKLTIPSKLAYGEIIGYRRSYSTKCYTSF"
FT   gene            complement(25650..26423)
FT                   /locus_tag="Rmag_0022"
FT   CDS_pept        complement(25650..26423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAa0339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01825"
FT                   /db_xref="InterPro:IPR021246"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV68"
FT                   /protein_id="ABL01825.1"
FT                   /translation="MHTHLNSGVVQYQLPMGDKLLNMNDLINQSISLEFNGEIVCSNCK
FT                   ERTNKSYSQGFCYPCCQRLARCDLCIMKPETCHHHLGTCREPQWGLNNCFNPHIVYLAN
FT                   SSGIKVGITRKSNIPSRWIDQGAITALPILEMNNRLKSGKIEMALKDYVNDKTNWRKML
FT                   KNEVEHTNLSTKRDDLFKTISHLIDTLSAIMLDNEALEINYPVVKYPSKISSLNFDKTP
FT                   KIEGILQGIKGQYLLLDTGVLNIRKFSSYHITLIY"
FT   gene            complement(26456..27334)
FT                   /locus_tag="Rmag_0023"
FT   CDS_pept        complement(26456..27334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0023"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: tcx:Tcr_0262
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   TIGRFAM: phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01826"
FT                   /db_xref="GOA:A1AV69"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV69"
FT                   /protein_id="ABL01826.1"
FT                   /translation="MGTLFNTNLSLPLIQKGKVRDIYDIDDKRMLIVTTDRLSAFDVIF
FT                   DDPITNKGIILTEIANFWFEKTRHIIPNHLTLEPLDSILNTKEATLIKGRGIIVKKLNP
FT                   LAIEAIVRGYIIGSSWKDYQQTGKVCGIKLPTNLQLAEKLPKAFYTPSTKANLGEHDAN
FT                   IDFDKTVKILGQGLAEQVKQVSLKIYQFATNYALERDIIIADTKFEFGLDEHNQLTLMD
FT                   EVLTPDSSRFWSKIDYQVGTSQKSFDKQIVRDYLETLDWNKSPPASTLPQSIIQQIANK
FT                   YKEVQQRLMQD"
FT   gene            complement(27845..28963)
FT                   /locus_tag="Rmag_0024"
FT   CDS_pept        complement(27845..28963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0024"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: pae:PA0667 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01827"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV70"
FT                   /protein_id="ABL01827.1"
FT                   /translation="MGKLYTNILLILISFSIASAYANNNAYHFTIKRGDSLSQYFSKLG
FT                   LSSRLLANLLFANKNNKKLNQLTIGHKLTIRLSNNRQFKSLTYQLNRKTNLNVILNNNY
FT                   FSTILKKQSKQIPINLSITVVRINHSFGVDAQKEGIGFSTINLIVKALSRQLNFNTDLK
FT                   KGDRFIIVNNDNIKPVAIIYQSIIKNKSIEAFAYKNKHGHTGYFDRFGHSLSSSFLKAP
FT                   LKYKRISSKFQLRRYHPILKTWRPHRAVDYAANYGTPVYSTANGIITTKDKKGALGKVV
FT                   IIQHGFDYVTVYAHLSKYANNLYKDKKVKKGQIIGYVGSTGRSTGPHLHYELHYKGKRR
FT                   NPLTYKLPAQKGISRANLQDFKIKVNKILSSL"
FT   sig_peptide     complement(28895..28963)
FT                   /locus_tag="Rmag_0024"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.958 at
FT                   residue 23"
FT   gene            complement(28956..30107)
FT                   /locus_tag="Rmag_0025"
FT   CDS_pept        complement(28956..30107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0025"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="KEGG: eba:ebA5994 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; TIGRFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; PFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase, N-terminal domain protein;
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase, C-terminal
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01828"
FT                   /db_xref="GOA:A1AV71"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AV71"
FT                   /protein_id="ABL01828.1"
FT                   /translation="MKNITLLGATGSIGKSTLSVVDLHSDKFNIFTLSANTNWQLMLEL
FT                   CNKYQPNYAIMVDESSAEKLSTIITTDTQILSGTQALDKVVAHQDTDFVMAAIVGTAGM
FT                   SSALCAVKAGKRIMLANKESLILAGDIFMKAVEEFNAELIPVDSEHSAIFQCLQSGRSG
FT                   LNKIQLTASGGPFLHTPISKFKYITPNQACAHPNWSMGRKISVDSATMMNKGLEVIEAY
FT                   YLFSLTPEQIDVVVHPQSIVHSSVYYKDGSTLSQLGKPDMRTVISYAMSYPQRINSGVT
FT                   ALDLTNTPALEFYQPDFEKFTCLKLAFETLNKGGNAMITMNAANEIAVEYFLNHQINFL
FT                   DIPKIIDQTLSAMKHTTPNSLEEVVNNDLVAREMTREIIKQYG"
FT   gene            complement(30104..30904)
FT                   /locus_tag="Rmag_0026"
FT   CDS_pept        complement(30104..30904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0026"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; KEGG:
FT                   cps:CPS_1558 phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01829"
FT                   /db_xref="GOA:A1AV72"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV72"
FT                   /protein_id="ABL01829.1"
FT                   /translation="MLKQRIITAFILAPLFVWAIFSMSSHYFTQLLLIFVALGAWEFSY
FT                   LIKFKRLIARLLLVVGIIACALIIQNNVQIIEFVLYLSILWWIVNLYWILSYPNKTNLW
FT                   FNPFIVRVISGVLLLVPMWVALITLQQQYGAKYFLLLMLIIWGADSGAYFVGKAIGKRK
FT                   LAPKVSPGKSIEGMIGGIGVALVVMVMFLQYQNIATKQYLSYLLLTIIVASVSVLSDLF
FT                   ESLFKRISNIKDSGQILPGHGGILDRIDSLTAAAPFFLLGLDLI"
FT   sig_peptide     complement(30815..30904)
FT                   /locus_tag="Rmag_0026"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.946) with cleavage site probability 0.568 at
FT                   residue 30"
FT   gene            complement(30898..31644)
FT                   /locus_tag="Rmag_0027"
FT   CDS_pept        complement(30898..31644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0027"
FT                   /product="Undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /note="KEGG: vvy:VV2553 undecaprenyl pyrophosphate
FT                   synthase; TIGRFAM: undecaprenyl diphosphate synthase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01830"
FT                   /db_xref="GOA:A1AV73"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV73"
FT                   /protein_id="ABL01830.1"
FT                   /translation="MLCIGIIQLVMSTLKHIAIIMDGNGRWASKHSLPRILGHQQGIKA
FT                   VHGVVKACVIRGIKTLTLFAFSSENKNRSTEEVSLLFKLFLGVLKQEVKKLNEHNIRLK
FT                   IIGDMSLFPAKIQQTALDAQALLASNIGLTLVIAANYGGQWDIAQAAAKIAKAAIDGDI
FT                   KASNINIDSFSQYLSLADEPNVDLLIRTSGELRISNFLLWDIAYSEFYFTETLWPDFNE
FT                   FELNKAINNFNNRNRRFGIRLKEKSC"
FT   gene            34314..35081
FT                   /locus_tag="Rmag_0028"
FT   CDS_pept        34314..35081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0028"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /EC_number="4.1.3.-"
FT                   /note="TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit; PFAM: histidine biosynthesis; KEGG:
FT                   sde:Sde_0490 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01831"
FT                   /db_xref="GOA:A1AV74"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AV74"
FT                   /protein_id="ABL01831.1"
FT                   /translation="MPLAKRIIPCLDVCNGRVVKGTKFVDIKDAGDPVEVAKRYDFECA
FT                   DEITFLDITASIEGRDTMIHMVEAIAEQVFIPLTVGGGIRKAVDVRAMLNAGADKVAIN
FT                   SAAIFNPNLINQLSEEFGSQCIVIAIDAKKVSDNKWEIFTHGGRKSTGIDAIEWAVKMT
FT                   KGDNGAGEVLLTSMDCDGVKTGFDLLLTKAASDAVDVPIIASGGVGNLEHLSEGVLQGG
FT                   ADAVLAASIFHFGEYTIQQAKQAMQENGIEVRL"
FT   gene            35150..35680
FT                   /locus_tag="Rmag_0029"
FT   CDS_pept        35150..35680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0029"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: neu:NE1011 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01832"
FT                   /db_xref="GOA:A1AV75"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV75"
FT                   /protein_id="ABL01832.1"
FT                   /translation="MNSKKELWILLASFVLPIAFGTAFFYLSPTFFTQHTVNYGEFVNP
FT                   IITTTKQDITFIDTQSGLQGLWTLTYTTKKCDNICIKVLQDMRTVRILMNEDMRRIQNL
FT                   LLITNKAKTQQVDILVGYASEVFNRQLNQFPENSLFLIDPLGNMMLRYNSKNLDIKRVI
FT                   KDLKRLFKYSRIG"
FT   sig_peptide     35150..35215
FT                   /locus_tag="Rmag_0029"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.741) with cleavage site probability 0.512 at
FT                   residue 22"
FT   gene            35687..36586
FT                   /locus_tag="Rmag_0030"
FT   CDS_pept        35687..36586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0030"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: mca:MCA0062 protoheme IX
FT                   farnesyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01833"
FT                   /db_xref="GOA:A1AV76"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AV76"
FT                   /protein_id="ABL01833.1"
FT                   /translation="MIIPLISDLLALCKLKVVALILLTAEVGMFLAVPAPYLPNGLLVL
FT                   SASIGISMAAASAAVFNHVVDEQIDAQMSRTNKRPLPQGKVSRNQALMWGVFLGLVGLG
FT                   ILQLFVNTITMVLTFVSLIGYAIIYTLYLKRATPQNIVIGGAAGAAPPVLGWTAVSGTQ
FT                   GIEYACLLFLIVFIWTPPHFWALAIHRVEEYKKVDVPMLPVTHGLAYTRTQILLYTVLL
FT                   LLVSLLPYLASMSGLIYLVVAIALGIRFLMYAIKIYNNPDDKRIAWCTFVYSINYLMLL
FT                   FVTLLFDHYWLILPLEVF"
FT   gene            36587..36778
FT                   /locus_tag="Rmag_0031"
FT   CDS_pept        36587..36778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01834"
FT                   /db_xref="GOA:A1AV77"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV77"
FT                   /protein_id="ABL01834.1"
FT                   /translation="MKGFGQVFKAVTFAMIGVGKKEDLAKDFARTEKQGPWAYIIVGLI
FT                   MTFVFIGLIITAVKLVLL"
FT   gene            complement(37140..38111)
FT                   /locus_tag="Rmag_0032"
FT   CDS_pept        complement(37140..38111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0032"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG:
FT                   noc:Noc_3040 cytochrome oxidase assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01835"
FT                   /db_xref="GOA:A1AV78"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV78"
FT                   /protein_id="ABL01835.1"
FT                   /translation="MFRKILQVSIILAFIVVILGAYTRLSDAGLGCPDWPGCYGQLSVP
FT                   DVKDGTTIQGFSRPLEVAKGWKEMLHRYTASTLGLIILILFFLVLKGKQQRHQSLKLPG
FT                   FNAFFVILQGVFGIWTVTLLVHPVIVTLHLMGGFVTTTLLIWMLLNQSKPPAIYQHTLK
FT                   KHKFILLITLGALSLQIALGGWTSTNYAALSCGEYFPKCLNVWWPDMDFSGALYWGPFE
FT                   INYEYGILENPARSAIQMIHRIGALITTIFILLLIYLFRNYTHLRSNLILITILLTIQI
FT                   TLGIFNVVLLLPIIIAVLHNIVALLLLLSIVKLVHKTFKVPT"
FT   sig_peptide     complement(38025..38111)
FT                   /locus_tag="Rmag_0032"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.719) with cleavage site probability 0.253 at
FT                   residue 29"
FT   gene            complement(38205..39029)
FT                   /locus_tag="Rmag_0033"
FT   CDS_pept        complement(38205..39029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cvi:CV3790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01836"
FT                   /db_xref="GOA:A1AV79"
FT                   /db_xref="InterPro:IPR018692"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV79"
FT                   /protein_id="ABL01836.1"
FT                   /translation="MLQTQRMAKGLNKKAHIKQVSYGAPFVWLKQGVEDFIKCPTLALF
FT                   YGALFTSFTYSYWNFLSNSPTLGDLSAPLLAIVVIIFGPISAMAMYDASKRLSAGENLS
FT                   LGSILMVIKSAFKANGSCPSLFLSVILIVLAIIWMVFTPLIYAVLNTDTFVNQSQTIIE
FT                   AILADISNFNNPLFLIVYGIFTIAIAWISFMISWFSFPMVLDQDVDPFTAANASIRTAL
FT                   ANKIVMLIWVPIVGVIVLAGLLTPYFIGMVVAVPILAHATWHAYKSMIGKIE"
FT   gene            39283..40350
FT                   /locus_tag="Rmag_0034"
FT   CDS_pept        39283..40350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0034"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="PFAM: cytochrome c oxidase, subunit II; cytochrome
FT                   c, class I; cytochrome C oxidase subunit II, transmembrane
FT                   region; KEGG: pha:PSHAa2872 cytochrome c oxidase, subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01837"
FT                   /db_xref="GOA:A1AV80"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV80"
FT                   /protein_id="ABL01837.1"
FT                   /translation="MSANVFAEYDFNMTQGVTSISRDIYGLHMMVFWICVAIAVIVFGV
FT                   MIYSLVVHRKSQGAVAANFHESTKAELLWTGIPIIILISMAIPASTVLIDLEDTAKAEM
FT                   TIKITGHQWKWQYDYPKEGISFISNLKQDSKDVIYSGNRRKNYLLEVDNNLVLPVDTSI
FT                   RFLITSNDVIHNWWVPDFGVKQDANPGFINDAWAQIDEVGTYRGQCAELCGKDHGFMPI
FT                   VVDVVSKLDYAKWVLKQQAAKAATLAKSNKTWREEELISLGQKVYNTNCSSCHGITGKG
FT                   IPGVFPALKGSSIATGDIKKHINIVLHGKAGTAMASYKNILGDADIAAVITFERTAFGN
FT                   QMGDLIQPAQIKAAR"
FT   gene            40373..41989
FT                   /locus_tag="Rmag_0035"
FT   CDS_pept        40373..41989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0035"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="PFAM: cytochrome c oxidase, subunit I; KEGG:
FT                   pae:PA0106 cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01838"
FT                   /db_xref="GOA:A1AV81"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV81"
FT                   /protein_id="ABL01838.1"
FT                   /translation="MTTAIATATTYTNDHHGPEKGLMRWIKTTNHKDIGSLYLWFAFTM
FT                   VLIGGAMAMVIRMELFQPGMQLIEPQFFNQMTTMHGLIMVFGAIMPAFVGLGNWLIPMM
FT                   IGAPDMALPRMNNWSFWILPFAGGILLSTFFMEGGAPAFGWTFYAPLSTTFAPNSTDFF
FT                   IFAVHLLGFSSIMGAINIIATVLNMRALEMKLMDMPLFVWTWLITSFLLIGAMPVLAGA
FT                   VTMMLTDRNFGTAFFDATGGGDPVLFQHIFWFFGHPEVYIMILPAFGVISHIVPAFARK
FT                   PLFGYSSMVYATASIAFLSYIVWAHHMFLTGMPVAGELYFMYATMLIAVPTGVKIFNWV
FT                   STMWRGSMTFEAPMLWAISFVFLFTIGGFSGLMLGIAPADIQYHDTYFVVAHFHYVLVT
FT                   GALWSIIAATFYWLPKWTGKMYNETLAKVHFWWAVISVNILFFPQHFLGLAGMPRRIPD
FT                   YSLQFADFNMISSIGGFAFGTSFILFTYIVIDCIRNGKPADSRPWEGAKGLEWTLEPKA
FT                   QYHSFNTPPTRTLIEQESQHS"
FT   gene            42080..42613
FT                   /locus_tag="Rmag_0036"
FT   CDS_pept        42080..42613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0036"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: mca:MCA0882 cytochrome c oxidase assembly
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01839"
FT                   /db_xref="GOA:A1AV82"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV82"
FT                   /protein_id="ABL01839.1"
FT                   /translation="MAEMESRQKITKKFWIKLVIAPILMFFFAYAMVPIYDVFCEITGF
FT                   NGTTGRVDSEQKYVVDETRKIEVSFFAMTMSGFPIQFGPKVSSMEVVPGRFYTTSYIAK
FT                   NNTDEVVVGQAIPSVAPTDAALYFKKLECFCFNKQVFKPHEQVEMTLRFVIEPELDERI
FT                   KDVSLSYNFFKLKS"
FT   sig_peptide     42080..42175
FT                   /locus_tag="Rmag_0036"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.930) with cleavage site probability 0.930 at
FT                   residue 32"
FT   gene            42631..43515
FT                   /locus_tag="Rmag_0037"
FT   CDS_pept        42631..43515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0037"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /note="PFAM: cytochrome c oxidase, subunit III; KEGG:
FT                   hch:HCH_00049 cytochrome-c oxidase, subnunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01840"
FT                   /db_xref="GOA:A1AV83"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV83"
FT                   /protein_id="ABL01840.1"
FT                   /translation="MNEQDYYVPSGTYWPIIGSIGIVTLFVGFANQMHGASWGGPIMAL
FT                   GLAILVFMLFGWFGQVVKESTNGIYNSQVDRSFRWGMSWFIFSEVMFFGAFFGALFYAR
FT                   QLSVPWLGGADNNIFTPELWNSFSATWRQIAFNTPGAILQSGITISIPTQLVDAWDLPA
FT                   LNTALLLLSGATLTFAHHALRSDHRNKIIGWLIATIVLGVLFLGFQITEYGHAYHDGLK
FT                   LTSGIYGSTFYMLTGFHGFHVTVGVLMLTVILYRVQKGHFSSNSHFGFEGVAWYWHFVD
FT                   VVWLGLFIFVYWL"
FT   gene            43758..44504
FT                   /locus_tag="Rmag_0038"
FT   CDS_pept        43758..44504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA0131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01841"
FT                   /db_xref="GOA:A1AV84"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV84"
FT                   /protein_id="ABL01841.1"
FT                   /translation="MDRTKCGYDGRIHTLVTKRTIIPAVLILLSIYGLVSLGFWQLERA
FT                   DEKWAIEHEIVLAQQSPVQLVTNVDELLNKEYYQVLLKGHYDANKQFIYDNQIVKGNAG
FT                   YYVLTPFVLSDKTAILVNRGFVSWHGKREQLTDIKLDNLPRIVKVELIKPVERIKLKKQ
FT                   PIKSNFPILIQSLNLDELSTLSNYKIIAMLARLDIKASDGFFRQWQPFYGSADKHLGYA
FT                   LQWFLMASVLSIIALRLLIKKIKKID"
FT   gene            44618..46036
FT                   /locus_tag="Rmag_0039"
FT   CDS_pept        44618..46036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0039"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit I"
FT                   /note="TIGRFAM: cytochrome c oxidase, cbb3-type, subunit I;
FT                   PFAM: cytochrome c oxidase, subunit I; KEGG: tcx:Tcr_1965
FT                   cytochrome c oxidase, cbb3-type, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01842"
FT                   /db_xref="GOA:A1AV85"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV85"
FT                   /protein_id="ABL01842.1"
FT                   /translation="MNLTEKYDLGVVKWFAIMASVYLVVGTLLGVYIASELAFPFLNHL
FT                   GTDLPYFQFGRLRPLHTNTVIFAFGGSVLMASAFYIVQRTNQTRLWSNKMAWFTFWSWN
FT                   TVIVLAVITLPLGLTQSKEYAELEWPIDILITLSWITYLYNFIMTIHIRNSNKVPHVYV
FT                   ANWFFMGMMVMVTYLHVVNNLSIPVGAFKSYSIFSGVQDAMIQWWWGHNAVGFFLTAGF
FT                   LGIMYYFVPKQAQRPIYSYRLSVIHFWALMFGYVWLGAHHLQYTALPDWAGSLGATISL
FT                   AMIIPSWGGALNGILTLSGAWDRLREDYILRFLIMSLAFYAMSTFEGPVMAAKTVNALS
FT                   HYTDWTIGHVHSGALGWNIMVAAGAMYHMIEKIYNIKMSQKLLGIHFWVHTIGTVVYIV
FT                   AMWVSGIMQGLMWRAYDEYGTLAYTFAESVSAMHPYYVMRAAGGTLVLVGAIIMLINIV
FT                   TTIRRSGADQTSNV"
FT   gene            46050..46781
FT                   /locus_tag="Rmag_0040"
FT   CDS_pept        46050..46781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0040"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit II"
FT                   /note="TIGRFAM: cytochrome c oxidase, cbb3-type, subunit
FT                   II; PFAM: cytochrome C oxidase, mono-heme subunit/FixO;
FT                   KEGG: tcx:Tcr_1964 cytochrome c oxidase, cbb3-type, subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01843"
FT                   /db_xref="GOA:A1AV86"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV86"
FT                   /protein_id="ABL01843.1"
FT                   /translation="MVNKNVKESLQVKLEKNIFGMYLFMALSVSLAGIVEIVPLFTNPE
FT                   AVKDKVIAIDGSTKSLLWPRSEGQTLSNWAPGDGVRPLTALELAGRDIYQREGCYLCHS
FT                   QMIRPFRDEKERYGHFSLAVESKYDHPFQWGSKRTGPDLARVGGKYSDEWHILHLRHPQ
FT                   EVVPESVMPKYRFLESALVDGETIATHMSGLSKVGVPYTQADIAQAPAMVEGKNEMDAM
FT                   VAYMQSLGSMIKFEDGVVYRE"
FT   gene            46945..47847
FT                   /locus_tag="Rmag_0041"
FT   CDS_pept        46945..47847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0041"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit III"
FT                   /note="KEGG: tcx:Tcr_1963 cytochrome c oxidase, cbb3-type,
FT                   subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01844"
FT                   /db_xref="GOA:A1AV87"
FT                   /db_xref="InterPro:IPR004678"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR032858"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038414"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV87"
FT                   /protein_id="ABL01844.1"
FT                   /translation="MSEHKNPLPGENNTGHFWDEENDIRELNNRPPRWYMLSLYIGIFA
FT                   IVAYTLYYPTIPWFGGHNKGFASWTQISEMNESITQLEAYREKRFADTEKSIAEKSLEE
FT                   IVLDDELRAYAIKTAKVLFGDNCAACHGSAGQGNVGFPVLADDDWLYGGKLSQISTTIA
FT                   NGRKGNMPARMLGISDADANTLATFLIETGKGKNGNPDPASKALYMSKGCIACHGPNMK
FT                   GNQLLGSANLSDSIYRFKADNQHASVVRTILHGVGQVSDPLTQDAVMPAFGHSNVIDAV
FT                   QIKKLTVYVHQLGDGIVVK"
FT   gene            47921..47996
FT                   /locus_tag="Rmag_R0001"
FT                   /note="tRNA-Thr1"
FT   tRNA            47921..47996
FT                   /locus_tag="Rmag_R0001"
FT                   /product="tRNA-Thr"
FT   gene            complement(49389..49970)
FT                   /locus_tag="Rmag_0042"
FT   CDS_pept        complement(49389..49970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0042"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /note="PFAM: outer membrane lipoprotein carrier protein
FT                   LolA; KEGG: pae:PA2614 periplasmic chaperone LolA"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01845"
FT                   /db_xref="GOA:A1AV88"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV88"
FT                   /protein_id="ABL01845.1"
FT                   /translation="MTNFLSTLILIFSNFSFANSNHGFSNFFNSFERLSANFTQITYSN
FT                   TGTLLASSSGTLLFKRPQQLIWHTLIPNERILLLNNTELWLIDIELEQASLIQATNLTQ
FT                   TPLYWLISQPSDISHTPQYTHTKDKIDWYSTQQANQLSFGFKDDVLQAITFNNKLDQTI
FT                   LVNFDSISINPNIKINAFELNLAPEFDVLR"
FT   sig_peptide     complement(49914..49970)
FT                   /locus_tag="Rmag_0042"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.989 at
FT                   residue 19"
FT   gene            complement(49963..52230)
FT                   /locus_tag="Rmag_0043"
FT   CDS_pept        complement(49963..52230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0043"
FT                   /product="DNA translocase FtsK"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: sde:Sde_1693
FT                   cell division protein FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01846"
FT                   /db_xref="GOA:A1AV89"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV89"
FT                   /protein_id="ABL01846.1"
FT                   /translation="MKKINKISTKRYSKKPRTKIVSEILFIFLSAVGLIFLSALFTYSA
FT                   NENPYSGDVALVAPVANLSGVFGAYLSDISLSILGYGAYLIPISLIWLGWNIHKRTDQE
FT                   KPKYSVTTLRFIALVTLIVFSTAFLTQNFVDTSTSGGYIGITMHRYFGILFGSAALIIY
FT                   LSIMMISFSIASSTSWINIFSSIRDILNRIFTKILDIRTQSKTKKAIKTSVTSKSSTLT
FT                   KIKKGKERSNKNIKKSTSYNLFNTTIVTGLPSLDLLDEPTEHTMGYSKQALKEMSQQVE
FT                   IKLKDFGFYVSVTTVTPGPVVTQFEISLAPGVKVSQIMNLNKDLARALLVKSVRIVDVI
FT                   PGKPVIGLEIPNTQREIISLKEILASENFIKSSSILTMGLGKNINGIPITANLSKMPHL
FT                   LVAGATGMGKSVGLNAMILSVLFKAKPEEVRIIMIDPKIVELACYADIPHLLTPVITDM
FT                   NQAASALWWCVNEMERRYSLLAKFGVRNIEGFNEKVKKYKDEGKPLLDSSFNSSTADED
FT                   ETVPELEVLPLIMLVIDEYADMLGALAQEDRAKAKRVEMLIVRLAQKARASGVHIIIAT
FT                   QRPSVDVITGLIKSNIPTRIAFKVSSKVDSRTILDQGGAEQLLGMGDMLYMTPGMSHLT
FT                   RVHGAFVDDGEIERVVSFLKENSETNYLDDILNTHSESDNLQDSNSTLDTSSELDALYD
FT                   EAVQIVTSSGRASISSLQRRMRIGYNRAARIIEDMENSGVVSSMNKSGNRQVLAPKLMT
FT                   ND"
FT   sig_peptide     complement(52096..52230)
FT                   /locus_tag="Rmag_0043"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.506 at
FT                   residue 45"
FT   gene            52279..53223
FT                   /locus_tag="Rmag_0044"
FT   CDS_pept        52279..53223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0044"
FT                   /product="thioredoxin reductase"
FT                   /note="TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   tcx:Tcr_0763 thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01847"
FT                   /db_xref="GOA:A1AV90"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV90"
FT                   /protein_id="ABL01847.1"
FT                   /translation="MSENKHCKVLIIGSGPAGYSAAVYAARANLNPIIVSGMEQGGQLM
FT                   STMGVDNWPGDVAGVQGPDLMARMKKHAERFDTQILNDTITSVNFTKRPFVLKGETTTY
FT                   TADAVIIATGSSAHYLGLESEEKFKGKGVSACATCDGFFYRGQKVAVIGGGNTAVEEAL
FT                   FLSNIADHVTIIHRKDKFSSEKILSNQLIEKAKIGNITIEYNHNLDKVLGDTMGVTGLR
FT                   LKDNDGKTKNIDVHGVFIAIGHTPNTAIFEGHLEMSHGYIKVQSGTQGNAMQTSVEGIF
FT                   AAGDVTDHIYRQAITSAGSGCMSALDAERFLGE"
FT   sig_peptide     52279..52356
FT                   /locus_tag="Rmag_0044"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.861) with cleavage site probability 0.851 at
FT                   residue 26"
FT   gene            53269..53344
FT                   /locus_tag="Rmag_R0002"
FT                   /note="tRNA-Phe1"
FT   tRNA            53269..53344
FT                   /locus_tag="Rmag_R0002"
FT                   /product="tRNA-Phe"
FT   gene            complement(54174..55136)
FT                   /locus_tag="Rmag_0045"
FT   CDS_pept        complement(54174..55136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0045"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase, Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase,
FT                   carbamoyl-P binding domain; KEGG: nmu:Nmul_A2481 aspartate
FT                   carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01848"
FT                   /db_xref="GOA:A1AV91"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AV91"
FT                   /protein_id="ABL01848.1"
FT                   /translation="MKKDLISNHIQLDDSGKLIHLLGLEGLSKQYLIHILDTADSLIDV
FT                   SGNLKKSKALDDIFVANLFFEPSTRTRNTFEIAAMRSSANVINVDLANSALKKNEDLLN
FT                   TMRTLKAMQIDMFVIRHKQNGLPHHVVQHLKDVSILNAGDGINAHPTQALLDMLSIRQH
FT                   KKTFENLSVAIVGDITHSRVAHSDIQALKTLGTTDIRLIAPKVLQYNLAPCSVVKHFDD
FT                   IEPGLKNCDVVIVLRLQKERMIEADIPNEQEYFDNFGLTPKRLALAKPDAIVMHPGPTN
FT                   RGVEIDSNVADGNQSIILQQVTNGIAVRMAVMQILVNKS"
FT   gene            complement(55117..55545)
FT                   /locus_tag="Rmag_0046"
FT   CDS_pept        complement(55117..55545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0046"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase, RNase H domain protein fold; KEGG: cbu:CBU_2094
FT                   putative Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01849"
FT                   /db_xref="GOA:A1AV92"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV92"
FT                   /protein_id="ABL01849.1"
FT                   /translation="MNISAYLGFDVGTKRTGIAIANSLTMQATGIKVIKHHKNGSTNWV
FT                   AFNEVISAHNINKFVVGLPFNQQGKEQTMTFIAKSFGNKLKNRYQIEVEFIDEYLSSNE
FT                   AKKLLKYNHHHHNAQRDDVDKQSSQLILQTWLNEKRFD"
FT   gene            complement(55542..56726)
FT                   /locus_tag="Rmag_0047"
FT   CDS_pept        complement(55542..56726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0047"
FT                   /product="lytic murein transglycosylase"
FT                   /note="TIGRFAM: lytic murein transglycosylase; PFAM:
FT                   Peptidoglycan-binding domain 1 protein; KEGG: sat:SYN_02632
FT                   membrane-bound lytic murein transglycosylase B"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01850"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV93"
FT                   /protein_id="ABL01850.1"
FT                   /translation="MLRFIYFLLMTSLVYADDTQGLSNTYSFEQFLSNIRFQATKLGIS
FT                   QTTLNNAFNDLTPNPKVLEYDRNQAEFNLNFWRYLNLRVNQNRLDKGMEKLQQYQKYLQ
FT                   ENYKKYGVPSQIVVAFWGLETNYGKNVGKMHLIRSLATLSFDKRRREFFTHELLTLLKL
FT                   IDEKKLPLNAQGSWAGAMGNMQFIPTNVAAYAIDANTDGKIDLWHTQADILASAAHFLK
FT                   KNGWHQGERWGREVNIPKAFNYHLANLSTKKTVNEWQTLGIRTIYNTNLPNSTMQASLI
FT                   LPMGYNGPAFLVYQNFHAILRWNHSILYALSVGHLSDRLIGANQLFAKSITEPSLSRNN
FT                   IKQIQTTLNQLGFDTGEPDGIPGPRTRHAARAYQKENDLPIDGYVGYQLLQQLQ"
FT   sig_peptide     complement(56676..56726)
FT                   /locus_tag="Rmag_0047"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.946) with cleavage site probability 0.946 at
FT                   residue 17"
FT   gene            56739..57665
FT                   /locus_tag="Rmag_0048"
FT   CDS_pept        56739..57665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0048"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: sde:Sde_1803
FT                   thiamine biosynthesis lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01851"
FT                   /db_xref="GOA:A1AV94"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV94"
FT                   /protein_id="ABL01851.1"
FT                   /translation="MPTLLIIFIFLFLSACSADETRQTITGTTMGTSYSIKINNNYVSQ
FT                   LMIDRRLDEIEQIFSTWNETSELSQLNKAPINQWIKVSDELFFVLSQAKKIHKQTQGFF
FT                   DSGMGRLINIWGFGTIKVQEKPSLEKIGQALAISSIEYLRLDNSRVKKLKDVHINLSAI
FT                   AKGYGVDVVTNILIKKGLKNFMVEIGGEVMVQGQWTIGIEKPNHSMPIAIELQNQAVAT
FT                   SGDYRNYLKWQGKKYQHIINPHTGLPASTNLSSVSVIHNSAMIADAYATAMMAMGSQKA
FT                   QILAQQLNLSVVLILSQQYDFKVLKIR"
FT   sig_peptide     56739..56795
FT                   /locus_tag="Rmag_0048"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.784 at
FT                   residue 19"
FT   gene            57788..58950
FT                   /pseudo
FT                   /locus_tag="Rmag_0049"
FT   gene            58950..59342
FT                   /locus_tag="Rmag_0050"
FT   CDS_pept        58950..59342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0050"
FT                   /product="camphor resistance protein CrcB"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: lpn:lpg0512 CrcB protein, camphor
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01852"
FT                   /db_xref="GOA:A1AV95"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV95"
FT                   /protein_id="ABL01852.1"
FT                   /translation="MSVLLTILLIGVGATIGASMRYYLIQLMNTTLGSGFPYGTLGVNV
FT                   LGSFLAGMLVVIVLEKAALREAYRLMLLIGLTGSLTTMSTLSWESIEMISLGHYGQAGL
FT                   NILLNVVLSLSAVGIGTALTRYLLIS"
FT   gene            complement(59339..60301)
FT                   /locus_tag="Rmag_0051"
FT   CDS_pept        complement(59339..60301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0051"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /note="KEGG: tcx:Tcr_1825 glutathione synthetase; TIGRFAM:
FT                   glutathione synthetase; PFAM: glutathione synthetase domain
FT                   protein; glutathione synthetase, ATP-binding; RimK domain
FT                   protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01853"
FT                   /db_xref="GOA:A1AV96"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV96"
FT                   /protein_id="ABL01853.1"
FT                   /translation="MKKIKIAVLMNDISTINPKKDSSLAMMLEASKRGWEIYTFDTTDL
FT                   FAQDGLVFADCAKTTVSNNLDHWFERKTNVVMTLDEFDVILMRKDPPFDMTYIYSTYLL
FT                   EQAENKGVLVVNKPQSLRDANEKLFALNFPHCMPKTLVSANQNKIKAFIKTQNTAVIKP
FT                   LDGMGGYDIFKLESYDITIDAVLKRLTNNGKHPIMAQAFLPDIDKGDKRILLINGKPVD
FT                   YALARIPAKGNFKGNLAAGAKGVGQLLSDRDRYLCEQIAPTLKTKGLIFVGLDVIGDYI
FT                   TEINVTSPTCIRELDTQFNLNIAGELLNVIEQKISTNRY"
FT   gene            60338..60414
FT                   /locus_tag="Rmag_R0003"
FT                   /note="tRNA-Met1"
FT   tRNA            60338..60414
FT                   /locus_tag="Rmag_R0003"
FT                   /product="tRNA-Met"
FT   gene            60518..60982
FT                   /locus_tag="Rmag_0052"
FT   CDS_pept        60518..60982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0052"
FT                   /product="protein of unknown function DUF150"
FT                   /note="PFAM: protein of unknown function DUF150; KEGG:
FT                   tcx:Tcr_1121 protein of unknown function DUF150"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01854"
FT                   /db_xref="GOA:A1AV97"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AV97"
FT                   /protein_id="ABL01854.1"
FT                   /translation="MARVTDKITHLIELVIKDMCYELVGIEYVASGKHSILRVFIDTDK
FT                   KGVGVNDCEKVSRQLSSIFDVEEPISGQYTLEVSSPGIERPLFHKEHYQRFLGANVKLR
FT                   MVRPIDGRRNFFGVIGCVNEADNTFELVGELDLVILDIDLIEKANLVVDF"
FT   gene            61014..62489
FT                   /locus_tag="Rmag_0053"
FT   CDS_pept        61014..62489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0053"
FT                   /product="NusA antitermination factor"
FT                   /note="KEGG: mca:MCA1316 N utilization substance protein A;
FT                   TIGRFAM: transcription termination factor NusA; PFAM: RNA
FT                   binding S1 domain protein; KH, type 1, domain protein; NusA
FT                   N-terminal domain protein; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01855"
FT                   /db_xref="GOA:A1AV98"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A1AV98"
FT                   /protein_id="ABL01855.1"
FT                   /translation="MDGKELFLMVEAISNEKNISKEEVLESLEEALAIATKKRNNIDAY
FT                   VEINRQTGEFLTFRQWMVVADGETFVDDDGTEFDSELHVYAKDASGVAVDDYVRKPIET
FT                   QKFGRIAAQIVKQVIVQKVREAEREVIVNDYSSRIGEVVMVTVKRVDRGNVYVDTGGGV
FT                   DGMIPKFDLIPNESVRKNDRLRAYIKEVKPSVRGAQIFLSRSMPEMMIELFKMEVPEIS
FT                   EGVIEIMGGSRDPGLRSKLAVRAKDRRIDPIGSCIGMRGARVQAVSNELNAERVDIILW
FT                   DEDHAQFVINAMAPAQVSSIIVDEDKHSMDIAVEDDQLALAIGRGGQNIKLASRLTGWR
FT                   LNVMSTTQADEKQAQETLKISDKLADQLGVDSEVAGVLIEEGFGSVGELVDADAQVLEN
FT                   IEEFDASMVEELQERASDAQLVQALGDAEASELLMSVEGVGEDLASALIEADIVTVDDL
FT                   AELSIDDLLDIQNMDTEIASSVIMIARENEGWF"
FT   gene            62546..64993
FT                   /locus_tag="Rmag_0054"
FT   CDS_pept        62546..64993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0054"
FT                   /product="bacterial translation initiation factor 2
FT                   (bIF-2)"
FT                   /note="TIGRFAM: translation initiation factor IF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; GTP-binding protein, HSR1-related; elongation
FT                   factor Tu, domain 2 protein; translation initiation factor
FT                   IF-2 domain protein; KEGG: tcx:Tcr_1123 translation
FT                   initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01856"
FT                   /db_xref="GOA:A1AV99"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AV99"
FT                   /protein_id="ABL01856.1"
FT                   /translation="MAHTVQTLSKLLKKTPDEVITILANAGVDGKNSDSAISAEERKIL
FT                   MSSLSKRSSSKSSMFSFSKTGIKSSANSASGAKVQVKKKRLTKSATATDEQPEIAVNEV
FT                   AQAVQVALDAGRDADKKLLAQDAKRLEMVRLQKTQAEVLKAQKKTVKQAQAQEIEKKAE
FT                   KPKMIDKFKEDKKPKRLRNTLNGNNTRRQLHVARHNPNRKLKKKDRTRLSQKVQEEQAQ
FT                   HAFQKPIEKVVHEIAIAENIKVTELAQKMATKAGEVLKVLMGMGVMATLNDVIDQDTAM
FT                   LVVEEMGHKSIASVEETVEDVLIEQLKSSGNEKARPPVVTIMGHVDHGKTSLLDYIRQA
FT                   KVTHGEAGGITQHIGAYQVQSNGNTITFIDTPGHAAFSKMRSRSANATDIVILVVAADD
FT                   GVMPQTIESIKHVQTAGVPMIVAINKIDKEGIDIDKIKQVLSTHNVISEDWGGDVMMIP
FT                   VSAYTGEGVDALLDAISLTAEVLEFSAVIKALARGTVLEARLEKGRGKVTTILVQSGTL
FT                   NKGDIMIAGFEYGKVKQIVDDKGKVLKSATPSMPVEVLGLSGVPNSGDEVLVVDSERKA
FT                   REVADFRKAKNREAQLQKQQASKMENFLMKMEESNVSTVNVLLKADVRGSAQALIEALE
FT                   GLSTDEAKVKVVSSGVGGINNTDITLAATSNALVLGFNVRADAVARKTADNEGVRIEYY
FT                   SIIYNLIDDVKTIMSGLLSPELSENIIGIASVKSVFRSQKMGDIAGCMVEEGVVRRDSL
FT                   IRVLRDSVVIFEGWLESLRRFKDNVNEVKSGTECGIGVLNYTDIQPGDQIEVFERIERI
FT                   RTL"
FT   gene            65011..65349
FT                   /locus_tag="Rmag_0055"
FT   CDS_pept        65011..65349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0055"
FT                   /product="ribosome-binding factor A"
FT                   /note="PFAM: ribosome-binding factor A; KEGG: lpp:lpp2819
FT                   ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01857"
FT                   /db_xref="GOA:A1AVA0"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVA0"
FT                   /protein_id="ABL01857.1"
FT                   /translation="MLEQTSYRVERISELIRRELTLLLKTTTKDPRLSGVMITDVLASR
FT                   DLSSAKVFYTVTKEDRTVVEPILSKASGFFRSRLSKTLDLRHTPALGFIFDSASNTGAR
FT                   IEQLLSKL"
FT   gene            65374..66282
FT                   /locus_tag="Rmag_0056"
FT   CDS_pept        65374..66282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0056"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /note="KEGG: pmu:PM0756 tRNA pseudouridine 55 synthase;
FT                   TIGRFAM: tRNA pseudouridine synthase B; PFAM:
FT                   pseudouridylate synthase TruB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01858"
FT                   /db_xref="GOA:A1AVA1"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVA1"
FT                   /protein_id="ABL01858.1"
FT                   /translation="MSRRNPKGRDINGIVLLDKDVGLSSNAALQKVKRLFFAKKAGHTG
FT                   ALDPLASGILPICLGQATKIAQFLLENDKSYFVRSKLGQMTDTGDCEGSIIKTQSFEHL
FT                   NEREIVNTAISFIGDILQIPPMYSALKRDGHPLYKLARQGVEVKRESRPVTIHKMTYLG
FT                   YANGILSLEITCSKGTYIRTLIEDIGKKLGCGAHVVELRRTGFAHIDISQTFKFSDLEA
FT                   LALDNYQTLDDKILASEAMLPNLENVYLSEAQSVNIKFGREIQTDKQGLFKVKLFDEKK
FT                   QFFGIGECQENGTIVPKRLFI"
FT   gene            66845..68116
FT                   /locus_tag="Rmag_0057"
FT   CDS_pept        66845..68116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0057"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: vpa:VP2898 phosphoribosylamine-glycine ligase;
FT                   TIGRFAM: phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01859"
FT                   /db_xref="GOA:A1AVA2"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVA2"
FT                   /protein_id="ABL01859.1"
FT                   /translation="MKVLVIGSGGREHAFAWQCAKFDTVSQVFVAPGNAGTQLENKLTN
FT                   VGIAAEDMEGLIAFVKVNKIDLTIVGPEAPLVIGVVDRFQEEDLVIFGPTKAASQLEGS
FT                   KAFCKYFLERNNIPTAYYGVFTNVDSAIQYVKNKGTPIVIKADGLATGKGVIIAHTQAE
FT                   AEGVIINMLQDNRFGEAGSRVVIEEFLSGEEASFIVMCDGKNVLPMATSQDHKTRDNGD
FT                   KGPNTGGMGAYSPAPIVTDEIFQTIMTKVIYPTVDAMAAEGNIYTGFLYAGLMIDQDNN
FT                   FKVLEYNCRFGDPETQPIMMRLRSNLADLCLLATQQKLDQASIEWDERICLGVVLAAKG
FT                   YPNAYNTSESIILPENSQDAKVFHAGTKLENGKILSSGGRVLCATALGESILDAKTKAY
FT                   QLVKKINWKGAYYRDDIGFKAVDG"
FT   gene            complement(68472..69230)
FT                   /locus_tag="Rmag_0058"
FT   CDS_pept        complement(68472..69230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0058"
FT                   /product="periplasmic or secreted lipoprotein-like protein"
FT                   /note="KEGG: neu:NE1008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01860"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVA3"
FT                   /protein_id="ABL01860.1"
FT                   /translation="MKKIILSISLIVNSLFLIGCAPVIQGASTVSSVISISNDRRSIGK
FT                   ILDDKTIASRLLIWYSEDPTLSDVHLNFMVYNKTVLITGEVSTPEIRIYASKQAQLQVP
FT                   NISQIFNEIKLGPSSGLISRVKDSAITIQVEFLFQNQEVFHPIHVRVMTENQVVYLMGA
FT                   LTKREANMAAKTAAKAKGAYKVVKLFDYLKTRPKAEIERDKLKELEDKRKAEFEKQQVD
FT                   LETKKADLQRQIRALSSNTTATNFSPEYAF"
FT   sig_peptide     complement(69150..69230)
FT                   /locus_tag="Rmag_0058"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.626 at
FT                   residue 27"
FT   gene            69598..70428
FT                   /locus_tag="Rmag_0059"
FT   CDS_pept        69598..70428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0059"
FT                   /product="Protein of unknown function UPF0011"
FT                   /note="TIGRFAM: Protein of unknown function UPF0011; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: aci:ACIAD1130 putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01861"
FT                   /db_xref="GOA:A1AVA4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVA4"
FT                   /protein_id="ABL01861.1"
FT                   /translation="MNGTLYIVATPIGNLDDITFRAIETLKIVDIILAEDTRHSKHLLN
FT                   HYDITTSMRAFHEHNEKRKTPDVINELLAGKHIALISDAGTPLISDPGYILVSEAKKAD
FT                   INVSPIPGSNAMISAISASGIASDKFSFFGFLPSKQSARLKVIRSIAHINEVAIFYESP
FT                   KRILSCAQDLQVILGNERIVCFAKELTKLFETINTNTLPKLIDYLQADDAHQKGEFVIL
FT                   ISAMDKGNKISEEEILDKILPILLAEMGAAKAAKLVAKITGFDKKYCYQRAIDF"
FT   gene            70449..70713
FT                   /pseudo
FT                   /locus_tag="Rmag_0060"
FT   gene            complement(70723..71328)
FT                   /locus_tag="Rmag_0061"
FT   CDS_pept        complement(70723..71328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0061"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="KEGG: cbu:CBU_0152 dephospho-CoA kinase; TIGRFAM:
FT                   dephospho-CoA kinase; PFAM: Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01862"
FT                   /db_xref="GOA:A1AVA5"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVA5"
FT                   /protein_id="ABL01862.1"
FT                   /translation="MSIIKIALTGGIACGKSRVSQILSGLGVDVINLDKLARQAVKPDT
FT                   LVLKKLIKHFGNDILNADKSLDRSALRELLLESKSNQQLIETMLHPEILMRMQTEIKKL
FT                   ESKLVVVEIPLLAEKNLTHLFDRIIIVGCNEEEQLKRLIARNDISLKEAKSMISTQINH
FT                   LLRLELCNKTPIDIIENNLDIADLTQKTNQLYKKLTNL"
FT   gene            71406..71482
FT                   /locus_tag="Rmag_R0004"
FT                   /note="tRNA-Met2"
FT   tRNA            71406..71482
FT                   /locus_tag="Rmag_R0004"
FT                   /product="tRNA-Met"
FT   gene            71651..73636
FT                   /locus_tag="Rmag_0062"
FT   CDS_pept        71651..73636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0062"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="KEGG: tcx:Tcr_0244 transketolase; TIGRFAM:
FT                   transketolase; PFAM: Transketolase domain protein;
FT                   Transketolase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01863"
FT                   /db_xref="GOA:A1AVA6"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVA6"
FT                   /protein_id="ABL01863.1"
FT                   /translation="MPSRRDLANAIRALSMDAVQKANSGHPGAPMGMADIAQVLWNDHL
FT                   KYNPIHAKWADRDRFVLSNGHGSMLIYSLLHLSGYDLSMNDIKNFRQLHAKTAGHPEYG
FT                   YADGIETTTGPLGQGVTNAVGMAIAERTLGAQFNKPGHDIVDHNTYVFMGDGCLMEGLS
FT                   HESCAMAGTLGLGKLIAFWDDNDISIDGHISDWMEKDAAGRFESYGWHVVRDVDGHDAD
FT                   AINAAINAAKAETAKPSLICTRTTIGFGSPNLCGTHNCHGAPLGDDEIAATRKELGWDF
FT                   APFKIPADIYKGWDHKEKGTIDESAWDVKFAAYKAEFPADAAEFERRMSGDLPDNFVIE
FT                   MDKFIAKTQEEMPSIASRQASQRTIETMAPLLPEMFGGSADLTGSNLTNWSGTVKVNAQ
FT                   NANGNYISWGVREFGMAHMMNGMVLHGAFKVYGATFFMFMEFMRNALRMSALMKIGTIY
FT                   VYTHDSIGLGEDGPTHQPIEQLATMRMIPNFQSWRGCDAVESAVSWKMAILRNNAPTGL
FT                   VFSRQTLTAMERTSEQVANIEKGGYILKDCEGTADIIFIATGSEVGLAVEAAAAMDVKV
FT                   RVVSMPCTNAYDDQGQAYKDSVLTPGVKRLAIEAGVGDGWYKYVGLDGDVVCMTTFGES
FT                   APADQLFKAFGFTINNVIAKAIAVIG"
FT   gene            73745..74740
FT                   /locus_tag="Rmag_0063"
FT   CDS_pept        73745..74740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0063"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="TIGRFAM: glyceraldehyde-3-phosphate dehydrogenase,
FT                   type I; PFAM: glyceraldehyde 3-phosphate dehydrogenase;
FT                   KEGG: tbd:Tbd_0160 glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01864"
FT                   /db_xref="GOA:A1AVA7"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVA7"
FT                   /protein_id="ABL01864.1"
FT                   /translation="MAIKVGINGFGRIGRMVFRAIAKNFSELEVVGINDLLDNDYLAYM
FT                   LKYDTVHGRFDGDIVVDGDNFVINGKKIRLSAERNPADLAWGDIDVDVAIDCTGFFLTE
FT                   EFCQAHIDAGAKKVVQSAPSKDNTPMFVYGVNHTKYTGQAIISAASCTTNCLAPIAKVI
FT                   NDNWGLKRGLMTTVHASTAAQKTVDGPSMKDWRGGRSVFENIIPSSTGAAKAVGVVLPE
FT                   LNGKLTGMAFRIPSVDVSVVDLTCELNKNVTYEQICDAMKEASKSSMKGTLAYTEDSVV
FT                   SSDFRGFSASSIFDSSAGIALDDTFVKVVSWYDNEYGYTCNMLRLVEHIA"
FT   gene            74781..75117
FT                   /pseudo
FT                   /locus_tag="Rmag_0064"
FT   gene            75162..76337
FT                   /locus_tag="Rmag_0065"
FT   CDS_pept        75162..76337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0065"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: ilo:IL2212
FT                   3-phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01865"
FT                   /db_xref="GOA:A1AVA8"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVA8"
FT                   /protein_id="ABL01865.1"
FT                   /translation="MSVINLLDLDLSSKRVLIRQDLNVSISNWIVTSDKRIKASLPTIK
FT                   IALKQGAKVMLMSHRGRPIEGEPSDEFSLQPVADRLSELLNTTVRLEKDWLNGVQMNNG
FT                   EVVLCENVRFNAGEMANDDNLSKRMALMCDIFVMDAFGTAHRAQASTHGVAKYAPIACS
FT                   GPLLSGELDALGKVLDNPKRPMVAIVGGSKVSTKLTVLESLSKIVDQLVVGGGIANTFI
FT                   AAQGFNVGKSLCEHDLIPMAKKLMEDCEIPVPTDVVCGKEFSETAEAQTKASTEVSDDD
FT                   MIFDIGPESIKQLAKIMENAGTIVWNGPVGVFEFEQFASGTKTLGKAIAESDAFSIAGG
FT                   GDTLAAVDKYGIEDKINYISTGGGAFLEFLEGKILPAVEILEQRASGVDFA"
FT   gene            76330..77772
FT                   /locus_tag="Rmag_0066"
FT   CDS_pept        76330..77772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0066"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="PFAM: pyruvate kinase; KEGG: vpa:VP2039 pyruvate
FT                   kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01866"
FT                   /db_xref="GOA:A1AVA9"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVA9"
FT                   /protein_id="ABL01866.1"
FT                   /translation="MPRRTKILATLGPATDKEGVLDSILEAGVNVVRINFSHGSKQEHL
FT                   NRVKAVRAWAQVNQTYVGVLMDLQGPKIRITTFKDGMKIQLNNGDIFALDADLDENSGN
FT                   QYSVGIVYKKLPQEVRVGNVLLLDDGKIVLEVIGIKGNKINTIVTQGGILSDKKGINLR
FT                   GGGLSANALTEKDKKDILIAAKAKADYVALSFPISGDDVRKTKQLLKQMGCDAGVISKI
FT                   ERAESLVESVILDIIKESAGIMVARGDLGVEIGDAQLPAQQKRLIKLARSNNRIVITAT
FT                   QMLESMITSPIPTRAEVFDVANAVLDGTDAVMLSAETAVGNFPENAVKTMHDVCIETEK
FT                   NPIAKISHHRLDETFTYIDETIAMSAMYAANHMGTRVIVTLTESGKTAIWMSRISSGIP
FT                   IVAMSDKVSTLQKATLYRGVHPCFLSTKKDWIEINKAVIKRLQVGNFVYDGDSVILTKG
FT                   MYKNKSGGTNLMKILTVGDSEY"
FT   gene            77856..78917
FT                   /locus_tag="Rmag_0067"
FT   CDS_pept        77856..78917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0067"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: noc:Noc_2804 fructose-bisphosphate aldolase,
FT                   class II, calvin cycle subtype; TIGRFAM:
FT                   ketose-bisphosphate aldolases; fructose-bisphosphate
FT                   aldolase, class II, Calvin cycle subtype; PFAM:
FT                   ketose-bisphosphate aldolase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01867"
FT                   /db_xref="GOA:A1AVB0"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVB0"
FT                   /protein_id="ABL01867.1"
FT                   /translation="MLISLRELLDHAAENDYGMPAFNVNNMEQVHAIMRAADKTNSPVI
FT                   MQGSAGARGYAGEPFLRHLILAATEMYPHIPVVMHQDHGSEPSVCLRSIQSGFSSVMMD
FT                   GSLKTDMKTPASFEYNVNVTAEVVKMAHAGGVSVEGELGCLGSLETGMMGEEDGHGAES
FT                   KLDLDMLLTSVEEAADFVKATNVDALAIAIGTSHGAYKFTQEPTGDVLRIDRIKEIYTR
FT                   IPDTHLVMHGSSSVPQDWLKIINDFGGDMGQTYGVPVEEIQEGIKHGVRKVNIDTDLRM
FT                   ASTGAVRRYLVENASNFDPRKFLKEATNAMSDICAARFEAFGSAGNADKITVSSLDTMS
FT                   QRYLSGELDVQVK"
FT   gene            78981..80855
FT                   /locus_tag="Rmag_0068"
FT   CDS_pept        78981..80855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0068"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG: ilo:IL2630
FT                   NAD/FAD-utilizing enzyme apparently involved in cell
FT                   division"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01868"
FT                   /db_xref="GOA:A1AVB1"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVB1"
FT                   /protein_id="ABL01868.1"
FT                   /translation="MNMGQAKSYSVIVIGGGHAGTEAALSSARMGVCTLLISHNIETLG
FT                   QMSCNPAIGGIGKGHLVKEIDAMGGIMARAIDKSGIQFRTLNASKGPAVRATRAQADRI
FT                   LYKAQIRYTLENQDNLSLFQQAVDDLIIEHDQIKGVVTQMGLAFMADKVILTSGTFLGG
FT                   VIHIGQRNFQGGRAGDAPSNALSGKLRSYDLRVSRLKTGTPPRLDNRTLNYSLMQVQPG
FT                   DTPLPTFSFMGVKEDHPRQIPCYITHTNEKTHDLIRDGLKDSPMFTGNIEGISPRYCPS
FT                   IEDKVVRFSERDSHQIFVEPEGLTTNEVYPNGVSTSLSYEVQLNFIRSIKGFEKAHIIR
FT                   PGYAIEYDFFDPRGLKQTLEVKKISGLYFAGQINGTTGYEEAAAQGLLAGVNAACAILE
FT                   RDAWLPKRNESYIGVMVDDLITKGANEPYRMFTSRAEYRLLLREDNADERLTPKARDLG
FT                   LISEVCWQSFQVKYEAITQEKNRLKNTWIQASDTQAGVVLNQNLNHEYSLLELLKRPKI
FT                   DYQILSQIESGKPFLTDATLINSIENQIKYAGYIKRQLEEIEKYRKNENTILSVNIDYD
FT                   SIKALSSEVRQKLELHKPETIGQASRIQGVTPASISILLVYLKTYQSK"
FT   gene            80891..81463
FT                   /locus_tag="Rmag_0069"
FT   CDS_pept        80891..81463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0069"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: mfa:Mfla_2754
FT                   methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01869"
FT                   /db_xref="GOA:A1AVB2"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVB2"
FT                   /protein_id="ABL01869.1"
FT                   /translation="MNIKLESEQISKLMNYLKLIIKWNKSYNLSAIRTMEKGVYKHLLD
FT                   SLSVIAYIKDKSLLDVGSGAGLPGIVISIMRPELLVTVLDTVGKKCRFMQFAKTQLQLK
FT                   NLNVIKNRVENYQIEFCFEQIISRAFSKVEKILKLTQHLLCNNGEYLLMKGAGFQQETL
FT                   PYGVDIQSLCVPEILGKRYLLIFRREK"
FT   gene            81460..82260
FT                   /locus_tag="Rmag_0070"
FT   CDS_pept        81460..82260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0070"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sde:Sde_1913 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01870"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVB3"
FT                   /protein_id="ABL01870.1"
FT                   /translation="MKKIGYFLIGLIVILALIVTVAFDPMGKKYAQQYAQNLLKIPVTI
FT                   SQFSTSFLDKRLNIDFIKVKNPPNFNNKYAFSLDHFVLKISDESISDLIVIDELSFDGI
FT                   SFVLEQNKTNVNLVTLIDNLDKTSSGTTFSLSEEIQNIGNKRIKINQFYVTNITLKIDT
FT                   KWLKETIKVPNINLQKFGGGSGIALSQVGQELMTVVLKNIKDALEKKGIELGKKEIKET
FT                   LMHKLRVDSIKEKFNLDKIKDSLNFSGTEELQNKAKDLFKQLGF"
FT   sig_peptide     81460..81528
FT                   /locus_tag="Rmag_0070"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.853) with cleavage site probability 0.709 at
FT                   residue 23"
FT   gene            82267..83037
FT                   /locus_tag="Rmag_0071"
FT   CDS_pept        82267..83037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0071"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: rso:RSc1787 putative
FT                   deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01871"
FT                   /db_xref="GOA:A1AVB4"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVB4"
FT                   /protein_id="ABL01871.1"
FT                   /translation="MQIVDSHCHIDRIDLSAFGGNVERMLAHAKELSVTQFLCVCIDLE
FT                   HFDEVFSLAKNYPQIYASVGVHPCELEGKDPSVKELLVLAEHDKIIAIGETGLDYFHVE
FT                   KIAADWQRDRFRRHIKASNQSGKPMIIHTRNAKKDTIAIMQTEKAEQGVMHCFSENWET
FT                   AKVVLDLGFYISFSGVITFKSAKDLREVAKKVPSDRLLVETDSPYLTPVPYRGKPNSPA
FT                   YSYYVAEKLAEIRGVSINNIANTTTNNFKQLFLA"
FT   gene            83034..83945
FT                   /locus_tag="Rmag_0072"
FT   CDS_pept        83034..83945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0072"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="5.4.99.-"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase;
FT                   KEGG: pmu:PM0992 ribosomal large subunit pseudouridine
FT                   synthase C"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01872"
FT                   /db_xref="GOA:A1AVB5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVB5"
FT                   /protein_id="ABL01872.1"
FT                   /translation="MSISFQIVDEFSEGQRLDNYLLKILKGVPKSHICRVIRKGWVRVN
FT                   KGRKKVSYKLILNDIVRIPPIKVSIIKSIYISDSLKKLLIDAKLYEDKGLLIINKPSGL
FT                   SVHSGSGVDVGIIEALRQIYKKPIELVHRLDRATSGVLLIAKKRSVLKNLHEQLSQHTV
FT                   EKRYTALVKGVWSKKCHTIDAPLYQNSRYIMVDAKGKYAISHFQPLKNFSDGGFSASLV
FT                   EISIETGRTHQIRVHAKYAGHALACDDKYGDKEFDRQVKFKGLKRLFLHAHQFIFTNPL
FT                   TNDIQKVNASLPVELEEFLAKL"
FT   gene            83993..84814
FT                   /locus_tag="Rmag_0073"
FT   CDS_pept        83993..84814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0073"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: vch:VC0094
FT                   4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01873"
FT                   /db_xref="GOA:A1AVB6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVB6"
FT                   /protein_id="ABL01873.1"
FT                   /translation="MRLDKPIGIYLLLWPTLWALFLAAEGVPDLKLLLIFVLGVILMRS
FT                   AGCVINDYADRHVDKLIKRTKQRPITSGEINHKSALKLFVLLIMLAFILVLLTNWLTIQ
FT                   LAMIAALLAILYPFTKRWTHFPQFVLGLAFAMSVPMAFSATLNTIPTTALYVFAATVIW
FT                   TVIYDTMYAMADREEDLKIGVKSTAILFAKFDRLIIGIFQIGLLLILIKISDVFNLTIL
FT                   YDISLALVALLMIYHQYFIRHRKKSACFQIFLHNKYIGVVIFAGIALSVVL"
FT   gene            complement(85474..86289)
FT                   /locus_tag="Rmag_0074"
FT   CDS_pept        complement(85474..86289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0074"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="TIGRFAM:
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase; KEGG: tcx:Tcr_1289
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01874"
FT                   /db_xref="GOA:A1AVB7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVB7"
FT                   /protein_id="ABL01874.1"
FT                   /translation="MKDIIEQAFEDRVNINPQSASMEIKQAVAEAIHFLDSGQARVAEQ
FT                   KGVGDWVVNEWLKKAVLLSFRLEDNVVMQGGFTQYFDKVSSKFADMSADEFNATGVRVV
FT                   PPASARRGSFIAKDTVLMPSYINIGAYVDSGTMVDTWATVGSCAQIGKNVHLSGGAGIG
FT                   GVLEPLQASPTIIEDNCFIGARSEVVEGVIVEQGAVISMGVYIGQSTKIFNRKTKEITY
FT                   GRIPAGSVVVPGNLPSKDGAYSLYCAVIVKQVNTKTRSKVGINELLRGI"
FT   gene            86449..87843
FT                   /locus_tag="Rmag_0075"
FT   CDS_pept        86449..87843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0075"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: tcx:Tcr_1962 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01875"
FT                   /db_xref="GOA:A1AVB8"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVB8"
FT                   /protein_id="ABL01875.1"
FT                   /translation="MTDKKIQVEGLYEEGEQWVQNLGDETIHAKRMKGKFRNFKWLAII
FT                   GWLPFFVGPYFTWNDKQAILFDIDKRQYHLFNITIFPQDIWMLTMVLLFLAILLAVMTT
FT                   ILGRVFCGYFCFQTIWTDIFTKIEQWIEGTPVQQRKLDKAPMSVNKFKLKLAKHAIWIV
FT                   IAFFSGITWMLYFGVSWADYFKGDVTSTTIAITAIIALGAYVFAGFMREQTCLWICPYA
FT                   RIQGAMVDDQSILPTYDHYRGEQRGRLKRGEFVEGFGDCIDCHQCVAVCPTGVDIRKGQ
FT                   EYGCITCGLCIDACDSVMKKVGKPKGLIRYTSLAEMKFNKPIKALYKRPRVVIYMSILL
FT                   VALSVLTCGILNLDQMDLKVLHDRQPLFVQLSDGSIRNKYKLKIMNKTDKVMPINISFS
FT                   SKIENLKSKKAFKTVMIPSGNIKSIYVYLTAFESDVGADNDVVFMVKSEQATLEYKTSF
FT                   FTSKSM"
FT   gene            87843..88322
FT                   /locus_tag="Rmag_0076"
FT   CDS_pept        87843..88322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0076"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_1961 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01876"
FT                   /db_xref="InterPro:IPR008620"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVB9"
FT                   /protein_id="ABL01876.1"
FT                   /translation="MSIYKSPIMISMLVLFITLVSATAYRIMIALETHPGLVVEDAYSS
FT                   GKRYVKTLNHKNQLARLGWILNLATPKVVIHNIKQTYTANSAQNDKTLANAFVTAYFYR
FT                   PLEKAHDFSINMAFNQEINQYQAQVTLPLKGRWDVVVEVVKRGFVQRTSRKLFAQ"
FT   sig_peptide     87843..87911
FT                   /locus_tag="Rmag_0076"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.975) with cleavage site probability 0.617 at
FT                   residue 23"
FT   gene            complement(90190..90891)
FT                   /locus_tag="Rmag_0077"
FT   CDS_pept        complement(90190..90891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0077"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: vfi:VF0829 high-affinity zinc uptake system
FT                   ATP-binding protein ZnuC"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01877"
FT                   /db_xref="GOA:A1AVC0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVC0"
FT                   /protein_id="ABL01877.1"
FT                   /translation="MSEVLISANHVSFSHHGKKVLDDVSFELRTGEFITLIGPNGAGKS
FT                   SLIKILLELIAPDDGKIKKSKYIRLGYTPQKFIPNEFIPISVIDFLKLNQKINTQSLIN
FT                   TTTLTGIETLLHLSLKNLSGGEIQRVLLTRAFLAKPNVLILDEPVQNLDVNGQMHLYKL
FT                   IQDIHNQQNCAVLMVSHDLHRVMKESTQVLCLYHHICCMGQPETILKNAQFNHLFADQM
FT                   DELMATYKHKH"
FT   gene            90999..93719
FT                   /locus_tag="Rmag_0078"
FT   CDS_pept        90999..93719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0078"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: hch:HCH_06350 DNA polymerase I; TIGRFAM: DNA
FT                   polymerase I; PFAM: DNA-directed DNA polymerase; 5'-3'
FT                   exonuclease; 3'-5' exonuclease; SMART: Helix-hairpin-helix
FT                   domain protein, class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01878"
FT                   /db_xref="GOA:A1AVC1"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVC1"
FT                   /protein_id="ABL01878.1"
FT                   /translation="MSHKLILMDGSAFLFRAYFSTLKQNLTNQDGFPTGAIFGVISAIK
FT                   RLQKQYPEAKIITIFDAKGKNFRHDIYPQYKAHRKPADSELVVQIEPLYEIIRAMGLHF
FT                   MCVPDVEADDVIATLSCYANQNNIKTIIASGDKDLMQLVSANISQLDMKGTVYDRQGVI
FT                   EKMGVAPEIFLDLLALTGDSADNVPGVPSVGPKTAIKWLQTYNDIAGIKENATQIKGKV
FT                   GEKLRNNFYLLDLSRRLVMLKFDVALPCNISDDESEQDVVKLADLYQQYGFSMWLKQLD
FT                   NMPMLEQEGIQATEVTESTSNMVDVLEDYSQTLVLDSDVFNAMVNRLKTSKTFVFDLET
FT                   TSLDYMNATIVGWVFLVDKNSFYVPVGHDYLNAPKQLDFKDVLDQLKLILEDVSIGKVG
FT                   QNLKYDAHILANYQIDLQGISDDTMVKSYCLNSVATRHNIDDLSEYYLNHKTIHFDDIA
FT                   GKGKKQITFNQVDLETAFPYACEYVIVTDLLNHVLDEEIVQYPKLVKLYQNLELPLIKV
FT                   LLCMERNGIELDMNELSTQQIDIVQQMKDIQAQVFELAGDIFNLESPKQIQQILFEPEG
FT                   LGLTPLKKTPKGAPSTNEEALKLLDHPLVDLILSYRTLTKLNSTYLEALPKQIDLNTHR
FT                   LHTSYHQAVTVTGRLSSSNPNLQNIPIRSKQGARIRGAFVAGKDNVIIAADYSQIELRI
FT                   MAQLSQDKNLLDAFNHDKDVHSVTASTMFNMPINEVTKKHRRRSKAINFGLIYGMSAFG
FT                   LTKQIDVSIIEAKQYIDTYFDNYPGVLHYMDSIKESAKVWGYVETVMGRRLYLPQINSK
FT                   NKILQQHALRTAINAPMQGSSADIIKKSMLDIHAWIGENNPDIRMIMQVHDELVFEVSE
FT                   SKADEFAHKIQGLMANVYLLDIPLKVNVGIGTSWQ"
FT   gene            93735..95438
FT                   /locus_tag="Rmag_0079"
FT   CDS_pept        93735..95438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0079"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: tcx:Tcr_0198 arginyl-tRNA synthetase; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01879"
FT                   /db_xref="GOA:A1AVC2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVC2"
FT                   /protein_id="ABL01879.1"
FT                   /translation="MKEQLQKILKQSLNLLENEGVLESAPENIRIDHTKDKTQGDFASN
FT                   IAMVLAKRSGLIPKVLAQKIIDNLGDNTQIDKVQIADPGFINFFISQGESVQIIEQIIN
FT                   QAEHYGKADVGKGQRILLEFVSANPTGPLHVGHGRVAAYGATVASLLRAVGFEVDNEYY
FT                   VNDAGRQMDILAISVYLRYVETEQFPDNGYKGDYIFDIAKKISGVKKLDIFISQRSVKK
FT                   NAGNKEKHIDRLIANCKFQLGHDYKKILDLAINNILSGIKIDLVEFGVKYQQWFSEQSL
FT                   MDSGLSKEIVKKLQDSGYIYEKEGALWFKTTDFGDDLDRVVVRKNGKYTYFASDIAYHL
FT                   EKFERGYDKIINIWGVDHHGYIARIKASIKALNHNSNKLEILLVQFVNLFRNGKKASMS
FT                   TRSGSFITLEELREEVGNDAARFFYILSKSGQHMNFDLDLAKSKSNENPVFYIQYAHAR
FT                   ICSVLKQAKSPSMVDIDLSVLNNESEALLIKELNRYKDILQSSALNYEPHVLACYLREL
FT                   AGHFHSYYNNSKFLVDDDKLRNARLFLIIAVKQILVNGLNLLGVSAPDSM"
FT   gene            95435..98596
FT                   /locus_tag="Rmag_0080"
FT   CDS_pept        95435..98596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0080"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: cbu:CBU_1230 UvrD/REP
FT                   helicase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01880"
FT                   /db_xref="GOA:A1AVC3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVC3"
FT                   /protein_id="ABL01880.1"
FT                   /translation="MNDQTQRRQALDVSQSFIVQAPAGSGKTELLTQRYLKLLSVSASP
FT                   ESVIAMTFTKKAVSELTTRVIESLKLAQGNRPKESYKQTTYDLALKVLEKSKTLDWQLL
FT                   NMYERFKILTIDGLSGLIASRYPSKNQLVPKQIIAQNCVRNDIYLKAAKQTLLAIDESE
FT                   YQNSIESVLLYLDNNVNKFYRLIIDMLAKRDQWLLKLYQHGVLNIETLRLSSKKIIIQH
FT                   LLLLKNEVERYFNVTFFKLLKDNTKPEFAQIQGVPDATVESLEVWKNLCQLCLTTQGKW
FT                   RTSLNKNNGFPVELKTQKQAVIKIFQDLSSHQQLRKLLAGVEQLPDVNFSTNQINILQD
FT                   IAQVLKLAVIQLNILFDVNQTYDFIQVALDANQALDEHQVGDVALFLDNKVQHILIDEF
FT                   QDTSATQFVLLEKLIINWQVGDGKTLFLVGDPMQSIYLFRQSQVGLFLQVRVQGIANIK
FT                   PKFLQLSTNFRSSESVVEGNNKIFSKIFPQQEDAFKGAIKYEHSQANFVDENENAIRFY
FT                   PFAYKRYDFEAQKVLEIIQNNPTKEIVILVRSRSHLDDIVSILKRANIEFEALKILPLK
FT                   EDLFTRDLLSLTRALKHLGDKLAWLAILRAPWCGLLLEDLLVLSQQDERVIFDLIQDEQ
FT                   VLQGLSENGQLRIRNFVHVFCDIVNQQSRFSFTKVLAFAINQLAPQSSLSVKRSMIKIQ
FT                   FLQIIHDCESVQQLDIETINQMLDGLYAPSVNARIKLMTIHEAKGLEFELVIIPGLGRM
FT                   PQNNIPSIIHLQEFSNQSLLLAPIRSYTQLDDSHTYTYLKHIKSQQNKFETMRLLYVAM
FT                   TRAKLEIHLLGTLNQSNQASSNTFLKLLAPIFQHQFDKLKLSTTEDNQPLVQAPEFVRY
FT                   IKPLEYDNLPDESKKKMDFQLSVDLQYKSLLGTLLHQYYEDSLFSPDKQSIRARLMECG
FT                   VGNMDIDSHINFIVNMLNLTKQDKHFSWLFKQRTSTQVEVEFINDKHSVIIDRLFIDED
FT                   TLWIIDFKTATKSNNESIAQFIQRQKIKYTQQLLSYKVALSEYYSMEIKCALYCSSVQE
FT                   LIEIY"
FT   gene            complement(98697..99130)
FT                   /pseudo
FT                   /locus_tag="Rmag_0081"
FT   gene            complement(99327..99908)
FT                   /locus_tag="Rmag_0082"
FT   CDS_pept        complement(99327..99908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0082"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="PFAM: thiamine monophosphate synthase; KEGG:
FT                   cvi:CV0150 probable thiamine-phosphate diphosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01881"
FT                   /db_xref="GOA:A1AVC4"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVC4"
FT                   /protein_id="ABL01881.1"
FT                   /translation="MVFNKKISNIYAVTPNTFLNSALIKRVIIEHQISILQYRHKINDD
FT                   NIKLKEAYALRLLCLEYNTLFIINDDINLAEKIHADGVHLGKDDDSIQQARQQLGDAAI
FT                   IGMSCYDNIDLALQAQNQGASYVAFGALFDSNTKPNAPYCPFSLITKVKKILNIPIVGI
FT                   GGIDLHNQQQAFDAGCDAVAMINTLFKKHH"
FT   gene            99907..100869
FT                   /locus_tag="Rmag_0083"
FT   CDS_pept        99907..100869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0083"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01882"
FT                   /db_xref="GOA:A1AVC5"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVC5"
FT                   /protein_id="ABL01882.1"
FT                   /translation="MASFQLRLNLLSTISIIVIIGVIWLLIELLLSSFFIPENKKKISL
FT                   IQNKTTYKGKVYLEKIHNFSLQEFDAKVQLSHFVKAKSYFSFKNSPALLIEPEVIFYDE
FT                   NGLKDYVLKSKCAHYTDRGEIKFKGEVSIQSSNGLSHKVNTEELLVGIKTSDLISKKQV
FT                   TYLGKNVKIIAQGMRMYAKDDTMRLIGRTKINQGNGQQILTKDLYINQSKGQKHYYSNN
FT                   KTTYLAKKNIIYANGVDMMNRQKQVIQLLGKVKIVQDSGSKIFTKNLTIDQSDGLEVYR
FT                   TKEKIHYQSKIVDIHAFGMNYDVIEQKIRLTGGVVGRYE"
FT   gene            100862..101347
FT                   /locus_tag="Rmag_0084"
FT   CDS_pept        100862..101347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0084"
FT                   /product="OstA family protein"
FT                   /note="PFAM: OstA family protein; KEGG: noc:Noc_2791
FT                   OstA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01883"
FT                   /db_xref="GOA:A1AVC6"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVC6"
FT                   /protein_id="ABL01883.1"
FT                   /translation="MSKVLLICLLALSGYAIALVIDNYKPIEVSASMVVIDEKKKISTY
FT                   VGKASITQGSFMLNAEIIQLFSNQQEVIKIIAKGTYKQPAHYQQNQSNQSRFIEAQALN
FT                   ITYLTKQELVHLKGKAHLVQGVDFFSGDTLDYDIKNDKIITSMSKDGTQRVRFKIKL"
FT   sig_peptide     100862..100918
FT                   /locus_tag="Rmag_0084"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.991 at
FT                   residue 19"
FT   gene            101492..102700
FT                   /locus_tag="Rmag_0085"
FT   CDS_pept        101492..102700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0085"
FT                   /product="sulfate adenylyltransferase"
FT                   /EC_number="2.7.7.4"
FT                   /note="KEGG: tbd:Tbd_0874 ATP-sulfurylase; TIGRFAM: sulfate
FT                   adenylyltransferase; PFAM: ATP-sulfurylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01884"
FT                   /db_xref="GOA:A1AVC7"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020792"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVC7"
FT                   /protein_id="ABL01884.1"
FT                   /translation="MTKLVPPHGSDTLKSLALEGNALTVELERAKLLPKINCSSREEGD
FT                   IIMMGVGGFTPLEGFMGKADWQSVCDNMTIESGLFWPIPITLSTDNEGVNQGDEVALVN
FT                   GETDEIIATMVISEKYSIDKTHECNTVYKTTEIEHPGVVMVMAQGKYNLAGSIKVLSDG
FT                   GFPEKYSSLYMTPMETRAYFDDKGWKTVAAFQTRNPMHRSHEYLVKIAVEVCDGVMIHS
FT                   VLGNLKAGDIPANVRSEAISVLIENYFVDNTILQSGYPLDMRYAGPREALLHALFRQNY
FT                   GCSHLIVGRDHAGIDDYYGPFDAHNIFDEIADDALMTKALKIDWTFWCHKCGGMSSMKT
FT                   CPHSAEDRALLSGTKVRKMLSDSEDLPETFSRPEVAKVLQAYYAGIKDEDKVEIKLNGH
FT                   SAK"
FT   gene            102897..103766
FT                   /locus_tag="Rmag_0086"
FT   CDS_pept        102897..103766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_2284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01885"
FT                   /db_xref="GOA:A1AVC8"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVC8"
FT                   /protein_id="ABL01885.1"
FT                   /translation="MIDINSTPITSLLVEGISYVDMQIYVIIMIALVVVMTALDLLHKK
FT                   SATYFFNTAAKADKDLAAGDAPCSLGKEEDRLKVLSAGDKVNILASTVVVDVVTAGEFS
FT                   NGLRRFVHILTMWGFIFFNASTAIIIFGTQETQVLAQVWNVGAIMLFIGTFWYWFGFKV
FT                   DSQAEGYSWTKIILKRDMFSLSLMATSVTALGWNIYGGGIGVWFILVLFSTTFLFGGVY
FT                   WSKFSHMFFKPAAAYNRRIIKANGTNENLPHETRDDVWQQNRHSMGLLKDAPMNMGLGI
FT                   KREAPKHY"
FT   gene            103798..104277
FT                   /locus_tag="Rmag_0087"
FT   CDS_pept        103798..104277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0087"
FT                   /product="dissimilatory adenylylsulfate reductase beta
FT                   subunit"
FT                   /EC_number="1.8.99.2"
FT                   /note="TIGRFAM: adenylylsulfate reductase, beta subunit;
FT                   PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: tbd:Tbd_2283 adenylylsulfate reductase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01886"
FT                   /db_xref="GOA:A1AVC9"
FT                   /db_xref="InterPro:IPR011802"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022738"
FT                   /db_xref="InterPro:IPR038465"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVC9"
FT                   /protein_id="ABL01886.1"
FT                   /translation="MPTFVYMTRCDGCGHCVDICPSNIMHIDDKYRRAYNIEPNMCWEC
FT                   YSCVKACPHQAIDVRGYADFAPLGHSVRVIRDEEKGTIAWRVKFRDGRVKNFLSPITTQ
FT                   PWGTKIPDFRNEPEPSDDMRNSQLLAFEPKYIRMDDGDIHTLESNGLKFKEGVYY"
FT   gene            104277..106160
FT                   /locus_tag="Rmag_0088"
FT   CDS_pept        104277..106160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0088"
FT                   /product="dissimilatory adenylylsulfate reductase alpha
FT                   subunit precursor"
FT                   /EC_number="1.8.99.2"
FT                   /note="TIGRFAM: adenylylsulfate reductase, alpha subunit;
FT                   PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: tbd:Tbd_2282
FT                   adenylylsulfate reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01887"
FT                   /db_xref="GOA:A1AVD0"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011803"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVD0"
FT                   /protein_id="ABL01887.1"
FT                   /translation="MGIKTIVEDNIDILVVGAGLGGTGAAYEARYWGRNKKIIIAEKAN
FT                   INRSGAVAQGLYAINCYMGTRFGENNPEDHVRYARMDLMGIVREDLLFDMARHVDSAVH
FT                   KFEEWGLPLMKDPKREDIGAYMREGRWQIMIHGESYKPIVAEAATKQVDKVYNRIMVTH
FT                   LLMDDAQENRIAGAVGFNVRTGNYHVFKSKTTIVGAGGASNIFKPRSVGEGMGRVWYAP
FT                   WSSGSAYGLLIEAGAKMTQMENRIVLARFKDGYGPVGAYFLHLKTYTQNGYGDEYESKW
FT                   FPALSKMVGKEYLDTEGQHLSHKPIPTCLRNHAFISEVNAGRGPIHMVTMEAFQDPHLE
FT                   EVGWENFLGMTVGQAVLWAATDVDPKYENPELTTSEPYVMGSHATGCGAWCSGPEDVSP
FT                   DEYFWGYNRMTTVDGLFGAGDTVGGTPHAFSSGSFTEGRLAAKAACKYIDDGKAEGIRV
FT                   SDKQIAERKEQIFKPLENYTIGRNEIVAGTVSPSYILPMSGLQRLQKLMDEYCGGVTVS
FT                   YVTNDKLLNIGLKKLAILEEDLEHIGAEDFHQLMRGWELRHRHRTSECVTQHTLFRKET
FT                   RWPGYYYRGDAMKLDDKNWHVLTVSHRDRVTGKYTLEKAPCYHLVGEKDEK"
FT   gene            106231..106581
FT                   /locus_tag="Rmag_0089"
FT   CDS_pept        106231..106581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_2281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01888"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVD1"
FT                   /protein_id="ABL01888.1"
FT                   /translation="MNIIDKTDEEILAIASPMWDDLVKYSNNSNYGAFSRHFSEDFLRG
FT                   ANEIEMGKQFARSELTKGLEKNAGYLGMIRRGQYVTVLYKQTHSKKEGEYLGRLVLGYE
FT                   DDVVKIFGTTIF"
FT   gene            106587..107093
FT                   /locus_tag="Rmag_0090"
FT   CDS_pept        106587..107093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0090"
FT                   /product="putative peptidyl-prolyl cis-trans isomerase"
FT                   /note="KEGG: tbd:Tbd_2280 putative peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01889"
FT                   /db_xref="GOA:A1AVD2"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVD2"
FT                   /protein_id="ABL01889.1"
FT                   /translation="MNNVIQEAKYVELIYKVIDKKTGNVFSEIEYPVGYVHGVNDTLGK
FT                   QVISELEGRKQGDILEVNIDVEKIYGSRDETLVFIDKIENVPLEYQKIGAKVVMENSKG
FT                   DSKEFLVTKVDDKTVTIDGNNLLCGREVKFLLEILLVRDATDEEIEAGGMIEKQSDIEQ
FT                   LLTVH"
FT   gene            107096..107455
FT                   /locus_tag="Rmag_0091"
FT   CDS_pept        107096..107455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_1503 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01890"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVD3"
FT                   /protein_id="ABL01890.1"
FT                   /translation="MSIDFTELEIKTIQSAVDRRWRKEKIEANLANIEITKEGEDESTF
FT                   TPAVVWEDENSTFIILKIGVFSYKSFFYYLTDQRFDTGVPEYNDLYECANKLLKVQADF
FT                   MLSKNIKDLGLHIQK"
FT   gene            complement(107558..109558)
FT                   /locus_tag="Rmag_0092"
FT   CDS_pept        complement(107558..109558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0092"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: mca:MCA1252 membrane-bound
FT                   proton-translocating pyrophosphatase; TIGRFAM: V-type
FT                   H(+)-translocating pyrophosphatase; PFAM: Inorganic H+
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01891"
FT                   /db_xref="GOA:A1AVD4"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVD4"
FT                   /protein_id="ABL01891.1"
FT                   /translation="MDTILILAISASIIAVLYGLFTIIWINKQPAGSDKMKEISDAITQ
FT                   GANAYLNRQYSTIAIVGVVLLIIITYFLGVTIGLGFLVGAVLSGVTGYIGMNVSVKSNS
FT                   RTAQAANNGMNTAFQVAFKGGAVTGMLVVGLALLGVSGYYAGMIEYGVAQKDALHALIG
FT                   LAFGGSLISIFARLGGGIFTKGADVGADIVGKVEAGIPEDDPRNPAVIADNVGDNVGDC
FT                   AGMAADLFETYAVTIVATMMLAGVLGLGDNAILYPLALGAASIITSIVGTFFVKVSDNG
FT                   SIMGALYKGLIASAGMAAIAFYFITNHMNMEINLFYASLIGLVLTAVMVVITEYYTSTE
FT                   YSPVQHVAEASLTGDGTNVIAGIGLSMKSTSLPVLAVCSSIWGAYELGGLYAIAIAATA
FT                   MLSMTGVIVALDAYGPITDNAGGIAEMAELPEKIRKITDPLDAVGNTTKAVTKGYAIAS
FT                   AGLATLVLFADFTNELRTIEQFKDIAFDLSNHKVIIGLFLGGLVPYLFGAMAMEAVGRA
FT                   AGDIVNEVRRQFREIPDIMNYTQKPDYSKAVDMLTKSAIKEMILPSILPIAFPVIVGLL
FT                   LGAEALGGLLIGSIVTGIFVAISMTTGGGAWDNAKKYIEDGHFGGKGSDTHKAAVTGDT
FT                   VGDPYKDTAGPAINPLIKIINIVAIMIIPFL"
FT   gene            complement(110185..110835)
FT                   /locus_tag="Rmag_0093"
FT   CDS_pept        complement(110185..110835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0093"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="KEGG: pol:Bpro_2952 adenylate kinases; TIGRFAM:
FT                   adenylate kinases; PFAM: adenylate kinase; adenylate
FT                   kinase, lid domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01892"
FT                   /db_xref="GOA:A1AVD5"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVD5"
FT                   /protein_id="ABL01892.1"
FT                   /translation="MNIILLGPPGAGKGTQATNICQKYSIPQISTGDMLREAVKADTPL
FT                   GIEAKKVMDVGGLISDDIIIGLVKERIQENDCKNGFLFDGFPRTIVQAEALKTDGVKID
FT                   FVVEIQVPYEDIIARMSGRRAHLTSGRTYHIVYNPPKVEGIDDITGEELIQRTDDAEDT
FT                   VRARLNIYHKQTKPLVDYYQSWMNKNSDAPKYGAVVGVGTLDEVRDRVYAQLN"
FT   gene            complement(110906..112150)
FT                   /locus_tag="Rmag_0094"
FT   CDS_pept        complement(110906..112150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0094"
FT                   /product="pyrophosphate-dependent phosphofructokinase"
FT                   /EC_number="2.7.1.90"
FT                   /note="PFAM: phosphofructokinase; KEGG: tbd:Tbd_1502
FT                   phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01893"
FT                   /db_xref="GOA:A1AVD6"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011404"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVD6"
FT                   /protein_id="ABL01893.1"
FT                   /translation="MKNAFYAQSGGVTAVINASACGVIETVRKHPDKIGTIYAGQNGII
FT                   GALTENLIDTSKESNADIKALKHTPSGGFGSCRYKMKSLETNKAEYERLIEVFKEYDVG
FT                   YFFYNGGGDSADTCLKVSQLSKSMGYPIQAIHVPKTVDNDLPITDNCPGFGSVAKYIAV
FT                   SIMEASFDVASMAATSTKIFVLEVMGRHAGWIAAAGGLVDNSIPVVILFPEVDFDEKKF
FT                   LAKVNKNVKEFNYCTIVVSEGAKWPDGCFLAEQGTHDDFGNAQLGGAAPVVANLIKDTL
FT                   GYKYHWAVADYLQRAARHLASKSDVEQAYALGVAAVNMALEGKNSVMPTIIRTSNNPYT
FT                   WEIGSGELKDVANVEKMMPMNYISNDGFGITDACREYLQPLIEGEDYPPYKNGLPDYVV
FT                   MKKIMTDKKLPTFEI"
FT   gene            complement(114090..114329)
FT                   /locus_tag="Rmag_0095"
FT   CDS_pept        complement(114090..114329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0095"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3728 cadherin"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01894"
FT                   /db_xref="GOA:A1AVD7"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVD7"
FT                   /protein_id="ABL01894.1"
FT                   /translation="MQLESSTTANDIESDSLNFSIQYKPSWSAFNTATGTLNGTPIESN
FT                   IGGGFNHSIRFINRYYLANTITMPNTFLSSDVVG"
FT   gene            complement(115810..116482)
FT                   /pseudo
FT                   /locus_tag="Rmag_0096"
FT   gene            complement(116484..117872)
FT                   /locus_tag="Rmag_0097"
FT   CDS_pept        complement(116484..117872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0097"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: mca:MCA0509 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: cysteinyl-tRNA
FT                   synthetase, class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01895"
FT                   /db_xref="GOA:A1AVD8"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVD8"
FT                   /protein_id="ABL01895.1"
FT                   /translation="MLKIYNTLSKQKEVFRPINADKVGIYVCGMTVYDYCHMGHARILV
FT                   IFDVIIRHLRRYFPNVEYVRNITDIDDKIIKRAIENKEDIYALTNRFIDAMHEDERALG
FT                   VLPPDVEPRATNAMKQIFYMIKSLIEKGFAYQAHNGDVYYSVRHFKNYGKLSRKNIDKL
FT                   EAGARIEIESAKKNPLDFVLWKMSKPNEPSWDSPWGQGRPGWHIECSAMSTHHLGNHFD
FT                   IHGGGMDLSFPHHENEIAQSEGANNCTFVNTWMHIGFVNIDDEKMSKSLNNFFTIRSIL
FT                   ESYNCETLRYFIMSSHYRSPLNFSDDNLNKAKSSLSRLYTAIRGLNTSSTVTEKVPMYF
FT                   DYSVRFNEALDNDFNTPIALSILFELAKTVNLQRKKDVDQANALAQLLKKLGDYIGILQ
FT                   MDADKFLKQGISLSNSEVDVKITSRNEARADKNFALSDQIRDKLAELGIVLEDNANDTT
FT                   WRRK"
FT   gene            118002..118601
FT                   /locus_tag="Rmag_0098"
FT   CDS_pept        118002..118601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0098"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   tcx:Tcr_1387 alkyl hydroperoxide reductase/thiol specific
FT                   antioxidant/Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01896"
FT                   /db_xref="GOA:A1AVD9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVD9"
FT                   /protein_id="ABL01896.1"
FT                   /translation="MSVLVTQQAPDFTAAAVLADGSIVDNFQLSNLKGKKIVLFFYPLD
FT                   FTFVCPSEILACHHRMMQFNDKGVEVIGVSVDSQFTHNAWRNTAPADGGLGVIDFPLVA
FT                   DTDHSIMEAYGIVHPAGIALRASFLIDENFEVRHQVVNDLPLGRNIDEMLRMVDALDFH
FT                   TEHGEVCPAGWNKGDEGMKDTPAGVSDYLSKHADEL"
FT   gene            118857..119927
FT                   /locus_tag="Rmag_0099"
FT   CDS_pept        118857..119927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0099"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="KEGG: mca:MCA2063 3-isopropylmalate dehydrogenase;
FT                   TIGRFAM: 3-isopropylmalate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01897"
FT                   /db_xref="GOA:A1AVE0"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVE0"
FT                   /protein_id="ABL01897.1"
FT                   /translation="MLKVLILPGDGIGQEITTQALKVIDCLNADFNLGMMLEHGLVGGN
FT                   AYDETGSPLPQATLDAARQCDSILLGAVGGYQWEFLERDLRPERGLLELRAEMDLFSNL
FT                   RPAILYPQLVNVSTLKEEVVSGLDLMIVRELVAGIYFGKPRGVEIRDGQKYGFNTAAYY
FT                   ELEIRRIGRSAFKIAQLRNKRVCSIDKANVLEVCELWREVMTDVAKDYPNVELTHMYVD
FT                   NAAMQLVKAPKQFDVMVTSNLFGDVLSDCAAMLTGSIGMLPSASLNQDGFGMYEPIHGS
FT                   APDIAGKDIANPLAAILSVAMMLRYSLNQASLACKIEAAVNTVLNKGYRTQDIAIESDL
FT                   VVGTNKMGDLVVEALV"
FT   gene            121096..122177
FT                   /pseudo
FT                   /locus_tag="Rmag_0100"
FT   gene            122225..122770
FT                   /locus_tag="Rmag_0101"
FT   CDS_pept        122225..122770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0101"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: noc:Noc_2420 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01898"
FT                   /db_xref="GOA:A1AVE1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVE1"
FT                   /protein_id="ABL01898.1"
FT                   /translation="MRKRPIVLNIKTIATTSFFNIEEMDIEFSNGSKRIYERLKPPGNG
FT                   AVLVIPMLDIETVLMIYEYSGGTDRYELTLTKGKIDGGETLIEAANRELIEEIGYGSNK
FT                   LTFIKEMTIAPGYQSSITYIVLAQDLYKASAQGDEPEPLEIAAFKMSDLENLVYNEDLT
FT                   EARSIAALYMARDVINNQ"
FT   gene            122782..123281
FT                   /pseudo
FT                   /locus_tag="Rmag_0102"
FT   gene            123511..124758
FT                   /locus_tag="Rmag_0103"
FT   CDS_pept        123511..124758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0103"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: tcx:Tcr_1847
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01899"
FT                   /db_xref="GOA:A1AVE2"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVE2"
FT                   /protein_id="ABL01899.1"
FT                   /translation="MGFSYKNHILYAESVAITDLIDAYESPLYVYSRTDIENNWYEFDQ
FT                   AFGTHPHLVCYAVKANSNLAVLNVLSKIGSGFDIVSIGELERVLFAGADASRCVFSGVA
FT                   KTKFEIKRALEVGIFCFNVESMAEMNRIEQVAKDMGTQAQISLRINPNVDAKTHPYIST
FT                   GLKENKFGVDIDDVVPIYRMAHNSPYLAVKGLNCHIGSQLVEVSPFLDALDKVLELVAK
FT                   LDKINIRITHLDLGGGIGIKYNNEQIIDINAYIASILDKVKMNDLKIILEPGRAVVGNA
FT                   GVFVTKVEFLKQNSDKSFAIIDGAMNDLLRPAFYQTYHQVLPVNENAKGVDANWDLVGP
FT                   ICETGDFLAKNRKLSLSEGDYLALMSTGAYGFTMSSNYNSRPRVAEVMVSGNQHTLVRE
FT                   RETIQDLFNKEHIIND"
FT   gene            124751..125053
FT                   /locus_tag="Rmag_0104"
FT   CDS_pept        124751..125053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0104"
FT                   /product="protein of unknown function UPF0044"
FT                   /note="PFAM: protein of unknown function UPF0044; KEGG:
FT                   pmu:PM0713 putative RNA-binding protein containing KH
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01900"
FT                   /db_xref="GOA:A1AVE3"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVE3"
FT                   /protein_id="ABL01900.1"
FT                   /translation="MIKLTNNQKKFLRSKGHSLEPIVMVGQHGLSESVLVELKATMEKH
FT                   ELLKIKIRIDKREEKQKIIAKIISIYNAYLVQVIGNIVVIYRGFDEEPQIILPRK"
FT   gene            125019..126146
FT                   /locus_tag="Rmag_0105"
FT   CDS_pept        125019..126146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0105"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="KEGG: sde:Sde_2584 lipid-A-disaccharide synthase;
FT                   TIGRFAM: lipid-A-disaccharide synthase; PFAM: glycosyl
FT                   transferase, family 19"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01901"
FT                   /db_xref="GOA:A1AVE4"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVE4"
FT                   /protein_id="ABL01901.1"
FT                   /translation="MKNHKLSFQESKGPIKIAISAAETSGDLIGSKLIKSLKKQKSNVS
FT                   IEGLAGDKMIAAGCVQRWDQKQINVMGFSEVLKKLPFLLRLRKLIIVYFSNQKPDVFIG
FT                   VDAPDFNFVIERKLKSQGVKTVHFISPSIWAWRQFRIKKIKQSSDLVLCLFPFEVDFYQ
FT                   AHNQRALFVGHPLAQSLLPRKSHIKTKNILLMPGSRQSEVKRLLPEMLLAAKIMLVQDP
FT                   MLTFHLALANDELLNWATTQVENIPVEISLGRAHACMLNVDLALVASGTATLELALVGV
FT                   PMVVVYKLSSVSYFIALILVKSKYISLPNIIANKNLVPELIQNNANGNNIAKHAMVIMS
FT                   RDNKTLIKEFNAIHQQLNLGSSDESARIIYEFINE"
FT   gene            126127..126963
FT                   /locus_tag="Rmag_0106"
FT   CDS_pept        126127..126963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0106"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: cbu:CBU_0098 nicotinate-nucleotide
FT                   pyrophosphorylase; TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01902"
FT                   /db_xref="GOA:A1AVE5"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVE5"
FT                   /protein_id="ABL01902.1"
FT                   /translation="MNLSTSKYILDSVALALAEDFGTGDVSADLFLNKTIISAEIISRE
FT                   FSVICGIEYAQSTFLLLDDKIKLDWKIKDGECISSGQILCILIGSSKAIISAERVALNF
FT                   LQMLSSVATKTHDLVSKINHTNAQLIDTRKTIPGLRLAQKYAVKCGGGVNHRMGLYDCV
FT                   MLKENHIIALGSITLAVKLAIEQYPNLPLIVEVEDLSQLQEVLILSGVARVLCDNFSIS
FT                   DLIQAVGLAKGKLPLEASGNINENNIVEVANTGVDFISTGSITKNIQAIDLSLRFI"
FT   gene            complement(126949..127707)
FT                   /locus_tag="Rmag_0107"
FT   CDS_pept        complement(126949..127707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0107"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /note="PFAM: inositol monophosphatase; KEGG: noc:Noc_2419
FT                   3(2),5 -bisphosphate nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01903"
FT                   /db_xref="GOA:A1AVE6"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVE6"
FT                   /protein_id="ABL01903.1"
FT                   /translation="MFDLLIPPLIRLTTQAGDMIMSLYKSELNIKIKSDETPLTIADKN
FT                   AHKLIIKTLSKLTPNTPILSEESEVIEFSERSKWHEYWLIDPLDGTRDFLEQTGEFCIC
FT                   IAYIKQHKPIFGMIYAPLSKTHYYTTDANNTFKQEGVIQTLNAHTNHHPLKIVIGHWSS
FT                   HNKQLQEHLGKYSAYKVSQLGSALKFCAIAEGRYDYYPKFGPCSEWDTAAGVCILQGAG
FT                   GSVVNQDGKPLSYNTKDNLTSPIFFASNKS"
FT   gene            complement(127740..127816)
FT                   /locus_tag="Rmag_R0005"
FT                   /note="tRNA-Met3"
FT   tRNA            complement(127740..127816)
FT                   /locus_tag="Rmag_R0005"
FT                   /product="tRNA-Met"
FT   gene            complement(127824..129626)
FT                   /locus_tag="Rmag_0108"
FT   CDS_pept        complement(127824..129626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0108"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; PFAM:
FT                   sigma-70 1.1 domain protein; sigma-70 region 3 domain
FT                   protein; sigma-70 region 2 domain protein; sigma-70 region
FT                   4 domain protein; sigma-70, non-essential domain protein;
FT                   sigma-70 region 1.2; KEGG: xfa:XF1350 RNA polymerase
FT                   sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01904"
FT                   /db_xref="GOA:A1AVE7"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVE7"
FT                   /protein_id="ABL01904.1"
FT                   /translation="MKSTTKAHKQSLQKLIMAGKEKGYLTYSEINDILPEDLLTQEQVE
FT                   PIVTILEELDIAVSDIVPDADTLVVESGAKAQSTSAEAAIAALAALDSEFGRTTDPVRM
FT                   YMREMGVVDLLEQEDEIRIAKEIEAGVFEIMKGITLYPVITDFFFKAHTRLEEGKCKMT
FT                   DVIIGYQGDTEDFAVKKAAFDAGKFDNDEEHEDMEYTGPDENQVYNRFETISKCSKTYN
FT                   ETNEKLGFRHKKTIEMRQQLSQSLSDLRLAPKLVNTMIEVICNRVEQVKKQEKTIQNKC
FT                   LDAGMNRLYFFESFSKNETNFDWLSAIKLDEKTEEKLKVSKDEIYYAQKNLQQFEEEMQ
FT                   LTITELKTLNKMYRRGDRRAKKAKSQMIEANLRLVISIAKKYANRGLQFLDLIQEGNVG
FT                   LMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRVRRQL
FT                   LQKFGREASPEELATEMELPEYKIIKILKISKEPLSMETPVGDDEDSNIGDFIEDTNLS
FT                   SPVEITTKESLRETTSELLSNLSPREAKVLKMRFGIDMNTDHTLEEVGRQFDVTRERIR
FT                   QIEAKALRKLRHPSRAHKLQSFLE"
FT   gene            complement(129728..130681)
FT                   /locus_tag="Rmag_0109"
FT   CDS_pept        complement(129728..130681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0109"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: tbd:Tbd_0387 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01905"
FT                   /db_xref="GOA:A1AVE8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVE8"
FT                   /protein_id="ABL01905.1"
FT                   /translation="MSLEKIKIFSGNANPELSGEIISNLNVVQGKALVGRFSDGESQVE
FT                   ILENVRGCDVFIIQPTCGPSPAETLMELLVIVDALKRSSATRITAVVPYFGYSRQDRRS
FT                   RLTRVPITAKLAAKMVESAGVDRILTVDLHADQIQGFFNIPIDNIYAQPVLIEDILSKN
FT                   YQDIVVVSPDVGGVIRARAAAKRLFDADLAIIDKRRPAPNMVKIMNVIGDVEGRTCILI
FT                   DDMVDTAGTLCQAAGILKQRGAKKVVAYTTHAVLSGNAIHNIRSSELNKLVTTNTIPLN
FT                   ADATNCSKIRQLSIAPTMAEVIKRISEEQSISTIFT"
FT   gene            complement(130754..130828)
FT                   /locus_tag="Rmag_R0006"
FT                   /note="tRNA-Gln1"
FT   tRNA            complement(130754..130828)
FT                   /locus_tag="Rmag_R0006"
FT                   /product="tRNA-Gln"
FT   gene            complement(130808..131665)
FT                   /locus_tag="Rmag_0110"
FT   CDS_pept        complement(130808..131665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0110"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="KEGG: nmu:Nmul_A0588
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01906"
FT                   /db_xref="GOA:A1AVE9"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVE9"
FT                   /protein_id="ABL01906.1"
FT                   /translation="MSSTWLAPAKINLFLHINNKREDGYHNLQTIFQMLDYYDELKFSI
FT                   TNGGVIKRINGNEDVEQSQDLIVKAAKVLQEYTGTTLGANLSIVKNIPIGGGLGGGSSD
FT                   AATTLVALNQLWDTKLTQPQLMKLGLNLGADVPVFIFAKSAWAEGIGEILSPIKMPNYY
FT                   YLVVFINKHTSTKEIFSHYALTMSKPQGKIAKFSELINTHNDCLQAAIALEAEIGVALK
FT                   HLNTCANHISQVRMSGTGSCVFNEFLTEKDALAAAKKVPKKWMSFVTRAINTSPIHSWA
FT                   VAKR"
FT   gene            complement(131658..132200)
FT                   /locus_tag="Rmag_0111"
FT   CDS_pept        complement(131658..132200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0111"
FT                   /product="Exonuclease, RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease, RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: psp:PSPPH_0557 oligoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01907"
FT                   /db_xref="GOA:A1AVF0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVF0"
FT                   /protein_id="ABL01907.1"
FT                   /translation="MNKKTNLIWIDLEMTGLIPEKDVIIEIATIVTNVQLHIIAQGPSL
FT                   VIHQNDEILSNMDQWNTEHHTSSGLLRRVRESSLSCKQAEAQTLEFLKKYVHTGASPMC
FT                   GNTICQDRRFLYNYMPTLERFFHYRHIDVSTLKELVIRWKPNAKMIFEKDSAHLALSDI
FT                   QDSIDELKHYRNVFINV"
FT   gene            complement(132215..133234)
FT                   /locus_tag="Rmag_0112"
FT   CDS_pept        complement(132215..133234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0112"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="TIGRFAM: anthranilate phosphoribosyltransferase;
FT                   PFAM: glycosyl transferase, family 3; KEGG: sde:Sde_0753
FT                   anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01908"
FT                   /db_xref="GOA:A1AVF1"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVF1"
FT                   /protein_id="ABL01908.1"
FT                   /translation="MNIQQAIKQIIKKQDLSENEMHKVMNDIMTGKTTDAQIGGFLVGL
FT                   AIKGESVDEITAAAKTMRSLVKSVTIKNTKHLVDTCGTGGDGLGLFNISTACTFVVAAA
FT                   GGSVAKHGNSSISSKSGSADVLKAAGVNLDMSVEKISKCIEKIGIGFMFAPFHHIAMKH
FT                   VIEPRKDLAIKTIFNVLGPLTNPAKVPNQVMGVYAQSLVEPIAYVLKNLGSKHVIVVHS
FT                   KDGLDEISIADDTFVAELKNGQVSTYTINPADFSLPLGNLNDIKANNADYSLVLIQQAL
FT                   DGKDGVAKNIIALNSGAAIYVCGLANSLQKGVNKALNILNSDVAHQKLDDFVRESTDC"
FT   gene            complement(133242..134456)
FT                   /locus_tag="Rmag_0113"
FT   CDS_pept        complement(133242..134456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0113"
FT                   /product="aminopeptidase P, Metallo peptidase, MEROPS
FT                   family M24B"
FT                   /EC_number="3.4.11.9"
FT                   /note="PFAM: peptidase M24; peptidase M24B, X-Pro
FT                   dipeptidase/aminopeptidase domain protein; KEGG:
FT                   aci:ACIAD1126 aminopeptidase P"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01909"
FT                   /db_xref="GOA:A1AVF2"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVF2"
FT                   /protein_id="ABL01909.1"
FT                   /translation="MIHQKRRHALLNELDDNAIVLVSTNPEKNRSGDVNYPFRVHSDFY
FT                   YLTGFQEPEALAVFSKENYTIFLRPKDKIREIWDGKRLGIDDAPNTLKSNHAFSIDLLK
FT                   EKLPQIILNNQVYFDTKTCQLDNDISRLLSNHQLKSLAPTLHEMRLIKDMLEINIMQKA
FT                   ANISIKAHQLAMQTIQPNMFEFEVQSIFDGYFTKNNAQHAYTPIIAGGENACILHYIEN
FT                   NKKLNKNDLILIDAGAEVDCYASDITRTFPVNGQFSRAQKQIYQIVLDAQINAINVIKP
FT                   GVKINEPHKVATNIIKQGLINLGILKTGADLSQFYMHGTGHWLGLDVHDVGQYKKDDHH
FT                   RKFVAGMITTVEPGIYIRKNDKISPIYHNIGIRIEDDVLVTTSGNTVLTKSLAKEINEI
FT                   ESLMS"
FT   gene            complement(135125..135394)
FT                   /locus_tag="Rmag_0114"
FT   CDS_pept        complement(135125..135394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01910"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVF3"
FT                   /protein_id="ABL01910.1"
FT                   /translation="MIKLAWWCVTNTNNQAEIGRFLLTKNLCVNAEVGKDIAHYLLEFL
FT                   PFTQNIEQLIDSTNLILQKDLINKEEKTKLWKQGQKNSNFGWFY"
FT   gene            complement(135363..135722)
FT                   /locus_tag="Rmag_0115"
FT   CDS_pept        complement(135363..135722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0115"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_2558 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01911"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVF4"
FT                   /protein_id="ABL01911.1"
FT                   /translation="MLSTEDILKLNVLIATSVAIRIDTYKLVVVGLNAKFKEQVIDLNP
FT                   TGDSDVYIKAVKKLLINQILGAMGGYISYLKRWSRIVEVASSNLALLLKLGEVEAVVAV
FT                   SNTTNFDKTGLVVCY"
FT   gene            complement(135981..136841)
FT                   /locus_tag="Rmag_0116"
FT   CDS_pept        complement(135981..136841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0116"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: tcx:Tcr_1837 pyrroline-5-carboxylate
FT                   reductase; TIGRFAM: pyrroline-5-carboxylate reductase;
FT                   PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01912"
FT                   /db_xref="GOA:A1AVF5"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVF5"
FT                   /protein_id="ABL01912.1"
FT                   /translation="MYIILFFQIFVMQNSLIGFIGAGNMAYAIISGLINNGIKHNQIKI
FT                   SDTNKALLSLRKTEFNLEVFTDNTKLAIQCNVIVLAVKPQVLSSVCKDLKNKLAINTLI
FT                   ISIAAGVRSRDIERWLGDNQAIVRTMPNMPALLNQGITGLFANKQVSDKQKSLAENILN
FT                   SVGECLWVNDEGLLDVITAVSGSGPAYFFLMLESMTKVGAALGLDEAVAQKLSIQTALG
FT                   ASIVASSSEDSPQQLRNKVTSKNGTTQAAIESFQDQDFEVIIAHAMRAAFNRANEIGME
FT                   LGNDK"
FT   gene            136881..137549
FT                   /locus_tag="Rmag_0117"
FT   CDS_pept        136881..137549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0117"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /note="KEGG: tcx:Tcr_0265 phosphoglycolate phosphatase;
FT                   TIGRFAM: phosphoglycolate phosphatase ; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 1; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01913"
FT                   /db_xref="GOA:A1AVF6"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVF6"
FT                   /protein_id="ABL01913.1"
FT                   /translation="MKIFNPKLIMIDVDGTLVDSAPDLAYCIDELMKVMNRTPWGEAKV
FT                   RHWVGNGVPKLVERSLTGEFEANVNKQDFNKAYPIFLELYSVNTSTRSCLYSGVKEGLN
FT                   YLKQQGYILGCVTNKAKQFTLPILKDLDIFNYFRLVVSGDTLAKKKPDPLPLLHSAEFF
FT                   NINPQDCLMLGDSISDVAASRAAGFEIICMSYGYNHGEDIQNANPDLVIDSMAELKDYL
FT                   "
FT   gene            137574..138812
FT                   /locus_tag="Rmag_0118"
FT   CDS_pept        137574..138812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0118"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   hin:HI1554 adenosylmethionine--8-amino-7-oxononanoate
FT                   transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01914"
FT                   /db_xref="GOA:A1AVF7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVF7"
FT                   /protein_id="ABL01914.1"
FT                   /translation="MNTFDNQHIWHPYAKIPNEVPAYLVESAKGVYLTLEGGKRVIDGM
FT                   SSWWSAIHGYNHPVLNKAIETQLGKMSHVMFGGLTHQPVIELTKTLLKITPDNLTKIFF
FT                   TDSGSVSVEVALKMALQYWHNKRQANKKKFITILGGYHGDTFGAMSVCDPDNGMHHLFS
FT                   SVLSQHFFVKSPSIVSMDEALADLEIILEQDANSIAAMILEPVVQNAGGMRIYNPQYLL
FT                   KAKALCKQYHVLFILDEIATGFGRTGQLFALEHVNVKPDILCLGKALTGGYMTLAATLT
FT                   TNGVSSVVGTLMHGPTFMANPLACAVANASIELLLNSPWQKNIANIEKILNAELLSLQK
FT                   HTQVKYVRILGAIGAIELIHEIDIQIIQKHLITLGVWLRPYGKLLYTMPPFIITDSELL
FT                   VITNAIKTIVSGL"
FT   gene            complement(138971..139252)
FT                   /pseudo
FT                   /locus_tag="Rmag_0119"
FT   gene            complement(140171..142135)
FT                   /locus_tag="Rmag_0120"
FT   CDS_pept        complement(140171..142135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0120"
FT                   /product="primosomal protein N'"
FT                   /note="TIGRFAM: primosomal protein N'; PFAM: helicase
FT                   domain protein; type III restriction enzyme, res subunit;
FT                   DEAD/DEAH box helicase domain protein; KEGG: cbu:CBU_1815
FT                   primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01915"
FT                   /db_xref="GOA:A1AVF8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVF8"
FT                   /protein_id="ABL01915.1"
FT                   /translation="MSLIVEVAIPIPLNKTFDYLCDDEVLVGVRVKVPFVRKKVIGIVL
FT                   AIRDKSNFYKLKSVEEVLDKTPILDKLTLSLLFWSANYYHHPIGEVISTALPKNLRLGK
FT                   KANIKKITGLPNQTKQSNFKLSDEQNIAITQILKSNYQYHAFLLHGVTGSGKTEVYLHT
FT                   TQAMLNQKKQVLVLVPEIGLTPQMITRFESRLKTRVVTIHSQLNETKKLDAYLMAKNGE
FT                   AGVVIGTRSAIFSPMPNLGLIIIDEEHDNSFKQQSNFRYCAKNLSFIRAKQANIPIVLG
FT                   TATPSLELLKNVMDQKITRITLTKRTGNATLPKISLIDMRSNTDGALSKMLIEKTKQYL
FT                   SAGKQVMLFINRRGYAPVYYCTQCSWKAQCDHCDSTMVYHRHINRLKCHHCGGEKMPEH
FT                   TCPDCFRQSLKVLGYGTERLEETLSSYFADTPIIRIDRDTTRRKKAFTRHLEQINAGKS
FT                   CIIIGTQMLAKGHDFSNLAMVGILDIDTGFLSLNFRATEYLAQLLIQVSGRAGRHKEKG
FT                   EVVIQTRYPDHPIFNFILSSHYTQFANQLLKQRLSAMMPPFSHQALLCANAKNKQNAEN
FT                   FLHEAVVLLKNIQINSVEILGPVINTIEKKSDYYYFNLYLQSNNRVTLHQMLSTFNQHI
FT                   NILKLKNKVRWYLDIDPIE"
FT   gene            142200..142637
FT                   /locus_tag="Rmag_0121"
FT   CDS_pept        142200..142637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0121"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   pae:PA3982 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01916"
FT                   /db_xref="GOA:A1AVF9"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVF9"
FT                   /protein_id="ABL01916.1"
FT                   /translation="MVVIQNIIHDSSINEYDLSNTLQEVIKELDRGESELLIRLVNETE
FT                   IKNLNKVYRHQDKLTNVLSFQSDLPIEIDEAVLGDVVICTQVVLKESIEQHKSFNNHLT
FT                   HMAIHGMLHLLGYDHIDTKDAQQMENLEIKILAKIGINNPY"
FT   gene            complement(142684..143856)
FT                   /locus_tag="Rmag_0122"
FT   CDS_pept        complement(142684..143856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0122"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase;
FT                   tRNA(Ile)-lysidine synthetase-like; PFAM: PP-loop domain
FT                   protein; KEGG: cbu:CBU_1509 mesJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01917"
FT                   /db_xref="GOA:A1AVG0"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVG0"
FT                   /protein_id="ABL01917.1"
FT                   /translation="MENLKTKDLFLKDKQIVLGLSGGIDSVVLLYYLNTHYPNKTRVIH
FT                   YNHHLSQYCNEWNKFCEKLCLSLNITYLSIDLYFNNTSNIEENTRKKRYHSLSNSLKKN
FT                   EVLCTAHHQNDQAETLLLQLFRGSGIKGLAAMPKEKPLGMGIHYRPFLTISKFQIIDYA
FT                   KNNKLNWIEDDSNKNTNFMRNFLRLEILPKLSGAYKNLTRTLARSAKHQSEALKLIREL
FT                   ADIDMNTYHIINNANRIDTNRLIKLETHRIKNVLRHHLNLLNFLTPSDKIMHQIIELLY
FT                   TKENTNPLVCWDKYEIRRYQNELYFINKTLPRKNAFCPFYKELKNFKNFSIRYRQEGQR
FT                   IKLLGKTHTQSLKKVLQEANIPPWERNRLKMYYIDNKLCAIERIGKISNI"
FT   gene            complement(143837..144787)
FT                   /locus_tag="Rmag_0123"
FT   CDS_pept        complement(143837..144787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0123"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, alpha subunit; PFAM: acetyl-CoA carboxylase,
FT                   alpha subunit; KEGG: noc:Noc_0848 acetyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01918"
FT                   /db_xref="GOA:A1AVG1"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVG1"
FT                   /protein_id="ABL01918.1"
FT                   /translation="MNLDYLDFEQPIVELEEKIQALDNIKDKADIVDEMGALKIKSNAL
FT                   TKKIFSSLSDWQISQLARHPKRLYTLDYISHVFDEFTELHGDRIYGDDHAIIGGIARLD
FT                   AQPVMFIGQQKGRTTQEKLKYNFGMPRPEGYRKALRLMKLSEKFSMPIITFIDTPGAYP
FT                   GIGAEERGQSEAIAKNLFEMSTLATPIISVVIGEGGSGGALAIGVADIIMMFKYSIYSV
FT                   ISPEGCASILYKDATKANLAAESLKLTSAHLKENGLIDIIIDEPLGGIHRDPSQAKVLL
FT                   KEALIQQLNEIKQLPIEQLLQNRQEKLLNFGKFKD"
FT   gene            145278..145955
FT                   /locus_tag="Rmag_0124"
FT   CDS_pept        145278..145955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0124"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47; KEGG:
FT                   pae:PA5208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01919"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVG2"
FT                   /protein_id="ABL01919.1"
FT                   /translation="MAKNIIDGLFGKSPISPLQKHMTQVHSCILELNGFMVAIHVQNWA
FT                   QAEKIRSDIGAKEGEADILKKKLRLSLPSTFMMPFSRRDLLDLLLIQDSIANITKDVSG
FT                   LMINRKMALPDEIFDDVIELTKVCIKTSSMALKAVNELDELLETAFGSRERKVIGSIIK
FT                   DVNKLESKSDKIQYEIRAKLFPLESSLPPVDVMFYYRAVEWLGELADAAQKVGSRLEVL
FT                   LAR"
FT   gene            145966..147246
FT                   /locus_tag="Rmag_0125"
FT   CDS_pept        145966..147246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0125"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: csa:Csal_0712
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01920"
FT                   /db_xref="GOA:A1AVG3"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVG3"
FT                   /protein_id="ABL01920.1"
FT                   /translation="MDVVVNYADIFIMLAIGFGLFMAWGIGANDVANAMGTSVGSGAIT
FT                   FRQAVVIAIVFEFAGAILAGGEVTATIRKGILDAALFTDSPHLLVYGMLASLLAAGTWL
FT                   LIASSLGWPVSTTHSIVGAIVGFGAVGVGVDAVAWDKVIKIIMSWVASPVLAGTLAIII
FT                   FKSLQSLVIDTKDLLANAKKYLPFYVFFVGFIIALVTLFKGLKHVESLKYISKDTSLSM
FT                   MIAVTVGILAAVIAAFLMKHIKIDPKDDKDFHYANMEKLFAVLMVITASAMAFAHGSND
FT                   VANAIAPLAAVYSIVEVGGGITSKSVVPSWILLVGGGGIVFGLVTYGFRVMKTIGKGIT
FT                   ELTPSRGFAAELAAATTVVLASSTGIPVSTTQVLVGAVLGVGIARGVAALNMRVINMIF
FT                   LSWLITLPAGAIMSILFFFALKGVFGA"
FT   gene            147250..147480
FT                   /locus_tag="Rmag_0126"
FT   CDS_pept        147250..147480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0126"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: mca:MCA0260
FT                   toluene-tolerance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01921"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVG4"
FT                   /protein_id="ABL01921.1"
FT                   /translation="MTLEEIQAKIQMGIKNSTVTMGGDGCSCSTKVVSSIFEGMPLLAR
FT                   QKMVLAVMNEEITNGTLHALSIKTRTPEEDV"
FT   gene            147921..149225
FT                   /locus_tag="Rmag_0127"
FT   CDS_pept        147921..149225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0127"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; KEGG: tcx:Tcr_0779 DEAD/DEAH box
FT                   helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01922"
FT                   /db_xref="GOA:A1AVG5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVG5"
FT                   /protein_id="ABL01922.1"
FT                   /translation="MDFSKLGLSDSILKAIEQQGYREPSLIQAQAIPAILEGKDVMAAA
FT                   QTGTGKTAGFILPILEILSKCSPIKFNQVRMLILTPTRELAAQVSDSVTIYGKYLSFKS
FT                   SVVFGGVKINPQMRKLRDGVDILVATPGRLLDLYSKNAVKFDTLEIIVFDEADRMLDMG
FT                   FIHDIKRILKILPQKKQTLMFSATFSNDIRILAKSLVNNPVEISVTPRNSTVKTVKQWI
FT                   HPVDKFKKQALLIYLIQEHSWYQVLVFSRTKHGANRIATQLEKKKISATVIHGNKSQGA
FT                   RTRALADFKNAKVNVLVATDIAARGIDIDQLPHVVNFDLPRVPEDYVHRIGRTGRAGSK
FT                   GEAISLVSVDEAKQLFDIERLIQNKLDRIMVEGFVPEYNLPESGKKILSPKTKKNKNYN
FT                   KLKYGKNRNSKKNKLNNKKGFLDSKFNKKSTRKII"
FT   gene            complement(149876..150919)
FT                   /locus_tag="Rmag_0128"
FT   CDS_pept        complement(149876..150919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_2337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01923"
FT                   /db_xref="GOA:A1AVG6"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVG6"
FT                   /protein_id="ABL01923.1"
FT                   /translation="MKEKKYLYIFSLLIILLIGFHFITWNLITKEFFIHKENIDVGDLG
FT                   RMSYLSKSLTLRKNKQNLPNKHIQYNDNVEIDILTIGDSFSYGKGGGNNKYYQDYIATT
FT                   QNLKVMNIQPSGKGYIETILILSSNGILDKLNPKSIILQSVENGAVDRYAKIIDWDIGL
FT                   KNISTSFLDKKYSHSKPNPSFINNLNYNALLYSLLYKYDDNAIFSKTYITPLIKNLFSC
FT                   EDKDRLLFYYKDLESLSKSNNKSIDLLNKNLNKLQKILSEKNINLYFMPSVDKYNLYSK
FT                   YIQHNKYQQSAFFEILRPLKKEYNFIDTKMILEEMLDNNISDVYYCDDTHWSFKASEEI
FT                   FKQVRLK"
FT   gene            complement(150928..152394)
FT                   /locus_tag="Rmag_0129"
FT   CDS_pept        complement(150928..152394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0129"
FT                   /product="membrane bound O-acyl transferase, MBOAT family
FT                   protein"
FT                   /note="PFAM: membrane bound O-acyl transferase, MBOAT
FT                   family protein; KEGG: bcz:BCZK0793 alginate
FT                   O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01924"
FT                   /db_xref="GOA:A1AVG7"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVG7"
FT                   /protein_id="ABL01924.1"
FT                   /translation="MLFNSYEFIFVFLPITFFIYFYLNHKRLTEASKGFLVCSSLFFYS
FT                   WWNVAYLPIILSSMVFNYVIGRSLNKTCKNKSKGFSKKSILIFGIVFNLSLLGYFKYTD
FT                   FLIENFNLAFGSNAELLQLALPLAISFFTSQQIAYLVDSYRQETKEYDFLNYVLFVTFF
FT                   PQLIAGPIVHHKEMMPQFANTRNKVKNYRNIAMGLFIFSIGLFKKVVIADTFAVWATQG
FT                   FDVATTLNLFEAWATSLSYTFQLYFDFSGYTDMAIGLALLFNIRLPVNFNSPYKATDIQ
FT                   DFWRRWHMTLSRFMRDYVYIPLGGNKKGKFRTYNNLMATFVIGGLWHGAGWTFIFWGFL
FT                   HGLALMVQRFWSKLGFKLWIWLAWLITFNFVNIAWVFFRAREWDDAVKVLGSMFSLDNI
FT                   VIKETFSNKLNFLSEYNIQFGEVMKMTNDGSDVIKWIIFGFILILVFKNSLEKTNKFKS
FT                   NIWHLLIHVIVLFTALTSLNTVSEFLYFNF"
FT   gene            152860..153246
FT                   /locus_tag="Rmag_0130"
FT   CDS_pept        152860..153246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01925"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVG8"
FT                   /protein_id="ABL01925.1"
FT                   /translation="MGYLLILSRKLEKKMSKPIIENNYSLTNFEYAVYRCELVSKSQTH
FT                   LVAFKNGCSEITSELDMEVASIFANLDSYININLNNILSKFLSDKTKSFVLADDELKLL
FT                   AVLRLENNSEITAKMDEYGKRKDC"
FT   gene            153995..154440
FT                   /pseudo
FT                   /locus_tag="Rmag_0131"
FT   gene            complement(154782..155966)
FT                   /locus_tag="Rmag_0132"
FT   CDS_pept        complement(154782..155966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0132"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase, class Ib; RNA-binding S4 domain
FT                   protein; KEGG: ftl:FTL_0968 tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01926"
FT                   /db_xref="GOA:A1AVG9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVG9"
FT                   /protein_id="ABL01926.1"
FT                   /translation="MEIEQALAIFTRGADETLPLDELKKKLKKSKPLRIKTGFDPTAPD
FT                   LHLGHTILINKLKQLQDLGHEILFLIGDFTAMIGDPTGKSKTRPPLSREQIQENAKSYT
FT                   KQVFKILDKDKTTVVFNSQWMDKMTSMEFIQLASKQTVAKMLEHDNFSKRYKSGQAISI
FT                   HEFLYPLVQGNDSVELKSDVEIGGTDQKFNLLVGRELQKQAGQEQQVILTMPILEGLDG
FT                   VQKMSKSLNNYIGIDDTPDEMFGKIMSISDELMWRYFELLSFQSLKVITDLKQAMMQGK
FT                   NPRDIKFILADEIITRFHNIDTAKQMQQNFIDRFSKNQMPDEMDKFSFKAGIKIANLLK
FT                   DTGLCSSTSNAYQMINQGGAKINGKKITDKNLELETGTNIYQVGKRKFARVTIQ"
FT   gene            complement(155972..157231)
FT                   /locus_tag="Rmag_0133"
FT   CDS_pept        complement(155972..157231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0133"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; KEGG:
FT                   hch:HCH_05847 gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01927"
FT                   /db_xref="GOA:A1AVH0"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVH0"
FT                   /protein_id="ABL01927.1"
FT                   /translation="MDSIKNLIVTLGENAKNAAKTLRCATTVAKNNTLINIASQIDQNR
FT                   ASIFKANNQDLVNGKNKGLETTLLDRLMLDEERLNGVIESLNQIINLPDPIGEITDLKY
FT                   QPSGIQVGKMRVPLGVLGIIYESRPNVTIDAAALCLKSGNSVILRGGSEAIHSNYALYT
FT                   CVRQGIKQAGLNENCAQLINTQNHEAVIELVKASDYVDAIIPRGGKGLVEAISNSAKTP
FT                   VIKHLNGICHTYIDKDADKKKAISIAFNAKTRRYGVCNATETLLVHACAVSRILPKLIA
FT                   QYLTKGVELRGCKETLKLSNKIIAATEKDWNTEYLDAILSIRIVNSMSEAIKHIDKHGS
FT                   GHTESIVSENYTRSRRFITEVDSASVMINASTGFADGFEYGLGAEIGISTDKFHVRGPV
FT                   GLEGLTSQKFIVLGDGHIRQ"
FT   gene            complement(157219..158238)
FT                   /locus_tag="Rmag_0134"
FT   CDS_pept        complement(157219..158238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0134"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: pfl:PFL_5441 DNA polymerase III, delta
FT                   subunit; TIGRFAM: DNA polymerase III, delta subunit; PFAM:
FT                   DNA polymerase III, delta"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01928"
FT                   /db_xref="GOA:A1AVH1"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032780"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVH1"
FT                   /protein_id="ABL01928.1"
FT                   /translation="MKIKPQQLNIQLVNKLDTIYFIFGAEILLIEQSLAQINKTAKKVG
FT                   FDERISFDIDANFDWNQIFREISAVSLFSPKCIIKCRLKTGKIGIKGAKALTEIASTLP
FT                   DDILLIVSTGKLDMAQQKSKWFKTLEQLGTVVQHFEMQSNHLVDWIANHMAELGLEANT
FT                   EIAQSIAFCTEGNLTASMQEIQKLKMAYPNGKINTQEYLEQANQQSKYTVYGLIDAALF
FT                   GNSNQVNKIYQTLISDTIMPIQLSNSLYLEIKSIIEMSVELIQVKNINIVLQNNRVWNK
FT                   RKPIITNILKRHSYQRLQKLLLSLGRIDRSIKGMDNLNVIDELHTLLLSLAGKTQWTQ"
FT   gene            complement(158228..158680)
FT                   /locus_tag="Rmag_0135"
FT   CDS_pept        complement(158228..158680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01929"
FT                   /db_xref="GOA:A1AVH2"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVH2"
FT                   /protein_id="ABL01929.1"
FT                   /translation="MSKINLLTTAIIIILLSSCGFHPPYKNSEINASITSSRNNAFADE
FT                   LQKRFNQNIPQTLVVQVGTENQNQRTALYTSNNEASSYTLSLSIPIKVFNQRKKLLLSQ
FT                   TFNANTYLNKMNVSQANRLQIEEGYQQLRHLIIKQLLRKLFKLNEN"
FT   sig_peptide     complement(158600..158680)
FT                   /locus_tag="Rmag_0135"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.699) with cleavage site probability 0.419 at
FT                   residue 27"
FT   gene            158830..160752
FT                   /locus_tag="Rmag_0136"
FT   CDS_pept        158830..160752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0136"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /note="KEGG: mca:MCA1848 cell division protein FtsH;
FT                   TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase, central domain protein;
FT                   peptidase M41, FtsH extracellular; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01930"
FT                   /db_xref="GOA:A1AVH3"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVH3"
FT                   /protein_id="ABL01930.1"
FT                   /translation="MFKNLLLWLVLGSVLTSIFSQFQVGDQKDDITYSQFIQSVNQGDV
FT                   SQVTIAGSNITGVGVGGEQFSTYSPGDLGLMGDLLNNGVNVVAKPPEKDGFFKQLIISL
FT                   APILLLIGVVLYTMKGAGGAMGGKNPMSFGKSKARLITKDESDTTFDDVAGVDEAKDDV
FT                   SELVDFLSNPGKFTKVGGKIPKGVLLVGPPGTGKTLLAKAIAGEADVPFFFISGSDFVE
FT                   MFVGVGASRVRDMFEQAKKNAPCIIFIDEIDAVGRQRGAGMGGGHDEREQTLNQMLVEM
FT                   DGFEGSEGVIVIAATNRPDVLDPALLRPGRFDRQVMVDLPDINGRDAILKIHMRKLPIA
FT                   KNVKSINIAKGTPGFSGADLANLTNEAALIAAGKGKKLVGMQEFEKAKDKIMMGSERKS
FT                   MAMDETEKEMIAYHEAGHAIVGRLVPEHDPVYKVSIIPRGRALGVTMFLPEKDSYSISK
FT                   RKLNSQVASLFGGRIAEELIYGTDNVTTGASNDIERVTEIAHKMVKQWGMSETLGPLAY
FT                   GEEEGEVFLGRQVTKHKHVSEDTFKVIDVEIRKIIDSNYQMASKILKDNKDILIEMSKA
FT                   LIEFETIDKEQIDDLMDRKPIRESAVIVDSDVASIELGSGVELNNGNKDSDEKPLSGGT
FT                   TEQVA"
FT   sig_peptide     158830..158907
FT                   /locus_tag="Rmag_0136"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.753 at
FT                   residue 26"
FT   gene            160794..161594
FT                   /locus_tag="Rmag_0137"
FT   CDS_pept        160794..161594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0137"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: cps:CPS_3451 dihydropteroate synthase;
FT                   TIGRFAM: dihydropteroate synthase; PFAM: dihydropteroate
FT                   synthase, DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01931"
FT                   /db_xref="GOA:A1AVH4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVH4"
FT                   /protein_id="ABL01931.1"
FT                   /translation="MQSTNAMIMGVLNITPDSFSDGGQYLAIDKAINQAQLMIEQGADM
FT                   IDIGGESSRPNAPKVSTDDEASRVIPVIKVLSKLISVPISIDTAKAKIMQLAIEAGASM
FT                   INDVRALQAKSSLEVAASTGKDVCLMHMQGNSKTMQNNPVYINVIDEIKYFFDQRVEAC
FT                   INAGINQNKIILDPGFGFGKTFNHNLEILRSLDEFKSFGLRILVGMSRKSMVGSMLNSR
FT                   NINGRVIGSVTTAIIASQNGADIVRVHDVLETKDAFKVLQSVAG"
FT   gene            161599..162924
FT                   /locus_tag="Rmag_0138"
FT   CDS_pept        161599..162924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0138"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase C terminal;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: mca:MCA1847 phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01932"
FT                   /db_xref="GOA:A1AVH5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVH5"
FT                   /protein_id="ABL01932.1"
FT                   /translation="MDNYFGTDGMRGKVGVEPITADFFLKLGWAVGSVLAKRAKASVII
FT                   GKDTRVSGYLFESALEAGFLSAGVDVGLLGPMPTPAVAYLTQTYNASAGVVISASHNNF
FT                   QDNGVKFFSAKGLKLSSQYQSEIEKKLAETMISVGADKIGKAYRYEQPLGRYIEFCKST
FT                   FDRTQSLLGLNIVIDCANGATYHIAQSVFSELGANINIINNTPDGFNINEHCGATDTKY
FT                   LQQVVLESKADLGIAFDGDGDRLIMIDENGELVDGDELVFIIAKAWQSQGRLVNNTVVG
FT                   TKMSNLGMHHALRDLDIKFIEADVGDRFVMEKMQKSGSILGGEGSGHIICLNKTTSGDG
FT                   IISALQVLEVLVKSQSSLAKLKQSMEKYPQILINVKTQARINLKNYTKLQRTQLAVEQT
FT                   LGDESRVLIRVSGTEPLIRVMVEAKDKIIAQQGAEKLSNIFK"
FT   gene            165052..165627
FT                   /locus_tag="Rmag_0139"
FT   CDS_pept        165052..165627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0139"
FT                   /product="electron transport complex, RnfABCDGE type, A
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   A subunit; PFAM: RnfA-Nqr electron transport subunit; KEGG:
FT                   noc:Noc_0970 electron transport complex, RnfABCDGE type, A
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01933"
FT                   /db_xref="GOA:A1AVH6"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVH6"
FT                   /protein_id="ABL01933.1"
FT                   /translation="MNEYVLILVSTILVNNFVLVKFLGLCPFMGVSKKIDTAIGMGFAT
FT                   TFVLTLASIFSYLINTYILLPFEIEYLRTISFIVTIAGVVGFTELVVNKTSPILHQSLG
FT                   VFLPLITTNCAVLGVALLNVNQDNGFLASGVYGFGAAIGFSFVLVLFSAMRERIDVVDV
FT                   PEAFKGTPVALITAGLMSMAFMGFIGLV"
FT   gene            165614..166153
FT                   /locus_tag="Rmag_0140"
FT   CDS_pept        165614..166153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0140"
FT                   /product="electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   B subunit; PFAM: 4Fe-4S ferredoxin, iron-sulfur binding
FT                   domain protein; Fe-S cluster domain protein; KEGG:
FT                   tbd:Tbd_2016 electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01934"
FT                   /db_xref="GOA:A1AVH7"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR016463"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVH7"
FT                   /protein_id="ABL01934.1"
FT                   /translation="MDLSELFDSVLILSILTLILGSILGYAGIKFKLKTNPLVDQIDAI
FT                   LPQTQCGQCDYPGCRPYAQAISIGEAKINQCPPGGQEGADALAELLGVETLVLNAEHGE
FT                   LKPNHVVFVDEAVCIGCTLCIQVCPVDAFLGASKMMTQVIIDECTGCDLCIPVCPVDCI
FT                   HVQEITVSNIFKVKHG"
FT   gene            166146..167639
FT                   /locus_tag="Rmag_0141"
FT   CDS_pept        166146..167639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0141"
FT                   /product="electron transport complex, RnfABCDGE type, C
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   C subunit; PFAM: 4Fe-4S ferredoxin, iron-sulfur binding
FT                   domain protein; Respiratory-chain NADH dehydrogenase
FT                   domain, 51 kDa subunit; KEGG: noc:Noc_1173 electron
FT                   transport complex protein RnfC"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01935"
FT                   /db_xref="GOA:A1AVH8"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVH8"
FT                   /protein_id="ABL01935.1"
FT                   /translation="MDDYSFNGGIVIRNPYPVDKMEIIQAPLPKKVIISLQQCIGEHAK
FT                   PCVSVGDYVLTGQVIASAEGSFGVFIHASISGVVLSIDKQVISHKSGVKFECITIESDD
FT                   KDKWIDNEGCGVDFLHSPVQTMIDCIQKSGIVGLGGAGFPTHVKLGKIKQCHTLIINGT
FT                   ECEPGVMCDNALMQFYPREIIRGVEILLYICGAERAIIAIEDDKQVAYQALLMFNHNDR
FT                   ISINQISTKYTSGAEKLLIKALLGVEISTGGFAVDKGIVCQNVATTKAVFDAVVDHKPL
FT                   VSRIVTVTGSGVKPNNFEVRLGASFESLISIASPSQKAHDYRMGGMMMGVDVTDIQAPI
FT                   CKITNAIFVSNHIQKPAIQECIRCGKCSEVCPVKLLPQQLYWHTKSENIEKALNYNLAD
FT                   CIECACCDYVCPSHISLANYFSFAKTLNKQQTREQDRINIARERFEFREYRLERNKLER
FT                   AQMMVDKKKALKEKMVKDQSQKQKIAEAVQRVQQTKNKK"
FT   gene            167669..168583
FT                   /locus_tag="Rmag_0142"
FT   CDS_pept        167669..168583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0142"
FT                   /product="electron transport complex, RnfABCDGE type, D
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   D subunit; PFAM: NQR2 and RnfD family protein; KEGG:
FT                   eca:ECA2279 electron transport complex protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01936"
FT                   /db_xref="GOA:A1AVH9"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVH9"
FT                   /protein_id="ABL01936.1"
FT                   /translation="MMRQVIYALVLGVMVAYYFFGWGILLQIALGAVTAIVVESVFIAL
FT                   RNRDIINSISDGSAVLTGILLAISIPSIAPWWVIVMGVSFAIIFGKQLYGGLGNNLFNP
FT                   AMLGYVFLLISYPLQMSTWQVDFLSFTQALKVIFDLSNIDVISGATKLDEVKNGLSLVG
FT                   SIQQLELHSPSQAWINVGFLFGGLYLFLKKVIFWQIPVAFLVGIVISSILLFVGNTDLY
FT                   LPTQNHLMLGGTMLGAFFIATDPVSASTTPKGRIIYGFLIGVLIVIIRTFGGYPDGVAF
FT                   AVLLINMTVPLIDSFTQPKVFGR"
FT   gene            168583..169191
FT                   /locus_tag="Rmag_0143"
FT   CDS_pept        168583..169191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0143"
FT                   /product="electron transport complex, RnfABCDGE type, G
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   G subunit; PFAM: FMN-binding domain protein; KEGG:
FT                   tcx:Tcr_1032 electron transport complex, RnfABCDGE type, G
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01937"
FT                   /db_xref="GOA:A1AVI0"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVI0"
FT                   /protein_id="ABL01937.1"
FT                   /translation="MLHAILKSGALLFVFTVVSVFFVSLTQTNTKDVITYNEKQLLIQR
FT                   LGELVSDYSNDILADQYTKTLKLHNVTQVVNIYPAKKNHKIFSYLIEHTYPNGYNGDIR
FT                   LLTGVGVDKKLLGVRVIIHKETPGLGDKIELKKSNWIEQFFGLSLSNPSMENWKVKRDG
FT                   GVFDAFTGATITPRAIVTATYQVLELLNEPCLLSKTPCN"
FT   sig_peptide     168583..168663
FT                   /locus_tag="Rmag_0143"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.970) with cleavage site probability 0.786 at
FT                   residue 27"
FT   gene            complement(170121..170891)
FT                   /locus_tag="Rmag_0144"
FT   CDS_pept        complement(170121..170891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_0902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01938"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVI1"
FT                   /protein_id="ABL01938.1"
FT                   /translation="MKNPIVVLGIGELGSVFSRAFLKNNYPVYPITRQTNIDKLVNTIS
FT                   PEFILVCTAEADLQNALQSIPKQWKDRVVMMQNELLPRDWQTHNFINSTVISVWFEKKK
FT                   GMDSKVLISSPTYGKKAQILIDSLALIDIPAHTLNSEKMLLFELVLKNLYILTTNIAGI
FT                   AIEKGATVNDLHNQYLNLMRDVSSDVLKLQSALTGKSFNERDLEQGMIKAFEGDLTHNC
FT                   MGRSAPARLKRALELAKVFNLSVPTLEKIESKYF"
FT   gene            complement(170888..171757)
FT                   /locus_tag="Rmag_0145"
FT   CDS_pept        complement(170888..171757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0145"
FT                   /product="succinyl-CoA synthetase (ADP-forming) alpha
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase; KEGG: noc:Noc_0714 succinyl-CoA
FT                   ligase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01939"
FT                   /db_xref="GOA:A1AVI2"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVI2"
FT                   /protein_id="ABL01939.1"
FT                   /translation="MSVLIDKNTRVITQGFTGKQGTFHSEQSITYGTQFVGGVTPNKGG
FT                   QKHLNFPVFNTVAEAMNATNANASMIYVPPQFAYVSILEAIEAQMPVIVCITEGIPIQD
FT                   MLKIKAILKTSDSILIGPNCPGVITPDECKLGIMPGNIHQNGSVGVISRSGTLTYEAVH
FT                   QTTQSGLGQSTCIGIGGDPIQGMSFVDCLALFEMDPQTQSIIMVGEIGGSAEEEAAEYI
FT                   QSNVSKPVVSYIAGLSAPKGKRMGHAGAVINASTGKAIDKINALKKVGVAIAPTPATMG
FT                   KTLLEILA"
FT   gene            complement(171754..172914)
FT                   /locus_tag="Rmag_0146"
FT   CDS_pept        complement(171754..172914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0146"
FT                   /product="succinyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="KEGG: sha:SH1668 succinyl-CoA synthetase (beta
FT                   subunit); TIGRFAM: succinyl-CoA synthetase, beta subunit;
FT                   PFAM: ATP-citrate lyase/succinyl-CoA ligase; ATP-grasp
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01940"
FT                   /db_xref="GOA:A1AVI3"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVI3"
FT                   /protein_id="ABL01940.1"
FT                   /translation="MHIHEYQAKTLFRCRDIQIPKGILIDNTTKINDVCKALGGDVWVV
FT                   KAQIHAGGRGKGGGVIFCHSIEKVERVCNQLLGSKLITPQTDAKGLPVGQLLIEAKQNI
FT                   ERELYLSLLIDRQTHKITVLSSTKGGMDIEKVASKTPDKIIKFGIDPLGSLSVQDCTFL
FT                   AKKLGFNTELTKQFNNTLLSLYEIFTQKDVNLIEINPLIITQENKLLALDGKIDFDDNA
FT                   LYRHKDIAKLRDISQEDEKERLASEYQLNYILFDGNIGCMVNGAGLAMATMDLIEHFGG
FT                   SPANFLDVGGGTTADRVAKAFELIQTETNVKSILVNIFGGIVHCDLIAQGILQAIKTVG
FT                   LTLPIVVRLEGTNAPEGLNLLNKSKFNIHVESDLTKAAIKIVKLTK"
FT   gene            172969..173532
FT                   /locus_tag="Rmag_0147"
FT   CDS_pept        172969..173532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0147"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /note="TIGRFAM: translation elongation factor P; PFAM:
FT                   Elongation factor P/YeiP protein; Elongation factor, KOW
FT                   domain protein; KEGG: tcx:Tcr_1741 translation elongation
FT                   factor P"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01941"
FT                   /db_xref="GOA:A1AVI4"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVI4"
FT                   /protein_id="ABL01941.1"
FT                   /translation="MVNYAINQFKNGLKLILDGNPCSIVNNEIVKPGKGQTFNRVKFKD
FT                   LITGKTLIKTFKSGETLEGADVMELDLQYLYNDGNTWNFMDLDSFEQYTIDNATMNDAK
FT                   GYLVEQDMCTVTLWNDNPISVIPPNHVILEVLNTDPGLKGDTAGTGGKPATMNTGVVVQ
FT                   VPLFVDIGDKVKVDTRTNEYVGRA"
FT   gene            173595..174476
FT                   /locus_tag="Rmag_0148"
FT   CDS_pept        173595..174476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0148"
FT                   /product="tRNA synthetase, class II (D, K and N)"
FT                   /note="PFAM: tRNA synthetase, class II (D, K and N); KEGG:
FT                   cps:CPS_4763 conserved hypothetical protein TIGR00462"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01942"
FT                   /db_xref="GOA:A1AVI5"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVI5"
FT                   /protein_id="ABL01942.1"
FT                   /translation="MQGNIALIKRQRVIQKIRQFFEQQAVLEVQTPTLINTPTSDAYID
FT                   SISLSVNANIGMQNTQYLHTSPELEMKKLLVQGSGDIYQICQVFRDNEYGEHNSNEFTL
FT                   LEYYRLGFDINQLMADMVNLLQTLGIQDKVHQLSYAQVFSQYADIDVLNTDFDVLKVIA
FT                   SKLGLSTDFAWIEELQMLLFVHLVEPKLKNIPLCFIYDYPKSQSAFAKVKNQVAHRFEL
FT                   YLNGIEVANGYDELQTKDEYQQVFTCETIKRKQLGKPISQIGVSFLSKLNKSLPQCSGV
FT                   AIGINRLLTQIS"
FT   gene            174527..175771
FT                   /locus_tag="Rmag_0149"
FT   CDS_pept        174527..175771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0149"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: lpf:lpl1180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01943"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVI6"
FT                   /protein_id="ABL01943.1"
FT                   /translation="MIKLIYLVLLFSFPIQALQILQPINDNQAVQQQLEAPQLNAPLSV
FT                   KQLLTQLKKSAKLGDARSQFSLANMYHNGINVIVDDKLAFYWYLQVAEQGYVSAQFNVA
FT                   NSYYYALGTDKDLEQALHWYKKSALLGYRAAQLNLAKLYDVGIGVDRDLTLAQRWYEAA
FT                   ANQFDPEAQFYLADFYEREGDSSKALDYYKKSANQGFVNAQVRLSALYRIGYLVKQSDI
FT                   KALYWTLIASNQTVKLLKKLSSKSQKVVQNKQEKSVIHQSIIKPIVIIEPIMVKTPQQS
FT                   TINLNEQLFSNIDRLIPSQDEISKSLNYNTKLNTNLEILLTSVGQNNPIVQYNLSALYS
FT                   KDGIVRKDNRAAFILMRQSANQGIIQSQNILAIMYMNGIGVQIDHNKAYYWANVTAQKG
FT                   SQQGKRILLYLIANL"
FT   sig_peptide     174527..174580
FT                   /locus_tag="Rmag_0149"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.702) with cleavage site probability 0.598 at
FT                   residue 18"
FT   gene            175836..176161
FT                   /pseudo
FT                   /locus_tag="Rmag_0150"
FT   gene            176434..177645
FT                   /locus_tag="Rmag_0151"
FT   CDS_pept        176434..177645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0151"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="PFAM: argininosuccinate synthase; KEGG: sde:Sde_2423
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01944"
FT                   /db_xref="GOA:A1AVI7"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVI7"
FT                   /protein_id="ABL01944.1"
FT                   /translation="MNKINIKKVVLAYSGGLDTSIIVKWLQDTYRCEVVTFTADIGQGE
FT                   EVELARTKAKAAGVKEVYIENLREEFVRDFVFPMFRANAIYEGEYLLGTSIARPLISKR
FT                   LVEIAHQEDADAISHGATGKGNDQVRFELNAYALDADIQVIAPWREWDLSSRESLMDYA
FT                   QKHGIEIDYKKQLKKSPYSMDANLLHISYEGGILEDPWAEPEEDMWRWTVSPENAPNKA
FT                   EYVEITFKKGGIIAINGKTMSPASVMEDLNKRAGAHGIGRNDIVENRFVGMKSRGCYET
FT                   PAGTVMLKAHRAMESLTLDQAAAHLKDELMPKYAEMVYNGFWFAPERKMLQAAIDNTQE
FT                   IVNGIVRLKFYKGNVTVVGRQSKDSLFSEKIATFEDDEGAYNQKDAAGFIKLNALRLRL
FT                   KALK"
FT   gene            complement(177719..177792)
FT                   /locus_tag="Rmag_R0007"
FT                   /note="tRNA-Cys1"
FT   tRNA            complement(177719..177792)
FT                   /locus_tag="Rmag_R0007"
FT                   /product="tRNA-Cys"
FT   gene            complement(177865..177940)
FT                   /locus_tag="Rmag_R0008"
FT                   /note="tRNA-Gly2"
FT   tRNA            complement(177865..177940)
FT                   /locus_tag="Rmag_R0008"
FT                   /product="tRNA-Gly"
FT   gene            complement(177993..178577)
FT                   /locus_tag="Rmag_0152"
FT   CDS_pept        complement(177993..178577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0152"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number="2.7.8.5"
FT                   /note="TIGRFAM: CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; KEGG: aci:ACIAD0342
FT                   CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase (phosphatidylglycerophosphate
FT                   synthase) (PGP synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01945"
FT                   /db_xref="GOA:A1AVI8"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVI8"
FT                   /protein_id="ABL01945.1"
FT                   /translation="MTTIPNILTLSRIFLIPVFVSLYYFQPAYSIMPVFTWINFLLTGT
FT                   YVLISATDYFDGYLARRLNMTSQLGAFLDPVADKLMVSTALILLVDFYPTDTHWYISVC
FT                   ALIIISREILVSALREWMGAIGQRSNVSVSWMGKVKTFVQIFAILFLLYQQPFFGLPSF
FT                   KIGVVLLLIATSLTLWSGFIYLKEGRKTFNN"
FT   gene            complement(178612..178688)
FT                   /locus_tag="Rmag_R0009"
FT                   /note="tRNA-Arg4"
FT   tRNA            complement(178612..178688)
FT                   /locus_tag="Rmag_R0009"
FT                   /product="tRNA-Arg"
FT   gene            complement(178742..179995)
FT                   /locus_tag="Rmag_0153"
FT   CDS_pept        complement(178742..179995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0153"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: par:Psyc_2052 probable
FT                   UDP-N-acetylmuramoyl-tripeptide-D-alanyl-D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01946"
FT                   /db_xref="GOA:A1AVI9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVI9"
FT                   /protein_id="ABL01946.1"
FT                   /translation="MLQTTTSTIAKILKTDCTTNVEFKDVCTDTRKHMNGALFLALTGD
FT                   NFDAHDYIDQAQQMGAVAIVANKPVNNQLPTLVVDDTQIALNTIASWHLKNIKPIVIAI
FT                   TGSNGKTTTKNMLANILNLQAPTLKTQGNLNNHLGVPMTLLTLEEQHQYAVIEMGANHL
FT                   GEIAHLCSLVNPNIAIVTNTLDAHIGEFGGFDNLVKAKGEIYSNNSHNIVNTQDTFTGD
FT                   VSFGKGGDIFASKLVNNKFDLNIYKQKISVTLNLIGTHNIENALAASTCAYALGIDINL
FT                   IKQGLEVTKAEHGRLEVINTKKFRIIDDTYNANPHSTTTALKALQDFSGEKIVVLGAMR
FT                   ELGNDSEELHLKIGQLAKKSADTFYSYGKLTQHYYGIHFDSKQQLANHLLANHVHATVL
FT                   IKGSRTVKMNELVDLLKK"
FT   gene            complement(180021..180191)
FT                   /pseudo
FT                   /locus_tag="Rmag_0154"
FT   gene            complement(180638..182032)
FT                   /locus_tag="Rmag_0155"
FT   CDS_pept        complement(180638..182032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0155"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetases;
FT                   PFAM: cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: lpp:lpp0978
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01947"
FT                   /db_xref="GOA:A1AVJ0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVJ0"
FT                   /protein_id="ABL01947.1"
FT                   /translation="MNISQLLANIVQTKIDIEIKGLCLNAQSTQPGDLFIALQGKLTHG
FT                   ADYINQAIDKGCVAILVDSKEIECVIPSIRIDNLSQYLQTLANTFYKNAIKVNIISITG
FT                   TNGKTSVAYFISQLLTKLGIKNGLIGTLGITHSQQLSLNTTPDILTLYQVLDNYYQNNI
FT                   HHAILEVSSHALTQDRIAGLNIKQAIFTNLTQDHLDYHHTLDKYQATKEKLFVLDTVES
FT                   VILNQDDSHYKHFLNITKDKKRISYSLGDFDSIKTIEQGFLVQLDHYVFEIPFLGEFNL
FT                   LNILAALNSVEALGFKRDDIIPLFYQLLPPPGRMQRIEPHLAWIDYAHTPDAIGNAITT
FT                   LKKHYPNFKIRIVFGCGGNRDKDKRAEMGKIASNLADTIILTNDNPRSENPKTIIENIL
FT                   SGIDDSYKLDIIENRQLAIETAITTLKENECLLIAGKGHETIQQFSDKTIYLNDLEIAQ
FT                   NSTKAI"
FT   gene            182253..184142
FT                   /locus_tag="Rmag_0156"
FT   CDS_pept        182253..184142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0156"
FT                   /product="sulfate thiol esterase SoxB"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: metallophosphoesterase; 5'-Nucleotidase domain
FT                   protein; KEGG: tcx:Tcr_1549 sulfate thiol esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01948"
FT                   /db_xref="GOA:A1AVJ1"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041829"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVJ1"
FT                   /protein_id="ABL01948.1"
FT                   /translation="MVLTRRDFIKVLGAGSAAGLISGCGNDADKLSSQDNRYEVAKTGN
FT                   ARILHITDTHGNLLPNYFREPNVNLGFGATFGQLPHVVGNKLLKQIGVKAGSADAYAFT
FT                   YNNFEDLVAKYGKTGGFSQIKTVLDSLRESADGVQNTLTLDGGDTWQGSGTSLWTRGAD
FT                   MVEACNILGVDVMVGHWEFTYKEEETLKNISFFKGDFLGQNVRIIEDTLMGDEYITMTE
FT                   KYGGNGLFDENEGLPFKPYVIKNVGGHRIAVIGQAFPRTSNANPQKYFFPDWSFGLRED
FT                   EMSELVSDIRKNEKPDAVIIISHNGMDVDIKMASRISGIDAIFGGHTHDGMPKPVEVKN
FT                   AGGVTVVTNAGCSGKYIGVMDLNIKDHKVMGYEYKMLPILTDFIKPDTAMVSFIDKIRT
FT                   TRYDKDVVEARSAKMLNNPDRIGKTYDEILTEKLCTTEQTLYRRGNFMGTWDQVLVNSL
FT                   REEHDANFAMSAGVRWGTSVPAGYNVTMEDLMTNTSMTYGETYVSELKGAQLKEILEGI
FT                   AENLFVQDPYLQSGGDMVRMGGMDYTIDPALGLGQRISNMKDDEGTPIDLNKFYKVSGW
FT                   AQVSNVGNGRLMWDVAADYLRKQKHLNLTKVNHPTIKGVNNNPGIENYDGKLI"
FT   gene            184536..185663
FT                   /locus_tag="Rmag_0157"
FT   CDS_pept        184536..185663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0157"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: jan:Jann_0120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01949"
FT                   /db_xref="GOA:A1AVJ2"
FT                   /db_xref="InterPro:IPR032809"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVJ2"
FT                   /protein_id="ABL01949.1"
FT                   /translation="MLYLIKAITLFWLLIDVSIADMVRPALVEISIYPDKKVDVVIDLS
FT                   LEALMTGISTQYKNTTDAPNSAQYDTLRSLIADDLREQFKAFETEFLNYIFLTINEKPQ
FT                   QLTLTSVKIDIVGYKKRSRKTLLTYSTQLRKWPKTLSWQYNKAYGDSALRYQVYKEGEY
FT                   NWSQWRWLRNGVTSGVIDINDLEPITTMQRMLQFISIGFDHVIPLGWDHMLFIIGMALS
FT                   SLMWRRLLLLVSVFTLAHTLTLGLAMLGIVEISERIIEPLIAFSIAYVVIENLLPNQSI
FT                   KRKSIIVFLFGLVHGLGFANMLKSFEMSSDNFLITLISFNIGVELAQILIVLSVVSLLF
FT                   FVKSLNLDYKKIAIVPTSIVISLIGIWWGIDRLIN"
FT   gene            complement(185671..186654)
FT                   /locus_tag="Rmag_0158"
FT   CDS_pept        complement(185671..186654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0158"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: noc:Noc_2788 sugar phosphate isomerase
FT                   involved in capsule formation, KpsF/GutQ; TIGRFAM:
FT                   KpsF/GutQ family protein; PFAM: CBS domain containing
FT                   protein; sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01950"
FT                   /db_xref="GOA:A1AVJ3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVJ3"
FT                   /protein_id="ABL01950.1"
FT                   /translation="MCLLAMSNSLLQSAKKVILTEAQAVMMLADGLDQSFIDACQLIQN
FT                   CTGKVVLIGMGKSGHIAGKIAATFASTGTPAFAVHPGEAGHGDLGMITQEDVVIAISYS
FT                   GESDEIMTLIPIIKRLGILIIGMTKNVNSSIGRISNVHLDVSVEKEACPHNLAPTSSTT
FT                   VALVMGDTLAISLLINKGFSVDDFARSHPSGTLGRRLLTLVSTIMKIGDDIPIVSADTK
FT                   LLDALLIMSQKTLGMVLITNNNNILKGIFTDGDLRRVLETYPNIQSLTISKVMTPNCQS
FT                   ISKDRPAMAAVQMMDEFNLNSLPVVDDNNQVVGAINTHTLMQAKII"
FT   gene            186730..187173
FT                   /locus_tag="Rmag_0159"
FT   CDS_pept        186730..187173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0159"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: bbr:BB2274 low molecular weight
FT                   protein-tyrosine-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01951"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVJ4"
FT                   /protein_id="ABL01951.1"
FT                   /translation="MGNICRSPTAEGAFKSQMEKRGVGCLFEIDSAGTHAYHIGEQPDS
FT                   RSQLAANKCHVDLSYQLARQVHKSDFYHYDYIFSMDTSNLSVLQSICPREYQTKLSLML
FT                   DNIPNNQVKSVPDPYFEGCFDEVFEMLNCASGFLLQSLLKRSL"
FT   gene            187302..187676
FT                   /locus_tag="Rmag_0160"
FT   CDS_pept        187302..187676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0160"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: csa:Csal_0416 ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01952"
FT                   /db_xref="GOA:A1AVJ5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVJ5"
FT                   /protein_id="ABL01952.1"
FT                   /translation="MSTINQLVRNPRKKKVIKSGVPALDSCPQKRGVCTRVYTTTPKKP
FT                   NSALRKIARVRLTNANEVTTYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDT
FT                   TGVDGRMQGRSKYGTKKSKK"
FT   gene            187709..188182
FT                   /locus_tag="Rmag_0161"
FT   CDS_pept        187709..188182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0161"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="PFAM: ribosomal protein S7; KEGG: tcx:Tcr_0291
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01953"
FT                   /db_xref="GOA:A1AVJ6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVJ6"
FT                   /protein_id="ABL01953.1"
FT                   /translation="MRRRSAPKRKILPDPKFGDLVLAKFVNILMLDGKKSVAEKIVYEA
FT                   LDIIEIRGGGNEQPIEVFKQALDNIGPQVEIKSRRVGGSTYQVPIEVRAERKIALAMRW
FT                   IIEASRKRGEKGMKLRLAGEVLDAVQNRGSAFKKKKDTHRMAEANKAFAHFRW"
FT   gene            188207..190309
FT                   /locus_tag="Rmag_0162"
FT   CDS_pept        188207..190309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0162"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: noc:Noc_2327 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01954"
FT                   /db_xref="GOA:A1AVJ7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVJ7"
FT                   /protein_id="ABL01954.1"
FT                   /translation="MARITPLDRYRNVGIMAHIDAGKTTTTERILLYTGRTHKIGEVHD
FT                   GGATMDWMEQEQKRGITITSAATTCFWKGMDKQFEDHRINIIDTPGHVDFTIEVERSLK
FT                   VLDGACAVFCAVGGVEPQSETVWRQANKYNVPRIGFVNKMDRAGADFLRICEQIKTRLG
FT                   GNPVPMQIAIGAEENFEGVIDLISMRAIFWNEADQGATYETRDIPAELQELAEKKREFM
FT                   IESAAEANDELMEKYLEEGELSHDEIKEGIRSQTIKSEIIPMFCGSAFKNKGVQVVLDA
FT                   MIMYMPSPLDVDAIAGILNDKDEAVASRNVGDDEPFAALAFKIATDPFVGNLTFFRVYS
FT                   GVLKAGDFVYNSSQGKKERIGRMVQMHANEREEIKEVRAGDIAAAIGLKDVTTGDTLCD
FT                   LKQKIVLEKMEFPEPVIALAVEPKTKEDQEKMGIALGKLAAEDPSFRVSTDEESGQTII
FT                   AGMGELHLDIIVDRMVREFDVECNVGAPQVSYREAITTMVEHQYKFAKQSGGRGQYGHV
FT                   YLRIEPQEPGAGYEFVDEIKGGVIPKEYVPAVNKGIQEQIKNGVLAGFPIVDIKVTVYD
FT                   GSYHDVDSNEIAFKIAASKCLSEGVRMANPQLLEPMMAVEVSTPENYMGDVIGDINRRR
FT                   GIVSAMEDTPTGKQIKAEVPLIEMFGYANDLRSMTQGRASYSMEFKKYTAAPKNVADEV
FT                   IEKLNK"
FT   gene            190320..191510
FT                   /locus_tag="Rmag_0163"
FT   CDS_pept        190320..191510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0163"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein; KEGG:
FT                   tcx:Tcr_0293 translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01955"
FT                   /db_xref="GOA:A1AVJ8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVJ8"
FT                   /protein_id="ABL01955.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITKIMSEARGGEFK
FT                   DYADIDNAPEERERGITISTAHVEYESEARHYAHVDCPGHADYIKNMITGAAQMDGAII
FT                   VIAATDGPMAQTREHILLSKQVGVPYIVVYMNKADMVDDEELVELVELEIRELLDEYDF
FT                   PGDDTPIIFGSALKALEGDMSDIGMSSIIKLVKALDTYIPTPKRDTDKSFLMPIEDVFS
FT                   ISGRGTVVTGRIEAGIVYVGDELEIVGIKDTQTTTCTGVEMFRKLLDSGEAGDNVGVLL
FT                   RGTKREEVERGQVLAKPGSIKPHSKFEAEVYILSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGACQLPDGVEMVMPGDNVKMQVELLSPIAMEDGLRFAIREGGRTVGAGVVSKVTD"
FT   gene            191601..191912
FT                   /locus_tag="Rmag_0164"
FT   CDS_pept        191601..191912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0164"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10; KEGG: mca:MCA2373
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01956"
FT                   /db_xref="GOA:A1AVJ9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVJ9"
FT                   /protein_id="ABL01956.1"
FT                   /translation="MSNQNIRIKLKAFDHRLIDKSALEIVETAKRTGASVRGPIPLPTK
FT                   KERFTVLTSPHVNKKARDQYELRTYVRLMDVISPTDKTVDALMKLDLAAGVDVAIKLN"
FT   gene            191948..192664
FT                   /locus_tag="Rmag_0165"
FT   CDS_pept        191948..192664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0165"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="PFAM: ribosomal protein L3; KEGG: pmu:PM1415 50S
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01957"
FT                   /db_xref="GOA:A1AVK0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVK0"
FT                   /protein_id="ABL01957.1"
FT                   /translation="MAMGLVGQKIGMTRLISDDGSITPVSVIKIELNRIVQTKTVDTNG
FT                   YSAIQVTTGVKVNKKGEAKVHRVPAAIKGHYAKTSQEIGLGLWEFRVEADEITDATSVD
FT                   ISLFSAGHYVNVVGRSKGKGFQGGVKRHNFQMQDATHGNSISHRAIGSTGQCQEPGRVF
FT                   KGKKMAGHMGNEQVTQECLKIVKVDSERNIIFVKGSIPGATKGFVKISLSSKKNKINQE
FT                   VSKNIQNQATNEVVLN"
FT   gene            192684..193298
FT                   /locus_tag="Rmag_0166"
FT   CDS_pept        192684..193298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0166"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: cps:CPS_0872
FT                   ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01958"
FT                   /db_xref="GOA:A1AVK1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVK1"
FT                   /protein_id="ABL01958.1"
FT                   /translation="MKFKVLNISTNKSSTIEVADTVFARGFNQALVHQVTTAYMSGGRQ
FT                   GSKAQKNRSTVSGGSKRPWAQKGTGRARAGTTRGPIWRSGGVTFSAAPRGYAQKVNKKM
FT                   YKGAISVIFSELARSERLKVVSEFNIKEIKTKNITALLKALNVKDVLLMTDELDENLYL
FT                   SSRNLYHVGVCDIQSIDPVSLIGYDNVVVTEIALKKIEAML"
FT   gene            193295..193585
FT                   /locus_tag="Rmag_0167"
FT   CDS_pept        193295..193585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0167"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: cvi:CV4184
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01959"
FT                   /db_xref="GOA:A1AVK2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVK2"
FT                   /protein_id="ABL01959.1"
FT                   /translation="MNQEKILKILLAPIVSEKTTMLSAHNQYAFKVRVDCSKREIKAAV
FT                   EMLFSVNVENVTTSIVKGKKKIFKGRIGSRPNWKKAMVKVSEGQMIDVSRT"
FT   gene            193596..194426
FT                   /locus_tag="Rmag_0168"
FT   CDS_pept        193596..194426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0168"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="PFAM: ribosomal protein L2; KEGG: sde:Sde_0963
FT                   single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01960"
FT                   /db_xref="GOA:A1AVK3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVK3"
FT                   /protein_id="ABL01960.1"
FT                   /translation="MAQVIKRKPTSPGRRFVVSIVDKELHKGASYAPLTQSKNRISGRN
FT                   NVGRITTRHKGGGHKRRYRIIDFKRNKDDITARVERLEYDPNRSANIALVLYTDGERRY
FT                   IIAPHGLSVGYTIVSGNSVAIQAGNVMPLSNIPLGGVVHCIELKPMKGAQIARSAGAFA
FT                   QLIAKEGNYVTLRLRSGEVRKVLADCRATIGEVSRSEHSLKKLGKAGATRWRGVRPTVR
FT                   GVVMNPVDHPHGGGEGKTSGGRHPVSPWGTPTKGYKTRSNKRTDKLILRHRNKG"
FT   gene            194429..194698
FT                   /locus_tag="Rmag_0169"
FT   CDS_pept        194429..194698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0169"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: pae:PA4259 30S ribosomal protein
FT                   S19"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01961"
FT                   /db_xref="GOA:A1AVK4"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVK4"
FT                   /protein_id="ABL01961.1"
FT                   /translation="MARSLRKGPFIDEHLIKKVLVAQEKNDRKPIKTWSRRSVVVPEMI
FT                   GLTIAVHNGRVHVPVSINENMIGHKLGEFAITRTFKGHSGDRKV"
FT   gene            194713..195045
FT                   /locus_tag="Rmag_0170"
FT   CDS_pept        194713..195045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0170"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: cps:CPS_0868 ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01962"
FT                   /db_xref="GOA:A1AVK5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVK5"
FT                   /protein_id="ABL01962.1"
FT                   /translation="MKEVKAIHKYAKTSAFKVRLVANQIRLKSVDEALNILSFSNKKAA
FT                   VLIKKVLNSAISNAEHNDGLDIDELFVASICIDEGSTMKRIRPRAKGKANRILKRTSHI
FT                   TVGVSK"
FT   gene            195053..195751
FT                   /locus_tag="Rmag_0171"
FT   CDS_pept        195053..195751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0171"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="KEGG: pae:PA4257 30S ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3-C-terminal
FT                   domain protein; KH, type 2 domain protein; Ribosomal
FT                   protein S3, N-terminal domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01963"
FT                   /db_xref="GOA:A1AVK6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVK6"
FT                   /protein_id="ABL01963.1"
FT                   /translation="MGQKVNPKGIRLGIVKDWDSKWYANSQDYSKYLLSDIKVRDYLFD
FT                   KLTNASVSRIQIERLANNAKITIHTARPGIIIGKKGADIEQLKSIVSKMMGIPVHINIE
FT                   EIKKPELDARLVAENIAQQLEKRVMYRRAVKRVLGNTTRLGAKGIKVMVNGRLNGAEIA
FT                   RSEWYREGRVPLHTFRADVDYSSYGANTQYGVIGIKVWIFKGEILNHKKGTLDEVARRG
FT                   ATNQIAQKIK"
FT   gene            195764..196174
FT                   /locus_tag="Rmag_0172"
FT   CDS_pept        195764..196174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0172"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="PFAM: ribosomal protein L16; KEGG: son:SO0238 50S
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01964"
FT                   /db_xref="GOA:A1AVK7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVK7"
FT                   /protein_id="ABL01964.1"
FT                   /translation="MLQPKRTKFRKMMKGRNRGLATGYKVSFGEIGLQAVSRCRMTARQ
FT                   IESARRAMTRHVKRQGKIWIRVFPDKPITKKPLEVRMGKGKGSVEYWVAQIKPGQMLFE
FT                   MQGVDEIIIREAFALAAAKLPVKTTIIKRTVM"
FT   gene            196174..196362
FT                   /locus_tag="Rmag_0173"
FT   CDS_pept        196174..196362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0173"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: ribosomal protein L29; KEGG: tcx:Tcr_0303
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01965"
FT                   /db_xref="GOA:A1AVK8"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVK8"
FT                   /protein_id="ABL01965.1"
FT                   /translation="MNVKELRNQDVSTLNETLIKLLKKHFELRMQHKSAQLDDASKLGK
FT                   TKRSIAQVKTIIRQKQV"
FT   gene            196359..196625
FT                   /locus_tag="Rmag_0174"
FT   CDS_pept        196359..196625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0174"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="PFAM: ribosomal protein S17; KEGG: ppu:PP0463
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01966"
FT                   /db_xref="GOA:A1AVK9"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVK9"
FT                   /protein_id="ABL01966.1"
FT                   /translation="MSEKKVERVLTGTVVSNNRNKTIAVLIERKVRHPIYKKYIKRSTK
FT                   VHAHDEKNKCALGDLVRVVEAKPFSKTKHWALLEVVEKSVFVD"
FT   gene            196654..197022
FT                   /locus_tag="Rmag_0175"
FT   CDS_pept        196654..197022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0175"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: tcx:Tcr_0305 ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01967"
FT                   /db_xref="GOA:A1AVL0"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVL0"
FT                   /protein_id="ABL01967.1"
FT                   /translation="MIQMQTKLKVADNSGGVKAMCIKVLGGSKRRYANIGDVIKVSIKE
FT                   AASRGKVKKGDVYDAVVVRTAHGVRRSDGSCIRFDNNAIVLLNTKLEPIGTRIFGPVTR
FT                   ELRSAQFMKIVSLAPEVL"
FT   gene            197022..197333
FT                   /locus_tag="Rmag_0176"
FT   CDS_pept        197022..197333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0176"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="KEGG: cbu:CBU_0249 ribosomal protein L24; TIGRFAM:
FT                   ribosomal protein L24; PFAM: KOW domain protein; SMART: KOW
FT                   (Kyrpides, Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01968"
FT                   /db_xref="GOA:A1AVL1"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVL1"
FT                   /protein_id="ABL01968.1"
FT                   /translation="MKKIKLNDEVIIITGKNKDSTGAVIKVLDSKVLVEGLNLAKKHVR
FT                   SNPNAGVTGGITEIEVPLAVSNVAIYNSATKKADRVGIRTNKDGIKERFFKSNNEVIV"
FT   gene            197356..197895
FT                   /locus_tag="Rmag_0177"
FT   CDS_pept        197356..197895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0177"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="PFAM: ribosomal protein L5; KEGG: xoo:XOO3570 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01969"
FT                   /db_xref="GOA:A1AVL2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVL2"
FT                   /protein_id="ABL01969.1"
FT                   /translation="MSRLQEQYKNEILPALQKELDMSNPMQVPKIEKITINMGLGSALG
FT                   DKKVLQSALKEMSLISGQKPLICNARKSVASFKLREGNPIGCKVTLRKERMYEFLDRLI
FT                   NIAIPRIRDFRGFKATAFDGRGNYNMGITEQITFAEIDFEKVTRILGMDIAITTTAKSD
FT                   EEAKKLLVMFKFPFKG"
FT   gene            197901..198206
FT                   /locus_tag="Rmag_0178"
FT   CDS_pept        197901..198206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0178"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="PFAM: ribosomal protein S14; KEGG: csa:Csal_0434
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01970"
FT                   /db_xref="GOA:A1AVL3"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVL3"
FT                   /protein_id="ABL01970.1"
FT                   /translation="MAKKSMINRDIKRTKLVEKYKVKRLELKKIIKSINVSDEERFQAT
FT                   IKLQALPRDASPTRQRNRCALTGRPHGFYRKFGLARTKLRERTMNGEAPGLSKASW"
FT   gene            198218..198613
FT                   /locus_tag="Rmag_0179"
FT   CDS_pept        198218..198613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0179"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="PFAM: ribosomal protein S8; KEGG: bte:BTH_I3054
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01971"
FT                   /db_xref="GOA:A1AVL4"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVL4"
FT                   /protein_id="ABL01971.1"
FT                   /translation="MSMSDPIADMLTRIRNAQMVEKKEVNVPASNLKSAIASVMQEEGY
FT                   IKSFSVDGIAASKTLNIKLKYYDNKSVIEKLKRISKPSLRVYVSSSQMPSVMNGLGIVI
FT                   VSTPKGVMTGQTAYEQNIGGEVLCSVY"
FT   gene            198629..199174
FT                   /locus_tag="Rmag_0180"
FT   CDS_pept        198629..199174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0180"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="PFAM: ribosomal protein L6; KEGG: tcx:Tcr_0310
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01972"
FT                   /db_xref="GOA:A1AVL5"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVL5"
FT                   /protein_id="ABL01972.1"
FT                   /translation="MSRVAKSPITIPTGVEVTITSNLMSVKGRFGQLNMSIHPCIVITN
FT                   TNNKLSFDITITEKKEQKKAWAQAGTARANTANLIQGVTEGWEKKLTLIGVGYRAKVME
FT                   RVLNLTLGFSHPINYKLPEGITVEAPSQTEIIIKGMDKQKVGQVAAEIRAYHPPEPYKG
FT                   KGVCYIDEQVVRKEAKKK"
FT   gene            199192..199539
FT                   /locus_tag="Rmag_0181"
FT   CDS_pept        199192..199539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0181"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: psp:PSPPH_4576 ribosomal protein
FT                   L18"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01973"
FT                   /db_xref="GOA:A1AVL6"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVL6"
FT                   /protein_id="ABL01973.1"
FT                   /translation="MKLSKKQARLRRATKFRAKHAQGSTKRLCVHKTAQHIYAQIISPC
FT                   GTKVLASASTLTAKLKNGGNVDAATKVGKEIAKAATSVKVIKVAFDRSGFKYHGRVKAL
FT                   ADAAREGGLDF"
FT   gene            199583..200101
FT                   /locus_tag="Rmag_0182"
FT   CDS_pept        199583..200101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0182"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="PFAM: ribosomal protein S5; ribosomal protein S5
FT                   domain protein; KEGG: csa:Csal_0438 ribosomal protein
FT                   S5-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01974"
FT                   /db_xref="GOA:A1AVL7"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVL7"
FT                   /protein_id="ABL01974.1"
FT                   /translation="MAEYKKNNNNDDKDYIEKLVNIRRVVKVVKGGRIFGFSALVVVGD
FT                   GNGKVGYGTGKAREVPVAIQKAMDKARKRMKSVSLVNGTLHYPIVSSVGAAKVYMQPAS
FT                   EGTGVIAGGPMRSVLEAVGVHNILAKCNGTRNPISVVRATVEGLTSMSSPQLVAAKRGK
FT                   TVDQITRKG"
FT   gene            200101..200421
FT                   /locus_tag="Rmag_0183"
FT   CDS_pept        200101..200421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0183"
FT                   /product="LSU ribosomal protein L30P"
FT                   /note="PFAM: ribosomal protein L30; KEGG: cps:CPS_0619
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01975"
FT                   /db_xref="GOA:A1AVL8"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVL8"
FT                   /protein_id="ABL01975.1"
FT                   /translation="MVEENKIVKKVIVTKKPTIKKAPVKAAFKKEVVVKNATVIKKTQT
FT                   SSKRNTVNITLVKSFHGRLPSHRATIVGLGLKRINHIKELKDTPEIRGMINKVAYLLKV
FT                   ED"
FT   gene            200426..200869
FT                   /locus_tag="Rmag_0184"
FT   CDS_pept        200426..200869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0184"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="PFAM: ribosomal protein L15; KEGG: ppr:PBPRA0339
FT                   putative ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01976"
FT                   /db_xref="GOA:A1AVL9"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVL9"
FT                   /protein_id="ABL01976.1"
FT                   /translation="MNVMQLNTLSPIQGEKQSRKRVGRGIGSGFGKTCGRGHKGQKARS
FT                   GGFRKVGFEGGQMPLQRRLPKVGFSSRVSIVTSQVTLSEIDRLTETDITIDALKAHNLI
FT                   TKNIKRVKVILSGEIIKTVTLTGIKTTKGAKLAIEAVKGLVNE"
FT   gene            200873..202171
FT                   /locus_tag="Rmag_0185"
FT   CDS_pept        200873..202171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0185"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: noc:Noc_2305 SecY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01977"
FT                   /db_xref="GOA:A1AVM0"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVM0"
FT                   /protein_id="ABL01977.1"
FT                   /translation="MKQSLGLSQDLSKRILFLLGALIVFRLGTHITIPFISSAALASLV
FT                   QDQQGTILDMFNMFSGGALERLSIFTLGIMPYISASIIIQLMTSIVPKLEQLKKEGETG
FT                   KRKITQYTRIGTVVLAIFQSYGISIALQSQSSGGIALVTQGDFTFNMVTVVTLTTGTLF
FT                   LMWLGEQITEKGIGNGISMIIFAGIVSGLPSALGSTLSLVATGELTIILVVILLIMTLL
FT                   VTAFVVFMERGQRRITVNYAKRQQGRKMVSGQSSYLPLKINMAGVIPPIFASSIILFPA
FT                   TLGGWFSQSEGMDWLADLTASISPGQPLYVLFYGLAIVFFTFFYTALTFDSKDTADNLR
FT                   KSGGFIPGIRPGKHSADYIDLVMSRLTASGAIYITAVCLLPEFLILYWNVPFYFGGTSL
FT                   LIIVVVVMDFIAQAQSHLMSNQYESLMKKTGLN"
FT   sig_peptide     200873..201001
FT                   /locus_tag="Rmag_0185"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.797) with cleavage site probability 0.690 at
FT                   residue 43"
FT   gene            202185..202298
FT                   /locus_tag="Rmag_0186"
FT   CDS_pept        202185..202298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0186"
FT                   /product="LSU ribosomal protein L36P"
FT                   /note="PFAM: ribosomal protein L36; KEGG: vpa:VP0278
FT                   ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01978"
FT                   /db_xref="GOA:A1AVM1"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVM1"
FT                   /protein_id="ABL01978.1"
FT                   /translation="MKVRASVKKICNNCKIIKRHGVVRVICKEPRHKQRQG"
FT   gene            202454..202807
FT                   /locus_tag="Rmag_0187"
FT   CDS_pept        202454..202807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0187"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="PFAM: ribosomal protein S13; KEGG: ftl:FTL_0258 30S
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01979"
FT                   /db_xref="GOA:A1AVM2"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVM2"
FT                   /protein_id="ABL01979.1"
FT                   /translation="MARIAGINIPTHKHIVIGLQSIFGIGDTRAKATCKILKLDPATKV
FT                   VDIAEDQLELIRAEVAKYEVEGDLRRQVSMDIKRLKDLGCYRGVRHRKSLPLRGQRTKT
FT                   NARTRKGPRRLIK"
FT   gene            202823..203206
FT                   /locus_tag="Rmag_0188"
FT   CDS_pept        202823..203206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0188"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="PFAM: ribosomal protein S11; KEGG: tcx:Tcr_0317
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01980"
FT                   /db_xref="GOA:A1AVM3"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVM3"
FT                   /protein_id="ABL01980.1"
FT                   /translation="MAKTPTRKKSKKVIIDGIAHIHATFNNTIVMITDRHGNAICWSAS
FT                   GGSGFRGSRKSTPFAAQVTAGSCGEKALAFGMKNLEVRVKGPGPGRDSAIRGLNAQGLK
FT                   IQSITDVTPIPHNGCRPSKKRRV"
FT   gene            203216..203842
FT                   /locus_tag="Rmag_0189"
FT   CDS_pept        203216..203842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0189"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: sgl:SG2254 30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01981"
FT                   /db_xref="GOA:A1AVM4"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVM4"
FT                   /protein_id="ABL01981.1"
FT                   /translation="MARYTGPTCKLARREGTDLFLKSGIRSLDSKCNVTQLPGMHGANA
FT                   RRQKGTEYGLQLREKQKVRRIYGILEKQFRLYYKKASQKKGSTGENLLSLLECRLDNVV
FT                   YRMGFGSTRAEARQLVSHKSILMNGLVVNIPSYQVSVNDEISIREKAKKQSRIQLALEL
FT                   AEQSTQPQWLDIDHKALKGVFKNVPARDELSSDIQEHLIVELYSK"
FT   gene            203855..204835
FT                   /locus_tag="Rmag_0190"
FT   CDS_pept        203855..204835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0190"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: csa:Csal_0446 DNA-directed RNA polymerase,
FT                   alpha subunit; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase, alpha subunit domain
FT                   protein; RNA polymerase, dimerisation; RNA polymerase,
FT                   insert; SMART: RNA polymerase, RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01982"
FT                   /db_xref="GOA:A1AVM5"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVM5"
FT                   /protein_id="ABL01982.1"
FT                   /translation="MQGSARNFLKPKLVESSQTGVNEFKVILEPLERGFGHTLGNALRR
FT                   TLLSSMTGSAVTEVAIDGVMHEFSTIEGVQEDVLDILLNLKEVSVMLNTAETAQVVIEK
FT                   KGPCEITVADIEANGIDITAFNPDKVIATINDESHMRMTLKISTGIGYDTATSRTDEAS
FT                   SIGGMQLDASFSPIRRVSFTVDAARVKQKVNLDKLNITIETNGSVNAEVAIKRAAIILQ
FT                   EQLSSFVELELVEEEEALPTSEDFDPQLLAAVDELELTVRSANCLKAEQIYYIGDLIQK
FT                   SEQDLLRTPNLGRKSLNEIKEVLTEKGLNLATSIENWPPVDLMSE"
FT   gene            204846..205244
FT                   /locus_tag="Rmag_0191"
FT   CDS_pept        204846..205244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0191"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="PFAM: ribosomal protein L17; KEGG: ppr:PBPRA0346
FT                   putative ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01983"
FT                   /db_xref="GOA:A1AVM6"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVM6"
FT                   /protein_id="ABL01983.1"
FT                   /translation="MRHRKSGRQLNRNSSHRKAMFKNMANSLFLHETIRTTLSKAKELR
FT                   RVVEPLITKAKIDSVANRRNIFSKLRDDAIVAKLFTELAPFYKDRPGGYIRILKAGFRA
FT                   GDKALMAIVQLVDFETTTDIVAETTDFS"
FT   gene            205255..205470
FT                   /locus_tag="Rmag_0192"
FT   CDS_pept        205255..205470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0192"
FT                   /product="SSU ribosomal protein S21P"
FT                   /note="PFAM: ribosomal protein S21; KEGG: tcx:Tcr_1809
FT                   ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01984"
FT                   /db_xref="GOA:A1AVM7"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVM7"
FT                   /protein_id="ABL01984.1"
FT                   /translation="MPSIKVRENEPFDIALRRFRRTCDRAGVITDVRKKEFYEKPTWVN
FT                   KRMKAAAVKRTHKEMAKNRVHRKRMY"
FT   gene            205544..205944
FT                   /pseudo
FT                   /locus_tag="Rmag_0193"
FT   gene            complement(207693..207839)
FT                   /pseudo
FT                   /locus_tag="Rmag_0194"
FT   gene            complement(208609..209161)
FT                   /pseudo
FT                   /locus_tag="Rmag_0195"
FT   gene            complement(209161..209529)
FT                   /locus_tag="Rmag_0196"
FT   CDS_pept        complement(209161..209529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0196"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="KEGG: noc:Noc_2728 protein-methionine-S-oxide
FT                   reductase; TIGRFAM: methionine-R-sulfoxide reductase; PFAM:
FT                   Methionine sulfoxide reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01985"
FT                   /db_xref="GOA:A1AVM8"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVM8"
FT                   /protein_id="ABL01985.1"
FT                   /translation="MNLVKKLTPEQFRVTQQAGTEAPFTGKYYNYQEQGNYLCVCCHQI
FT                   LFSFNTKFDSNMGWPSFSNASKSDSVKLITDNSHGMSRVEARCSNCDAHLGHVFSDGPT
FT                   SSGNRYCINSASLDFKPS"
FT   gene            209570..210658
FT                   /locus_tag="Rmag_0197"
FT   CDS_pept        209570..210658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0197"
FT                   /product="Polynucleotide adenylyltransferase region"
FT                   /note="PFAM: Polynucleotide adenylyltransferase region;
FT                   KEGG: cbu:CBU_1827 tRNA nucleotidyltransferase (CCA-adding
FT                   enzyme)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01986"
FT                   /db_xref="GOA:A1AVM9"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVM9"
FT                   /protein_id="ABL01986.1"
FT                   /translation="MKVYLVGGAVRDQLLGIADEFTEKDWMVVGSSSKQMLDLGYRQVG
FT                   KNFPVFLHPGTQEEYALARLERKIGTGYKGFKFDISSQVTLEQDLFRRDLTINAMAQKA
FT                   GELFDPFNGQEDLNNGILRHVSNAFSEDPVRILRIARFAARFKKFGFKVAHQTHQLMSQ
FT                   MVTSGEVDALTPERVFKELNKALSYETPSAFFKVLTACGAYQKVFSSLDNQVHQNHSNS
FT                   FVFLDNLNTDKAHIKFSIWLKDENRHNIKALCNIIKCPKQYQQLSELVSQFYQFSQDFT
FT                   NHSSNEVFDFFAKTDILRHKDRFEDLLSTFKLLEIDIVPIEHLRDLLKDINISKLDKSD
FT                   IAKAIQIEKRLIIDLFFKTVKK"
FT   gene            complement(210716..211002)
FT                   /pseudo
FT                   /locus_tag="Rmag_0198"
FT   gene            complement(212133..214607)
FT                   /locus_tag="Rmag_0199"
FT   CDS_pept        complement(212133..214607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nmu:Nmul_A0722 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01987"
FT                   /db_xref="GOA:A1AVN0"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR019925"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVN0"
FT                   /protein_id="ABL01987.1"
FT                   /translation="MLINAELTELNAKDIIVLANNRQVLAFKKTFAIQRGNTQLPKALS
FT                   WGQYLCYTWHQISPNSNLRFIDQIESRHLIKQSMQKLGQNTHQSLLDEVVKNNDYCANY
FT                   LIDLSELTYSKIRSSELFSAWINAYKNTKLILGLIDLHDLPSLIIKTNTSITKPHIYGF
FT                   KTLTPQQKLLFDTIGYQQINAISTHNILTFTFDTTTSEIFKAAQWAKAHFDTNPDKSVV
FT                   IVSPQLSDIQHQLSSIFDQVFDNLLTEIEQKSYNISLRLHLNQYSLIQDLLSILTLSIQ
FT                   LQCNKIQSTLFNKVATCVYVSGYQQERSSRSLLMNQVLSLSVDEFSLDRIDKDLSKCPI
FT                   LEAIINNIKREKPTNNTLESHLLNFNNMLKTWGFATDRNLSNTEYKLFNKYLQTSLGLN
FT                   QLSFYFGKVSTQSAITQLNNLTAQVIFQEQANKTNIQILDALEARGLYFDEAWILGMTN
FT                   QFLPTRLNSTRFIAHDISVTHQIPNTDYKLITTDAKNTLESLNSLANKVVFSYALTHLG
FT                   NEQLPSPLVEFNPTINTSHIQKIFPIPLESILDTNTSYLKKPQIKLGVRILKDQMACAF
FT                   KGFAHRLDTTSFDAPHIGINRLEQGNIIHNVLQYIYQKITSKEQLLALNTKELDNLILN
FT                   KINTVLKRHLNSSFKKIEKLRLSHLIHTFIEADKLREDFYVLTTEQNITANIANLEFET
FT                   RLDRLDRMSNGDKIIFDYKTSTTSISSWYGSAISEPQLPIYAITNNVQGAAFIELASNK
FT                   INFKGLSKNPDSLPKQSKYKDKYQDWNKQLKIWQQTLNIASIDFQNGITTVLPNKNACN
FT                   FCEFDLLCRIVK"
FT   gene            complement(214597..215196)
FT                   /locus_tag="Rmag_0200"
FT   CDS_pept        complement(214597..215196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0200"
FT                   /product="cell division checkpoint GTPase YihA"
FT                   /note="TIGRFAM: GTP-binding; PFAM: GTP-binding protein,
FT                   HSR1-related; KEGG: tcx:Tcr_0047 GTP-binding protein,
FT                   HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01988"
FT                   /db_xref="GOA:A1AVN1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVN1"
FT                   /protein_id="ABL01988.1"
FT                   /translation="MHKHYHQAKFLLSCPSLKGCPPDEGYEVIFAGRSNAGKSSVINTL
FT                   TLQNKLAKVSRTPGKTQHFVFFELDKDRRLVDLPGYGYAKVPKRVKTKWHKDINEYFNK
FT                   RDCLRGTVLVMDIRHPFKLFDQMVLNWCHSINLSTQIILTKSDKLKKGAASNTYLKVHN
FT                   QIKKYPYVDVQLFSSLKKQGLEILGARLNTFFGYVD"
FT   gene            215270..215560
FT                   /locus_tag="Rmag_0201"
FT   CDS_pept        215270..215560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0201"
FT                   /product="cytochrome c, class I"
FT                   /note="KEGG: sdn:Sden_1464 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01989"
FT                   /db_xref="GOA:A1AVN2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVN2"
FT                   /protein_id="ABL01989.1"
FT                   /translation="MKRILLVVTVATFTMNFAQADGAADYAAGGCANCHGITGVSVIQI
FT                   YPNLSGQNSAYTVKQLKDFQTGVRKDPTMNAMSKIVAGKEQSIADFLATQK"
FT   sig_peptide     215270..215332
FT                   /locus_tag="Rmag_0201"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.988 at
FT                   residue 21"
FT   gene            215620..215913
FT                   /locus_tag="Rmag_0202"
FT   CDS_pept        215620..215913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0202"
FT                   /product="cytochrome c4 precursor"
FT                   /note="KEGG: mag:amb3084 cytochrome c4 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01990"
FT                   /db_xref="GOA:A1AVN3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVN3"
FT                   /protein_id="ABL01990.1"
FT                   /translation="MQKILHYVLAMMTLSIALGVQASGKSVYNSLGCSSCHGIDGKPST
FT                   SAYPTLAGKDAVWLVNQLKYFQFGVRKDPTMNAMVPIVAGYEQIIADYLSKQ"
FT   sig_peptide     215620..215688
FT                   /locus_tag="Rmag_0202"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.895 at
FT                   residue 23"
FT   gene            215942..216625
FT                   /locus_tag="Rmag_0203"
FT   CDS_pept        215942..216625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0203"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: ppr:PBPRA3501
FT                   putative cytochrome c4"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01991"
FT                   /db_xref="GOA:A1AVN4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVN4"
FT                   /protein_id="ABL01991.1"
FT                   /translation="MYNPSSFVFNKTHLMNKLASIFIIVITFASINVSASGDVAKGKVI
FT                   AATCVVCHGVQGNSVVATFPKLAGQGEGYLLKQLQDFKSNTRKDVIMKNTVVSLTKDDM
FT                   ENLAAYFSKQTITQGVVSKSANIALGEQLYKGGNKDKGVTACIACHGPIGAGIPSAKFP
FT                   ALASQHVTYIIKQLVAFRQDAYNVQTGTNTPERNNDYEGMMRNITKYLDNKEIEAVSQY
FT                   IAGLH"
FT   sig_peptide     215942..216049
FT                   /locus_tag="Rmag_0203"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.791 at
FT                   residue 36"
FT   gene            216740..218029
FT                   /locus_tag="Rmag_0204"
FT   CDS_pept        216740..218029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0204"
FT                   /product="trigger factor"
FT                   /note="TIGRFAM: trigger factor; PFAM: peptidylprolyl
FT                   isomerase, FKBP-type; trigger factor, C-terminal domain
FT                   protein; trigger factor, N-terminal domain; KEGG:
FT                   hch:HCH_02157 trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01992"
FT                   /db_xref="GOA:A1AVN5"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVN5"
FT                   /protein_id="ABL01992.1"
FT                   /translation="MKASLEILKGLDRSLTVDLPIDIFNQKTDKILQKIASQVNFDGFR
FT                   KGKVPVAVVRKRFGNNVNSDAINEIVNETLTDALTQVKATPVSQPVISKIDSEDEKNFS
FT                   YTVDFEVFPEIKVADFSKLTIEQIKVEITKADEQRTLNGLKEQLTEYKAVKRKSEIGDR
FT                   LSIDFKGLIDGKTFDGAEAKDFKIVLGKGSMIKGFEEGLIDVTPNSMLMLDLVFPKNYH
FT                   MNKLSGKAVTFEININEVALPKEPKLNEVFAKKFGEKDMDALKVSIKMQMKVEIDGRIG
FT                   YLNKNAIFDALSEANQFDVPQSSIDNEAQNLLKEMKERIQQQGGLPAQGEIPASAFNDE
FT                   AQRRVKLGLLVNQISNDNKLSASLEQIDAKLQEISQAHGKDTQKIIDSYNQDPTKKLSI
FT                   ELLVIEKMVQDLILDKAKVTFKQKKFQEIT"
FT   gene            218037..218633
FT                   /locus_tag="Rmag_0205"
FT   CDS_pept        218037..218633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0205"
FT                   /product="ATP-dependent Clp protease proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="KEGG: mca:MCA0242 ATP-dependent Clp protease,
FT                   proteolytic subunit ClpP; TIGRFAM: ATP-dependent Clp
FT                   protease, proteolytic subunit ClpP; PFAM: peptidase S14,
FT                   ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01993"
FT                   /db_xref="GOA:A1AVN6"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVN6"
FT                   /protein_id="ABL01993.1"
FT                   /translation="MDIENLNQIPIVVEQSARGERAYDIYSRLLKERIIFLVGPIEDYM
FT                   ANVVVAQLLFLESENPDQDIHLYINSPGGLVSAGLAIYDTMQFIKPDVSTLCIGQAASM
FT                   GALLLTAGAKDKRFALPNVRCMIHQPLGGFSGQASDIDIHAQEILKVREKLNQIFKLHT
FT                   SQTIKTIQKDTDRDNFMSANEATKYGLIDKVLAKR"
FT   gene            218638..219903
FT                   /locus_tag="Rmag_0206"
FT   CDS_pept        218638..219903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0206"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpX"
FT                   /EC_number="3.4.21.92"
FT                   /note="KEGG: tcx:Tcr_1178 ATP-dependent Clp protease,
FT                   ATP-binding subunit ClpX; TIGRFAM: ATP-dependent Clp
FT                   protease, ATP-binding subunit ClpX; PFAM: AAA ATPase,
FT                   central domain protein; zinc finger, C4 domain protein;
FT                   ATPase AAA-2 domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01994"
FT                   /db_xref="GOA:A1AVN7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVN7"
FT                   /protein_id="ABL01994.1"
FT                   /translation="MKDDNQELVCSFCGKGKSEVGRLIKGPGVFICNKCVESCHDLIED
FT                   QASQEGVNEFEDWNYTPKQLNNFLNDYVIGQDHAKKVLSVAVYNHYKRLRSDYISNKVE
FT                   LDKSNILMVGPTGSGKTLLAQTLARILDVPFTVADATTLTEAGYVGDDVENVIKNLLSK
FT                   CDFDPKRAQRGIIFIDEIDKISRRSDSPSITRDVSGEGVQQAMLKLIEGTVASVPPQGG
FT                   RKHPNQETIDVDTSKILFICGGAFDGLDKIINRRVEKVTGIGFAADVKDQKEKKTLSDL
FT                   FALIQPEDLIKFGLIPEFVGRLPVQTALSELDETALVKILIEPKNSVIKQFQEIFFMEG
FT                   VKLIFRNPSLLAIARLAIKRKIGARGLRSILEDLLLDTMFELPSLLDVTEVIIDKAVVK
FT                   KKKAPLIIYQSQKHSNKSKRVD"
FT   gene            219918..221243
FT                   /locus_tag="Rmag_0207"
FT   CDS_pept        219918..221243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0207"
FT                   /product="GTP-binding protein HflX"
FT                   /EC_number="3.1.5.-"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein, HSR1-related; KEGG: eca:ECA3933
FT                   putative GTP-binding phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01995"
FT                   /db_xref="GOA:A1AVN8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVN8"
FT                   /protein_id="ABL01995.1"
FT                   /translation="MVLFEQQKDAIGKGERTLLVYVELTSNKQSHNAQVEFKELAESSG
FT                   LNIVKTIKVNCNSVLIRFFIGTGKVEEIAKIVEDSALDLVIFSPELSPSQERNLKKSLK
FT                   CQVMDRTGLILDIFALRASSFEGKLQVELAQLKHLSTRLIRGWTHLERQKGGIGLRGPG
FT                   ETQLETDKRLIAIRIKNITKRLYKVHKQRDLGRKSRTKNELPMIALAGYTNAGKSTLFN
FT                   VLTNAEVFANDQLFATLNSTIRRVILPASGEAAIVDTVGFIQDLPHDLVDAFKSTLEET
FT                   KCANVLLHIVDAADEYNIEKIAQVEDIIFEIGASNIPSILVMNKIDCLDNFVPRMDRDE
FT                   NGHIHRVWLSAQTGKGIDFLHQALAEQLSGMMTRAKVHLDVGSAYIRSNIHDIGHIHHE
FT                   KVDDFGAWVLEIFVTKHYLSKLLNFKGVTLLWEQSSPTNKLI"
FT   gene            221207..223543
FT                   /locus_tag="Rmag_0208"
FT   CDS_pept        221207..223543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0208"
FT                   /product="ATP-dependent proteinase, Serine peptidase,
FT                   MEROPS family S16"
FT                   /EC_number="3.4.21.53"
FT                   /note="KEGG: tbd:Tbd_1675 peptidase S16, ATP-dependent
FT                   protease La; TIGRFAM: ATP-dependent protease La; PFAM:
FT                   peptidase S16, lon domain protein; AAA ATPase, central
FT                   domain protein; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01996"
FT                   /db_xref="GOA:A1AVN9"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVN9"
FT                   /protein_id="ABL01996.1"
FT                   /translation="MGTELTNEQIDLSKSNIPLLPLRDVVVFPHTVIPLFVGRKTSVNA
FT                   ITQAMGANKYIFLVTQKNDKVEEPLGDDLHQVGTLATILQMLKLPNGTIKVLVEGVRRA
FT                   KIEKIVQVDGFSEVSLSEFSLKSNDDTEIKAMMRLALDGFENYIKLNKRVPEEALKVLQ
FT                   EVSDVERFSDIIIANLNLKVSEKQALLGDDNAQDRLNKILSIIQGEIDVLGTEKKIQSR
FT                   VRKQMESNQRDYYLNEQMKSIQKELGQAEDENEIEELQASIYKAKMSKEAKEKAQSELK
FT                   KLSRMSSHSSDASIIRTYIENLCDMPWKKKTVINKDLNKAQKILDDDHYGLDKVKERIL
FT                   EHLAVQTRVTHNKANILCLVGPPGVGKTSLGESIARAVNRKYVRMALGGVRDEAEIRGH
FT                   RRTYIGAMPGSIIQKMQKAKVKNPLFLLDEIEKMASDYRGDPSSAMLEVLDPEQNHTFN
FT                   DHYLEVDYDLSQVMFVATANSLDLPQPLLDRMEIIELSGYTEDEKVEIAKRHLTKKAMD
FT                   SNGIKNSEIKFQDGAILDIIRYYTREAGVRGLSRTISTICRKVVKEVVLKKRKTKANID
FT                   VKSLAKYLGVRKFRFGLAEQNNQVGEVTGLAWTSVGGDLLTIEATAYKGKGKLNYTGQL
FT                   GDVMQESIQAAKSVVRSRAKKFGIDENFDEKLDIHIHVPDGATPKDGPSAGAAMITALV
FT                   SVLTGRKVKSDVAMTGEITLRGEVTPIGGLKEKMLAALRGGIKTVIIPDNNERELSEVP
FT                   DKIKGKLKVIQVKWIDEVLDIALEK"
FT   gene            complement(224784..226049)
FT                   /locus_tag="Rmag_0209"
FT   CDS_pept        complement(224784..226049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0209"
FT                   /product="16S rRNA m(5)C-967 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: hin:HI0624 Sun protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01997"
FT                   /db_xref="GOA:A1AVP0"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVP0"
FT                   /protein_id="ABL01997.1"
FT                   /translation="MANNITRFIALEAIYSVIINKKSLSAFNYPKDNDTPLIKSLVFGT
FT                   IRFYHQLNDIVSKRLKHSFKKEDLDVHCLMLLGAYQLLYSKIAIHASIFETVNVVNALN
FT                   KPWAKALVNAILRKIDRDKKILQQQVHYSHPSWLVKKIKRDYPNDFETIFKQNNTQAPM
FT                   TIRVHTSLNLDHYQQQLQQEGISSQKLAITPQALVLDKATTVFNLVKFEQGACYVQDAS
FT                   AQLSVPLLNPKNTDLILDACSAPGGKATHLCELAPQCKVIALDNDNKRLIKISQNAQRL
FT                   KITNIQTILGSAQNQDWWDSQLFDKILFDAPCSATGVIRRHPDIKLLRKPKDITTLVVL
FT                   QKNILENLWQMLKPSGILLYATCSILKVENEQQIKYFLNTHYDAKEIKIELDWGINTTV
FT                   GRQQLPTDNFDGFYYAKIIKLT"
FT   gene            complement(226039..226764)
FT                   /locus_tag="Rmag_0210"
FT   CDS_pept        complement(226039..226764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0210"
FT                   /product="thiol-disulfide interchange protein DsbC"
FT                   /note="KEGG: noc:Noc_2253 thiol-disulfide interchange
FT                   protein DsbC"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01998"
FT                   /db_xref="GOA:A1AVP1"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVP1"
FT                   /protein_id="ABL01998.1"
FT                   /translation="MLKLLFITTVLFSNNAFADKNAIINTLYPFFGTIDKQYIINTPLS
FT                   DIFEITLRNLIDSLLVSKNDRYLIQNNVVDLTTTARQLIPMNGNVKLIKQALINTIDDH
FT                   DKIIYPAKNEKYIIHVFTDVDCPFCKKLHNGMKQMNDLGITVKYLASPLASLHPAAQGK
FT                   MERIWCADDPVKAMDDYKKNKIILNLKTCHNPVANQLAISKQLGVNGVPTIFLEDGTHL
FT                   LGYMTPAILLQKIKATIGK"
FT   sig_peptide     complement(226708..226764)
FT                   /locus_tag="Rmag_0210"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.999 at
FT                   residue 19"
FT   gene            226850..228271
FT                   /locus_tag="Rmag_0211"
FT   CDS_pept        226850..228271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0211"
FT                   /product="aminopeptidase A, Metallo peptidase, MEROPS
FT                   family M17"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17, leucyl aminopeptidase domain
FT                   protein; KEGG: noc:Noc_0289 leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABL01999"
FT                   /db_xref="GOA:A1AVP2"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVP2"
FT                   /protein_id="ABL01999.1"
FT                   /translation="MKFSLINETVQCFEGDSVVVFCNSNTVFDDKNIQKLITLNHFEPK
FT                   SERVLLLSLVSGFKSKQVIVAGLGDTPVDAKAYVKTLNTVSVVLAEIKAKNLMIQSVKI
FT                   IGFNESWVHKITAKVMHNATYKVQKIGDDKQGSDIEHIAIQSTMDNTSALMQGQAIADG
FT                   MSLTRYLGDLPPNVCTPSYLADTAMSLAEEFNLEYEILEEADMNKLGMGSLLSVSKGSI
FT                   EPPKLISLSYQGNGNEKPIVLVGKGVTFDSGGISIKPGAGMDEMKYDMCGAASVLGTMR
FT                   TIAKIKLNINLVVVVPAVENMPAHNASKPGDVVKSMSGQTIEILNTDAEGRLILCDALT
FT                   YVKKFNPNVVIDVATLTGAVIIALGKHNSGLMSNDQDLANDIICASKISLDGVWQLPIE
FT                   DEYDELLKSNFADMANIGGHEASSITAGCFLSRFTQDYRWAHLDIAGTAWVSGEKKGAT
FT                   GRPVSLLTQFIMNQV"
FT   gene            complement(228858..229279)
FT                   /pseudo
FT                   /locus_tag="Rmag_0212"
FT   gene            complement(229409..230029)
FT                   /locus_tag="Rmag_0213"
FT   CDS_pept        complement(229409..230029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_0450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02000"
FT                   /db_xref="GOA:A1AVP3"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVP3"
FT                   /protein_id="ABL02000.1"
FT                   /translation="MSGIVNLVKWLLIIIGTITTYYAVSLQIKYDGVTGKIISEIISPK
FT                   LHPESMAKVYMPMTNTLLDTGDTAMASIVRVKVADDVSNSDVEEAMESIAIAEGIRSVG
FT                   MLPLSEMVELQTGKKQRFLKIYQYCSPRIAMTMVDHSDAFSAYLPCRLALIEDKQGQRW
FT                   IYTLDMNAMIYGGAPLPDFLLKKALAVQKMIIAIQNGGAEGDF"
FT   gene            complement(230131..230535)
FT                   /locus_tag="Rmag_0214"
FT   CDS_pept        complement(230131..230535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0214"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   vvy:VV0994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02001"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVP4"
FT                   /protein_id="ABL02001.1"
FT                   /translation="MTNNTTPILVKDVMWTQVDIVDSKCTVQNALNNMQHKKTKMLLVD
FT                   KSHEYDEYGVVLIADIASKVIAKDRALDRVNVYEIMNKPVISVRPDMDILYCARLLTNF
FT                   SLSRCPVLDNGKIIGVVGLTNIVFNGLRVV"
FT   gene            complement(230535..230885)
FT                   /locus_tag="Rmag_0215"
FT   CDS_pept        complement(230535..230885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0215"
FT                   /product="putative nitrogen regulatory protein P-II family
FT                   protein"
FT                   /note="KEGG: vpa:VP0813 putative nitrogen regulatory
FT                   protein P-II family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02002"
FT                   /db_xref="GOA:A1AVP5"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVP5"
FT                   /protein_id="ABL02002.1"
FT                   /translation="MHFKLIIAFVDSDKTDKILEAARTKGATGSTIISQARGEGLKHNK
FT                   TFLGLNIETPRDVLLLLVEQHLSRGILETISDTGHFESSPQEGIAFQIDVEDAVGVMHQ
FT                   IHALEHTIEKKI"
FT   gene            complement(230894..231634)
FT                   /locus_tag="Rmag_0216"
FT   CDS_pept        complement(230894..231634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0216"
FT                   /product="protein of unknown function DUF1538"
FT                   /note="PFAM: protein of unknown function DUF1538; KEGG:
FT                   vpa:VP0812 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02003"
FT                   /db_xref="GOA:A1AVP6"
FT                   /db_xref="InterPro:IPR011435"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVP6"
FT                   /protein_id="ABL02003.1"
FT                   /translation="MSIVDNFISMFWNVAPIVMVLLGFQIIILKQKIPHLKKIIIGFIL
FT                   VWIGLTLFIVGLEKVLFPLGKLMANQLTSSNFIGSDALSWSDYYWVYIFAASIGFATTI
FT                   AEPSLLSVAIKANQVSGGFIKVWPLRIAVAIGVAVGIAIGSFRIVTGLPLHYFIIAGYI
FT                   VVLIQTYFAPKNIIALAYDSGGVTTSTVTVPLVAALGLGLASTIDGRSTLIDGFGLIAF
FT                   ASLFPIMSVMAYVQIIKFLKQDKK"
FT   gene            complement(231631..232362)
FT                   /locus_tag="Rmag_0217"
FT   CDS_pept        complement(231631..232362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0217"
FT                   /product="protein of unknown function DUF1538"
FT                   /note="PFAM: protein of unknown function DUF1538; KEGG:
FT                   cps:CPS_1953 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02004"
FT                   /db_xref="GOA:A1AVP7"
FT                   /db_xref="InterPro:IPR011435"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVP7"
FT                   /protein_id="ABL02004.1"
FT                   /translation="MKKTVQQFISNLIDSVKDLAPIIGVITFFQIVVLQQSIPNLMDIM
FT                   IGTGFILLGLTLFVYGLKLGLFPIGEVLAYSFVKKGSIFWLLLFAFALGFGTTVTEPAL
FT                   IAVANEAAKVAHLGGIVNTQTELNSYAQTLRFTVAISVGLAVVIGVFRILKGWPIQYLI
FT                   IGGYLLVIITTFFAPDFIIGIAYDSGGVTTSTITVPLLTALGVGLTSSISGRNPLTDGF
FT                   GMIAIASLLPIIAVMLFGILL"
FT   gene            232489..233349
FT                   /locus_tag="Rmag_0218"
FT   CDS_pept        232489..233349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0218"
FT                   /product="aminodeoxychorismate lyase apoprotein"
FT                   /EC_number="4.1.3.38"
FT                   /note="PFAM: aminotransferase, class IV; KEGG: noc:Noc_1662
FT                   aminotransferase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02005"
FT                   /db_xref="GOA:A1AVP8"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR017824"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVP8"
FT                   /protein_id="ABL02005.1"
FT                   /translation="MNSTLLINGKKQTKLSVLNRLVQFGDGLFETCLIEDAKLLFWSKH
FT                   FSRLKKGYDKLKIYPVSETIWLKEIAKAFTISKLDQAVVKIIISRGESVRGYGYEKNIK
FT                   PTRIVIVSPVPDLPWQYHLEVCVSGYSGNQLLSEIKHCNRLEQVFARSELQTQECIMLD
FT                   ENAQVISVTQGNIFAIRNQVIFTPSLTDCGIEGTRRSVVFDLVQVLGLKLEICSLSLSE
FT                   LLEADEVFITNSMIGVKPVDKINQQLFNHHQITNQLISAFIRSKNNHLSSVLLKSKSPY
FT                   FCIFS"
FT   gene            233425..233813
FT                   /pseudo
FT                   /locus_tag="Rmag_0219"
FT   gene            233845..234462
FT                   /locus_tag="Rmag_0220"
FT   CDS_pept        233845..234462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0220"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; KEGG: nmu:Nmul_A1387
FT                   thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02006"
FT                   /db_xref="GOA:A1AVP9"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVP9"
FT                   /protein_id="ABL02006.1"
FT                   /translation="MQRGKFITIDGVEGSGKSTQIDFICDYLVTKKINVILTREPGGTE
FT                   LGEKIRTLLLSTDIQSIHGDTELLLLFAARNEHIRTKIIPSLEKGDWVLSDRFTDASYA
FT                   YQGGGRGLSIERITQLEKWVLQDFTPDVTLLLDVSVALGMSRVESRGRKDRIELETNDF
FT                   FKRVRNSYIERSKQFPKRIKLIDASKTLEQTAQQIKIILQVL"
FT   gene            234459..235466
FT                   /locus_tag="Rmag_0221"
FT   CDS_pept        234459..235466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0221"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: cbu:CBU_0500 DNA polymerase III, delta prime
FT                   subunit; similar to ATPases involved in DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02007"
FT                   /db_xref="GOA:A1AVQ0"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVQ0"
FT                   /protein_id="ABL02007.1"
FT                   /translation="MNFPWHANAWSKLQNMIDQDRMPHALLITGVEKIGKFELMQQIVG
FT                   VLLKDDVIIRKDNIREDLDYSVLIRHSNYPNMVYCRSGEMVEKSKNRSKNIRIEQVRVF
FT                   CDALNKTADQLQIGVIFYGDQMNMSAANGLLKTLEEPRKNTLIIILAHHVENLPDTVVS
FT                   RCQNIYIAPAYDQQTCQWLIEHIGKTQNADFDILQLLENTHGVPFKALSELSDGNFIHY
FT                   QHYQNQLLNIAINPLMVTQIKEFEGNELVVLNCLQNIVIEGIRLKTIHQEGGLIELNQV
FT                   IKAVKFEFLFKLLDDIYHTIKLSKTTVNIKLLLDIILIIWSHITHLKQYPQIIQ"
FT   gene            235504..236790
FT                   /locus_tag="Rmag_0222"
FT   CDS_pept        235504..236790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0222"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; KEGG: cps:CPS_4629
FT                   glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02008"
FT                   /db_xref="GOA:A1AVQ1"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVQ1"
FT                   /protein_id="ABL02008.1"
FT                   /translation="MNQSETLFAQAKTVIPGGVNSPVRAFNGVGGSPIFFTRGEGAYLF
FT                   DEDDKKYIDYVASWGSMILGHTNQAVIIAVKTTLENGLGFGAPTQIETKLAEKVCELMP
FT                   SIELVRMVSSGTEATMSAIRLARGHTGRDKIIKFEGCYHGHSDSLLIKAGSGALTLGVP
FT                   TSPGVPKDFAKHTLTLEYNNIDQVCEVLSEVGAEVACIIVEPVAGNMNCIPPIDGFLQV
FT                   LRELCDEYGVILVFDEVMTGFRVALGGAQAFYNVKPDLTTLGKVIGGGLPVGAFGGKRE
FT                   IMQSIAPLGPVYQAGTLSGNPISMSAGLVMLNVLSKDENFYTILNTKVQKLTKGILAKA
FT                   KENNIGMTANVVGGMFGLFFTDSQSVTNFKETSQCNIELFKKFFHLMLAEGVYMAPSAY
FT                   EAGFVSSAHSDTDIQNTIDAAGRAFIKLT"
FT   gene            237349..238002
FT                   /locus_tag="Rmag_0223"
FT   CDS_pept        237349..238002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0223"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; KEGG: tcx:Tcr_0999 HAD-superfamily subfamily IB,
FT                   PSPase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02009"
FT                   /db_xref="GOA:A1AVQ2"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVQ2"
FT                   /protein_id="ABL02009.1"
FT                   /translation="MALAIFDLDKTLIKGDSDFLWGEFLSEIGAVDAGTYQSKNQYFID
FT                   QYVLGKLDINEYLEFCLMPLSQHSIQILNQWHQQFMSQKIEQILLPKAQVVVDAHKTKG
FT                   DIVIVITATNRFVAEPIVARYGIEHLLATNPEIKEGQYTGKIEGEPCFQSGKINHLNKW
FT                   LKETGENIKGASFYSDSHNDLPMLELVDYPIVVHGDDKLNTFAIERDWQCLDWM"
FT   gene            complement(238031..238546)
FT                   /locus_tag="Rmag_0224"
FT   CDS_pept        complement(238031..238546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_0575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02010"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVQ3"
FT                   /protein_id="ABL02010.1"
FT                   /translation="MSDNKKMTIIATKGTFDWAFPPFIIASTGVAMDKEVTIFFTFYGL
FT                   NLLLKDTSKLRVSPLGNPGMPMKLPFGPEWLQKINFGPKIPNIFWSLPFTEYLATFLMK
FT                   KTMKKNGVATLDELRSMCQEFDVKFIACEMTVGLFGYSKDDFIDGIEFAGAATYFNECD
FT                   GSNHNLYM"
FT   gene            complement(238575..238799)
FT                   /locus_tag="Rmag_0225"
FT   CDS_pept        complement(238575..238799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0225"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: mag:amb0858
FT                   predicted redox protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02011"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVQ4"
FT                   /protein_id="ABL02011.1"
FT                   /translation="MADETLDASGLNCPLPILKTKKALSKMDAGKILNVISTDVGSVKD
FT                   IEAFCNQTGNKLISTIEESGKYIFNIEKA"
FT   gene            238966..239995
FT                   /pseudo
FT                   /locus_tag="Rmag_0226"
FT   gene            complement(240174..240845)
FT                   /locus_tag="Rmag_0227"
FT   CDS_pept        complement(240174..240845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0227"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="KEGG: tcx:Tcr_1568 ribose 5-phosphate isomerase;
FT                   TIGRFAM: ribose 5-phosphate isomerase; PFAM: Ribose
FT                   5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02012"
FT                   /db_xref="GOA:A1AVQ5"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVQ5"
FT                   /protein_id="ABL02012.1"
FT                   /translation="MTQDEMKFAVAQAALKHVVKDTIIGVGTGSTTNFFIDALAKIKNE
FT                   IKGAIASSKATRQRLESYDIKVFDLNEVETISVYIDGADESDDGLNLIKGGGGALMREK
FT                   IVAAVANQFICIADESKLVTIMGDFPLPVEVIPMASNYVKYQISQRIGGTPTVRENFIT
FT                   DNGNLILDIKDLKITNPKVMETKLNSITGVVANGLFANRGADILLLGTSNGVKIVTRLI
FT                   G"
FT   gene            240887..241492
FT                   /locus_tag="Rmag_0228"
FT   CDS_pept        240887..241492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0228"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein; KEGG:
FT                   vpa:VP2621 Ham1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02013"
FT                   /db_xref="GOA:A1AVQ6"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVQ6"
FT                   /protein_id="ABL02013.1"
FT                   /translation="MQKIILASNNQGKIKEFNIMLSGIYEVVSMQDMQVEEVPEIGLTF
FT                   VENALIKARNASMISGLPALADDSGIVVDALGGRPGIYSARYANHHGDDKANTQKLLNE
FT                   MATVPEGARSARFWCAVVFVGHENDPTPIIIQRGWEGEILREKMGDNGFGYDPIFYLPT
FT                   HNCTSAELSSIEKNKISHRSRALSALLKILKTNQWTMR"
FT   gene            241529..242604
FT                   /pseudo
FT                   /locus_tag="Rmag_0229"
FT   gene            243517..243804
FT                   /pseudo
FT                   /locus_tag="Rmag_0230"
FT   gene            243885..244151
FT                   /pseudo
FT                   /locus_tag="Rmag_0231"
FT   gene            244285..245175
FT                   /locus_tag="Rmag_0232"
FT   CDS_pept        244285..245175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0232"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: tcx:Tcr_1899 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02014"
FT                   /db_xref="GOA:A1AVQ7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVQ7"
FT                   /protein_id="ABL02014.1"
FT                   /translation="MLNNMSNNTNNITSVLTESLPYIKKFQGKTIVIKYGGNAMVDEAL
FT                   KSSFARDIVLMKLVGMNPIVVHGGGPQIGKTLKKIGKQSQFIDGMRVTDSETMDVVEMV
FT                   LGGLVNKEIVNLIHQHGGHSIGLTGKDGSLISAKKLKHDIEPTSEIIDLGHVGEVDKID
FT                   ISVINLLLKGDFIPVIAPIGVGKDGFSYNINADLVASAIAQALNAEKLILLTNASGLLD
FT                   ANGELLTRLDDNIIDGLIKDGTIHSGMLPKINCALSAVKNGVKSTHIIDGRVAHAVLLE
FT                   VFTNSGVGTLITCNE"
FT   gene            245168..246016
FT                   /locus_tag="Rmag_0233"
FT   CDS_pept        245168..246016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0233"
FT                   /product="dihydroorotate oxidase B, electron transfer
FT                   subunit"
FT                   /EC_number="1.3.98.1"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   noc:Noc_0363 dihydroorotate dehydrogenase electron transfer
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02015"
FT                   /db_xref="GOA:A1AVQ8"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR037117"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVQ8"
FT                   /protein_id="ABL02015.1"
FT                   /translation="MNKASIKIHDCQILAHYQFEGKQYILTLASNIIAKQTKPGQFVHL
FT                   TVSSALAMRRPISIMSVDIENGTFDLLYKVVGEGTRQLSQRKVGDILSIIGPIGNGFKL
FT                   TDKKRPLLIGGGAGMPPMIAIAQQIKDLGYESFAILGSEVPFPFVDKLADNNKDYQGAT
FT                   YTMPELEDWGIECRLTSLQGFDGTFKGFVTDLAKIYLDNLKTDERMQVEIYACGPRLML
FT                   VAVANLAKEYNLPCQISLEENMACAVGGCAGCVVEIQTNQGISMKRVCVDGPVFDAYQI
FT                   F"
FT   gene            246013..246651
FT                   /locus_tag="Rmag_0234"
FT   CDS_pept        246013..246651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0234"
FT                   /product="Protein of unknown function UPF0001"
FT                   /note="TIGRFAM: Protein of unknown function UPF0001; PFAM:
FT                   alanine racemase domain protein; KEGG: eca:ECA3627 putative
FT                   alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02016"
FT                   /db_xref="GOA:A1AVQ9"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVQ9"
FT                   /protein_id="ABL02016.1"
FT                   /translation="MIKDNLEKIQERINQVNHTQFVTLIAVSKTRSVDELQQAINTGQK
FT                   HFAENYLQEALIKINHLKGQNLIWHFIGPIQSNKTLKIAKNFDWVHSVDRLKIAKRLNE
FT                   QRPKNLPNLKVLLQINIDNEPIKSGASIEQIDELVTHFESLKNLTLRGFMCIPNPSNSA
FT                   QNFTRMTSIIKQYPNLDALSMGMSRDLESAITNGATFLRIGTDIFGKRA"
FT   gene            248041..250506
FT                   /locus_tag="Rmag_0235"
FT   CDS_pept        248041..250506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0235"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: lpp:lpp1719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02017"
FT                   /db_xref="GOA:A1AVR0"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVR0"
FT                   /protein_id="ABL02017.1"
FT                   /translation="MIKKKRLSGIKVLKISTWVSVIFTFIFVLVVLFFVIFPMLLKVPI
FT                   ETQLSSLTGLDVQLSKITFDFEKKGITLKVHDISIASGEAQQMAMIKNLSWHINLLSLF
FT                   DDIYHSSQIFIDTLVLYSNLDDFSIDDIRNIASLGMLKELYFFESLHINKTIIKDTVEI
FT                   ASLTLKRDGMQLLLTIPNQSIGTKHLDITIILSSAKINQNGFLTLPITLSGDDFELLSS
FT                   LKIYSYQGYDFIQFSGLIQRMNVINISDYLPMVLIGDINHQWIKHAFQSGELDNINISI
FT                   KKNLSTQLPAKIKFDAHLSNTELLFNTDWQSLKQLDANIAIDGRKITVMVNHTMLNDMF
FT                   LQGMKVQILDMSKDKLEISVVGKINTQSEILTQFLKDAPLNDNVNDVLGKFSLSGKVVG
FT                   NVDLIISLDETEPILDINLSIQDNRMTTLGGAIVVKNYDAQLTLHNNKITSKGVGNIRG
FT                   ESFNIRINSNNQDSGLDALFKVGLTNGNNFEFYLTKYLDQTWQANVKSDTLKTDVKIIL
FT                   NENALPEVKLINLQVEALDKIKGNWDIQAKDFPSMHLSVQNIQVGESKWPDFEATLGSQ
FT                   DKVLKIINLEFLGIGVNSQNLSFDGAWVDGRTILTAKAKGSKLSKFLDKLNIKEKVRGG
FT                   QFEFDIRLFCNCAPWNMSFKGASGLIKMKVKEGVFTNKDPNISRVLSLLNIKSIAKRLE
FT                   LDITDLVSEGFVYDTIDAQVSINNSMATISHFKLDSSSSTINLTGSSNIVKQTYHLEAK
FT                   VLPAISDAVPITTYLAGGGLSGMVVWLVDKILFKGKLINNIVDKVVEFKYKITGPWNKP
FT                   IIENISTVL"
FT   gene            250503..251927
FT                   /locus_tag="Rmag_0236"
FT   CDS_pept        250503..251927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0236"
FT                   /product="microcin-processing peptidase 2, Unknown type
FT                   peptidase, MEROPS family U62"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   plu:plu4064 tldD protein, suppresses the inhibitory
FT                   activity of the carbon storage regulator (CSRA)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02018"
FT                   /db_xref="GOA:A1AVR1"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVR1"
FT                   /protein_id="ABL02018.1"
FT                   /translation="MIEQLLDDHRLNQEKITILLSSLAAKGTDYADLYFQHSAVESWFL
FT                   EESIVKSGTYHISHGVGARAVSSDQTGFAYSDDLNIKAIEKAISFAKGISTQTGTRRIQ
FT                   AFQSIPQVARYNGSNPLSSFSSQEKVNFLKRIDILGRKEPKVKQVSALISGGFSEVLIA
FT                   STDGVFAKDYRPMVRVSVSIIVEHNGRTESASSGGGGRYNYRYFIDHALDEIYVNEAIR
FT                   QALVALESKKAPAGNMPVILGPGWPGVLLHEAIGHGLEGDFNRKKSSIFTNRIGEQVAS
FT                   DKCTIVDNGTLENRRGSLTIDDEGIPTQNTLLIENGILKGYLFDKMNAKLMNTVSTGNG
FT                   RRESYAHIPIPRMTNTYMLNGQDSLKNMITSVDNGIYAVNFDGGQVNITSGKFVFSANE
FT                   AYLIKNGKIMHPIKGVTLVGSGAEVLKKISMVANDLKLDNGVGVCGKDGQNVPVGVGQP
FT                   SLKIDQLTVGGTEVNA"
FT   gene            252028..252384
FT                   /locus_tag="Rmag_0237"
FT   CDS_pept        252028..252384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0237"
FT                   /product="NADH dehydrogenase subunit A"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 3; KEGG: tcx:Tcr_0817 NADH-ubiquinone/plastoquinone
FT                   oxidoreductase, chain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02019"
FT                   /db_xref="GOA:A1AVR2"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVR2"
FT                   /protein_id="ABL02019.1"
FT                   /translation="MLESYIPVIVFIFLGLAFGVGPMLIGYLLGPSKPYEEKNTQFECG
FT                   FPAFDDSRMYFNVRYYLVAILFILFDLEVAFVFPWAVVQSQLGWFGFIAISIFLFLLAV
FT                   GFIFEWKNGALEWE"
FT   gene            252388..252867
FT                   /locus_tag="Rmag_0238"
FT   CDS_pept        252388..252867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0238"
FT                   /product="NADH dehydrogenase subunit B"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: nmu:Nmul_A1092 NADH-quinone oxidoreductase, B
FT                   subunit; TIGRFAM: NADH-quinone oxidoreductase, B subunit;
FT                   PFAM: NADH ubiquinone oxidoreductase, 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02020"
FT                   /db_xref="GOA:A1AVR3"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVR3"
FT                   /protein_id="ABL02020.1"
FT                   /translation="MAIEGLMKQGFVTTSLNNVINWARTGSLWPMTFGLACCAVEMMEA
FT                   GSSRYDLDRFGIVFRPTPRQSDLMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCAN
FT                   GGGYYHYSYAVVRGCDRIVPVDIYVPGCPPTAEALLYGIIQLQDKIRSTNTIART"
FT   gene            252867..253481
FT                   /locus_tag="Rmag_0239"
FT   CDS_pept        252867..253481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0239"
FT                   /product="NADH dehydrogenase subunit C"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: lpn:lpg2787 NADH dehydrogenase I, C subunit;
FT                   TIGRFAM: NADH (or F420H2) dehydrogenase, subunit C; PFAM:
FT                   NADH dehydrogenase (ubiquinone), 30 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02021"
FT                   /db_xref="GOA:A1AVR4"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVR4"
FT                   /protein_id="ABL02021.1"
FT                   /translation="MQDLKASLIKVFGERHLVEAFGELTLIVDSQDIIKTCLKLRDFFY
FT                   FDTLIDLCGVDYLTYGQSDWNGNASASGFSRGRNHQGSKDRHEQRFVVVYHLLSVSKNK
FT                   RIRVKSFVDEAEPIIKSVTDIWASADWYEREAFDLMGILFENHTDLRRILTDYGFKGHP
FT                   LRKDFPMIGEVEMRYDEDLGRVVYEKVSIEPNINVPRVIRK"
FT   gene            253483..254736
FT                   /locus_tag="Rmag_0240"
FT   CDS_pept        253483..254736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0240"
FT                   /product="NADH dehydrogenase subunit D"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: tcx:Tcr_0820 NADH dehydrogenase I, D subunit;
FT                   TIGRFAM: NADH dehydrogenase I, D subunit; PFAM:
FT                   NADH-ubiquinone oxidoreductase, chain 49kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02022"
FT                   /db_xref="GOA:A1AVR5"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVR5"
FT                   /protein_id="ABL02022.1"
FT                   /translation="MAEIRNYTLNFGPQHPAAHGVLRLILEIDGEVIERADPHIGLLHR
FT                   GTEKLVESKPYNQSIGYMDRLDYVSMMCNEHAYIMAIETMLGIKVPERAQYIRVMFDEI
FT                   TRILNHLMWLGTHGLDVGAMSIFLYAFREREKLIDCYEAVSGSRMHATYYRPGGVYRDL
FT                   PDKMPQYLASGFRTDKELKTMNENRQGSLLDFIADFVKEFPKSIKQYDDLLTDNRIWKQ
FT                   RLVNIGIVSANRAKQLGFTGPMLRGSGVAWDLRKNQPYAVYDQLEFDIPVGVTGDSYDR
FT                   YLVRMEEMRQSNHIIKQCVKWLQGNPGAVMSDDHKVSPPKRTDMKGDMESLIHHFKLFT
FT                   EGYCLSEGEIYRAVEHPKGEFGIYLISDGANKPYRVKIRAPGFAHLAAMNEMARGHMLS
FT                   DVVTIIGTQDIVFGEIDR"
FT   gene            254733..255206
FT                   /locus_tag="Rmag_0241"
FT   CDS_pept        254733..255206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0241"
FT                   /product="NADH dehydrogenase subunit E"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: tcx:Tcr_0821 NADH-quinone oxidoreductase, E
FT                   subunit; TIGRFAM: NADH-quinone oxidoreductase, E subunit;
FT                   PFAM: NADH dehydrogenase (ubiquinone), 24 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02023"
FT                   /db_xref="GOA:A1AVR6"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVR6"
FT                   /protein_id="ABL02023.1"
FT                   /translation="MISIGAKKQIDAWIAKYPKDRKSSAVMQTLKIIQAENENKLSADT
FT                   IQAVADYLDMPDIAVQEVATFYENYNHKKVGKYVIRFCHNISCMLNGADDLIAYLENKL
FT                   GVQTDEVTPDGLISVKKVECLGACVGAPMFQINDEYFENLTFDKIDKIVDNLK"
FT   gene            255203..256471
FT                   /locus_tag="Rmag_0242"
FT   CDS_pept        255203..256471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0242"
FT                   /product="NADH dehydrogenase subunit F"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: lpp:lpp2831 NADH dehydrogenase I chain F;
FT                   TIGRFAM: NADH-quinone oxidoreductase, F subunit; PFAM:
FT                   Respiratory-chain NADH dehydrogenase domain, 51 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02024"
FT                   /db_xref="GOA:A1AVR7"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVR7"
FT                   /protein_id="ABL02024.1"
FT                   /translation="MNEVCFKSLIKDQCWSLKTYEANGGYSVWCKILKGELTPEYIIDE
FT                   LKTSGLRGRGGAGFPTGLKWSFMPRHSDGQKYVICNSDEGEPGTCKDRDILRFNPHAVI
FT                   EGMAIGGFVMNASVGYNYIRGEFMEPFYRFEDALKEAYKVGLLGRNINNSSVNFDLYTH
FT                   LGAGAYICGEETALLESIEGKKGQPRFKPPFPANVGLFGKPTMINNTESFASVPEILRC
FT                   GGQWFADIGVENSGGCKLFSVSGHVKNPANFEVPMGTPFKDLLKMAGGMRDGARLKAVI
FT                   PGGSSTPVLTAKVAMNMTMDYDGIEKAGSMLGAGSVIIMDESTCMVEVLTRLTHFYYDE
FT                   SCGQCTPCREGTGWLYRVLKRIIDGNGEQTDIDLLLGVQDKIIGNTICALGDAAAMPVE
FT                   SFLRNFRLEFKYYIEHGKSMVKG"
FT   gene            256476..258737
FT                   /locus_tag="Rmag_0243"
FT   CDS_pept        256476..258737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0243"
FT                   /product="NADH dehydrogenase subunit G"
FT                   /EC_number="1.6.5.3"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, chain G; PFAM:
FT                   ferredoxin; molybdopterin oxidoreductase; KEGG:
FT                   tcx:Tcr_0823 NADH-quinone oxidoreductase, chain G"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02025"
FT                   /db_xref="GOA:A1AVR8"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVR8"
FT                   /protein_id="ABL02025.1"
FT                   /translation="MADIEIEIDGKIISAKAGEMLIKVTDREGVSVPRFCYHKKLSVVA
FT                   SCRMCLIDVEGAPKPQPACSTPVNEGMKVHTQNDKAKVSQKAVMEFLLINHPLDCPICD
FT                   QGGECELQDVAVEYGSDVSRFSEDKRIVSDSDIGALIQTDMTRCIHCTRCVRFGLEIAG
FT                   IMEMGGTGRGEHLKIEPFLREGIQSELSGNMIDVCPVGALTSKPFRYELRSWQMHSIPS
FT                   IARHDLVGSNLFVQTYKDKVKRVVSADNDWVNETWISDRDRFSYEGLTHENRLLEPQIK
FT                   VQGQWKQVSWKVALDYAIKGLNSHVLKHKKVNQLGGLVSNTATMEELYLLKKILTEVGC
FT                   DNIDHRLNVKNLDNTITLDSNIKLDALEKIDYALIVGANIRLEQPMINHRLRKATKKGA
FT                   DIDTLNVMAFDFNYSLNTENIIAPNKIAFTLAGVLKSVITSNTQELPDYLVAVEIDEVA
FT                   NKIASKLLNSSSSVIILGEHIINNEDASVIANLVTKIAKNTNSKTLNLSITANTIAANL
FT                   VGFVPQNSGMNVNTMFTSDMLGFILLDIYPQYDFHDLDTAIKTFMPDNTFVISLNSFKD
FT                   DIVTGYSDVIFPIASIYETSGTQLNINNDMKSYTAAVKAPNEVKPAWKVLKVMADLLEL
FT                   PGFHYADSTQIRAEISHQPHAKYVHDECINLTSKHNGISTIWQSSPYSIDAVLRHSRAL
FT                   QKTKIGQMNNACINPVSAEILGLSADDKYLGVPVVITSTVADDCVFINANQPTNIQEQE
FT                   "
FT   gene            258737..259810
FT                   /locus_tag="Rmag_0244"
FT   CDS_pept        258737..259810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0244"
FT                   /product="NADH dehydrogenase subunit H"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase, subunit
FT                   1; KEGG: tcx:Tcr_0824 respiratory-chain NADH dehydrogenase,
FT                   subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02026"
FT                   /db_xref="GOA:A1AVR9"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVR9"
FT                   /protein_id="ABL02026.1"
FT                   /translation="MELWQAFVQMVYTLTPWFDGTIASILIILIKAITLVIPLMLVVAY
FT                   FTYAERKVIGYMQLRIGPNRVGPKGWLQPIADALKLMTKEIIFPTKANIYLFLLAPVLA
FT                   IAPAIAVWVVIPFDEDIYITNLDISLLYVLAIGSIGVYGIILAGWASNSKYPLLGALRS
FT                   ASLLVSYEIVIGFALATVVMIAGSVNLNTIVQAQQGGIIYWNFIPLFPMMIIFFISALI
FT                   ETNRAPFDVVEGESEIVGGTHVEYSGMTFAVFFLAEYANMILMAVLAVVMFFGGWHSPF
FT                   EAIPYLESAFSWVPGIIWLLAKTTFFMFLYLWVRATFPRFRYDQIMRLSWKVFLPITII
FT                   WIFVVALMTQLKLEPWF"
FT   gene            259824..260315
FT                   /locus_tag="Rmag_0245"
FT   CDS_pept        259824..260315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0245"
FT                   /product="NADH dehydrogenase subunit I"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: tcx:Tcr_0825 NADH-quinone oxidoreductase,
FT                   chain I; TIGRFAM: NADH-quinone oxidoreductase, chain I;
FT                   PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02027"
FT                   /db_xref="GOA:A1AVS0"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVS0"
FT                   /protein_id="ABL02027.1"
FT                   /translation="MIKKLSKLVKDFTLSELRTGMKITAKELVNKKITVQFPEERTPIS
FT                   PRFRGLHALRRYPNGEERCIACKLCEAVCPANAITIESEMRDDGTRRTIVYDIDLFKCI
FT                   FCGFCEEACPVDAIVETQIFDYAFKSRQGSIMTKERLLEVGSQNEQAINQARLEDAKYK
FT                   "
FT   gene            260325..260933
FT                   /locus_tag="Rmag_0246"
FT   CDS_pept        260325..260933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0246"
FT                   /product="NADH dehydrogenase subunit J"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 6; KEGG: noc:Noc_2556 NADH-ubiquinone/plastoquinone
FT                   oxidoreductase, chain 6"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02028"
FT                   /db_xref="GOA:A1AVS1"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVS1"
FT                   /protein_id="ABL02028.1"
FT                   /translation="MNSEQIIFYILSFWFIVSSLAMIFSRNAAKAVLFLVLAFFNAASI
FT                   WILLEAEFLAITLILVYVGAVMVLFLFVIKMLNIDKSTLRAKFTGYLPLGLIVAAIIVA
FT                   EMSLVLGANQFGLDVFSSPERHGMDYSNITVLAMQLYTTYVYPFELAAVLLLIAIIAAI
FT                   TLVYRNETSRKKQSISEQVNVQAKDRVRLVSITPSKGDK"
FT   sig_peptide     260325..260411
FT                   /locus_tag="Rmag_0246"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.899) with cleavage site probability 0.625 at
FT                   residue 29"
FT   gene            260934..261239
FT                   /locus_tag="Rmag_0247"
FT   CDS_pept        260934..261239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0247"
FT                   /product="NADH dehydrogenase subunit K"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 4L;
FT                   KEGG: rso:RSc2052 probable transmembrane NADH dehydrogenase
FT                   I (chain K) oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02029"
FT                   /db_xref="GOA:A1AVS2"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVS2"
FT                   /protein_id="ABL02029.1"
FT                   /translation="MVSLSDYLILSSVIFCIGLVGIFVNRTNIITLLMCVELILVAVNT
FT                   NFVAFSHFLGNEVGQIFVFFILTVAAAEVAIGLAILTLLFRNRGSISVDVTNSLKG"
FT   gene            261242..263203
FT                   /locus_tag="Rmag_0248"
FT   CDS_pept        261242..263203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0248"
FT                   /product="NADH dehydrogenase subunit L"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: eba:ebA4846 NADH dehydrogenase I, chain L;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain L; PFAM: NADH-Ubiquinone oxidoreductase (complex I),
FT                   chain 5/L domain protein; NADH/Ubiquinone/plastoquinone
FT                   (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02030"
FT                   /db_xref="GOA:A1AVS3"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVS3"
FT                   /protein_id="ABL02030.1"
FT                   /translation="MEKLYLTIAFSPLVGAILAGFFGTILGKTVTHILTILGVLISTVL
FT                   SLYVFNYHVLEQGEVFNQNLYTWMQLSNLNVSVGFLIDNLTAVMLVVVSFVSLMVHIYT
FT                   IGYMHDDTGYTRFFSYISLFTFSMFMLVMSNNFMQLFFGWEAVGLVSYLLIGFWHHKES
FT                   AIQANLKAFLINRVGDFGFLLGIGLVLAFSGSLDYMEVFSSLDKTMNQQLWGLDLITII
FT                   CLLLFVGAMGKSAQVPLHVWLPGSMEGPTPISALIHAATMVTAGIFMVSRMSPMFELSD
FT                   VALMVIMIVGAITALFMGLLGIVQNDIKKVVAYSTLSQLGYMTVALGVSAYSVAIFHLM
FT                   THAFFKALLFLGAGSVIVAMKHQQDIRKMGGLRKKMPITYWTAFIGTLALIGFPGFSGF
FT                   YSKDMIIEAVHFSSLPYASWVYVAVIVGVFITAFYSLRMFFLVFHGKSRVDVHTAKHLH
FT                   ESAPSMIFPLIALSIPSLMIGYLTIEPMLFNGWLNNAITIASSHVSMTELRGEFHSAAS
FT                   MIPHAIQTLPFWMMIGGIVTAWIFSIYRTQWSDWIQKKCHRTSYVLESLYGFDRFNDIV
FT                   FVSGVKKLGNILYKVSDVGLIDKILVNGSAKLIGLVGKIIRPIQTGYVYHYAFFMIFSL
FT                   LIILTWVLFAGNNPLLEF"
FT   sig_peptide     261242..261325
FT                   /locus_tag="Rmag_0248"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.756) with cleavage site probability 0.735 at
FT                   residue 28"
FT   gene            263206..264711
FT                   /locus_tag="Rmag_0249"
FT   CDS_pept        263206..264711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0249"
FT                   /product="NADH dehydrogenase subunit M"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: tcx:Tcr_0829 proton-translocating NADH-quinone
FT                   oxidoreductase, chain M; TIGRFAM: proton-translocating
FT                   NADH-quinone oxidoreductase, chain M; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02031"
FT                   /db_xref="GOA:A1AVS4"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVS4"
FT                   /protein_id="ABL02031.1"
FT                   /translation="MQNSLLSLLIWLPIFSSVLVIFIGNNRVNTARWVSVIISILVFMI
FT                   SLSLYTGFDSSTHLMQFVEKESWILQLNIHYHIGVDGISMPLIILTTFSTILVIVAGWE
FT                   VIAKRCAHYMAAFLMMEGLIIGVFSSLDAILFYAFWEASLIPMLLIIGIWGGDNRVYAS
FT                   IKFFLYTFLGSVFMLVSFIYMHNKGGSFLILDMHNLELSLEEQSYIFWAFFMAFAVKVP
FT                   MFPVHTWLPDAHVQAPTGGSVILAAIMLKMGGYGFFRFSLPITPDASLEFSEIIIVLSL
FT                   IAIVYIGFVALVQRDMKKLIAYSSISHMGFVTLGVFTLFLTYKPDTIEGALLGLEGAMV
FT                   QMISHGFISAAMFLVVGVLYDRLHSREISTYGGVINSMPKFTGFALLFAMANVGLPGTS
FT                   GFVGEFMVILGAIQANIWYGVLVASTLIVGAAYTLWMVKRVFWGVVSNPAVATLKDINA
FT                   REFSMLAILVVAVLIMGLYPQPVLELMYISIEHLLHQALTSKF"
FT   gene            264715..266169
FT                   /locus_tag="Rmag_0250"
FT   CDS_pept        264715..266169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0250"
FT                   /product="NADH dehydrogenase subunit N"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: tbd:Tbd_1155 NADH dehydrogenase I chain N;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain N; PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02032"
FT                   /db_xref="GOA:A1AVS5"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVS5"
FT                   /protein_id="ABL02032.1"
FT                   /translation="MNNFIEFDTSSLWIALPEIFLLSAIVIVLLIDLFLDKNFKQVTYY
FT                   LIQLSLFITGLLAFNLIDHPQIIIFGGSFVLDNMASVFKVFMMAATMVAMVYSRHYLRT
FT                   HSLFRGEYFVLVLLSVLGMMVMVSGYSLLTLYLGLEILSLSLYALIAIARERADAIEAA
FT                   LKYFVLGAIASGLLLYGMSMIYGISGSLNINDIASFASNTNLDSRETLIINFGLVFLVI
FT                   GIAFKLGAVPFHMWVPDVYQGAPTSVTLFISTVPKIAAFAMLVRILVDGLDSMHAYWSD
FT                   LFMVLSILSIALGSVVALMQSNIKRMLAYSTISHVGFIMLGFVAGTPIGYGAAAFYMLV
FT                   YVLMSLAAFGMIILLNKQGFEIDQISDFKGLNKHAPWFALMMLIIILSMAGVPPLVGFY
FT                   SKFFILQQVVSAGFITIAVIVVIFAVISAYYYLQIIKSMYFDETDKKITIYASIDIQLV
FT                   LSINAILILAVGLFPDFWMKLALSLF"
FT   gene            266494..274953
FT                   /locus_tag="Rmag_0251"
FT   CDS_pept        266494..274953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0251"
FT                   /product="glycosyl hydrolase, BNR repeat-containing
FT                   protein"
FT                   /note="PFAM: glycosyl hydrolase, BNR repeat-containing
FT                   protein; KEGG: rso:RS05070 putative
FT                   hemagglutinin/hemolysin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02033"
FT                   /db_xref="GOA:A1AVS6"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVS6"
FT                   /protein_id="ABL02033.1"
FT                   /translation="MKINNAKTTTQLKTLQTQAQAFSKTLSKVIVIVIKGEQHIRVIPG
FT                   HAYEISIEDGRNFDLIAQKVDNDLKVLLPNDTIVVFNEYFKVCVSDLSCLVSLPSEDGI
FT                   YHIIENNFVTFTNNSQIIHFYGDESVLSAVATNQSTVFAESFNEVYLTNIFSSLSIDSG
FT                   EVLDGLLIVGLAGAGGGISSLEDVILKMVVSAGEFIENNGGLVKLYKYDPFIEKLTFFT
FT                   DVDLNNSGMQDFSIGNYKGIIIAKLIDTNGNNADFRDEATGVDTDISATLLAVIDASKG
FT                   GNIDVSITPLTTIAALRMGLTTSGELPTGIMLDISTISDANKGVAKAFGLGNDADVVTT
FT                   KIQTVITQDGETSISNAYGNILAALSGVDSDKNSGNMAATITQFEEKLIGMGADLKLNT
FT                   EGQEDLLAGASKAETSNSKIDVGLGLATTIKDTDAIDSSTTINITLGFEDTGISAIDNI
FT                   VKAYDLDGHDVGTDEGIRINVIGVSSNWVYSTDAGINWFIGATDFELGTGFNLVEKTTT
FT                   YNKADIMVRNGTDILAGFIEGTEATLGAGTIFVDGDMPSGITSTELSSSSSANFAVINI
FT                   SVTAGSTWRYSTENGADGTWKVVDVGSSFSLIANAIYTINQIQVKEIDAAGNESTILKN
FT                   AAEITGSILALNLNRDTGNSIFDGKTNDAIINVITGPDVIWEYTINGGTDWTTGSRGNG
FT                   SFELLGSDSHAVSDIKVKIAGQDDSNVITLSHYSATSIDILTANVDATLTLASAGDTGA
FT                   SSDNITSNKIINISGGVTWEYSTDGGENWIKGSDSSFELSSQSYVQGQIQVKQVDEYGN
FT                   YSQPTLFDAITIDYIAPTITLFTLNTVGGSYGVNSNINITSTVNEEIASGTITVTLNTG
FT                   ETVILTVSADDKTLLTGNYIVNTGNTTTGLKVTSFTINSIIDIAGNIMTDNMVPADKKI
FT                   LYNIEDRDSTIVIDGVAPSITCATNPNSAQILKIGETLSVELTLDEMVTLTNAAIAIIT
FT                   LIIDDRDGSTMEVTATATGNGIVSNTLIFTTAALPNNLNDNNGVKVKANSLSFTSGEFK
FT                   DAVGNDVSSVFTEISEIANTQVDTIAPTVILSGNIVPTANLTMIFDENIIKVAGKEIKI
FT                   YKADGTFVEAVDSVEVTNDIVTINPATDLESNIAYYVIIAAGAFKDIAGNEYAGISESS
FT                   VWTFDTASLSTTVAWSGMGVNSGDEYINLSELTNVTISGHIANPYGVGNVKVLEIKFIS
FT                   SNGGTAYTVPSSLVGTAITIDGSGNWVLDNDSIWASSANFTDGKAYKVKVKLTAILDNN
FT                   PVEGIGMSSDSVVFDTVAPVTPNAVLITDSGSSSSDSITNNSAINAPVNKEIGATVEYK
FT                   IATGSWSTTYIAPTTNGDYIVKVRQIDKTGNASSEQIITFTLDVTTDVVDVTSSVIVNK
FT                   MDITSGVAFDADIVTPNASDIEKITVIFGNIQTGDNLLLDVERTLSSSFTQTTSVTLGI
FT                   ANVNYIYASNKLTITKHSGGSFSATEVESIVEAVKLKNTNSTPGDIDRTATFAYVDTAG
FT                   NTGASAQATMTVVATIPTIVSVTDDHDQTGQEVTSEMTIYTVTFSHGVVSSFESNDVIL
FT                   VDTLGAPIVITNWIIGVLTEVPDSSGTQWTVSVTPPLGENTVDVTAARLKIEKTGLVDI
FT                   YGNDPFDINHTQSIADAQSFDTQPPSIPTLTLNTEISAGTVTKDRVMNVTNLVADVASW
FT                   QYSVDGGVSWTTVSDSSVTNFTLTDGTYGADFIRVKQTDNAGQTSNIAKYTINFSIDTA
FT                   IDTPTFSPVDNGKMSNTDNFVLTFAESMIAVTGKNIIIKQLSDGSVIETIAADNSAQVS
FT                   INATGVVTINPTDINLVARTSYYVEVEAGAFKDNAGNESTAITGSTVWNVIVNEMNATI
FT                   MVATDNKINAIENTTDIVIAVIIGADSTILSTLLLGDFTVTITKVGGSVVSISGTAYDS
FT                   STGIWRAIINDGGLINGDIYTVQANITSSAMGINTSSTQTVTVGTNAPTLTLTDNKAIV
FT                   GNDNVVNITESANGFSMTGISTGLTIGSEVSVVFNTITYTTTVTGASNNWSIDIPSTDT
FT                   NVLIEGTTYIVTVNASDNHGNPATQLSQNITVDKTAPVSTIVIDEIITDLSTITGQTSA
FT                   NIDVEIKLDTDNNNSYDDATYIVISDANGNWTLDLNSAASLISGSAPTFASIDTQLGVQ
FT                   VNIIDTAGNMTTRTETATKQASSYSISDSRVIEGTTGTKTMTFIVTRGGDFSDAGTVDY
FT                   AVNTTLSLAKFSSSANGVDDDYSGSTSGTVTFAVGERFKEITFTVNGDYYKEVNQNIIV
FT                   DLTNPTEGAISKATGIGEIVEVDITQLAAAYSLKDVNSDLATNAVRVRRSSDNTELDIG
FT                   FDKYDNLDTRALLNFVGRDTDDTGYVSIWYDQTGNGRDMTQTSSTKQGVIVSDGVVQTH
FT                   SNGQTTIGFNRGLNGANDDFMEAIGTGGGTVTNLEVYVTYEFNIIRVGTLFNLGTSIED
FT                   GRIIAHAPWSSGAIYWDAGSSTGDARLFVSDAQQSGQVSQLVFTANYNHTGAGTVLQNN
FT                   VDAKQGIFVDGDNKAADETLKGNSLVLGNTWVLMSFGYGSTVCQSGKVSEFLVYTSNTE
FT                   AVEPIGLFGSANNNVFTYAGESALVMLDGKLGYDMIKLSNASDINLDVTSVSLVNIEVI
FT                   NMQNVESNRLTINNTQLDTNVSILSVLMNTGDSIVYESNTFNYSATQEAVNFGTTDNDI
FT                   INMSSFNETVYGRGGNDTFVYKSWSDAAASSSADSITDFTIGMGADKDILNLKDLLTDY
FT                   DSTNLADFINLSQIGGNTIISVDKNGAMGDVFTEDINITLTGVTEASLVTMINDGNLVL
FT                   E"
FT   gene            275408..275623
FT                   /locus_tag="Rmag_0252"
FT   CDS_pept        275408..275623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02034"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVS7"
FT                   /protein_id="ABL02034.1"
FT                   /translation="MIQRTDTDLLDFTSAKISSVNGNIATIFGLNDDVKKSTNTVFNEL
FT                   VNGVTNDKLSQNITNNLIVGAKKSDE"
FT   gene            276554..277822
FT                   /locus_tag="Rmag_0253"
FT   CDS_pept        276554..277822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0253"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   cvi:CV1734 probable outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02035"
FT                   /db_xref="GOA:A1AVS8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVS8"
FT                   /protein_id="ABL02035.1"
FT                   /translation="MIKRTMVLLFFGFLLGGVSVQEQSKGEFNLSNLISKAIAYHPSIK
FT                   SNIFLEDSAKNEITSAKWQYFPIPKFSVSQVDSSNTDRNYNGDSRVSTISLTQPLWAGG
FT                   SIDAGLAKSRAKLLLAQASTKVVQQDLALRVINAYSKWYDSYLKKKSYSKSQKEYSMLR
FT                   TRLRRRIKQGLSSSSDLNLVNSRSTQAEASFNSAIIQHKNSLLNLEGLLGTSIDSKDLI
FT                   RDFSIVKFETNQTKLSRKALLTSPRVKQIKAESLVIEAELDQSHAKLYPDINLKLERQW
FT                   GSFTTKDAKTENRIFIEFNSSFGAGLSNFSQTRQIKSRYQSLQAKIKDEENKVAQQIKL
FT                   DWMSSVSLKKQKILLELSLANIEKVRKSYYRQFLAGRKTWQDVMNSIREVSQLESQLAS
FT                   VYGEIILANWRIFVYVEDIGALL"
FT   sig_peptide     276554..276622
FT                   /locus_tag="Rmag_0253"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.545 at
FT                   residue 23"
FT   gene            277840..278184
FT                   /locus_tag="Rmag_0254"
FT   CDS_pept        277840..278184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02036"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVS9"
FT                   /protein_id="ABL02036.1"
FT                   /translation="MVFDRADKILWHSTISFKEEQNIIDKILVEKIIWYIDNTQNFKLS
FT                   LKKKDFVTFVEFFDKEEKLSREKLIKIAIQKTTKITPVEEIMQKEQTDIKQEQNKKQSN
FT                   IIQKLIKKNC"
FT   gene            278611..280689
FT                   /locus_tag="Rmag_0255"
FT   CDS_pept        278611..280689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0255"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: par:Psyc_1599 ABC drug efflux transporter, fused
FT                   ATPase and inner mebrane subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02037"
FT                   /db_xref="GOA:A1AVT0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVT0"
FT                   /protein_id="ABL02037.1"
FT                   /translation="MEQSLLFSLQRLSKLQRSRFNALELQQIIEDECNSSIEKLVMLHN
FT                   VCHALLIPNPKALKSINDPSLLPLLIFDEFQQWGILKSFNAKGEWVAEWFSKEKNSWLE
FT                   VILYDLSKYNIFAIKMKKKFDIGNGRIFKIVKTELITHKKWLIDASLAGVLINIVAVVS
FT                   AFYSMQIYDRVVPTGAQQTLLVLTIGVLAITVLDFIAKLVRAGLYEKLIDNIDRRLSRD
FT                   IYKRFLALRMDQLPKSVGSLASQMRGYESVRSFLSTITTYLVVDVPFVLFYVLLIATIG
FT                   GYLALLPMIFFVIATLTGLYFHKKIETLADNINESVNLRVGLLVESVEGAETIKSGQGG
FT                   WRMLSNWMNVTDEGRSYDLEMKRMTDQSQYMVAFFQQSSFVLMVASGALLIGGGDLTMG
FT                   GLIACSILSGRILAPVAQIPSHLVQWANTKSAIRSLDMILDLKCDHDGIDSPIVFENLR
FT                   GEFYIEAKTQINYGEKVALALPEMRINPGEKIGVLGPIGSGKTSLLRLLSGMYKPNVGR
FT                   ILLDDIDLAHISKPILAEKIGFLQQEGRLFKGTLRENLILGLVDPDDDKILKVSKLTGL
FT                   LDSVISTTEKGLEQEIFEGGLGLSGGQKQLLNLTRVVLRAPKIWLLDEPTASVDRNLEV
FT                   LLINMFKKIIKVEDTLVLVTHKIEMIELVDRLIVVNKNQIVMDGPKADVIAQLSGKT"
FT   gene            280701..281870
FT                   /locus_tag="Rmag_0256"
FT   CDS_pept        280701..281870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0256"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   par:Psyc_1598 HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02038"
FT                   /db_xref="GOA:A1AVT1"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVT1"
FT                   /protein_id="ABL02038.1"
FT                   /translation="MNLEKILLKIERSFSIVYVLLGGFIAFILWASLFDIDETVRCQGK
FT                   VVANGSSQIIQVADGGVLSKLLVSEGEHVQQRQLLATLEKDRAQASYYEIRSQVAYLKS
FT                   ALARANAEILEKPIVFDELTKNYPDFMNAQKALYVQKKRSLNQEVSMLEEGLAMNIEEW
FT                   EITQSLEKTGDVSQLEVLRAKQKVLYFKRKVVDTKNKYYEKTSSEIEKLEGELAKNLYK
FT                   LKKQKSVLEYTNIYSPVSGIVKELKVTTVGGVLRAGEQLMEISPSQGGVILEAKINPVD
FT                   IGRLKLGMPVMIKLDAFDYTIFGGLKGTLNYISSDTLLDKDPSGRQITFYQVNVKIEGP
FT                   EYEDNVKSKVINVKLGMSGTIDVKVGKRSLFTYLIKPISRGFSGALNEK"
FT   sig_peptide     280701..280796
FT                   /locus_tag="Rmag_0256"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.754) with cleavage site probability 0.754 at
FT                   residue 32"
FT   gene            complement(282381..283169)
FT                   /locus_tag="Rmag_0257"
FT   CDS_pept        complement(282381..283169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0257"
FT                   /product="biotin biosynthesis protein BioC"
FT                   /note="TIGRFAM: biotin biosynthesis protein BioC; PFAM:
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   tcx:Tcr_1981 biotin biosynthesis protein BioC"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02039"
FT                   /db_xref="GOA:A1AVT2"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVT2"
FT                   /protein_id="ABL02039.1"
FT                   /translation="MSQVRFAFNKASNNYNDYAFLQKEIAVRLDQKLNIISSKADIILD
FT                   LGAGTGLLSQQLTKRFSNSKIICLDFAQQSLKYNPSSSKICANANYLPLPDNSVDMITS
FT                   NLMMQWCQNLNILFSECFRVLKNNGLILFSTFGPDTLKELKKSWSIVDDKTHVNTFIDM
FT                   HNIGDQMLQNGFQNPVMEMETLTLTYQTVIDLLRDLKAIGAQTVAKRSKSLTGKDKFQL
FT                   MIRMYESYKNNGKLPATYEVIYGHAWKKTTGVNNITLESQ"
FT   gene            complement(283157..284008)
FT                   /locus_tag="Rmag_0258"
FT   CDS_pept        complement(283157..284008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0258"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   rty:RT0013 probable zinc/manganese ABC transporter
FT                   substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02040"
FT                   /db_xref="GOA:A1AVT3"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVT3"
FT                   /protein_id="ABL02040.1"
FT                   /translation="MIFPSLLTIITLLSANIFAAPNIVVSIKPIQSIVNSLTQGITESK
FT                   LLLKTNQSAHYTHLKPSQLSLLSHADLAIFIHPTFESGLKKVLANLNEKLIIGNVKNIH
FT                   LIHNEKHQKVVNYHLWLDVNNMQIFAKKLIERLIKIDPDNQSNYRTNLNKLNKNLDKLK
FT                   QDINQKLSIYKPKVLASYSNTFDYFTNANQLKKSINITNYHGERLSIFKILEAKKIMKN
FT                   TQTKCLLSTIEVPKKRTNTLTEGLNINSVSIDIIGLNIQQGSDYYFELMHNITNKVVQC
FT                   LR"
FT   sig_peptide     complement(283949..284008)
FT                   /locus_tag="Rmag_0258"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(284049..285005)
FT                   /locus_tag="Rmag_0259"
FT   CDS_pept        complement(284049..285005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0259"
FT                   /product="methyltransferase, putative"
FT                   /note="PFAM: putative methyltransferase; methyltransferase,
FT                   putative; Methyltransferase type 11; KEGG: vvy:VV2291
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02041"
FT                   /db_xref="GOA:A1AVT4"
FT                   /db_xref="InterPro:IPR010017"
FT                   /db_xref="InterPro:IPR027555"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVT4"
FT                   /protein_id="ABL02041.1"
FT                   /translation="MLSDFYKYATSTQLDLICTQLINLSTHVFNTNNGNIPKWEQAIKQ
FT                   IKTQNTGSLDFITPYLNISAHHINNFTLEKSLKQLIPWRKGPYQIGDLQLDSEWRGDMK
FT                   WHRLIPHIKPLKDKVVLDVGSGNGYFTYLMAISGAKIALGIEPFLLFNYQFQAIRTLIN
FT                   NLPNVFVLPLSLDKIPKKPLFDTVFSMGVLYHQKDYELHLNQLKDVMKPSGELILETLI
FT                   IDLEKVKKIIPKGRYAKMRNVYCLPSKNTLRTWLEDAEFKNIKLLDVTKTTSKEQRATH
FT                   WIGNNTQSLKNFLDPNNRDLTIEGFPAPKRAIFICQK"
FT   gene            285105..285485
FT                   /locus_tag="Rmag_0260"
FT   CDS_pept        285105..285485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02042"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVT5"
FT                   /protein_id="ABL02042.1"
FT                   /translation="MINKTLGLVVTFALVGSVMAGGDDLDMGPVEPIFDKVVVKSEHNI
FT                   DTMILTDTSKVIGQTITGAPVTIAAHEACKDRLNLFNTNIEKFKQALASGFLYNTGPLN
FT                   EMGTLFSPKRWKDYFFCVENHQ"
FT   sig_peptide     285105..285167
FT                   /locus_tag="Rmag_0260"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.908 at
FT                   residue 21"
FT   gene            complement(285556..286113)
FT                   /locus_tag="Rmag_0261"
FT   CDS_pept        complement(285556..286113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0261"
FT                   /product="ribosome recycling factor"
FT                   /note="PFAM: ribosome recycling factor; KEGG: noc:Noc_0811
FT                   ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02043"
FT                   /db_xref="GOA:A1AVT6"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVT6"
FT                   /protein_id="ABL02043.1"
FT                   /translation="MLNEIQQDAQSRMNKSVASLKNAFSKIRANRAHSSLLEQIHVDYY
FT                   GSMVPLSQVANISVEDSRTFKVSPWEKDMVAVIEKAIMTSNLGLNPQTMGQIMRIPLPP
FT                   LTQERRGELVKIVKDEAEQAKVAIRNIRRDANSDFKELLKEKEISRDGARKAENSIQKI
FT                   TDTYIKEIEAKFCEKENSLLEI"
FT   gene            complement(286117..286836)
FT                   /locus_tag="Rmag_0262"
FT   CDS_pept        complement(286117..286836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0262"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /note="TIGRFAM: uridylate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: vvy:VV2555
FT                   uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02044"
FT                   /db_xref="GOA:A1AVT7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVT7"
FT                   /protein_id="ABL02044.1"
FT                   /translation="MLMSKYKRILLKLSGEALANTENIIDPVALNKVVNIIKSVLSQNV
FT                   EIAIVVGGGNIFRGAVLAQAGMNRITGDHMGMLATVMNALAIADVCQKNKVDTLVMSGF
FT                   SIGGGVCDSINHVHAKQALNEGKVVIFCAGTGSPCFTTDTGAALRAIEIDADAVFKATK
FT                   VDGIYTSDPIKNSDAKRYDSLSFDGAIEKNLQIMDVSAFALCREHDLEICVFSMLENTN
FT                   TLSDILKGKPLGTIVRK"
FT   gene            286912..289728
FT                   /locus_tag="Rmag_0263"
FT   CDS_pept        286912..289728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0263"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: vch:VC0394 excinuclease ABC,
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02045"
FT                   /db_xref="GOA:A1AVT8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVT8"
FT                   /protein_id="ABL02045.1"
FT                   /translation="MDQISIRGARVHNLKNIDIDIPRNKLVVITGLSGSGKSSLAFDTI
FT                   YAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPTISIEQKATSHNPRSTVGTITEI
FT                   YDYLRLLFARAGIPKCPKHQINLESQTISQMVDSIVKLPMGEKIMLLAPIVQNRKGSHA
FT                   KLLEELNHQGFLRARVDGVVVYIDEMEVLNGKVNHTIEIVIDRLKVREDMASRLSESLE
FT                   TALNLSAGLVRVASMEDEPSWQEGVFSAKFSCVECGYSLSELEPRIFSFNNPVGACQTC
FT                   DGLGVKDTFDEQKIVANPSISLADGAVYGWGRSNAYFYQMLILVSKYYDFNIETPYEQL
FT                   SDKHKKIVLYGSGTDDIDFSKIKGRKGWSNKAKPFEGIIPRMIRRYEESDIRSVREELS
FT                   RYVVSKDCVQCHGDRLNESARNVFIDGKNLSNITKLSIADIYDFFKELKLEGARGQIAD
FT                   KILKEIVQRLAFLINVGLEYLSLNRRANSLSGGEAQRIRLASQIGAGLMGVLYVLDEPS
FT                   IGLHQRDNQKLLNTLTYLRDIGNTVIVVEHDKEAIKQADYVIDIGPGAGIHGGEIVAMG
FT                   SPKDIENNLKSLTGDYLSGRQSIEVPTKRKNVSQWLRIKGAKGNNLNKVDLSIPVGVLT
FT                   CVTGVSGSGKSTLINDTLYALVARELNHAQTTPAEYESIEGLNYFDKIVNIDQSPIGRT
FT                   PRSNPATYTGVFSLVRDLFSQTLEARTRGYKAGRFSFNVKGGRCEACKGDGLIKVEMHF
FT                   LPDVYVLCDVCQGQRYNQQTLKVFYKGKSIAQVLDMTVEQACEFFQPMPKIKRKLQTLM
FT                   DVGLSYIILGQNATTLSGGEAQRIKLAKELSKMDTGQTLYILDEPTTGLHFHDIKLLLS
FT                   VINRLRERNNTIVIIEHNLDVIKTADWIVDLGPEGGNKGGQIIAFGTPEEVAQVKGSYT
FT                   GEYLKAYL"
FT   gene            complement(289711..290454)
FT                   /locus_tag="Rmag_0264"
FT   CDS_pept        complement(289711..290454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02046"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVT9"
FT                   /protein_id="ABL02046.1"
FT                   /translation="MKLLTLIIFTILINSTAHALKAHTANYKLSINGFKIAEEVRTLYK
FT                   LDKHYFYTANARTSGLAAFIKDYSIAASSIFSSNPQGVDAIHYQIIEKEDGKLVKNYDI
FT                   DIHSKNHSIMPILTKTQSKIRTWHSKSGNIVDPLSLFLALSNDLKHNPNQSIFTYQVTN
FT                   GKSIEQHQYKRTNGHFLKINNQSIKAIKVNRINANNSNIKAYFLPKYQYLPVLIEQNKG
FT                   NKRYTYTLTDLQIKNEVKDKLQVSF"
FT   sig_peptide     complement(290395..290454)
FT                   /locus_tag="Rmag_0264"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.783 at
FT                   residue 20"
FT   gene            complement(290451..291056)
FT                   /locus_tag="Rmag_0265"
FT   CDS_pept        complement(290451..291056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0265"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein;
FT                   KEGG: pha:PSHAa1948 phosphoribosylglycinamide
FT                   formyltransferase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02047"
FT                   /db_xref="GOA:A1AVU0"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVU0"
FT                   /protein_id="ABL02047.1"
FT                   /translation="MNGIVLISGNGSNLQSIIDHSAAIDLDIKAVISNHSSAYGLKRAE
FT                   YANILTHTLNHKQFSSVEEFDQELSNIINQYNPEIIILAGFMRILSAKFTNQYSDKMLN
FT                   IHPSLLPKFQGLNTHKRVLEAKESQHGVSIHFVTEQLDGGPIIAQVSVDVFDTDTTESL
FT                   AKRVLLEEHKLFHKVIHWFTQGRLKLEKNHATLDGKVL"
FT   gene            complement(291071..292072)
FT                   /locus_tag="Rmag_0266"
FT   CDS_pept        complement(291071..292072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0266"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="KEGG: eca:ECA1254 phosphoribosylaminoimidazole
FT                   synthetase; TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; PFAM: AIR synthase related protein; AIR
FT                   synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02048"
FT                   /db_xref="GOA:A1AVU1"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVU1"
FT                   /protein_id="ABL02048.1"
FT                   /translation="MSSLSYLDSGVDITKGNSLIKQIKPIAKSTTRPGVLAGLGGFGAM
FT                   FELPINKYKNPVLISGTDGVGTKLKVAQMLNKHDTIGIDLVAMCVNDLIVQGAEPLFFL
FT                   DYYATGQLNTELAISVIYGIGEGCKQSGCALIGGETAEMPGMYQGEEYDLAGFCVGIAD
FT                   KDKIIDGTEVTKGDHIIALASSGPHSNGYSLIRKILAQSDPTDAQLNALIKPTKIYVKS
FT                   VLSLIEKFSVHAISHITGGGLLENIPRVLPENLSAKLDASSWQLLSIFQFLQDNGNINM
FT                   MEMYRVFNCGIGMVIIVPSEQSTDVIQHLNELDEHAWLVGEITSNQGNQVII"
FT   gene            292127..292693
FT                   /locus_tag="Rmag_0267"
FT   CDS_pept        292127..292693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0267"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   noc:Noc_1186 CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02049"
FT                   /db_xref="GOA:A1AVU2"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVU2"
FT                   /protein_id="ABL02049.1"
FT                   /translation="MSFSSLPNALSILRIILTVPVVMALLNHQYFLAMVLFFIAGVTDA
FT                   LDGWIAKRYSFQSRLGSILDPMADKLLLVSSFVALYVIGLLPLWLLVLVFLRDFMIVSG
FT                   TVGRFIGSGTSKNDLLSPSKLSKINTVLQIALVLFLVMVQIYPVSTQYSTVFFIIIATS
FT                   TVLSGADYMWIWVEQVILQEKKNPQ"
FT   gene            292690..293364
FT                   /locus_tag="Rmag_0268"
FT   CDS_pept        292690..293364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0268"
FT                   /product="regulatory inactivation of DnaA Hda protein"
FT                   /note="PFAM: Chromosomal replication initiator, DnaA; KEGG:
FT                   cbu:CBU_1734 chromosomal replication initiator protein
FT                   DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02050"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVU3"
FT                   /protein_id="ABL02050.1"
FT                   /translation="MNQLGLPLSLNSKMLLSNFIGKKNQQVLDFVNQLLTQKSSAVVFI
FT                   SGAKSSGKTHLLQGCAFSALDGQLGVIYIDIKQELPEGIINDLVSVDWICIDNVDYLSI
FT                   IQQQALFDLYNRIKLADTKLIVSAGSLPGELNLLKDLKTRLSLAVVFTLETLNDEQKIL
FT                   IIERKMTDININIDIKVYHYLFKVFSRDLNDVLNAINILDETSLQKKNNISIPFVKQTL
FT                   GI"
FT   gene            complement(293361..293768)
FT                   /locus_tag="Rmag_0269"
FT   CDS_pept        complement(293361..293768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02051"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVU4"
FT                   /protein_id="ABL02051.1"
FT                   /translation="MPNKHYTCPFSNLILSGRCGCKFDAKDCIAEKEFGVCLDGSSSKK
FT                   CQSLYAHLHDNSNFVLNTHHQNNLSVGQQSKIKMGGLLALQEILNTENSNKIEDISNLV
FT                   KIVEEKYMDFKNIPFSKLMPRIAQFKFRKKP"
FT   gene            293865..295283
FT                   /locus_tag="Rmag_0270"
FT   CDS_pept        293865..295283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0270"
FT                   /product="uroporphyrinogen-III C-methyltransferase /
FT                   precorrin-2 dehydrogenase"
FT                   /EC_number="2.1.1.107"
FT                   /EC_number="1.3.1.76"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase;
FT                   siroheme synthase; PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: mfa:Mfla_0652
FT                   uroporphyrin-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02052"
FT                   /db_xref="GOA:A1AVU5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR019478"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037115"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVU5"
FT                   /protein_id="ABL02052.1"
FT                   /translation="MNYLPIFIDIKQKPCLVVGGGDIAYRKINFLLKAHGQVTCIAKSS
FT                   CKNVVKLASDNKIIYFEKSFEASDIKEQVLIVSATDNTSLNKQVSELSNQNNIPVNVVD
FT                   SPDLCTFIMPSIVDRSPIVIAISSAGKAPVLARLIRAKLESTLPHAYGKLAELAGNFRD
FT                   KVKEKFSNIEDRRYFWEKTFSGIIAEKVFSGKIQEAKADLQVQLDGSTKTQVGEVYLVG
FT                   GGPGDPDLLTFKALRLMQQADVVLYDRLVSNGVMGLVRRDAQLIYVGKERDNHVVPQGD
FT                   INQLLVNLAKQGRRVCRLKGGDPFIFGRGGEEIETLAENGISFQVVPGITAASGCSTYS
FT                   GIPLTHRDYSQSCRFVTGHLKDGSMNLPWHELSVEQQTIVFYMALNGARHLSEQLITHG
FT                   MSPDMPVALVEKGTTPEQKVYTTTLKKLPDLVKNEIIHAPTLIIIGEVVTLREKLNWFD
FT                   AKLASSKKSYLFGG"
FT   gene            295585..295671
FT                   /locus_tag="Rmag_R0010"
FT                   /note="tRNA-Leu1"
FT   tRNA            295585..295671
FT                   /locus_tag="Rmag_R0010"
FT                   /product="tRNA-Leu"
FT   gene            295688..296497
FT                   /locus_tag="Rmag_0271"
FT   CDS_pept        295688..296497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0271"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /note="KEGG: tcx:Tcr_1620 phosphoserine phosphatase SerB;
FT                   TIGRFAM: phosphoserine phosphatase SerB; HAD-superfamily
FT                   hydrolase, subfamily IB (PSPase-like); PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02053"
FT                   /db_xref="GOA:A1AVU6"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVU6"
FT                   /protein_id="ABL02053.1"
FT                   /translation="MSVQITIQHSLDENIAKQISSKFQVFDTHIRHQMTSINLDDLRQQ
FT                   HQTDFNHLPEVDFSNIKLFVSDMDSTLINIECIDEISDFANIKPQVAAITELAMQGKLD
FT                   FDDSLIERVSLLKGLSIDVLDKVYTQRLEINPGGRTLISFFKTKSIQTAVVSGSFTYFT
FT                   NRLAQDLALDYACANVLTIENNQLTGVTEGLMINAQAKADFVKELCDKQSLSYSQVIVV
FT                   GDGANDLSMMRIAGVSVAYHAKPNIMKHANIVINFGRLNKIMDLFNP"
FT   gene            296552..298456
FT                   /locus_tag="Rmag_0272"
FT   CDS_pept        296552..298456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0272"
FT                   /product="cytochrome c-type biogenesis protein CcmF"
FT                   /note="TIGRFAM: cytochrome c-type biogenesis protein CcmF;
FT                   PFAM: cytochrome c assembly protein; KEGG: psp:PSPPH_3309
FT                   cytochrome c-type biogenesis protein CcmF"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02054"
FT                   /db_xref="GOA:A1AVU7"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVU7"
FT                   /protein_id="ABL02054.1"
FT                   /translation="MLIEIGHFALVLAFVFAVLQVVLPTIGIIKHDTILSGLSRPLLWM
FT                   QFFWILIAFAILMNAFLVDDFSVKYVANNSNTQLPNIFKMSAVWGAHEGSLLLWALILT
FT                   AWSVAVSIFSRRLPDEVLNHILIILGLISIGFLLFLLLTSNPFERLDMVPIQGRELNPL
FT                   LQDFGLIIHPPMLYMGYVGMAVPFAFVLSSLIRGQLDSTWLRWSRPWTLIAWAFLTFGI
FT                   TLGSWWAYYELGWGGWWFWDPVENASFMPWLVATALVHSLSVSEKRGVFKHWTVLLAIS
FT                   GFSLSLLGTFLVRSGILTSVHSFAADPARGLFILIFLVIVVGGSLVLYAWRASLMQSNN
FT                   TFSFLSRESGLLVNNVLLVAAMSSVFLGTLYPLLLDALGLGKISVGAPYFSAVFVPIMI
FT                   LALLVMVIAPFLRWKKDTTQRVAGLLKWVWIGVGLLFVISALLTDNTSVLLAVFLFIWI
FT                   VMHSLVLLFQRLNQKGSMSFAFIGMIFAHIGIAVFLLGATVTTQYGVEKDIKMDIDKPI
FT                   TIAGYDFIFKGVTHLFGQNYQGNKGHVEVYFENEKISDLRPEKRQYVTGMPMTEAAIDP
FT                   SLYRDIYIVLGESLENDSWSLRIYYKPLIRWIWLGGLLITLGALLAAFDRRYRLRVKE"
FT   gene            298453..299604
FT                   /locus_tag="Rmag_0273"
FT   CDS_pept        298453..299604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0273"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: dar:Daro_1405 TPR
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02055"
FT                   /db_xref="GOA:A1AVU8"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017560"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVU8"
FT                   /protein_id="ABL02055.1"
FT                   /translation="MNLYLWFILMIITSSIWIIWFLYRPLKSNEINLESSNIILGKQKL
FT                   LELEQDLHQNLIDKKQFNQAKEEISTTLAIELQQVSNIENNANNNTWVLILILVLLPIM
FT                   SIGVYQYLILGNNMSAEKPLSLEQSADKIVQYLQTNDNDAQAWKMLGLMYFEIGKLDLS
FT                   IDAYEKSYKINPKDPGLLVEYASMMISVNDNQFSDQSVKLIKQALDIEPNASDALYLAG
FT                   MFAASQLNFNLAKGLWQRALNALPEGSMDRVALVSILSELKTVEESKDTPEYSISVSVD
FT                   ISNEILKSRSSEDFIMIYVKAAKGRPMPIAIKKMKLKDFTGQVVLTNQDSVIRGNQLSY
FT                   HEQVIAVVRISETGSAMRGVGDVQVLSKVINMVDNLSIHLSVK"
FT   gene            299609..300739
FT                   /locus_tag="Rmag_0274"
FT   CDS_pept        299609..300739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0274"
FT                   /product="succinyldiaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /note="TIGRFAM: succinyl-diaminopimelate desuccinylase;
FT                   PFAM: peptidase M20; peptidase dimerisation domain protein;
FT                   KEGG: aci:ACIAD0791 succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02056"
FT                   /db_xref="GOA:A1AVU9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVU9"
FT                   /protein_id="ABL02056.1"
FT                   /translation="MNKTLKLAKNLVSIDSITPQDKGCQSIMTNHLSHLNFKITDLKFG
FT                   EVDNFWAIRGHQSPVFVFAGHTDVVPVGDELKWHISPFSAQVQDGMLHGRGTADMKGSL
FT                   AAMLSATDRFVKDYPNHKGSIGYLITSDEEGPATDGTVKVAKYLKEINQIVDYCLVGEP
FT                   SATNELGDVIKNGRRGSLNGILKIIGKQGHIAYPHLADNPIHLAISALNDLCNEVWDKG
FT                   NEYFPATSFQISNIHSGTGVTNIIPGESDVVLNFRYSTQNTHKQLQSRVCVILNKHNFE
FT                   YQITWEHSGYPFLTPKGKLVNACTNAIKTVKNINTQLSTSGGTSDGRFIALILKAQVVE
FT                   LGPLNATIHQVDECVSIQDLEDLSDIYYHVLKNILT"
FT   gene            300743..301417
FT                   /locus_tag="Rmag_0275"
FT   CDS_pept        300743..301417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0275"
FT                   /product="tRNA (Guanine37-N(1)-) methyltransferase"
FT                   /note="KEGG: vvy:VV2786
FT                   tRNA-(guanine-N1)-methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N1)-methyltransferase; PFAM: tRNA
FT                   (guanine-N1-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02057"
FT                   /db_xref="GOA:A1AVV0"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVV0"
FT                   /protein_id="ABL02057.1"
FT                   /translation="MRFDVITLFPDMFNTIKDEGVIARAIKKSCLLIHTWQLRDFSNNK
FT                   YKNIDDKPYGGGAGMVMKVKPIRDCIHKIKQSNPKTKVIYLSPQGQPLKHKLAKELSTF
FT                   DSITLLCGRYEGVDERIIKHDIDMEISIGDYVISGGELAAMVLIDTISRQIPNVLGNAD
FT                   SLNDSFAKNLLDYPHYTRPEIIDKQAVPEVLLSGHQANIDTWRVEQSIKKTQEKRKDLL
FT                   ED"
FT   gene            301598..301936
FT                   /locus_tag="Rmag_0276"
FT   CDS_pept        301598..301936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0276"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   mca:MCA2137 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02058"
FT                   /db_xref="GOA:A1AVV1"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVV1"
FT                   /protein_id="ABL02058.1"
FT                   /translation="MKFVTAILRPHKLDDVREALSEVGVSGVTVTEVKGFGRQKGHTEL
FT                   YRGAEYQIDFLPKIKLEVAIEASRLDEVIEVISNVANSGKVGDGKIFVTNLDKVVRIRT
FT                   GETDKNAL"
FT   gene            301983..303221
FT                   /locus_tag="Rmag_0277"
FT   CDS_pept        301983..303221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0277"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: cps:CPS_3995 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02059"
FT                   /db_xref="GOA:A1AVV2"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVV2"
FT                   /protein_id="ABL02059.1"
FT                   /translation="MGVFAQDINGADTAWIMTSTALVLFMTLPGLALFYGGLVRTKNIL
FT                   SILMQCFAIAGIISILWFVVGYSIAFSGDNPYFGDFSNVLLVQISINTVNGSIPESLFA
FT                   VFQMTFAIITPALIIGSYAERMKFSAVLLFSSIWLLVVYAPVTHWVWGGGWLGNVLDYA
FT                   GGTVVHITAGIAALVAAIVLGPRKDFFKKPMPPHNMTMTITGAAMLWVGWFGFNGGSAL
FT                   VAGGDAAMAILVTHISAATGAITWMFYEWIKFGKPTALGTVTGMVAGLGTITSASGFVG
FT                   PTGALVIGFISGIVCFNAVIIIKQKFKIDDSLDVFPVHGVGGIIGTLMTGFFASKELGI
FT                   FSGQGGWDRKAIVIADQLQIQFIGVVATVIYTAVVTYLILKVVDAITGLRVSEEEEQQG
FT                   LDIVSHEEKGYDL"
FT   gene            303496..304386
FT                   /locus_tag="Rmag_0278"
FT   CDS_pept        303496..304386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0278"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase; KEGG: tcx:Tcr_1552
FT                   dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02060"
FT                   /db_xref="GOA:A1AVV3"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVV3"
FT                   /protein_id="ABL02060.1"
FT                   /translation="MRINHPLTGSIVALITPMFDDGSIDFGVLKSLVAFHIDSGTKAIV
FT                   SMGTTGESATLNQDEHIEVIRATIEFANSRIPIIASTGANSTSEAIELTKAAKVIGADA
FT                   CLLVTPYYNRPTQEGLYQHYKLIAETVDIDQILYNVPSRTAVDLCVETVLRLSNIDNII
FT                   GIKDATGDLNVAKALIEQCADDFLFYSGDDATAVEFILMGGHGGISVTANITPKQVASA
FT                   YQFALENDRELAESTNAPLADLHQHLFIESNPIPIKWAMFKMGKCNNGIRLPLMILSQQ
FT                   AQAMLEQDLSNLGII"
FT   gene            304389..305504
FT                   /locus_tag="Rmag_0279"
FT   CDS_pept        304389..305504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0279"
FT                   /product="NlpBDapX lipoprotein"
FT                   /note="KEGG: dar:Daro_0847 NlpBDapX lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02061"
FT                   /db_xref="InterPro:IPR010653"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVV4"
FT                   /protein_id="ABL02061.1"
FT                   /translation="MIIRKLTILLLVFSLGGCISLGSKEKQKQDGLGERDIKYYSNKTL
FT                   TSLEVPPDLTKPSTQNALKLSEYVANIQEDLISFSEKDRAIKDASSIEVKKSGSLRWLV
FT                   VDKKPDAVWGLAKSFFKSHGFIIKKANKKIGVMETNFLENHPEIPDQSLGLIRSMFRKV
FT                   TKTRYTLPIVDKYRLRIESTDNGNKTEVYLSLTSMQEVLTNKSSDDENTIWQSQVKDHT
FT                   LETEMLYRLMTFLGSDHALARKKIIAAREQKKLTVKVAKSISGYAKLMFSLTQYETWNN
FT                   IGWALDQLGIDVEDKDVKEGSFYINFVKKEDKGIFSGLFGDDAIKKYFQIVVRQVASNI
FT                   TEVYFNDLSGDNKQVTIDFSYQFLGNIAKQF"
FT   sig_peptide     304389..304460
FT                   /locus_tag="Rmag_0279"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.975) with cleavage site probability 0.573 at
FT                   residue 24"
FT   gene            305567..307411
FT                   /locus_tag="Rmag_0280"
FT   CDS_pept        305567..307411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0280"
FT                   /product="DNA ligase (NAD(+))"
FT                   /EC_number="6.5.1.2"
FT                   /note="PFAM: NAD-dependent DNA ligase; NAD-dependent DNA
FT                   ligase, OB-fold; KEGG: dps:DP1006 related to NAD-dependent
FT                   DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02062"
FT                   /db_xref="GOA:A1AVV5"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVV5"
FT                   /protein_id="ABL02062.1"
FT                   /translation="MDELSDEELAQFCQIANLAYRAGKPIISDQDYDFIYLDALKNRDP
FT                   DNLLFKFIETEGQSFSEEKVLLPEAMLSIDKAYSWDEISKWIKRLEKSAMQISLDLSAI
FT                   QIKATPKLDGFSGFDDGSRLYTRGDGKKGSDISRVFERGLCVFNDAERGLGAGEIVIKK
FT                   SYFKKYLAHSFEYPRNFQASLIKEKALDEQAQKAIIDKAALFIPFIKLPTWSGLVAELV
FT                   AKFDQIVAQVLVMVDFDVDGVVFEAINTDLKTQMGANRKFHRWQIAFKENKDKAHVKVL
FT                   NVIPQVGRSGKITPVVELEPTLLSGATIMRATGHNYGLVKEQGLGVGSVVELTRSGLVI
FT                   PKIIFVLKPMPVDIPDNCPSCDKPLVWKSDFLTCINHKNCPAQIIGKMAYFFKILANND
FT                   GFGIATIEKLYAHDIRSVSQIYALNIEDLVTIGFGEKTSMNLINQLNRSVSEQVEDWRF
FT                   LAAFGMHRMGLGNCENLLKSHHLNDIFDLNLKEIANIDGFAELTGQIIVQGLISIADEF
FT                   NHIYQYGFNLETTILTKDLQTLTHELFDKKIVFTGKMNHSRDDMKKHAKSIGIKVSTSI
FT                   SAKIDYLVIGDKVGQKKIKDAEKFGVVVMTETDYLSKI"
FT   gene            307708..308055
FT                   /locus_tag="Rmag_0281"
FT   CDS_pept        307708..308055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0281"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   sde:Sde_0232 nitrogen regulatory protein P-II (GlnB, GlnK)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02063"
FT                   /db_xref="GOA:A1AVV6"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVV6"
FT                   /protein_id="ABL02063.1"
FT                   /translation="MKMIIAIIKPFKLDNVIEALSDIGVSGITATEVKGFGRQKGHTEL
FT                   YRGAEYTVDFLPKVKLEIAIAANQVDGVVEIIRVAAKSEGEGKIGDGKIFVSSLDQVFR
FT                   IRTGEIGSVAL"
FT   gene            308229..308832
FT                   /pseudo
FT                   /locus_tag="Rmag_0282"
FT   gene            309194..309634
FT                   /locus_tag="Rmag_0283"
FT   CDS_pept        309194..309634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0283"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   bxe:Bxe_A1873 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02064"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVV7"
FT                   /protein_id="ABL02064.1"
FT                   /translation="MQVQDIMSTNVKTVTPDQLAKDIAIIMVMDHISGAPVVDDDNNLV
FT                   GIISEKDILQHMFPKLDEVMSDTYFDFENMEHNYKNTMNVKVGELMTKDVASIDLSMPC
FT                   LKAASTMWLRNIRRIPVTHNNKLVGIVSIGDVHRAIFKSRIK"
FT   gene            309685..310209
FT                   /locus_tag="Rmag_0284"
FT   CDS_pept        309685..310209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0284"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: ANTAR domain protein; KEGG: mca:MCA0588
FT                   response regulator NasT"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02065"
FT                   /db_xref="GOA:A1AVV8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVV8"
FT                   /protein_id="ABL02065.1"
FT                   /translation="MLRKALQDKGHEVVCCMSDSSNLQDSNEMTYADMVIVNADIPDEL
FT                   VFANLTDINKTKPIVMFTEESNPGMASSAIKSGVHAYIVDGLEENRVQPIIDVAIARFR
FT                   EFQALKDELDATRNQLSERKAVEKAKGLLMQHKDVNEDEAYQSLRKMAMNKNKRIVDVA
FT                   ESVINAFELLE"
FT   gene            complement(310215..311081)
FT                   /locus_tag="Rmag_0285"
FT   CDS_pept        complement(310215..311081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0285"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: tcx:Tcr_1974 sec-independent protein
FT                   translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02066"
FT                   /db_xref="GOA:A1AVV9"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVV9"
FT                   /protein_id="ABL02066.1"
FT                   /translation="MTNKEMTFVQHLVELRNILLHSIIAILIIFIGIFPFANEIYSFIA
FT                   APIINVLPENTNIIAINVISPFLTPLKMSLIIAVYVAMPYLLYQIWSFVAPALYKHEKQ
FT                   MILPLVVSSTILFYTGLLFSFYIVFPVIFGFLSSVAPNIVDLTPDIQYYLDFVLKVSFA
FT                   FGVAFEVPIATILLIMFGITTVDKLKSNRPYAIIGAFILGMLLTPPDIISQTLIAIPMW
FT                   LLFETGLIFAPLFKQNKQKISDKPPPNSSKKFSKKEKNSDNNDWNDNEMEAEMKKIDTE
FT                   MKKLDKE"
FT   gene            complement(311081..311362)
FT                   /locus_tag="Rmag_0286"
FT   CDS_pept        complement(311081..311362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0286"
FT                   /product="twin-arginine translocation protein, TatB
FT                   subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatB
FT                   subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: neu:NE0638 mttA/Hcf106 family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02067"
FT                   /db_xref="GOA:A1AVW0"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVW0"
FT                   /protein_id="ABL02067.1"
FT                   /translation="MFDVGFWEFALIGIIALIIVGPKRMPAIARKAGTYVGKAKRFIAN
FT                   IQEDISDELEIDKLKEHLSTVDKKPNILEIFDDTKNTFNDVKNNTDQK"
FT   gene            complement(311374..311577)
FT                   /locus_tag="Rmag_0287"
FT   CDS_pept        complement(311374..311577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0287"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: ilo:IL2370 sec-independent protein
FT                   secretion pathway component, TatA family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02068"
FT                   /db_xref="GOA:A1AVW1"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVW1"
FT                   /protein_id="ABL02068.1"
FT                   /translation="MMPGPFELIVILVIVLLLFGGKRLKNVGSDLGNAIKGFKKSMQKE
FT                   PADQINTKDNIVEAKTTKESTK"
FT   gene            complement(311594..311911)
FT                   /locus_tag="Rmag_0288"
FT   CDS_pept        complement(311594..311911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0288"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /note="PFAM: phosphoribosyl-ATP pyrophosphohydrolase; KEGG:
FT                   tbd:Tbd_1706 phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02069"
FT                   /db_xref="GOA:A1AVW2"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVW2"
FT                   /protein_id="ABL02069.1"
FT                   /translation="MNDILIKLEQVLEQRKSAKVDESYISSLYNKGTDEILKKIAEESA
FT                   EVIMAAKDGVNDKIIYEVADLWFHTLVLLRFKEIKVNQITNELSRRFGLSGLQEKAKRN
FT                   N"
FT   gene            complement(311904..312284)
FT                   /locus_tag="Rmag_0289"
FT   CDS_pept        complement(311904..312284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0289"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="PFAM: phosphoribosyl-AMP cyclohydrolase; KEGG:
FT                   bur:Bcep18194_A3530 phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02070"
FT                   /db_xref="GOA:A1AVW3"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVW3"
FT                   /protein_id="ABL02070.1"
FT                   /translation="MDALKQTKFDDKNLIPAIVQDFKTGDILMFAWMNQESLALTIEKQ
FT                   QAVYYSRSRKKLWFKGEQSGHTQLIKEIFTDCDNDVILLRVDQVGGIACHTGRKSCFFQ
FT                   QLDKNNWKTVANVLKNPKDIYE"
FT   gene            complement(312610..313941)
FT                   /locus_tag="Rmag_0290"
FT   CDS_pept        complement(312610..313941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0290"
FT                   /product="NADPH-glutathione reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: tcx:Tcr_0140
FT                   glutathione reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02071"
FT                   /db_xref="GOA:A1AVW4"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVW4"
FT                   /protein_id="ABL02071.1"
FT                   /translation="MNTDYDMIAIGAGSGGLSAVERAAEYGRKCLIIEVKIIGGTCVNV
FT                   GCVPKKVMWFAANTGSIIKNAKGFGFEVEQKGFSWKKLKVGRDNYIKSITNWYDSYLQK
FT                   LGIDYIHGFGQLVDKNIVSVNGKEYTAEYIILSSGEEPAVPHIEGSEYGITSDNFFALE
FT                   ALPKKVAVIGGGYIGVELAGVLNALGSEVTLFCRADKLLRGFDSMIQNTLDKDYSSHGI
FT                   TIHHNTQIDKVSKNKTLFTNQGAFTGFDTIIWAVGRNPMTQHLGLKVAGVKCDQKGFIQ
FT                   TDKFQTTNVDNIFALGDVTGRTSLTPVAIAAGRRLSDRLYNNMTDRHLDYNNIATVVFS
FT                   HPPIGMVGLTEAQANEKFDKIKIYKSEFTPMADALLEHKTTTALKLVCAGDNEKVIGCH
FT                   IMGHGADEILQGFAMAIKMGVTKKQFDDTIAIHPTISEELVTMR"
FT   gene            315165..315368
FT                   /pseudo
FT                   /locus_tag="Rmag_0291"
FT   gene            complement(315374..316468)
FT                   /locus_tag="Rmag_0292"
FT   CDS_pept        complement(315374..316468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0292"
FT                   /product="bacterial peptide chain release factor 2 (bRF-2)"
FT                   /note="TIGRFAM: peptide chain release factor 2; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   mca:MCA0302 peptide chain release factor 2, programmed
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02072"
FT                   /db_xref="GOA:A1AVW5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVW5"
FT                   /protein_id="ABL02072.1"
FT                   /translation="MELSPTYQKIQDLKQRTIVLLTHISLEKKQARLEEVLLEMENPNI
FT                   WTNPDQAQVLGQEKSKLTSICQTFKQVNSVLEDAQELLNMAQTENDEDTANDIIDDLDT
FT                   IQSSIEKLEFERMFSGDLDVNSAYLDIQSGSGGTEAQDWAEMVLRMYLRWGEKHNFKVK
FT                   LMETSAGEVTGIKSATIHFDGKYAFGWLRTEIGIHRLVRKSPFNANGKRHTSFCSVFVS
FT                   PEVDNDIDIDINPLDLRVDTYRASGAGGQHVNKTESAVRITHLPTNIIVQCQDGRSQRA
FT                   NKDQAMKQLKSKLYELEIQKRNAEKQSLEDKKSNIGWGHQIRSYVLDQSRIKDLRTGVE
FT                   STNTNDVLDGNLDQFIEASLKAWL"
FT   gene            complement(316527..316787)
FT                   /locus_tag="Rmag_0293"
FT   CDS_pept        complement(316527..316787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0293"
FT                   /product="SSU ribosomal protein S15P"
FT                   /note="PFAM: ribosomal protein S15; KEGG: dar:Daro_2449
FT                   ribosomal protein S15, bacterial chloroplast and
FT                   mitochondrial type"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02073"
FT                   /db_xref="GOA:A1AVW6"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVW6"
FT                   /protein_id="ABL02073.1"
FT                   /translation="MSIDTQAIIKKYQSKTGDTGSSNVQIALLTARIKHLTEHFKTHKK
FT                   DHHSRRGLLHLVSQRKKLLIYLKDANTASYSNLIIHLGLRK"
FT   gene            complement(316850..317746)
FT                   /locus_tag="Rmag_0294"
FT   CDS_pept        complement(316850..317746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0294"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   psb:Psyr_1614 lipid A biosynthesis acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02074"
FT                   /db_xref="GOA:A1AVW7"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVW7"
FT                   /protein_id="ABL02074.1"
FT                   /translation="MTKTKFYHPKFIPTWALIGLMKLTAKLPLKIQLMMGKIIGRGLYP
FT                   LLSRLRKIAFVNISKCFPNKNKVQVTRLVKQHFEALGIGLFEISNCFYLSDKKLKQRYN
FT                   IEGSEILQNALDKQQNIILLVGHFTTMMLTGRMLLQNFDFADVYRPQNNALFDNKMQKI
FT                   FTQHGSLMIKAKDTRALIRTLKSGLPIWYTHDQDLGTKISTFSPFFDIQTATIKATEKL
FT                   ARIDNTVVIPLSFTRQHTTYTLEFSPALVNYPNDKPQKNTRLTNQILQQQILKAPEQYL
FT                   WIHKRFKTRPNNEPSFY"
FT   gene            317787..319568
FT                   /locus_tag="Rmag_0295"
FT   CDS_pept        317787..319568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0295"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="KEGG: pfo:Pfl_5148 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: zinc finger, CHC2-family protein; TOPRIM
FT                   domain protein; DNA primase catalytic core, N-terminal
FT                   domain; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02075"
FT                   /db_xref="GOA:A1AVW8"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVW8"
FT                   /protein_id="ABL02075.1"
FT                   /translation="MPFVNADFKDDLPNCVDIVDIINRRVPLKKVGKDYKACCPFHHEK
FT                   TPSFSVSVEKQMYKCFGCDEGGGVINFVMKFDNLGLVEAIETISGELGISVVYDENVKS
FT                   VDSRLARYRNLMQRVRQFYIQQLKQSPAKDKAVNYAKNRGISGKIAKYFELGFAPPSSN
FT                   LLSEFEQNDQNIADLKTMGLLCDDQYRSGQYYDFFKDRLMFPIHNAKGNIIAFGGRTFD
FT                   NNTKVKYLNSPETPIFSKSKELYGLYHARKYSRSIDYILVVEGYMDVIALHQVGISQVV
FT                   ATLGTATTIEHLNILSRVTNTIIFCFDGDNAGKKAAWRALNVTLPVIKTGITVKFLFLP
FT                   DGEDPDSLVKKESSKVFVTRIENAQPLSQFLFSHIKAELDFSTIEGKTLFLEKVSTLLR
FT                   KINYKIYQQQLLEGLAGEVNQSIEQIKYILERQDTPVQINTFDIPKNYEEPPISDFYDS
FT                   DDNYKALISAPIKSSNSLIDQMIGLLLNYPSMIDETVELRVRKINDADVLQNLANSALL
FT                   QEDITLEDIIKPFPQKQQLLDLYNKKKVLKNYDYKDEFLDALLKIEKKQKNENALLITN
FT                   EIEYTKSLQARKGKLKS"
FT   gene            complement(319565..321445)
FT                   /locus_tag="Rmag_0296"
FT   CDS_pept        complement(319565..321445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0296"
FT                   /product="peptidoglycan synthetase FtsI"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   Penicillin-binding protein, dimerisation domain; KEGG:
FT                   tcx:Tcr_0562 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02076"
FT                   /db_xref="GOA:A1AVW9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVW9"
FT                   /protein_id="ABL02076.1"
FT                   /translation="MSGKISTISKALILRRVQNYWHRQGAIKYFFIFLFSVFSYQTTSI
FT                   SQSNIIGLSIQNRAYHQATSLETKIAQRGDILDRNGHILASNLLLKRLNLDPTLIQVEF
FT                   IPKLARILDIKVQTLSKLLASKRKIGSKYLIIKKNITLTDPIINKLKQLNLMRILVCAN
FT                   KNITNKLSFIERTLNTLNLQKTKTTYTLVKQCKKARIAGVALQQDTKRYYPKSASLAPL
FT                   LGRVNANKKGASGIEGEFENRLAGHNGQTLINFKANTNEAYFNSKTIIQIQQGQNIMLT
FT                   IDTDIQYHAYEAIKKAVQKHESDSGSAIILTPNGEVLAMVNYPADNPNDNSTYNAEHYR
FT                   NRVLSDKVEPGSTMKPFTMLLALDKNQITATEDEFIDVSKRIGHIKPDGKYKQMTIKKI
FT                   LQRSHNLGTVNISERLEPEAMYNTWNKLGFGHQLDLIPSIENSGSLRHFNSWTLSDKRT
FT                   LSFGHGPMETNLAQLARAYLVFANKGAIPQLKLIKNTSTENITQVFNKQSIAKIAQLLS
FT                   TVTSNQGSGYRAQIKGYNVAGKTGTAEMVVNGSYNKKGAKRTFFTGFVPVKKPKYIMAV
FT                   RLDYPKKCYTSWNPNLRSKCEGSNSAAMVFKEAMGHILNNDVSIKLSMKN"
FT   gene            complement(321442..321714)
FT                   /locus_tag="Rmag_0297"
FT   CDS_pept        complement(321442..321714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02077"
FT                   /db_xref="GOA:A1AVX0"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVX0"
FT                   /protein_id="ABL02077.1"
FT                   /translation="MRLNINKTKLNIALILGVVALSILTIYWHHQMYLLYTQSKHIEAR
FT                   NQQLVALHKQLLIKQSQTTSGSEIKAKALKILKMQAPKRQIELLL"
FT   gene            complement(321716..322639)
FT                   /locus_tag="Rmag_0298"
FT   CDS_pept        complement(321716..322639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0298"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase; KEGG: tcx:Tcr_0559 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02078"
FT                   /db_xref="GOA:A1AVX1"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVX1"
FT                   /protein_id="ABL02078.1"
FT                   /translation="MIFNHHQSVMLNESIGALNIKTDGIYIDATFGRGGHAQGILNKLG
FT                   EQGKLIAFDQDINAIEYAHKNFTDSRLTLIYSAFSNMLNIITQQGLMSKIDGILMDLGV
FT                   SSPQLDNAQRGFSFKADGPLDMRMNQTTGMSATQWLNLANEEEIANVIYQFGDEKRSRH
FT                   IATRIKKYQQKHTLETTLALAGIVSKVVKRQKNKHPATRTFQAIRIFINQELKQLEDVL
FT                   EQSKDILRKDGRLSIISFHSIEDRIVKHFIQKNSRQKNLPKGLPIIDYKIEKTCLKNLG
FT                   KYFASKAEISRNKRARSAILRVASKN"
FT   gene            322947..323222
FT                   /locus_tag="Rmag_0299"
FT   CDS_pept        322947..323222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02079"
FT                   /db_xref="GOA:A1AVX2"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVX2"
FT                   /protein_id="ABL02079.1"
FT                   /translation="MPYCLNKFYQFAVGGVLVLLLFPWGSTLKLCTLLNISDVADIFAY
FT                   KAITLNIKTTMVIIKNGLALFIWLCYVLIIAKTFTFLNLVYKKNFI"
FT   gene            complement(323385..324334)
FT                   /pseudo
FT                   /locus_tag="Rmag_0300"
FT   gene            complement(324610..325326)
FT                   /pseudo
FT                   /locus_tag="Rmag_0301"
FT   gene            325602..327839
FT                   /locus_tag="Rmag_0302"
FT   CDS_pept        325602..327839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0302"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA topoisomerase IV, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   repeat, beta-propeller; KEGG: hch:HCH_05404 DNA
FT                   topoisomerase IV, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02080"
FT                   /db_xref="GOA:A1AVX3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVX3"
FT                   /protein_id="ABL02080.1"
FT                   /translation="MNQISLEQQSVAEFSERAYLDYSMYVILDRALPFIGDGLKPVQRR
FT                   IVYAMSELGLKSTARFKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYPFIDGQ
FT                   GNWGAPDDPKSFAAMRYTESKLSRYSDLLLSEINQGTVNWVDNFDGSLQEPKNLPAQVP
FT                   NLLLNGTSGIAVGMTTNVPPHNLTEVVSACIALLDKPSMDLDGIMQIIRAPDYPTDADI
FT                   VSSPADLRQIYETGHGSVKMRAIYQKEKGNIVIEALPFQTSGAKVIIQIAAQIRAKKLP
FT                   LVDDIRDESDHENPTRIVIIPRSNRVDVDVLMLHLFATTELEKSYRVNMNVIGLNGKPG
FT                   VLSLIPMLKEWLSYRMKVVINRLTYRLDKILVRLHILKGLLIAFLNIDEVIAIIREHDK
FT                   PKLVLIDHFKLSDIQVEAILELKLRYLAKLEEIKIQAEQQDLALEKEKLKLLLSSDLRL
FT                   KILIKKELKAIIKDFGDERRSNIKRNVNTAQAFSEDDLAPAENITVVLSEKGWVRSAKG
FT                   YSIDPNTLNYKAGDSYLTSVKGKSNKPVIFIDSTGRSYSLLANSLSSARGQGEPLTGKL
FT                   SPPSEARFVDVIMGKASQNILLASNIGYGFIATIGDLLSSRQAGKAFFSLSKGAQMMRI
FT                   INVDDLDNQFIALVTNRGRLLIFPISELPILSKGKGSKLIQISTKDVKSRQEFVMNICI
FT                   LLETQHLKVIAGKRHFTIKFQDLSNYISSRARCGKLLPKGYQNVSSIEAIG"
FT   gene            327941..328318
FT                   /locus_tag="Rmag_0303"
FT   CDS_pept        327941..328318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0303"
FT                   /product="preQ(0) biosynthesis protein QueD"
FT                   /note="PFAM: 6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein; KEGG: tcx:Tcr_1389 6-pyruvoyl
FT                   tetrahydropterin synthase and hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02081"
FT                   /db_xref="GOA:A1AVX4"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVX4"
FT                   /protein_id="ABL02081.1"
FT                   /translation="MFVLKIVTDFASAHLLRDYPGDCSRLHGHNWKVEMMVVARKLNSN
FT                   GITIDFREIKKQTKVVVKLLDHQYLNEIAPFDKLNPTAENIAKYFFYEVGQLINTNDVK
FT                   VKEVTIWETSRASVTYYQGDL"
FT   gene            328315..329109
FT                   /locus_tag="Rmag_0304"
FT   CDS_pept        328315..329109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0304"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: protein of unknown function DUF198; KEGG:
FT                   noc:Noc_2039 protein of unknown function DUF198"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02082"
FT                   /db_xref="GOA:A1AVX5"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVX5"
FT                   /protein_id="ABL02082.1"
FT                   /translation="MSAIHLPDTQNSADTRQIIIDKVGIKDITHPITYIDCDGNKIPTI
FT                   GIFTMTVSLSERVKGTHMSRFIEILNEGPCEFSAHNFDKIIDKVRKRLESDIAHITLNF
FT                   TFFRRKKAPSSGVESMMDYQVTLYGTLNKDEVQVMMKVVVPVTSLCPCSKSISKYGAHN
FT                   QRSHITIKAKAAKDKTLHIEDLIDLAERKASCELYAILKRDDEKVVTERAYDNPAFVED
FT                   LVRDIAVDLNADDKISYYRLESENFESIHNHSAYALIENQKC"
FT   gene            329103..330197
FT                   /locus_tag="Rmag_0305"
FT   CDS_pept        329103..330197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0305"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /EC_number="2.5.1.54"
FT                   /note="KEGG: vfi:VFA0394 phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; PFAM: DAHP synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02083"
FT                   /db_xref="GOA:A1AVX6"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVX6"
FT                   /protein_id="ABL02083.1"
FT                   /translation="MLKKILNKISNIRITKIESITPPIGFIKKYPVKKPQSDFIIHSRK
FT                   TIADIISGKDKRLLVVVGPCSIHDPKAAIDYAQRLLKIKQKLDQDLFIIMRVYFEKPRT
FT                   TIGWKGLIYDPNLDNSFDMEKGFDLARSLLLGLSKMGMPSATEYLDLITPQYISDLISW
FT                   GAIGARTTESQTHRELASGLSCPVGFKNGTNGNIQIAIDAIVSASNSHMFWSISKKGVA
FT                   NRYTTTGNPNCHIILRGAADGPNYSKENIDNAAKQLIKDGLLGRVMVDFSHANSEKNFK
FT                   NQLLVGNEIVKQVSLGSDKIFGVMIESNIYEGAQAVDELKSLEYGVSITDACLGWQDTE
FT                   NLLKILASSVQARNTYFYTKSLTF"
FT   gene            330299..332884
FT                   /locus_tag="Rmag_0306"
FT   CDS_pept        330299..332884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0306"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   repeat, beta-propeller; KEGG: mca:MCA1421 DNA gyrase, A
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02084"
FT                   /db_xref="GOA:A1AVX7"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVX7"
FT                   /protein_id="ABL02084.1"
FT                   /translation="MSEHTENPTHFKPNLPVVTIEDEMRNSYLEYAMSVIVGRALPDVR
FT                   DGLKPVHRRVLYAMEVLGNDYNKSYKKSARIVGDVIGKYHPHGDTAVYDTIVRMAQPFS
FT                   MRNILIDGQGNFGSVDGDSAAAMRYTEIRMAKLSHELLRDLEKNTVDFIDNYDGSESEP
FT                   LVLPTRVPNLLANGSSGIAVGMATNIPPHNLGEVIEACLKTIDNEDITIDELLEIMPGP
FT                   DFPTAGIINGASGIRQAYETGKGKIYLRSVPHIEGEGEDKQSIVVTELPYQVNKAKLIG
FT                   KIAKLVKDKRIDGITGLRDESDKDGMRMVIELRRGEVPEVMLNNLYKLTEMQTVFGINM
FT                   VAIDKGMPKLMTLKNILEAFIAHRRDVVTRRSIFDLNKARNHAHLLEGLAVALHNIDDI
FT                   IELIKSASNSIDAKEVLVAKTWQGSVIKELIGDRDMVMFKPEDLPTELGLQMDGDYQLS
FT                   QKQVQAILDLKLHRLTGLEKNKIFDEFNELLERIKYLLDILQTPERLMQVIREELIDIQ
FT                   SNYANARMTQILEHKIDLTLEDLITQERRVVTLSHGGYVKAQSLSDYQAQRRGGKGKVA
FT                   TKVKDEDFVDQLFIANSHDTVLCFSSLGKVYWLKVYELPMASRIARGKPIVNLLPLEKE
FT                   EIINAILTVSKFDENHFVFMVTSSGTCKKTVLTNFSKPRKGGIIAIELKDNDQLIGVEI
FT                   TSGEHDIMLFSANGKSIRFKESDVRVVGRTAIGVRGIKLANADKVVSLIVVNQDNPILT
FT                   TTEKGFGKRTRLNEYRSQARGGLGVISIKTSDRNGKVVGAIQITDEDEMMLISNKGTLV
FT                   RARAVDVSIIGRNTQGVTLINIIKGEKLVSIAKIAEIEDEESEGENSIE"
FT   gene            complement(333760..335328)
FT                   /locus_tag="Rmag_0307"
FT   CDS_pept        complement(333760..335328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0307"
FT                   /product="bacterial peptide chain release factor 3 (bRF-3)"
FT                   /note="TIGRFAM: peptide chain release factor 3; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu, domain 2 protein; KEGG:
FT                   lpf:lpl0905 peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02085"
FT                   /db_xref="GOA:A1AVX8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVX8"
FT                   /protein_id="ABL02085.1"
FT                   /translation="MNEISKRRTFAIISHPDAGKTTVTEKLLLYAGAIKTAGSVKARKA
FT                   NTHATSDWMEVEKERGISITSSIMQFAYDNHVINLLDTPGHEDFSEDTYRTLTAVDSAL
FT                   MVIDAAKGVEMRTIKLMEVCRLRNTPILTFINKLDREGKEPIDLLDEIETVLNIECAPI
FT                   TWPIGMGKHFKGIVHLLEDKVYLCEIGKNSKIGEYIIIDDVNNSQLDEILGEDTILKIR
FT                   EEIELIHETTTPFSLDEFLAGKQTPVFFGSAISNFGIQNLLDGFIQYAPTPKNRESDVR
FT                   EVKPDEDKLTGFVFKIQANMNPKHHDRLAFMRIVSGQYKKGMKVLQVSTNKQIKISNAV
FT                   TFMSNERTFAEVAYAGDIIGIHNHGGISIGDTFTQGEKLTFQGIPNFSPELFRRAQLKD
FT                   PLKTKALQKGLKQLSEEGATQVFHPIINSSQILGAVGILQFDVVAHRLKHEYGVDCQFE
FT                   TINIATARWVTGSDKDIEQLKIKAGNNIAIDARGMLAYLAPSSVNLQLTIERYPNLVFL
FT                   ATREH"
FT   gene            complement(335328..335774)
FT                   /locus_tag="Rmag_0308"
FT   CDS_pept        complement(335328..335774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0308"
FT                   /product="CMP/dCMP deaminase, zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase, zinc-binding; KEGG:
FT                   xcb:XC_0132 deoxycytidylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02086"
FT                   /db_xref="GOA:A1AVX9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVX9"
FT                   /protein_id="ABL02086.1"
FT                   /translation="MNILDKWDERYLSLAKEISTWSKDPSTQVGAITVGQKKEVLSQGF
FT                   NGFPRGIHDSDDRYNHRETKYQFVVHAEMNAIYNATYSGTSLDGATLYVYGLPICLECA
FT                   KGIIQVGIKKVIIEKSRELDNWNQSVGLSQKMFIEASIELMIKD"
FT   gene            complement(335777..336862)
FT                   /locus_tag="Rmag_0309"
FT   CDS_pept        complement(335777..336862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0309"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: mfa:Mfla_2272
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   glycosyl transferase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02087"
FT                   /db_xref="GOA:A1AVY0"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AVY0"
FT                   /protein_id="ABL02087.1"
FT                   /translation="MFLELINFLAQFDAGFNVLNYLTVRAILAMLSALFFSLMLGRVFI
FT                   NQLQQYQIGQIIRTDGPKSHLIKAGTPTMGGILILFTFMISVLIWGDWSNIYLWIVIVT
FT                   SIIFGTIGFTDDYIKIKHKSSNGLSFSIKFLTQSLGAIVISTWIVLISQDSIQTQLLIP
FT                   FFKDTMLPLGIIGFLILSYFVIVGSSNAVNLTDGLDGLAIMPVILISGALAIFAYLSGH
FT                   YNFSSYLNIPFMPGTGELFVICAALIGAGLGFLWFNTYPAEIFMGDVGSLFLGAILAVI
FT                   TILIRQEILLFIMGSVFVAETLSVIIQVSYYKRYKKRIFLMAPLHHHFEKKGMSEPKII
FT                   VRFWMVTLILVLVSLASIKIR"
FT   gene            complement(336868..337869)
FT                   /locus_tag="Rmag_0310"
FT   CDS_pept        complement(336868..337869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0310"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidylprolyl isomerase, FKBP-type;
FT                   peptidyl-prolyl cis-trans isomerase, cyclophilin type;
FT                   KEGG: tde:TDE2391 peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02088"
FT                   /db_xref="GOA:A1AVY1"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVY1"
FT                   /protein_id="ABL02088.1"
FT                   /translation="MTYRLFLLLTLIISLPSQAKLEEGLYANLHTNQGDIILKFEFEKT
FT                   PLTVINFVGLAQGKKHSNIQIGKPFYNGLKFHRVIDNFIVQGGDPKGNGTGGPGYQFID
FT                   EITDDLKHDDGGILSMANSGPNTNGSQFFITYKAAPWLDGKHTVFGRVVEGMNVVNRIK
FT                   QDDFIRKVNIIRIGEKAKNFQTDEAAFQATNAKYTSKEEKQLAHKKQSLVKFVNQNYPN
FT                   TKLMTAGYFVEINQIGKDNQPKKGDLVKINLSIDLSDGTSIRKAEKPLQFAAGSGALIK
FT                   LIDDEVLQMTLNEKRIIIASLNQIYSDNKRSNLSQDSILIFKLELLSINDIR"
FT   sig_peptide     complement(337810..337869)
FT                   /locus_tag="Rmag_0310"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.991 at
FT                   residue 20"
FT   gene            337987..338220
FT                   /locus_tag="Rmag_0311"
FT   CDS_pept        337987..338220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0311"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: par:Psyc_0327 putative 4Fe-4S ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02089"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVY2"
FT                   /protein_id="ABL02089.1"
FT                   /translation="MSLLITDECINCDVCEPECPNDAIYMGDEIYEIDGDKCTECKGHF
FT                   DEPQCVEVCPVDCCLSDPNSVETEEELLAKIK"
FT   gene            complement(339057..340175)
FT                   /locus_tag="Rmag_0312"
FT   CDS_pept        complement(339057..340175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0312"
FT                   /product="alanine-glyoxylate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.44"
FT                   /note="PFAM: aminotransferase, class V; KEGG: cps:CPS_2190
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02090"
FT                   /db_xref="GOA:A1AVY3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVY3"
FT                   /protein_id="ABL02090.1"
FT                   /translation="MQSFNPPVRTLMGPGPSDVHPRILSAMARPTIGHLDPAFVSMMDE
FT                   TKEGLKTIFKTRNKLTLPVSAPGSAGMETCFSNLVEPDDKVIVCINGVFGMRMKENVTR
FT                   LGGKAIIVEDNWGEAVSANKLEEALKNNPDASIVAFVHAETSTGAQSDAKTLCKLAHQY
FT                   DCITIVDAVTSLGGTELRVDEWEIDAIYSGTQKCLSAMPGISPISFGERAIKKLSIRKT
FT                   PVSSWFLDLNLVMEYWSEGAKRTYHHTAPVNTLYGLHESLVMILKEGIENSWTRHQKNH
FT                   ELLRDGLEAMGINFLVNKKDRLPQLNSVFIPEGVDDVQIRATLLNDYNLEIGAGLGVYA
FT                   GKIWRIGLMGYASRKENIILCLSALKEILASK"
FT   gene            340995..342425
FT                   /locus_tag="Rmag_0313"
FT   CDS_pept        340995..342425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0313"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   psp:PSPPH_3252 glycolate oxidase, GlcD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02091"
FT                   /db_xref="GOA:A1AVY4"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVY4"
FT                   /protein_id="ABL02091.1"
FT                   /translation="MKVIQQLLTQLPKGIVLTGKENTRPFECDGLSMYRQNPLAVVLPE
FT                   NIAQIKQVLKICKVNNTPVVTRGAGTGLAGGAMPLEKSIVLGLSKLNRVILIDVKNRLA
FT                   IVEPGVRNIAISEAVAQHCLYYAPDPSSQIICTIGGNVAENSGGVHCLKYGLTVHNVKA
FT                   IKILTIDGDELILSRQDDGLGLLALMNGSEGLLGIIIEITVKLTPTPVLARVVMAGFGS
FT                   VRDCANVVSDIIRDGIIPAGLEMMDSFAIEAAERFAKVGYPLDAKALLLCELDGTQAQV
FT                   QSELDRVLKVLSSASTLKVSEGEEERLNFWKGRKSAFPAVGRLSPDYYCMDGTIPRRHL
FT                   ADMLEKINELSRKYQLRVANVFHAGDGNLHPLILYDANIEGESEKVEEFGTEILKLSVD
FT                   MGGTITGEHGVGVEKLNAMCHQFNAKELAIFHKIKSVFDPKSLLNPGKAVPELHRCAEL
FT                   GAMHVHHGKLPYLELERF"
FT   gene            342425..342958
FT                   /locus_tag="Rmag_0314"
FT   CDS_pept        342425..342958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0314"
FT                   /product="FAD/FMN-containing dehydrogenases-like protein"
FT                   /note="KEGG: eba:ebA4491 FAD linked oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02092"
FT                   /db_xref="GOA:A1AVY5"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVY5"
FT                   /protein_id="ABL02092.1"
FT                   /translation="MSNRIIQLQELIKDANNLHINSEWLAHVGVIEYFPEELVITIKAG
FT                   TKISDIQMKLAKHNQTLPFFIKIADMSIGAAYAQGAQDLSDCVLGVKIIDGTGEYLNFG
FT                   GQVMKNVAGYDVARLLVGSKGKLALITQISFKVIPISYITQLSASIKRTTTSQLRQQIE
FT                   RKLKQVFDPRGIFH"
FT   gene            342958..344082
FT                   /locus_tag="Rmag_0315"
FT   CDS_pept        342958..344082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0315"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein; KEGG: neu:NE0673 glycolate oxidase
FT                   (iron-sulfur subunit) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02093"
FT                   /db_xref="GOA:A1AVY6"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVY6"
FT                   /protein_id="ABL02093.1"
FT                   /translation="MRTIDIQNLKANDIIRKCVHCGFCLATCPTYQLLGDELDSPRGRI
FT                   YLIKSALENHHFSKQSIIRLDRCLTCRSCETTCPSGVEYGQLVNIGREFVEQKRPFWQK
FT                   VSRYFIRQFLTTPILFNPIGFIFRHSKIKGKPIKPIVKIGKVLLLGGCVQSVLAPNINH
FT                   SIKNILAKLGYETVETPQKQCCGAIDQHLSASHDALAKIKRNIDAWLKIESEVIISSAS
FT                   GCGLMVKDYVSMFEVLDPYYQKAQLIVNKTKDIAEFLSDKDLSQLNLEKVNISYHEPCT
FT                   LQHGQQLGGLVDSILNLLGYQQTPIVDSHLCCGSAGTYSIFQPKLSQQLKINKLQNLQS
FT                   DNPEVIVTANIGCLIHLQKGTKIPIKHWVELLDN"
FT   gene            344806..345219
FT                   /locus_tag="Rmag_0316"
FT   CDS_pept        344806..345219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0316"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /note="SMART: Rhodanese domain protein; KEGG: pol:Bpro_0171
FT                   rhodanese-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02094"
FT                   /db_xref="GOA:A1AVY7"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVY7"
FT                   /protein_id="ABL02094.1"
FT                   /translation="MNQLIEYLPKKAFERLQVNQNAILIDVRCEAENKFVGRPIECIFI
FT                   PWLDDPDWKPNEGKFIAAIKRFVGNKNNGLEREIILICRSGYRSNDAGKCLIENGFTNV
FT                   AHVVSGFEGGLDENDQRGNLNGWRHNGMPWLQC"
FT   gene            345220..346521
FT                   /locus_tag="Rmag_0317"
FT   CDS_pept        345220..346521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0317"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   vvy:VV2596 putative AmpG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02095"
FT                   /db_xref="GOA:A1AVY8"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVY8"
FT                   /protein_id="ABL02095.1"
FT                   /translation="MSKILSAYLDKRMLFIFLNGIASGFPWVIIGSAMTLWLKDAGLTR
FT                   TAIGFFGSIFFVYSINWLWAPLLDKIKIPFFKTLGFRRSWLLLLQILLFILIIAISWTD
FT                   PKISIVWVSLIALLIVITSATQDIVIDAYRIEIISENKDGKIAAAAAVSTSGWWFGFGF
FT                   LGAFAFYLADYSNNWSMVYFVMSFFVLGFILATLLMPKEVHSNQTVTNTPKQWLDETFF
FT                   SPFKDFFNRFGITAILILLFIMFFKIGEAFLGKMSLVFYDDIGLSKTDIATYSKLLGST
FT                   LTIIFSIIASFVSIRFGLLKGLFIGGVSMALTNLMYSYLATIGADKEFLALTIFLDNFT
FT                   SAFSTVTFVAFISYLVNKTYTATQYALMSSMGNLGKILFASSSGLLVDSLEGKDWVIAF
FT                   GGEWAVFFAITTLMVIPSLIMLFWIGKKFKDLFI"
FT   gene            346518..347501
FT                   /locus_tag="Rmag_0318"
FT   CDS_pept        346518..347501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0318"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: glycoside hydrolase, family 3 domain protein;
FT                   KEGG: tbd:Tbd_0727 beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02096"
FT                   /db_xref="GOA:A1AVY9"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022956"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVY9"
FT                   /protein_id="ABL02096.1"
FT                   /translation="MMGPIMMDVSGLALTTQEKQQLIKPSIGGVILFGRNFESIEQVTL
FT                   LIKDIRQVNQNLLIAVDHEGGRVQRFRYGFTHLPAMSKLGALYDKNPDIVIDKAFSCGF
FT                   VLAYELLDIGVDFSFAPVLDINYDTSQVIGDRAFHSNPDVIVKLAGSLISGMHKAGMKC
FT                   VGKHFPGHGFVTADSHIDLPIDDRPMSDLLQDMKPFKRLINHGLDALMYAHVVYTQVDD
FT                   KIAGFSSKWIKDILQNQLKFKGVIFSDDLSMQSAHFIKDITNRVKTSLDSGCDMVLICN
FT                   HPEFVAQIIDKDWGVSKKLQSMQGFYKFKSDKINHQQHLASIRDLL"
FT   gene            347498..347773
FT                   /locus_tag="Rmag_0319"
FT   CDS_pept        347498..347773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02097"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVZ0"
FT                   /protein_id="ABL02097.1"
FT                   /translation="MNNDNTQNFEIKLLGAVRKTLIAVAKDTMTKPGLKHPLSQVTQKM
FT                   ITDCLDIVTSRQIAIEKSLGTHTRMKPVYTDEQVVQSFSVDDLKKA"
FT   gene            complement(347815..349971)
FT                   /locus_tag="Rmag_0320"
FT   CDS_pept        complement(347815..349971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0320"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: pha:PSHAa0122
FT                   DNA-dependent ATPase I"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02098"
FT                   /db_xref="GOA:A1AVZ1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVZ1"
FT                   /protein_id="ABL02098.1"
FT                   /translation="MNLSEITNDLNDKQCQSVTFNNEKNALILAGAGSGKTRVLTHRIA
FT                   YLITQKDIRIDAILAVTFTNKAATEMRERLSTLLRRPIQSMWMGTFHSLAHRLLRTHYE
FT                   KSKLTSGFQILDAQDQFRIVKRLMKENSIDESKFPIKKVQWFINNQKNEDIRAQDIDPD
FT                   YNYFIKKNLEVFELYEAYCQENDLIDFAELLIRSYELLKNNTDLLNHYQARFEHILVDE
FT                   FQDTNTVQYKWIKLLFNGHNKIFCVGDDDQSIYGWRGAKIENITKLCTDFTPIETIRLK
FT                   QNYRSTGNILNASNALITHNVNRMGKSLWTDAGNGELIDVYEARTETDEANYVISNIQK
FT                   LITNGASPSDCSILYRFNAQSRIFEEALIKYNIPYIIYGGLKFFEYTEIKDALSYLRLI
FT                   ENSADNVAFERVVNFPTRGIGNVTVKKIRTFAQDNHTSLFQAAIQISSILPTRAANALS
FT                   SFINLIKQITDDTKHLNLSEKVTNLLNTSGLIMHYSNDKIGSKKENLKKLITITKQYNH
FT                   EQDNKMSEVMGFISLTSLDSSGNTNASINQNVQLMTIHSAKGLEFPCVFLVGMEEDLFP
FT                   SRQSKNEPHLTDEERRLCYVGMTRAMKKLSLSYAIKRFLYGQSLYAYPSRFLNEIPSKY
FT                   LNKIKAKFGATIQNYNDDNTFNKNITPKSDDQISIGALVKHAKFGLGTVLNFEGQGDST
FT                   RVQIKFKQVGTKWLINSYANLEFI"
FT   gene            350089..350274
FT                   /locus_tag="Rmag_0321"
FT   CDS_pept        350089..350274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02099"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVZ2"
FT                   /protein_id="ABL02099.1"
FT                   /translation="MTYYEGVKKMEEMGVNDNYIQGWVAGFLNNPEIEEQRITDEWESG
FT                   YEDGKEHTDANFTNFC"
FT   gene            350332..351279
FT                   /locus_tag="Rmag_0322"
FT   CDS_pept        350332..351279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0322"
FT                   /product="L-lysine 2,3-aminomutase"
FT                   /EC_number="5.4.3.2"
FT                   /note="TIGRFAM: lysine 2,3-aminomutase YodO family protein;
FT                   PFAM: Radical SAM domain protein; KEGG: sde:Sde_1081
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02100"
FT                   /db_xref="GOA:A1AVZ3"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVZ3"
FT                   /protein_id="ABL02100.1"
FT                   /translation="MMKDNWQYYARYTLKGANQSNDFFKIEAFKDQDFPIKIPLEFAQL
FT                   IDKSNKNDPLLRQVISSKVLSKSENFSLLPLEEEKYSPVAGLIHKYPNRVLLITSQVCA
FT                   IHCQYCFRQNFNYSEHDAISNWNEVQNYIVNDVKINEVILSGGDLLSLSDDKLSILIDN
FT                   IANIAHIKTLRIHTRSIVVMPSRITDKLADTLNQSRLNVVIVLHTNHAQELSVKFAQKI
FT                   TKLSGVTLLNQSVLLKGVNDSIKILTELCLKLFDLGILPYYLHMLDKVQGAQDFLVKDD
FT                   DAIQLHQQLKNNLSGYLVPKLVRDNGNHSKDWLL"
FT   gene            complement(351271..351825)
FT                   /locus_tag="Rmag_0323"
FT   CDS_pept        complement(351271..351825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0323"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: tbd:Tbd_2118
FT                   thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02101"
FT                   /db_xref="GOA:A1AVZ4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVZ4"
FT                   /protein_id="ABL02101.1"
FT                   /translation="MTKNLIIPPRLAFQLGNKIAKIGFICSLFLAFNVAQAISIDDMWQ
FT                   KERKIKVPDFSLTDLNGNIHTNKSTLGKYLVVNFWATWCPPCLKEIPDFVKFYEKNKDK
FT                   VLILGLDYEQAGKAAIIEFTDTFMVNYPIILFDDKNYAQFKKFDEILGMPTTYIYGPNG
FT                   NLVDYQMGEMDMMALEKAISK"
FT   sig_peptide     complement(351712..351825)
FT                   /locus_tag="Rmag_0323"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.896) with cleavage site probability 0.754 at
FT                   residue 38"
FT   gene            351838..352185
FT                   /locus_tag="Rmag_0324"
FT   CDS_pept        351838..352185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0324"
FT                   /product="arsenate reductase"
FT                   /note="TIGRFAM: arsenate reductase; PFAM: arsenate
FT                   reductase and related; KEGG: sdn:Sden_1646 arsenate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02102"
FT                   /db_xref="GOA:A1AVZ5"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVZ5"
FT                   /protein_id="ABL02102.1"
FT                   /translation="MSTVIYHNPRCSKSRAMLTILEQKNVDFEIIKYLENPPTSNELKQ
FT                   LLTDLNLEARSLMRKGEPEYKEQGLDDEALTENQLINSMIKTPKLIERPIVRTSKGVVI
FT                   GRPPENVLSIL"
FT   gene            complement(352211..352870)
FT                   /locus_tag="Rmag_0325"
FT   CDS_pept        complement(352211..352870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0325"
FT                   /product="Glutathione S-transferase, N-terminal domain"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   KEGG: tcx:Tcr_1309 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02103"
FT                   /db_xref="GOA:A1AVZ6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR005442"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVZ6"
FT                   /protein_id="ABL02103.1"
FT                   /translation="MKLELISFKLCPFAQCAIILLNKQKLDFELNHINPMNPPNWFKQI
FT                   SPTEQVPLLKVDERIIFESSVITEFINDISKTNLHPSDPIQKAENRSWIQFSSTLFDNL
FT                   FGIVTGDEEKFHTSKKSLFDKLAKVEVVKNNTKFFNGNNFSIIDAAFAPIFMRLNWINE
FT                   FTNNILSLNEFKHLSTWSKELLQVDVVKNSVVERLNDVYYSNIEAREGHLLTLLID"
FT   gene            complement(353318..353650)
FT                   /locus_tag="Rmag_0326"
FT   CDS_pept        complement(353318..353650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0326"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein; KEGG: sde:Sde_3343 poly(A) polymerase, PcnB"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02104"
FT                   /db_xref="GOA:A1AVZ7"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVZ7"
FT                   /protein_id="ABL02104.1"
FT                   /translation="MNLKQQLKTVTDTIEKLKGEDIVTLKILEQSADIEAIVIATGRSI
FT                   QHVRGISNNLKIEAKRLNMKMLGIEGIQTGYWVLIDLAEVVVHVMTGKTREFYKLEKLW
FT                   SELKNT"
FT   gene            complement(353647..354324)
FT                   /locus_tag="Rmag_0327"
FT   CDS_pept        complement(353647..354324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0327"
FT                   /product="nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="TIGRFAM: cytidyltransferase-related domain;
FT                   nicotinate (nicotinamide) nucleotide adenylyltransferase;
FT                   PFAM: cytidylyltransferase; KEGG: eca:ECA1306
FT                   nicotinate-nucleotide adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02105"
FT                   /db_xref="GOA:A1AVZ8"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVZ8"
FT                   /protein_id="ABL02105.1"
FT                   /translation="MSIAKEPRFKMISFFGGSFDPIHYGHLKNATQLKTELGLSKLFLM
FT                   PCAKPVHKKQLNFNVNQRMDMLRLAVEEFNTLSIDTREVNHNRDSYTIDSLKHIQSDYQ
FT                   NDSICLIMGVDSFNTLSSWKAYQVFYQYCHLVVIARADTFTHQEKYGFKLTSTVGDLAK
FT                   QKTGFVFFANNQILDISSSAIHDILLNILQRRINTTLSNKIRDQQNLSKLLPKSIIDYI
FT                   DTL"
FT   gene            complement(354321..355043)
FT                   /locus_tag="Rmag_0328"
FT   CDS_pept        complement(354321..355043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0328"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bsu:BG12648 involved in polyketide synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02106"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1AVZ9"
FT                   /protein_id="ABL02106.1"
FT                   /translation="MDIQIFKEKGYTLEILYCIGVLEDSIHFIFDHNTKTCAIVDPAWD
FT                   APLFIQRIHNKGYILTDIWLTHWHFDHTNAVDEIVKATGAKITVGVNEVPYLQIDSLPE
FT                   TVDNNDTIFIGNTPAKIINTPGHSAGGICYLLDGHIIAGDTLFVYGAGHCSLPGGNINE
FT                   LFHSMQKLKRIDDNVMLHCGHDYGSRVNTTMGEQKQGNAFLLIDNEADFLNYVNSMQQG
FT                   KIPYPTDAVTQTEIKAML"
FT   gene            355140..355215
FT                   /locus_tag="Rmag_R0011"
FT                   /note="tRNA-Ala1"
FT   tRNA            355140..355215
FT                   /locus_tag="Rmag_R0011"
FT                   /product="tRNA-Ala"
FT   gene            355237..355311
FT                   /locus_tag="Rmag_R0012"
FT                   /note="tRNA-Glu1"
FT   tRNA            355237..355311
FT                   /locus_tag="Rmag_R0012"
FT                   /product="tRNA-Glu"
FT   gene            355375..355449
FT                   /locus_tag="Rmag_R0013"
FT                   /note="tRNA-Glu2"
FT   tRNA            355375..355449
FT                   /locus_tag="Rmag_R0013"
FT                   /product="tRNA-Glu"
FT   gene            355482..356426
FT                   /locus_tag="Rmag_0329"
FT   CDS_pept        355482..356426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0329"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /EC_number="5.4.99.-"
FT                   /note="KEGG: eci:UTI89_C2927 ribosomal large subunit
FT                   pseudouridine synthase D; TIGRFAM: pseudouridine synthase,
FT                   RluA family; PFAM: RNA-binding S4 domain protein;
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02107"
FT                   /db_xref="GOA:A1AW00"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW00"
FT                   /protein_id="ABL02107.1"
FT                   /translation="MSLLSVIIPNRFIGQRIDAAMAQMLPNYSRVKITYWIKSGDALIH
FT                   HKTFKPKEKVLGGEVITLSIKIEKTNAWLAQDIVIDVVYEDEAIIIVNKPVNLVTHPGV
FT                   SNWTGTLANALLHYDSSLANLDRAGIVHRLDKNTSGLMVVARSEYAQKYLTRQLQTHSI
FT                   SREYSAIVYGHMISGGTVDKPIGRDPKDRIRQTVTESGKDALTHYRVIERFAHHTHVKV
FT                   MLETGRTHQIRVHLSFIGHPLIADPMYGGKIRFPKKADKQLKNSLKNFNRQTLHAKKLT
FT                   LIHPTSTELMSWKVPLPQDMQDLLQVLAKFDAN"
FT   gene            356580..356958
FT                   /pseudo
FT                   /locus_tag="Rmag_0330"
FT   gene            complement(357197..357592)
FT                   /locus_tag="Rmag_0331"
FT   CDS_pept        complement(357197..357592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0331"
FT                   /product="putative prophage repressor"
FT                   /note="PFAM: peptidase S24, S26A and S26B; KEGG:
FT                   tbd:Tbd_1516 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02108"
FT                   /db_xref="GOA:A1AW01"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW01"
FT                   /protein_id="ABL02108.1"
FT                   /translation="MSDLDTPQKLFQTNCSTNSEPFALQNLGNYMTPEFSENCIVIIDP
FT                   SIQIHNRAYAVVRFDDELYFRQYIERGSNKFLICLNTQHDDIELKGEFEIIGCVVQQKQ
FT                   RKQKPRHYYHLNPFTKEMDFYASGKLR"
FT   gene            complement(357580..358389)
FT                   /locus_tag="Rmag_0332"
FT   CDS_pept        complement(357580..358389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0332"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: ilo:IL0245 formamidopyrimidine DNA
FT                   glycosylase; TIGRFAM: formamidopyrimidine-DNA glycosylase;
FT                   PFAM: Formamidopyrimidine-DNA glycolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02109"
FT                   /db_xref="GOA:A1AW02"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW02"
FT                   /protein_id="ABL02109.1"
FT                   /translation="MPELPEVEITKRGLVPLIINQEVSRVILHRENLRWAIPKNLITIL
FT                   ANQKIKTIKRRAKYLLIKFEAGTLIIHLGMSGSIKVVDIKTPLLKHEHFELQFNNGTSM
FT                   RLNDPRRFGAVLFSKDGSHKLLDSLGVEPLEAVFNNGYLYQKSRNKRKNIKDFIMDSKI
FT                   VVGVGNIYACESLFMASINPQRKAGNVSKTRYKILTQCIKDILTQAIKAGGTTLQDFSQ
FT                   VDGNPGYFTQTLSVYGCENKTCHFCKSKIIKIVQNQRSTFYCRKCQT"
FT   gene            358468..359055
FT                   /locus_tag="Rmag_0333"
FT   CDS_pept        358468..359055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0333"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: noc:Noc_1372 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02110"
FT                   /db_xref="GOA:A1AW03"
FT                   /db_xref="InterPro:IPR010389"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW03"
FT                   /protein_id="ABL02110.1"
FT                   /translation="MFDRINLVQCKIILGFVTTAIVVYFVGMDVIINQHYAFSVWLHVL
FT                   AGIVWIGLLYYFNFVQGPGMVQALADTDGPGTAAIGKYIAPRALLWFRMAAVTTWILGL
FT                   VLLVLQSRGMDGIIGAFTLAQGYQVIGIGAWMGTIMAFNVWFIIWPNQQKILCMKEATA
FT                   EEIVIAKKNAALASSVNVILSIPMLLTMLAWH"
FT   gene            359363..360406
FT                   /locus_tag="Rmag_0334"
FT   CDS_pept        359363..360406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02111"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW04"
FT                   /protein_id="ABL02111.1"
FT                   /translation="MKKQLLIAAVAATMSIAATADVSITGDSYVSFASRKIGLANIGVN
FT                   KNHDSQGVRLKVVGSTGDTKITAVIRNGSQTRVNEEPKEIDKNRGLHMDSLYVTTKVGP
FT                   VNIKAGDYWGTIGLGARFSSRSKPNSFAASTKIGNWKVGMYTGDGSNSLGRDNNTNIST
FT                   SGKVGPVTIGLVHNPKDFTDITLKGIFRDISVEVERWIDKTEVKNDTTFVRIGGKVNNF
FT                   KWDVAQIRNDVVYSAFVENNDKFTPLGSMLIGKGARGGTATATVNVGDFTKILGVAVST
FT                   KLAGNTVKAIITKNTYGTIDEVTGTELIISRSVGGATFTANIAKLSGVEARNLNAANKG
FT                   LRLDVKF"
FT   sig_peptide     359363..359425
FT                   /locus_tag="Rmag_0334"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.932 at
FT                   residue 21"
FT   gene            360514..361197
FT                   /pseudo
FT                   /locus_tag="Rmag_0335"
FT   gene            361210..362583
FT                   /locus_tag="Rmag_0336"
FT   CDS_pept        361210..362583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0336"
FT                   /product="sodium/proton antiporter, NhaD family"
FT                   /note="PFAM: Citrate transporter; KEGG: sde:Sde_0065 Na+/H+
FT                   antiporter (NhaD family); TC 2.A.62"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02112"
FT                   /db_xref="GOA:A1AW05"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW05"
FT                   /protein_id="ABL02112.1"
FT                   /translation="MIKLFKLLTLLPMSAFATSEPFSTLDLTSHWVGYMALMLFVLAYI
FT                   LVMVEEFTHFRKSKPVILVAGIIWGLIGWVYSSQGLPHSAEVALRHNILEYSELFLFLL
FT                   VAMTYIEAMRERQIFEALKVWLVNKGLTFRQLFWLTGFLAFFISPIADNLTTALIMGAV
FT                   VLAVGVGNPRFVSIAFINIVVAANAGGAFSPFGDITTLMVWQKGIVEFSQFFSLLVPSL
FT                   INFVVPAAIMHFSIKNEVATVSQSKVDIKLGGIAIVVLFIITIITAVSFHNFLHLPPAM
FT                   GMMTGLSYLMIAAYFIRKSERKLQQDGFDVFKKVANAEWDTLLFFFGVILSVGGLGFMG
FT                   YLALTSETMYLSLGATYSNILVGVLSAIVDNIPVMFAVLSMNPDMSLGHWLLVTLTIGV
FT                   GGSLLSVGSAAGVALMGQSKGLYTFGSHLRWTGVIALGYGASIGAHLLMNGTLFDVPV"
FT   sig_peptide     361210..361269
FT                   /locus_tag="Rmag_0336"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.683 at
FT                   residue 20"
FT   gene            362570..363274
FT                   /locus_tag="Rmag_0337"
FT   CDS_pept        362570..363274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0337"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: putative transcriptional activator, Baf
FT                   family; PFAM: Bordetella pertussis Bvg accessory factor;
FT                   KEGG: cps:CPS_4744 putative transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02113"
FT                   /db_xref="GOA:A1AW06"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW06"
FT                   /protein_id="ABL02113.1"
FT                   /translation="MCQSELCLLVDIGNTAIKWRLNDETNSALIKEFNITELPKADEIF
FT                   VSCVGDCHILNGLNNVHFVKTERMFKSLECGYQIPSTLGSDRWLAMLASIERYPKQNLL
FT                   IIDAGTALTFDLVLANGKHQGGLIMPGLSVLRHSFSQFSSGVQQLSLSLTANNTQEGWI
FT                   FGTSQMLMGAINTQIEQHLDNYSDLIVVLTCGDAKIIALKLHYQVKLHQNLVLEGLSSY
FT                   AQTYKVLHSTLV"
FT   gene            363305..364504
FT                   /locus_tag="Rmag_0338"
FT   CDS_pept        363305..364504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0338"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: noc:Noc_1038 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase, class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02114"
FT                   /db_xref="GOA:A1AW07"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW07"
FT                   /protein_id="ABL02114.1"
FT                   /translation="MQDKRVLSGMRPTGQLHLGHYYGVLKNWLALQNEYDSYFFVADWH
FT                   TFTTHYSDKIDLNTNVMKMVVDWLSVGINPNTSTIFVQSKVPEHAELHLLLSMLTPLSW
FT                   LERVPSYKDQQLKLSTKDLATYGFLGYPLLQSADILIYKAGLVPVGEDQVAHIELTREV
FT                   ARRFNYLYGREVDFEEKAEIAISKMGKKQAKLYRSLRKVYQEIGNDDALIKAQALLQQQ
FT                   QNITLGDRERLLGYIEGVGKIVLPEPESLLTKASKMPGLDGQKMSKSYGNTISLRDTAE
FT                   QIRAKIKHMPTDPARIKLTDIGNPQKCLVWQLHKVYSNKSTCDWVVEGCTKAKIGCVEC
FT                   KQPIINAIEEELTPIQERIAKYQADPGLIKQIIFEGSEKARSVAKETMIEVRKAMGINY
FT                   "
FT   gene            364507..365235
FT                   /locus_tag="Rmag_0339"
FT   CDS_pept        364507..365235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0339"
FT                   /product="ribosomal large subunit pseudouridine synthase B"
FT                   /EC_number="5.4.99.-"
FT                   /note="TIGRFAM: Pseudouridine synthase, Rsu; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase;
FT                   KEGG: noc:Noc_1041 pseudouridine synthase, Rsu"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02115"
FT                   /db_xref="GOA:A1AW08"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW08"
FT                   /protein_id="ABL02115.1"
FT                   /translation="MADRLQKLIANAGYGSRRWAEHLIEQGRIEVDNKTASIGDNAEIT
FT                   DCVKIDGQKIDLSRYLEQEIKVIILNKQAGVICSNLDDKGRKSVYSLLPKESRWVMVGR
FT                   LDLNTSGLLLFTNNGDLANKLMHPSSQIDREYAVRVLGQVEDEDLKKLTQGVKLDDGFA
FT                   KFSQIIFGGGQGANRWYKVVLKEGRKHEVRRLWEELGFKVSRLIRIRFGEIRLPNNLKA
FT                   NQYDYLKPRQVKLLLDIVER"
FT   gene            365592..368360
FT                   /locus_tag="Rmag_0340"
FT   CDS_pept        365592..368360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0340"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   noc:Noc_2277 isoleucyl-tRNA synthetase, class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02116"
FT                   /db_xref="GOA:A1AW09"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW09"
FT                   /protein_id="ABL02116.1"
FT                   /translation="MSDYKSSLNLPATQFPMKANLANREGGFLKKWQNDGLYDQIRQQN
FT                   QGKPKFVLHDGPPYANGDIHIGHTVNKVLKDMIVKSKSLSGFDAPYVPGWDCHGLPIEF
FT                   NVEKKYGKVGVKIDASTFRSKCRKYADQQVLKQKQDFQRLGILSDWDNPYLTKDFQYES
FT                   DIVRALGRIVKNGHVSKGYKPVHWCTECGSALAETEVEYKDNQSEAIDVKFRIIDDSVF
FT                   NMNKPVSVVIWTTTPWTLPANEAVALHPELNYVLVDIGDEYLLLAQALVETSISRYGIE
FT                   ATIGEQTFSGSELEGLKIKHPFYDKQVPIILGEYVTIDAGTGAVHTAPAHGQEDFIVGL
FT                   KYNLPVECLVDIKGVFFKETELLGGQFIFKANDSVIEILKQANTLVKHESLMHSYPHCW
FT                   RHKTPVIFRATPQWFISMQKNGLIDTVNREISKVQWMPDWGKKRIELMMDSRPDWCISR
FT                   QRFWGVPITLFVHKQTGELHPNTQALFVSIANRIEKEGIEAWFKSDAQDFIGNDANDYD
FT                   KTTDILDVWFDSGVSHFTVLKARKELSNVADLYLEGADQHRGWFQLSLISSVAINGKAP
FT                   YKNVLTHGFVVDKNGKKMSKSLGNVMSPQKIVNNLGADVLRLWIASTDYTSEMTVGDEI
FT                   LKRSADSYRRIRNTMRFMLANMQAFNPVEHLLDNKQMLDLDKWIVAKTANLQTQIIKAY
FT                   EQYNFHHVVQLILNFCSNDLGGFYLDVIKDRQYTTQANSLARRSAQSALHHITEAMVRW
FT                   LAPILSFTAEEIWQNMPSEKNTSIFLASWYQDLTFGYENKAIDITREISPFIRKQMEGM
FT                   RGEKIIGSSLESEIDIYCETDIFSTLSQLDDELRFIFITSYIRIHSLNEKNDDCIKAIE
FT                   GVFIKVSKSRHEKCVRCWHHREDVGNNAKHPELCGRCVENVDGKGEIRKFA"
FT   gene            368361..369440
FT                   /locus_tag="Rmag_0341"
FT   CDS_pept        368361..369440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0341"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG: tcx:Tcr_2136
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02117"
FT                   /db_xref="GOA:A1AW10"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW10"
FT                   /protein_id="ABL02117.1"
FT                   /translation="MKTLNLDLQEKSYPIYIGQDLLSEGKLLTKHISGKQVMIVTNTTV
FT                   APLYLEKVQNLLLSFEFAQVILPDGEKYKTLDTLNCIFNALLKNRFDRSCTLIALGGGV
FT                   VGDMTGFAAASYQRGVNFIQIPTTLLSQVDSSVGGKTGINHVLGKNMIGIFHQPKCVLI
FT                   DIDTLDTLNNQQYSAGMAEVIKYGLLGHLNFFNFLQENIRDLMDRNKPLMAEIIYQSCQ
FT                   YKINIVVQDELEVGKRALLNLGHTFGHVIENILGYGIFLHGEAISVGMLMAVKLSHLEG
FT                   YLSINQVAQVQDLLEKANLPIFIIGKISASDFMKVMLVDKKVINGNIRLILLKELGHAF
FT                   VCNHYKDQLLNQVINEFCQ"
FT   gene            369447..370037
FT                   /locus_tag="Rmag_0342"
FT   CDS_pept        369447..370037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02118"
FT                   /db_xref="GOA:A1AW11"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW11"
FT                   /protein_id="ABL02118.1"
FT                   /translation="MTDKKNPGVEDDEVMITSSISDLEKMLESVEKHADLRTDTKFEKF
FT                   FLPALAVFSAIIIGFFVVIYSITLDMTRLANSMDPDMGGNMSSMVKSINNLSNNVEQMT
FT                   VSVAYMQKDFQRVNKNMNIIASKLDNLDAIAVDLTQVSLKMDSLEPMLINMEEMNKNMA
FT                   NIQNSMQWMQLDLNILRSSFSKPLRIFNNIPML"
FT   gene            370040..370327
FT                   /locus_tag="Rmag_0343"
FT   CDS_pept        370040..370327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0343"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; PFAM: Glu-tRNAGln amidotransferase, C subunit;
FT                   KEGG: neu:NE2071 Glu-tRNAGln amidotransferase C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02119"
FT                   /db_xref="GOA:A1AW12"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW12"
FT                   /protein_id="ABL02119.1"
FT                   /translation="MSLSEKQINQIAYLARLSLNEVQLKNNTQDLNAIFSLIEQLANIE
FT                   TDGIEPMLHPLHMFQRLRKDVVIEKEQSVLFQSVAPKTRNGYYLVPTVIE"
FT   gene            370329..371771
FT                   /locus_tag="Rmag_0344"
FT   CDS_pept        370329..371771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0344"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase; KEGG: noc:Noc_2636
FT                   glutamyl-tRNA(Gln) amidotransferase A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02120"
FT                   /db_xref="GOA:A1AW13"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW13"
FT                   /protein_id="ABL02120.1"
FT                   /translation="MHTKTIVELAQGFKDKDFSCVELTQYYLNRIDQSDLNAFITVTDE
FT                   LALAQAQVADDKIASGNANILTGIPYAHKDIFCTKGVKTSAGSRMLDTFVSPYDATVSQ
FT                   KLNQVNLVMLGKTNMDEFAMGSSNENSFYGAVKNPWNYLKIPGGSSGGSAASVAGGLSC
FT                   FATGTDTGGSIRQPASLCGITGIKPTYGRISRYGMIAYASSLDQAGPMTKTAQDAAIVL
FT                   NVMAGFDEKDSTSVEQKVPDYTTHLNDSIKGLIIGLPKEFFSSGLDDEVANNIMAAVKE
FT                   FEAMGAIVKEVSLPNLAYAIPVYYIVAPCECSSNLSRLDGVRYGYRAKNVKNLEDLYLR
FT                   SRSEGFGEEVKRRIMIGAYALSAGYYDAYYLKAQKVRHLISDDFKKVFEQIDVIMGPVS
FT                   PTTAFDLGSVKDPVSMYLADIYTLSANLAGLPGMSIPAGFAQNLPVGLQLIGNFWSESR
FT                   LLNIAHQFQLQTDWHLKTPQEC"
FT   gene            371773..373203
FT                   /locus_tag="Rmag_0345"
FT   CDS_pept        371773..373203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0345"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB/Yqey domain protein; GatB N-terminal
FT                   region; GatB, central domain protein; KEGG: mca:MCA0097
FT                   glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02121"
FT                   /db_xref="GOA:A1AW14"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW14"
FT                   /protein_id="ABL02121.1"
FT                   /translation="MEWETVIGLEIHAQLNTKSKIFSAASTQYGQKPNSQACAVDLGLP
FT                   GVLPVLNVEVINKAIKFGVAINAHINQRSIFDRKNYFYPDLPKGYQISQMDRPIVGEGK
FT                   IEITFDDQTKIVGITRAHLEEDAGKSMHDMFDDDTAIDFNRAGIPLLEIVSEPDMRSAK
FT                   EAVIYAKKIHALVQYIDICDGNMQEGSFRFDANVSIRPKGEKELGTRTELKNINSFKFL
FT                   ERAINLEVERQQDILEESGSIVQETRLYDSVKHETRSMRSKEETNNYRYFPDPDLLSVE
FT                   ISNELLEKIRQTLPELPTQKKARFVSELGLSDYDADVLTLQKPLADYFETMLEHHASNA
FT                   KLCANWIMGELSASLNKHKIDIQNSPITAQALSLLISRISDDTISGKAAKDVFKAMWNS
FT                   EGNADEIIQAKGLKQMIGMGEIEAIVEQVIANNARQAVQFKLGNDKIFGFFVGQIMKLT
FT                   AGKANPKQVNELLRNKLF"
FT   gene            373208..374581
FT                   /locus_tag="Rmag_0346"
FT   CDS_pept        373208..374581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0346"
FT                   /product="protein of unknown function UPF0061"
FT                   /note="PFAM: protein of unknown function UPF0061; KEGG:
FT                   vpa:VP0909 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02122"
FT                   /db_xref="GOA:A1AW15"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW15"
FT                   /protein_id="ABL02122.1"
FT                   /translation="MLDFATLGSDFFSNIDTQSLKQPFLIHKNQALQDRLKLSIKDNEL
FT                   LNIASGKNKFQCMQPIASIYAGYQFGHFVPQLGDGRSCLIGQVQGLELSLKGAGQTPYS
FT                   RGADGRAVLRSSIREYLCSIAMKGLNIPTTEALTLVGSHSEVYRENIETGAIVMRCAPS
FT                   HIRFGHFELFAVRGQISQVRQLADFVIEHHYQYCQGENQYIDFFNEVVQKTAIMIAHWQ
FT                   AQGFVHGVMNTDNMSILGLTIDYGPFGFLETYNPKFICNHSDHEGRYSFDQQPNIALWN
FT                   LSRLADSLSSLINTKQAKLVLDKYQNYLVESYSVLMRQKFGLHEKDKQDHVLITQFFDM
FT                   LYQHKKDRTNSLRQLSNVDKLAINTDFNDWIELYDKRVSQENNRNRISMMNSVNPNYIL
FT                   RNYLAEVAIRKAEDDKDYTEIEILFDLLSKPFEVHQDMEFYTYEAPDWAQGLTVSCSS"
FT   gene            complement(374578..375210)
FT                   /locus_tag="Rmag_0347"
FT   CDS_pept        complement(374578..375210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0347"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: tcx:Tcr_1229 peptidase
FT                   M50"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02123"
FT                   /db_xref="GOA:A1AW16"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW16"
FT                   /protein_id="ABL02123.1"
FT                   /translation="MLDIQTLLIWTIPVLFSITVHETAHGWIASKLGDHSARMMGRLTL
FT                   NPIKHIDPIGTILVPAFLYLTSGFIFGWAKPVPVNFNALRSPKKDMLWVAIAGPMSNFI
FT                   MAIIWLVIILLVVNNIDSQFLIDMGQVGVQINLILAVLNLLPLPPLDGGRIVSSLLPRK
FT                   LSYQYDQLEPYGLYILLGLLFLGVFQWVVFPIVKIIQQFMFSVTGLI"
FT   gene            375246..376925
FT                   /locus_tag="Rmag_0348"
FT   CDS_pept        375246..376925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0348"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); Anticodon-binding
FT                   domain protein; YbaK/prolyl-tRNA synthetase associated
FT                   region; KEGG: hch:HCH_04773 prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02124"
FT                   /db_xref="GOA:A1AW17"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW17"
FT                   /protein_id="ABL02124.1"
FT                   /translation="MKTTKLLIPTQKEVPNDAQIISHQLMIRAGLISKLASGLYSYLPM
FT                   GVRVLHKVENIIRQEMNKSGAQEVFMPVVQPAELWKTSGRWDKYGTELLRFTDRHQREF
FT                   CLGPTHEEVITHLAAQYLRSYKQLPMNFYQIQTKFRDEIRPRFGVMRSREFIMKDAYSF
FT                   HLDQYSLQQTYDVMYQTYCNIFDRLSLDYHAVLADSGSIGGDASHEFHVLAESGEDTIC
FT                   FSDESNYAANIEKVSFLKQEKTCKSTLTEERVLTKKKNSIEEVAEFLNVNKSDCVKILI
FT                   IKTKDGFKALALRGDHELNEIKAHNLFGNFEFAIDDEIKNLDLKKGFIGIKDLDIDLIV
FT                   DYSASVLCDFVCGANEWDYHLMSVNWQGIEFVDADLRSAVEGDYSPDGKGKLIIKRGIE
FT                   VGHIFQLGTKYSSAMKVNVIGESGKAITTTMGCYGIGVTRIIAASIEQNYDDKGIIFPQ
FT                   AIAPFQVVIVPINYNKSTRVKALSDKLYQQFIGAGIEVLLDDRKERAGIMFADSELLGI
FT                   PHRMVISDTHADNGNVEYKARDKIDKMQMKFDDALSFIQFKL"
FT   gene            376933..377745
FT                   /locus_tag="Rmag_0349"
FT   CDS_pept        376933..377745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0349"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: mfa:Mfla_2122 phosphatidylserine
FT                   decarboxylase; TIGRFAM: phosphatidylserine decarboxylase;
FT                   PFAM: phosphatidylserine decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02125"
FT                   /db_xref="GOA:A1AW18"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW18"
FT                   /protein_id="ABL02125.1"
FT                   /translation="MIWWQYVIPQHWLSRLMLHFACIKNIWLKNRFIAWFVKSYQVNLS
FT                   EAVRENIEDYQNFNDFFTRALKPDARKIADSLIVCPVDGKVSKVGNINNTQIIQAKNHK
FT                   YSVEQLLGNDIRSVEFRVGFFITIYLSPKDYHRIHMPYYGKLISMSYIPGDLFSVNQTT
FT                   AENVDGLFARNERVVCYFETEFGLCAFVLVGAIFVGSMQTVWHGQINPPYKKQIQHFDY
FT                   SNEGISLKKGQELGRFNMGSTVIMLMPDQTNKFSLKETEVVRMGQALV"
FT   gene            complement(377720..378889)
FT                   /locus_tag="Rmag_0350"
FT   CDS_pept        complement(377720..378889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0350"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: noc:Noc_2263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02126"
FT                   /db_xref="GOA:A1AW19"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW19"
FT                   /protein_id="ABL02126.1"
FT                   /translation="MMAINRYRLKVLSKNNKNAKRTEHLLNDLDHLIGTILLGNNFVNI
FT                   FASSITTILAIKLWGEGSIVPASLTLTFIILIFAETTPKTFAAKNPEKIALPASIIITA
FT                   LIKLFKPFVWLIAKLSKMILILFGIKNEPHDNLISSEELKMVVNDAKPIIASNYQKMLL
FT                   NIIDLEKVKVEDIMIPRHELISIDINKPDEILKQFERIQHTRLLTYETSSDNITGILHM
FT                   RDIVNLYAKGDFSIDNVLALVRTPYFVPEGTSLAHQLAHFQQQKRRLGLIVDEYGEVCG
FT                   MIVLEDILEEIVGQFTSNQNESIDEIIKQKDGSYLIDPRISIRELNNLLQLNLSVTKAK
FT                   TLNGLILETLQSIPKRDVSLKIDNVLIEIMHISEQTIKLVKIRLKPVPS"
FT   gene            complement(379012..380289)
FT                   /locus_tag="Rmag_0351"
FT   CDS_pept        complement(379012..380289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0351"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="PFAM: enolase; KEGG: tbd:Tbd_0621 phosphopyruvate
FT                   hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02127"
FT                   /db_xref="GOA:A1AW20"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW20"
FT                   /protein_id="ABL02127.1"
FT                   /translation="MNIKQIKAREVLDSRGNPTVEVDVILDDDTIGSAMVPSGASTGQR
FT                   EALELRDGGTRYLGKGVLKAVEFVNTEICNTLINFGIEDLGKIDQAMIDLDGTETKSRL
FT                   GANAILAVSLAVAHANANRQHKPLYMSLNQGENYKLPVPMMNIINGGEHANNNVDIQEF
FT                   MIIPAGAPSFKEALRYGAEVFHHLKAVLEAKNMNTTVGDEGGFAPDLSSNEDAIKVILE
FT                   AIDNAGYKAGKDIFIGIDAASSEFYENGTYNLVSENKSLNSEEFVDYLANWVENYPIIS
FT                   IEDGMDENDWNGWNLLTKKIGDKVQLVGDDLYVTNSKFLKQGIEKNITNSILIKVNQIG
FT                   TLTETFQVMKMATDAGYTSVMSHRSGETEDTTIADLAVATGCGQIKTGSLSRSDRLAKY
FT                   NRLLRIEEELGAKAVYPGLDAFNHLN"
FT   gene            complement(380307..381401)
FT                   /locus_tag="Rmag_0352"
FT   CDS_pept        complement(380307..381401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0352"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: DnaJ central
FT                   domain protein; heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: son:SO1127 chaperone
FT                   protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02128"
FT                   /db_xref="GOA:A1AW21"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW21"
FT                   /protein_id="ABL02128.1"
FT                   /translation="MSQKDYYEILGVAKNADAKQIKKAYKRLAMKHHPDRVKNDKASAE
FT                   KKFKEIQKAYAILSDVQKRQAYDQFGHVGGNANVGSAGGNPFGGGFGDIFGDIFGGGSQ
FT                   QSNNRGSDLRYDLEIDLKKAAQGSTVKIRIPKNETCDTCSGIGAKSGTNVKTCSICSGV
FT                   GQVQTQQGFFTVQRPCGTCSGTGQKIEFPCGTCRGQGLVRKQKTLSVKIPAGVDTGNRI
FT                   RLSGEGEAGTIGSSSGDLYVQVHVKKHAIFEREDNDLYCEVPIDFATAALGGSIEVPTL
FT                   ENKLKIKVPSGTQTGKLFRLRDKGISHLQRDGSGDLICQVKIETPVNLNKKQQDLLQKF
FT                   SSSCGKKHHPESDSFFDKMKSFFG"
FT   gene            complement(381478..383385)
FT                   /locus_tag="Rmag_0353"
FT   CDS_pept        complement(381478..383385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0353"
FT                   /product="chaperone protein DnaK"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; KEGG: sdy:SDY_0013 chaperone HSP70"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02129"
FT                   /db_xref="GOA:A1AW22"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW22"
FT                   /protein_id="ABL02129.1"
FT                   /translation="MSRIIGIDLGTTNSCVAIMDGGNVKIIENSEGDRTTPSIIAYPKD
FT                   SEEVLVGQPAKRQAVTNPENTLYAIKRLIGRRFDEDAVQKDINLVPYKIVKVDNGDAWV
FT                   EVKGKKMAAPEISAKVIGKMKKTAEDYLGEEVTEAVITVPAYFNDSQRQATKDAGKIAG
FT                   LNVKRIINEPTAAALAYGVDKVKGNKTIAVYDLGGGTFDVSIIEMEDIDGEKHFEVLST
FT                   NGDTFLGGEDFDQRIIGYLVDEFKRDQGVDLTNDPMALQRLKEAAEKAKIELSSSEQTD
FT                   VNLPYVTADASGPKHLNIKITRAKLELLVEDLLKRTIEPCKTALKDADLSASDIDEVIL
FT                   VGGQTRMPKVTKMVQDFFGKEPKKDVNPDEAVAMGAAIQAGVLGGDVKDVLLLDVTPLS
FT                   LGIETMGGIMTKLIEKNTTIPTNASQIFSTAVDNQSAVTVHVLQGERNMSSANKSLGQF
FT                   NLEGIPNAPKGQPQVEVTFDIDSDGILDVSAKDKNTGKEQSITIKASSGLSDEEVEKMI
FT                   KDAEAHADEDKKFQELVASKNMADSLIHSTKKTLEELKNEVSDDEKSVIEMAITELEKA
FT                   IKNDDKKAIDAKIQTLSKKAQPLTEKVQAKSSAENTSKEKSKADDDVVDADFEEVKDDK
FT                   "
FT   gene            complement(383462..383941)
FT                   /locus_tag="Rmag_0354"
FT   CDS_pept        complement(383462..383941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0354"
FT                   /product="Phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="KEGG: xft:PD0275 phosphopantetheine
FT                   adenyltransferase; TIGRFAM: pantetheine-phosphate
FT                   adenylyltransferase; cytidyltransferase-related domain;
FT                   PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02130"
FT                   /db_xref="GOA:A1AW23"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW23"
FT                   /protein_id="ABL02130.1"
FT                   /translation="MMKKIAIYPGSFDPITNGHIDLIKRASKLFDEIIIGITQNSKKKA
FT                   FLSIDDRINAANTTLKDIGNIKVLSFNTLLVDFVAKQNAQVILRGLRAVSDFEYEFQLS
FT                   SMNKHLNPNIETLFMTSAEKYANISSSLVREILTLGGDISIFVPTSVEALLKQRL"
FT   gene            complement(383962..384540)
FT                   /locus_tag="Rmag_0355"
FT   CDS_pept        complement(383962..384540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0355"
FT                   /product="16S rRNA m(2)G-966 methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM: conserved
FT                   hypothetical protein 95; KEGG: ilo:IL0225
FT                   N6-adenine-specific methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02131"
FT                   /db_xref="GOA:A1AW24"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW24"
FT                   /protein_id="ABL02131.1"
FT                   /translation="MTPIINNSFQIVSGEYQGRKFNFPKTPSLRPTSGKIRETLFNWIQ
FT                   FESHNKTYLDLFTGSGSLSFEALSRGARQVVSIEQNFNVYQSLKKNKTLLKTNRISIFN
FT                   QDALNFLSKKSTQTFDFIFLDPPFNKNYLPKTLKAFSKGNFMTSNTKIYIESEFKILKN
FT                   EAAEWLSTNIQINKQKHTGQVHYCLITPL"
FT   gene            complement(384521..385051)
FT                   /locus_tag="Rmag_0356"
FT   CDS_pept        complement(384521..385051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0356"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic pyrophosphatase; KEGG: ilo:IL2263
FT                   inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02132"
FT                   /db_xref="GOA:A1AW25"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW25"
FT                   /protein_id="ABL02132.1"
FT                   /translation="MQNSLKPVSAGNVPNEINVIIEIPANSSPIKYEIDKETGAMFVDR
FT                   FILTPMFYPCNYGFVPETLADDGDPADVLVITPYPLIHDSVITVRPIGILRMTDEAGKD
FT                   SKILAVPIDKSCKSYHNIKCIDDVDVTLKNQIEHFFTYYKDLEEGKWVKIDGWSDSIEA
FT                   KKELQNSFDAYHQ"
FT   gene            complement(385293..385984)
FT                   /pseudo
FT                   /locus_tag="Rmag_0357"
FT   gene            386301..386537
FT                   /pseudo
FT                   /locus_tag="Rmag_0358"
FT   gene            386548..386691
FT                   /pseudo
FT                   /locus_tag="Rmag_0359"
FT   gene            388157..388360
FT                   /pseudo
FT                   /locus_tag="Rmag_0360"
FT   gene            389644..391806
FT                   /locus_tag="Rmag_0361"
FT   CDS_pept        389644..391806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0361"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: noc:Noc_3018 signal transduction histidine kinase,
FT                   NtrY"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02133"
FT                   /db_xref="GOA:A1AW26"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW26"
FT                   /protein_id="ABL02133.1"
FT                   /translation="MIFSQYLSLKKTPPAWVWVFVFLLSISGTFYLGLNPDFIEHWWGY
FT                   LVGFNIIMSFVAIYYVYADVLRLKRDVKGGIVGSKFTWSFVKIVPVLVIVPVLSFYIFS
FT                   FQTIQNNVKDSEKAFNVFSQNFIQQVNGLYSGVQKIRDERYTEQTKRLLTLITSFGSFQ
FT                   KDAENYAQSMQIFLDGLIDKGWACQITLLNAQEEVVAKTADVTNCMAIEEQPLPGTQPR
FT                   MINEDETANVIQVKMSTRYLSNISNQDLFVVDMVYATDPGLLGFLSQVRGFANAAQNIK
FT                   FEINTSITQKRFMIDFSSTVLLAILSALMVVFRMIERLMKPLNNLSIATKEIAKGNYDV
FT                   RITKQKESEDVRSLIEQFNTMSRQIKASREGLDTHNLYLETILKYSYGVIALDQNRKIR
FT                   LINPVIGTMLGIEDEKLFFGKKCSTIVDRYSNLEPLFLMTQDKFKRDESEWSEEIKITL
FT                   ANQHLLLSCQGAALKNDNETLGFVIVIKDISRLNRTQKKAAWGEVAKLMAHEIKNPLTP
FT                   ILLSAQRLRNRFMDSLEGKDLDVIDKTTNTIIHQVQSMDTMVSAFADYANTPQIERKPC
FT                   DLNMLIKQSIALYDSQSNMNIDFDLFAGIPLLLLDSHSISRVLINLVKNASEAMIDGRD
FT                   LNVKIITEYLPKQAIVRLNTIDDGDGFDKYVLDRVFEPYVTTKIKGSGLGMAIVQNIIK
FT                   QHEGKIFASNVKPHGAMITIEFNCNK"
FT   gene            391819..392394
FT                   /locus_tag="Rmag_0362"
FT   CDS_pept        391819..392394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0362"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; helix-turn-helix,
FT                   Fis-type; KEGG: pol:Bpro_4433 two component transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02134"
FT                   /db_xref="GOA:A1AW27"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW27"
FT                   /protein_id="ABL02134.1"
FT                   /translation="MDRTLAIGRILIIDDENINAETMMDTLEDVNYHVVLAANANQAKT
FT                   IVEDQIFDLVMMDVWMPAQDGMSLLEEWTQSGFSTPIVMMSGHAEHQDVVKAIKLGAVD
FT                   FLEKPLHDILPLVRKILSEQVLEKSEHTINGIEFNAPLKEARNIFEVQYFNHHLQENKH
FT                   NIAKVAILAGLERTTLYRKLKDLGIDKK"
FT   gene            392401..393774
FT                   /locus_tag="Rmag_0363"
FT   CDS_pept        392401..393774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0363"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: pfl:PFL_0019 potassium uptake protein TrkA PA0016"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02135"
FT                   /db_xref="GOA:A1AW28"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW28"
FT                   /protein_id="ABL02135.1"
FT                   /translation="MKILILGAGQVGATLAKYLGSDNDNDITIIDKDESNLSNLQRHLD
FT                   IKTICGHASYPNVLEEADIKNMDMMIAVTRSDEGNMLACQMAHTLYQVKKKVARIRTAE
FT                   YLHRKELFSPNAIPIDFIITPEELVTNYIKRVVEEPGAEQVFEFENGLVQLVETRAYAG
FT                   TPIVGHPIKDLHEHLPKTRVRIVSLYRNGRAIPASGETVIRDGDRVYFMTKKASISKVI
FT                   KQFRREDKTYKNIIIAGGGRIGLNLAKFLEKNHHVRIIEMNKKRVSEIVDELENTLVLL
FT                   GNASDEELLLEEGIENTDLFLALTDFDEINVIVSILAKRLGAHKTVALVKRNVYEDLAK
FT                   QSEDVDMVISPDQITVSGILAHIRKGDTMMVYSLRQGKAEAIEIIVHGDKHHSDVVGKT
FT                   IEQINLPDGVVVGSVVRNHEVIMGSRTLIIKEGDHVLLVLTDISKIHEVEKLFERYFD"
FT   gene            393787..395235
FT                   /locus_tag="Rmag_0364"
FT   CDS_pept        393787..395235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0364"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: hch:HCH_00025 trk-type K+
FT                   transport system, membrane components"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02136"
FT                   /db_xref="GOA:A1AW29"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW29"
FT                   /protein_id="ABL02136.1"
FT                   /translation="MQFSIVFKTIGLLLMVFSLTQLPPIVVDFIYAQNEALSFMVAFSL
FT                   TLLSGFVLWFPFRNSTKNFRIREGALVVVSFWFVLSLFATTPFLLSVSLDMSFSDAFFE
FT                   SMSGLTTTGATVLSGLDDLPKALLYYRQQLQWLGGMGIIVLAVAILPMLGVGSMELYHA
FT                   ELSGISKERLTPKLTQTAKALWKIYISFTVVCALGYYFAGMNAFDAIGHSYATVAIGGF
FT                   STHDASIGYFNSYAIEMVAMIFMLLAGINFSLHFLVWRKNNLFFYLKDSEFKAYLLILS
FT                   ASILLVSSYLFDKGYYQTIEESIRYGIFQSISIITTTGFSGTNFSLWPFVLPVFLIFAS
FT                   FIGACVGSTGGGIKVVRILLMFKLAMKEIKKFIHPNAQINIKLNQKSVPENTLISVWGF
FT                   FSLYVIVFVMLMLMLMFTGLDQVSAFSATAASINNLGPGLGDVADNYGNINDTAKWILS
FT                   FSMLLGRLEILTLMALLHKSFWRF"
FT   gene            complement(395257..397314)
FT                   /locus_tag="Rmag_0365"
FT   CDS_pept        complement(395257..397314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0365"
FT                   /product="helicase c2"
FT                   /note="SMART: DEXDc2; helicase c2; KEGG: sdn:Sden_2429
FT                   helicase C2"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02137"
FT                   /db_xref="GOA:A1AW30"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039000"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW30"
FT                   /protein_id="ABL02137.1"
FT                   /translation="MLSNELKAQIRQSFMSLKKNMDGFKVRQTQNRMIAEISKTLSGEY
FT                   KGNNNILCIEAPTGTGKTFAYLIGSILIAKANKKKLIISSANVSLQEQLFFKDIPQVQK
FT                   YCCIDFEYALVKGRSRYVCIHNLINVCENNTSDNFLFESIPLFDKPPGKYQLEQLNEML
FT                   NDYSTKKWNGEIDDLMRVPDHSIWKKIACNRFTCTTKSCEFYQNCAFFKARQKITKADV
FT                   IVANHDLVLADLSTGNTILPNVNKSIFIFDEAHHLNSKALSHFSLTTSTELIKTSVKQT
FT                   KAVSEQLCKISKQDMPDIDIKQIDDYLTNLIQLFKKLEFNDNIYLFNQGIIDKSINQIS
FT                   ENILTLIGAIQTKFMLLKESWDDYLKITVIDKSISDSINNATGECEQHLLSIIALFSSF
FT                   LQTDEPNKAPHSRWIEKSTLANKKNSYLLNSAQTNISKNLDQLIWSKVSGAVLTSATLT
FT                   SLGSFERLNKQLGLLRNENQYLRLPSPFVFDQVDFIAAKLKASPTQVYEHTQEVALQLL
FT                   KRLDSNEGSLVLFASNKQMQIVADLIEKKLDCTLFVQGKYPKKYILEKHTDLRKQGKGS
FT                   VIFGLDSFAEGVDLKGDNLTHVIIAKLRFSVPTSPIDKTLATYLESQNRNPFMEISLPD
FT                   ASLKLIQACGRLIRTETDTGKITIFDNRLVSKFYGKQLLNALPSYNIIVE"
FT   gene            complement(397319..398290)
FT                   /locus_tag="Rmag_0366"
FT   CDS_pept        complement(397319..398290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0366"
FT                   /product="Dimethylallyltranstransferase"
FT                   /EC_number="2.5.1.1"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: ftl:FTL_1041
FT                   octaprenyl-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02138"
FT                   /db_xref="GOA:A1AW31"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW31"
FT                   /protein_id="ABL02138.1"
FT                   /translation="MKSLSDIQSLLKLDLQKTDEILINRLSSNVALINQMGHYIIHAGG
FT                   KRLRPLLLLLCARATEYQGTHHYLMAVVIELIHTATLLHDDIVDESITRRGKDTVNEVW
FT                   GNAPSVLVGDFLYSRAFEMMIEPNSMYIIRILSKTTNSIAEGEVLQLLNCKNTELTETE
FT                   YYAVIERKTACLFQAATQIGGLLSGVDKAQESALKDYGLHLGNAFQIIDDVLDYESNVK
FT                   TMGKEVGDDLSEGKTTLPMIYALAHTSGDNRQLLEDAINQADNSKIVQVIKILQSIKAF
FT                   DYTRNQAHKSAQLAKQSLKLIPDSDYKDALILLCDLSLQRQS"
FT   gene            complement(398346..398969)
FT                   /locus_tag="Rmag_0367"
FT   CDS_pept        complement(398346..398969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0367"
FT                   /product="23S rRNA Um-2552 2'-O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: ribosomal RNA methyltransferase RrmJ/FtsJ;
FT                   KEGG: sde:Sde_2721 ribosomal RNA methyltransferase
FT                   RrmJ/FtsJ"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02139"
FT                   /db_xref="GOA:A1AW32"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW32"
FT                   /protein_id="ABL02139.1"
FT                   /translation="MVKKGSSGRWMSEHINDEFVKKAQKSGYRSRSVYKLIEVINKDKF
FT                   IKLGDKVLDLGAAPGGWSQVAIKIVGKSGQVIASDILDIKPIDGVDFLRGDFTKDSVYE
FT                   TLLDITMSKKVDVVLSDMAPNMSGQSSIDIPKSMYLCELALDMAIKTLTPLGYFFVKVF
FT                   QGNGFNEFVKLCRSSFSFVTIRKPKASKLRSKEVYLLTSKLKLT"
FT   gene            399040..400857
FT                   /locus_tag="Rmag_0368"
FT   CDS_pept        399040..400857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0368"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein TypA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor, GTP-binding; elongation factor
FT                   Tu, domain 2 protein; KEGG: sec:SC3900 GTP-binding
FT                   elongation factor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02140"
FT                   /db_xref="GOA:A1AW33"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW33"
FT                   /protein_id="ABL02140.1"
FT                   /translation="MNTKLRNIAIIAHVDHGKTTLVDKLLEQSQTFDERFESTDRMMDS
FT                   NDLEKERGITISSKNTAIKWHDYHINIVDTPGHSDFGGEVERVLSMVDSVLLLVDAQEG
FT                   PMPQTRFVTKKSFDQGLNPIVVINKIDKDAARPDWVIDQVFDLFDQLGATDEQLDFPII
FT                   YASSINGYASLEDDVRLGDMTPMFETIIKHVKAPEVDINAFLQMQVTALDYSSFIGTIA
FT                   IGRITRGTIKKNMQVVVVDTQGNEHKAKIANLQGFLGLERIDTDSAQAGNIIAITGIEG
FT                   ISISDTICDPEAIEALPPLSVDEPTISMAFRVNDSPFAGQDGKFITSRNICDRLEKELI
FT                   YNVALRVESTTDPSEFIVSGRGELHLSILIETMRRESFELAVGRPQVILREIDDVICEP
FT                   FEDLSVDVEAQHQGTVMEKLGERKAELTNMIPDGNGRIKLYFNIPARGLIGFRTEFLTA
FT                   TTGTGLMNSTFDAYKPQKQGKIGQRSNGSLISMNQGQAVAYAIFNLQKSGKFFVEHNTD
FT                   IYEGMVVGIHTRDKDLVINVMKGKQLTNVRASGTDEAISLIPAIKLDLEQALEFIDDDE
FT                   LVEITPHNIRIRKRLLTENERKRARRKSK"
FT   gene            400941..403994
FT                   /locus_tag="Rmag_0369"
FT   CDS_pept        400941..403994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0369"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   lil:LA2439 acriflavine resistance protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02141"
FT                   /db_xref="GOA:A1AW34"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW34"
FT                   /protein_id="ABL02141.1"
FT                   /translation="MDNILNFFVKQKKLALVFTVFIIALGLLTLSGIQRDKFPAVDFEE
FT                   MSIVTIYPGASPEDVEQNVTNPIEDELRSISGIDKFNSTSKEGKSSIIVTLSQDISDIE
FT                   SLKQEIRNAVSRIKSLPEEVNDLPWVIDRKNSLKSILKINISSGELSYQALRDITDDMA
FT                   NSLALVEGVSKVVKEGYLDREIQIKVNPDSLYQHKLSLPQIIEAIKKRNKRYAVGSNHD
FT                   YINEKTIVVLAKFDEIQAVGNVIIKSTFDGPIIRLKDVASIVDGNKEETSITRVNGTKG
FT                   FILKIRKQENADIITTVDLIKEKVLNLRVKYPTNLQVFYSSDESKHVRNRLNIVINNGL
FT                   IGLFLVLIILALFLSLKTAFWVSISLPISLLGTVTLLGATGETINLISLAAMILVLGIV
FT                   VDDSIVMAESIHHYKQLGKDRYQSTVRGFKRVIAPVITTILTTILAFSSMFLMGGTMGK
FT                   FIYVIPLVVIFALTLSFLEISLALPAHLASSDEKTKGKIWFACIEDWFEGFLTKVLKWR
FT                   YGVVVIFSLVLIGTLYFAKTQMKYVQFPSVGADSISARLQMSVGTSLERTESISKQVEK
FT                   MIIEVVGEDLDSLTNNVGHYFTHVAKFTIKLVPFSIRVQTPKALLVQLKARVKNIKAAQ
FT                   KLKFSIGRPGPPQGEDVEINLVGSDNIQRQNAADSLEKILLNIDGIDNIERDDEPGKTR
FT                   IEVVIDFEKMARFDVDFSTINDYLKAAFTGINVTNVRYGDDDVDFRIYLGSDKQSEDFL
FT                   ALLKVNNRQGHPILLKQFISLQKIKGEPNFNHFNGQRSAVLSGSVDDEITTSSMVVSQA
FT                   LKRLDLANKYPTIRVTSEGGDKDTKKAMDNFKKAFIMAIFVIFLLLILLFNSYSQPILI
FT                   LIIVPFSIIGVIWAFFFHGETLSFFAILGTLALVGVIVNDSLVMVAHLNYLKAKFASTM
FT                   SVYEWVVQGAKDRLRAVVLTTLTTLAGVMPLAYGIGGTDFILQPMVLSLGYGLLFGTLI
FT                   TLILLPCLYLINHDLISWVKNFGAGFKI"
FT   sig_peptide     400941..401036
FT                   /locus_tag="Rmag_0369"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.641) with cleavage site probability 0.401 at
FT                   residue 32"
FT   gene            complement(405696..406578)
FT                   /pseudo
FT                   /locus_tag="Rmag_0370"
FT   gene            complement(408911..409525)
FT                   /locus_tag="Rmag_0371"
FT   CDS_pept        complement(408911..409525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0371"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: bur:Bcep18194_B2132 3-isopropylmalate
FT                   dehydratase small subunit region; TIGRFAM:
FT                   3-isopropylmalate dehydratase, small subunit; PFAM:
FT                   aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02142"
FT                   /db_xref="GOA:A1AW35"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW35"
FT                   /protein_id="ABL02142.1"
FT                   /translation="MQKFTTFTSIAIPLERANIDTDAIIPKQFLKSIKRSGFGVNLFDE
FT                   WRYLDHGEVGMDNSKRPLNMDFVLNQAKYQGAKILLVRENFGCGSSREHAPWALEDYGF
FT                   KAIIAPSFADIFYNNCFKNGILPIVQDNNIMDEFFTLSGEIMINLDAQSIHTNSKTYFF
FT                   EIDIERKRRLINGLDDIGLTLQYTDDIKAFEKDYFNKYNWL"
FT   gene            complement(409525..410958)
FT                   /locus_tag="Rmag_0372"
FT   CDS_pept        complement(409525..410958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0372"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   bbr:BB2130 3-isopropylmalate dehydratase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02143"
FT                   /db_xref="GOA:A1AW36"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW36"
FT                   /protein_id="ABL02143.1"
FT                   /translation="MSYFIKYCVSIMTQTLYDKLMNAHVIRRDNSTELIYIDRQLIHEV
FT                   TSPQAFEGLAIAGRKPWSTSANLAVPDHNVPTTNRSSGINGISDPISKLQIETLDKNCK
FT                   TFGINEIPMNDIRQGIVHVVGPEQGFTLPGMSIVCGDSHTSTHGALGALAFGIGTSEVE
FT                   HVLATGCLWQSKSKNFNIEVSGKLNKHVSAKDIALYIIGKIGTAGGTGHAIEFSGDTIQ
FT                   SLSIEGRMTLCNMAIEAGARVGMVAVDDKTIDYVKGRILAPSGAKWSKAVEYWHTLHSD
FT                   KNAHFEKIAHFNAKDIKPQVTWGTSPEMVITIDGYIPNPANAKNHTEKVSWENALNYMQ
FT                   LTADIKISDIKIDKVFIGSCTNSRIEDLRIVASVLKDKKIANNIKLALVVPGSGLIKKQ
FT                   AEKEGLDKIFINSGFEWREAGCSMCLAMNADKLKVGERCISTSNRNFEGRQGQGSFTHL
FT                   VSPAIAAASAITGHFSEVK"
FT   gene            410980..412755
FT                   /locus_tag="Rmag_0373"
FT   CDS_pept        410980..412755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0373"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /note="TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); PFAM: glutamine amidotransferase,
FT                   class-II; asparagine synthase; KEGG: tbd:Tbd_0060
FT                   asparagine synthase, glutamine-hydrolyzing"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02144"
FT                   /db_xref="GOA:A1AW37"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017535"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW37"
FT                   /protein_id="ABL02144.1"
FT                   /translation="MCGLCGQLRFDSQVVSGDELKVMMQKIARRGPDSSGLWVDDNIGF
FT                   GHQRLAIIDLSNHAHQPMIDKNLGLILIFNGTIYNYQALRQDLTKQGYQFFSHSDTEVI
FT                   IKAYHYWGESCVTHLDGMFAFCIWDKIQNQLFIARDRMGIKPLYFNLTNQAFSFASNMQ
FT                   ALITQGIDKSINPIALQQQLSLHGVVPAPNTIINGVNKIKPATTLTISAKGKVVERTYW
FT                   KPKAIRPKETLTDEQFIQRTHELLTDSVLKRMNAADVPIGVLLSGGLDSSLLVALLREA
FT                   GHENVRTFSIGFENIDDEVGSEFEYSDQIVAQFKTRHEKYVISNSQVLPRLGEAVSNMS
FT                   EPMVAQDAVAFYLLSEQVSKHIKVVLSGQGADEAFAGYFWYERMQAQTGSEIERFTKHY
FT                   VDRSYEEYLQTVNQQYHSNNHTETWLHYEFAKASADTFMDKVFRTDITRLVVDDPVKRV
FT                   DNMTMAWGLEARVPFMDYKLIEHALSVSPSLKMLNKGKHLLKQIARGLLLPDSVIDRKK
FT                   GYFPMPALKYVRGEFLDFMSGILTSSKCINRGVFNQTFIAKIINKPQNYMTALNGSRLW
FT                   HLALLEYWLQINIDE"
FT   gene            412748..413188
FT                   /locus_tag="Rmag_0374"
FT   CDS_pept        412748..413188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0374"
FT                   /product="ribonuclease H"
FT                   /note="PFAM: ribonuclease H; KEGG: ftl:FTL_0854
FT                   ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02145"
FT                   /db_xref="GOA:A1AW38"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW38"
FT                   /protein_id="ABL02145.1"
FT                   /translation="MNKIIIYTDGGCRGNPGIGGWGVWLKYGDYDKKLQGVQQDTTNNQ
FT                   MELTATIKALEVIKSNDIAIDLFTDSKYVITGISEWIKNWKAKGWKTANKKPVKNIDLW
FT                   QRLDVLNNQHNVTWHWVKGHSGDKGNDMADALANLAMDKIST"
FT   gene            413698..414022
FT                   /pseudo
FT                   /locus_tag="Rmag_0375"
FT   gene            414483..415358
FT                   /locus_tag="Rmag_0376"
FT   CDS_pept        414483..415358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0376"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_2669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02146"
FT                   /db_xref="InterPro:IPR022529"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW39"
FT                   /protein_id="ABL02146.1"
FT                   /translation="MLSKYLLVLIVLFSQVSIAFIPNILQLPELPMFGDFNPNQLRRNF
FT                   NKFIGIEPDYAREARMVLQIEDAVLDGEVEYLTLKNKNQVFSIYIQSELDKSKGGVIIL
FT                   HNRGQHANWGDLIKPLRVGLAEKGWDTLSVQMPVLDKQAKYYDYVSIFPYAHERIEAAI
FT                   NFYKQLGIDNIILIGHSCGAHMSMSYIDKFGDDKFSAYVGIGMGATDYKQKMVKPFPLD
FT                   KMHIPVLDVFSENDFASVIRLAKFRKVLVEATGNTHSAQLVIENAGHYYQEQGAAKNLT
FT                   NQVGIWLDTL"
FT   sig_peptide     414483..414542
FT                   /locus_tag="Rmag_0376"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.973) with cleavage site probability 0.973 at
FT                   residue 20"
FT   gene            complement(415821..416183)
FT                   /pseudo
FT                   /locus_tag="Rmag_0377"
FT   gene            complement(416322..416753)
FT                   /locus_tag="Rmag_0378"
FT   CDS_pept        complement(416322..416753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0378"
FT                   /product="cyclase/dehydrase"
FT                   /note="PFAM: cyclase/dehydrase; KEGG: vpa:VP0645
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02147"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW40"
FT                   /protein_id="ABL02147.1"
FT                   /translation="MHHISKNAIVTYSCEQMYQLINQVNQYPQFLNWCSDASILKQSND
FT                   QIIASVKINKGVFNQTFTTINTLIPHKKIDMRLKEGPFKYLNGAWIFTKLSSNACKIEL
FT                   NLAFNFSSKLVDIAISPIFTSIANSQLDAFVTRAKQVYS"
FT   gene            416752..417249
FT                   /locus_tag="Rmag_0379"
FT   CDS_pept        416752..417249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0379"
FT                   /product="SsrA-binding protein"
FT                   /note="TIGRFAM: SsrA-binding protein; PFAM: SmpB protein;
FT                   KEGG: tcx:Tcr_1409 SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02148"
FT                   /db_xref="GOA:A1AW41"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW41"
FT                   /protein_id="ABL02148.1"
FT                   /translation="MAKNNKKIKTSLNIIALNKKARHNYFIEQTLEAGLSLEGWEVKSL
FT                   RDSKVQIKESYVILKNNELFLFGAHISPLKSVSTHVNSDSTRTRKLLLNRLEINRIKDN
FT                   INQKGATIVPLKLYWARGKVKLEIGMAKGKKSHDKRQDIKLKDWQRDKQRTLKETNKIF
FT                   NF"
FT   gene            417438..417713
FT                   /locus_tag="Rmag_0380"
FT   CDS_pept        417438..417713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0380"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: mca:MCA0532 DNA-binding protein HU-beta"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02149"
FT                   /db_xref="GOA:A1AW42"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW42"
FT                   /protein_id="ABL02149.1"
FT                   /translation="MNKSELIDAIALAANLSKVDASRALNATTDAITGAMASSDGVQLT
FT                   GFGSFVVRNRAARTGRNPQTGATIQIKASKVAAFKAGKALKEAVNK"
FT   gene            417809..418234
FT                   /locus_tag="Rmag_0381"
FT   CDS_pept        417809..418234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0381"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="PFAM: nucleoside diphosphate kinase; KEGG:
FT                   mfa:Mfla_1624 nucleoside-diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02150"
FT                   /db_xref="GOA:A1AW43"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW43"
FT                   /protein_id="ABL02150.1"
FT                   /translation="MERTLSIIKPDAVAKNIIGQIYSRFEEAGFKIVASKMIHLDNYLA
FT                   GGFYAVHKNRPFYGELIEFMTSGPVMVQVLEGENVVVRHREIMGTTNPKEADSGTIRAD
FT                   FAKSLDENAVHGSDSLENAAIEIEYFFGKDGVFPRTR"
FT   gene            418283..419353
FT                   /locus_tag="Rmag_0382"
FT   CDS_pept        418283..419353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0382"
FT                   /product="23S rRNA m(2)A-2503 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: radical SAM enzyme, Cfr family; PFAM:
FT                   Radical SAM domain protein; KEGG: lpp:lpp1504 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02151"
FT                   /db_xref="GOA:A1AW44"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW44"
FT                   /protein_id="ABL02151.1"
FT                   /translation="MNKKNLLSFNQNALNDFFVGLGEKPYRTKQIMQWIYKDHEFDFEK
FT                   MLNFSKSLRDELSKVVCVELLRVVKQNFILDGVIKWVLALDKNNHIEMIYIPEKNRGTL
FT                   CISSQVGCGLACTFCSTGMQGFNKNLTTAEIIAQVLIASRYLNSKTKRISNVVFMGMGE
FT                   PLLNEHAVYNACDLLLDDLAFGLSRRKVTISTSGVVPAMLRMSERTPVSLAVSLHASDD
FT                   HLRNELVPINQKYSLEELLKACKVYLQAGTQKRHILFEYVMLKGVNDSIEHANKLVKLL
FT                   KGISAKINLIPFNSFEKTQYQTSSAQTIEKFQNILYHQGIRTMTRRTRGEDIGGACGQL
FT                   AGKVLDKTKRTYDRRH"
FT   gene            419337..419642
FT                   /locus_tag="Rmag_0383"
FT   CDS_pept        419337..419642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02152"
FT                   /db_xref="GOA:A1AW45"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW45"
FT                   /protein_id="ABL02152.1"
FT                   /translation="MIEGIDYYPKKRNKKLKLKWWILLILAFMISIFWYLNQKYDTKKI
FT                   KEAPILIIISKGEKEQKEITSTVIIDNHSSLDSDSNKKIINPKALDEAIYNYIKKN"
FT   gene            419642..420718
FT                   /locus_tag="Rmag_0384"
FT   CDS_pept        419642..420718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0384"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="KEGG: pae:PA3803 1-hydroxy-2-methyl-2-(E)-butenyl
FT                   4-diphosphate synthase; TIGRFAM:
FT                   1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase;
FT                   PFAM: IspG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02153"
FT                   /db_xref="GOA:A1AW46"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW46"
FT                   /protein_id="ABL02153.1"
FT                   /translation="MKPVYIIQRRKSKQVFVGDVAIGGDAPISVQSMTNTETTDVKATV
FT                   AQIQAIQNAGADLVRVSVPTIDAAEAFKIIKKQVNIPLISDIHFDYKIALKVAEYGADC
FT                   LRINPGNIGREDRIREVVAAAIDHNIPIRIGVNAGSLEKDLQKKYTEPTPEAMVESAFR
FT                   QIDILDKLNFDNFKISLKASEIFMTVFAYQQLASQIDNPLHLGITEAGSLRFGTIKSSI
FT                   GLGLLLSEGIGDTIRISLASDPVDEVRVGFDILKSLNLRSKGVNLIACPSCSRQKFDVI
FT                   KIVNELESRLEGITAPIDVAVIGCVVNGPGEAKAVSVGLIGGEPNLLYLDGKTHSKITN
FT                   ENLVNELEAQVRNRLKSP"
FT   gene            complement(420705..421199)
FT                   /locus_tag="Rmag_0385"
FT   CDS_pept        complement(420705..421199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_2123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02154"
FT                   /db_xref="GOA:A1AW47"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW47"
FT                   /protein_id="ABL02154.1"
FT                   /translation="MKKLLKRYSPNPDELKNHKHLGWLGKHLHHSSLWNFNRKSISKAF
FT                   AIGLFCAFIPIPFQMLLAAPIAVISSANLPLSIALVWITNPITMPVIFYGCYKLGSWIL
FT                   DVSIEKDLVMSLEYVWQVFNVIWQPFLLGCLIVSIVSSVLSYLLIQFIYRYKVYKRVKG
FT                   F"
FT   sig_peptide     complement(421008..421199)
FT                   /locus_tag="Rmag_0385"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.945) with cleavage site probability 0.943 at
FT                   residue 64"
FT   gene            complement(421196..422998)
FT                   /locus_tag="Rmag_0386"
FT   CDS_pept        complement(421196..422998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0386"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="TIGRFAM: deoxyxylulose-5-phosphate synthase; PFAM:
FT                   Transketolase, central region; Transketolase domain
FT                   protein; KEGG: mca:MCA0817 1-deoxy-D-xylulose-5-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02155"
FT                   /db_xref="GOA:A1AW48"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW48"
FT                   /protein_id="ABL02155.1"
FT                   /translation="MLNSITSPLDIKQLDIAKLQSLAEEVRTFLIESIQKTGGHLAPNL
FT                   GTIEMTIATHYVFDTPNDSFVFDVGHQAYTHKILTGRFDKMHTLRQKGGLSGFTKRSES
FT                   KHDSFGAGHSSTSISAALGIAIGNGINNNNSKSIAMIGDGALTGGMSFEALNHAGDSDA
FT                   DLLIILNDNDMSISKNVGAMNKYLTKLISGKVYSIMKSKSLGFLEKMPKIHKFAKRSEE
FT                   HLKGMVLPSTLFEELGLDYFGPIDGHDLPTLIQTLQNLKQQTKPRLLHIITKKGYGLKT
FT                   AENDPCKFHSVSPISSNSSNLPSYSTVFGVWLNNTALHHKNLIAITPAMCTGSGMSEFK
FT                   KNYPKQYFDVGIAEQHAITFAGGLATQGLKPIIAIYSTFLQRGYDQLIHDIALQNLNVI
FT                   FAIDRAGLVGSDGATHAGSFDLSFLRCIPNLTIMVPSNAMQMYQMFNTAFETNGTICIR
FT                   YPKGTSDIKNYITDEKIPLGKAKIILEGSNVAIFAFGIMVKSALTAGKKLNATVVDMRF
FT                   VKPLDKALIIKLASSHTKLISIEDNVIIGGAGSAISELLHQKNINTPLSILGLQDKFSE
FT                   QGEQQELYDLYELNEIGIINAVHS"
FT   gene            complement(423060..424433)
FT                   /locus_tag="Rmag_0387"
FT   CDS_pept        complement(423060..424433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0387"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: son:SO1252 peptidase, U32
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02156"
FT                   /db_xref="GOA:A1AW49"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW49"
FT                   /protein_id="ABL02156.1"
FT                   /translation="MIKYTTMKKPELLSPAGSLKHMRYAYAYGADAIYAGQPRYSLRVR
FT                   NNSFDSKTLERGILEAHANNKKFFVASNIIPHNSKIKTYMKDIEPIVNLNPDALIMADP
FT                   GLIMMVKEKFPNQVIHLSVQANAINYATVKFWKNVDINRIILSRELSLDEVKEIRQECP
FT                   DIELEVFVHGALCIAYSGRCLLSGYFNHRDPNQGSCTNSCRWKYDVKQAEETLEGDIKA
FT                   VEIKTSENQIVLLEEQSRPGELMPAFEDEHGTYIMNSKDLRAVEHVHTLTAIGIDSLKI
FT                   EGRTKSHYYAARTAQVYRQAIDDAVAGHEFNKDAFGVLENLANRGYTDGFYQRHQPEEL
FT                   QTYFDNYSRSNKQQVVGEILDYKDGKAFIEAKNKFSVGDSIEVILPNGCFNTTIKSMLT
FT                   EHNEVLNVAKGSGYRVWIPMRDIKPELGFIARNFDEKIKIKNKNIQKDPLLKIRRPSW"
FT   gene            424463..425062
FT                   /locus_tag="Rmag_0388"
FT   CDS_pept        424463..425062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0388"
FT                   /product="16S rRNA m(2)G 1207 methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="PFAM: methyltransferase small; KEGG: tcx:Tcr_0213
FT                   methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02157"
FT                   /db_xref="GOA:A1AW50"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW50"
FT                   /protein_id="ABL02157.1"
FT                   /translation="MRRDMFTKKDIPRLKQDLTIQTNLLGIDLTLKTRWGVFSPRSIDD
FT                   GTELFMKHLRISNDDKCLDLGCGYGPIGLAVAKSCPQGEVHMVDKDFVAVELSNINVKL
FT                   NHINNAQAYLSNAFLSVNKTNYFDKILSNVPAKVGREQLSIILYDAYDALKPNGKIMFV
FT                   SINGLRHFIKDNFKSVFGNYKKLKQGQKYTISQAIK"
FT   gene            425113..425442
FT                   /locus_tag="Rmag_0389"
FT   CDS_pept        425113..425442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0389"
FT                   /product="glutaredoxin-like protein"
FT                   /note="TIGRFAM: glutaredoxin-like protein; PFAM:
FT                   glutaredoxin; KEGG: tbd:Tbd_2499 glutaredoxin-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02158"
FT                   /db_xref="GOA:A1AW51"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW51"
FT                   /protein_id="ABL02158.1"
FT                   /translation="MDVMDRIQQQVDSAAIILYMKGTPQFPQCGFSATAARTLASTGVE
FT                   FTYVNIFEDQEVFQSLPVFADWPTFPQIYFNSELVGGGDIIVEMADMGTLKGEMEKASE
FT                   KFDTK"
FT   gene            425718..426355
FT                   /pseudo
FT                   /locus_tag="Rmag_0390"
FT   gene            complement(426387..427046)
FT                   /locus_tag="Rmag_0391"
FT   CDS_pept        complement(426387..427046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0391"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   chy:CHY_0833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02159"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW52"
FT                   /protein_id="ABL02159.1"
FT                   /translation="MIQLMKYQLIRSKRKTLSLQISDNAELLIRTPNRLSIKKIESFIR
FT                   EKQHWIEKKQALIKNTKRKMHYHEDEDLLYLGNTYPLKLIHMQKPQIHFDGTNFYLSGD
FT                   GKTHFHTWYKNTFRNIALPRLDYYADLHQLNYKKVYLKAQKTKWGSCSHVNNINLNYLL
FT                   IMAPMNVIDYVIVHELAHIKHKHHQSEFWQLVKSILPNYHQAKNWLKEQGHQLRRL"
FT   gene            complement(427440..431264)
FT                   /locus_tag="Rmag_0392"
FT   CDS_pept        complement(427440..431264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0392"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: ilo:IL0591 phosphoribosylformylglycinamidine
FT                   (FGAM) synthase; TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02160"
FT                   /db_xref="GOA:A1AW53"
FT                   /db_xref="InterPro:IPR010073"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR040707"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW53"
FT                   /protein_id="ABL02160.1"
FT                   /translation="MIKTIQHIQALSDFKQDMLNKKIARLGVKLINTEFVHFVNYESLL
FT                   TDNEVITLEELLSYGSYVEITNDMQIIIIPRLGTISPWSSKASDILHLCGLEKVHRIER
FT                   GVIYHLDKKITDKKAILSIIMDKMTESELSSIDDAHLIFDNFEPRLLANINILAEGKSI
FT                   LERINIELGLALSSGDINYLVDSFTKLKRNSTDIELMMFAQANSEHCRHKIFNADWMIN
FT                   GKSQVKSLFSMIRNTYHQHPEGLLSVYSDNSAVMAGYQGERFYANTKGKYVTSKEHRAI
FT                   LMKVETHNHPTAIAPHSGAATGSGGEIRDEGATGQGSKPKVGLCGFSVSNLNIKNAQQP
FT                   WEINYGKPNKIKSALDIMLEGPIGTASFNNEFGRPNTLGYFRTFEQKTPNGDVRGYHKP
FT                   IMLAGGLGHIQEQHIKKGNIPVGSKIIVLGGPAMLIGLGGGTASSIKSGEQNEDLDFTS
FT                   VQRANPEMQRRAQEVIDSCTNMGKDNPIVSIHDIGAGGLSNGLPELVNDSARGGRFQLR
FT                   AIPNDDFKMSPLEIWCNESQERYVLAIEEKNLKIFTDICTRERAPFAVLGESTKEQVLI
FT                   LNDELFDNNPINIPMDVLLGNPPKISINVRSESDHLNALNTNNITIDDGISRLLQLPTI
FT                   ASKNFLITIGDRSVTGLVARDQFIGPWQVPVADCAISLADYTNYQGEIMSLGEKTPLAL
FT                   CNAESAARMTIGEALTNILGGFVEDIHHISLSANWMSANGHTNEDAKLFSAVKAIGMDL
FT                   CPELGLTVPVGKDSMSMKTSWQEQGEDKSVTAPLSLIITAFSKTPDVRLQLTPLLETDQ
FT                   DSELLLIDLGFGKNRMGGSCLAQVYNQVGKDAPNLDDASVFKNFFTVINQFNKEGLISA
FT                   YHDRSDGGVITTLMEMAFASHCGLNITSNGKIEDLFNEELGCVIQVKAKNKQTVTNLLN
FT                   YVGLSNCTHKIASINHTDTIEIIVNDKIIYNKPRAKLQSLWSTTSFEIAKLRDKPNCAE
FT                   QEFNNIAHNTPGIKINPSFDINKSVSAPYILSSVKPKIAILREQGINGQIEMSAAFTKA
FT                   EFDAIDVHMSDILSDKVFLADFKGLVACGGFSYGDVLGAGRGWASSILYNERTKDEFEA
FT                   FFSRKDSFAFGVCNGCQMMSNLTDIIPGSSHWPSFHRNVSEQFEARFSSVKIKQSNSIF
FT                   LKDMAGSIMPIAIAHSEGRASFAPKMDKNHSIMQYVDHGGKPTQNYPHNPNGSDFATAG
FT                   VTSKSGQVTIMMPHPERVFRTVQNSHYPKNWHERSPWMRIFENARAWVD"
FT   gene            complement(431273..431974)
FT                   /pseudo
FT                   /locus_tag="Rmag_0393"
FT   gene            complement(432600..433340)
FT                   /locus_tag="Rmag_0394"
FT   CDS_pept        complement(432600..433340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0394"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; KEGG:
FT                   ilo:IL1088 uncharacterized conserved enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02161"
FT                   /db_xref="GOA:A1AW54"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW54"
FT                   /protein_id="ABL02161.1"
FT                   /translation="MAGHSKWHNIQHRKGAQDAKRGKIFTKLIKEIVISAKIGGGRIEN
FT                   NHSLKIIIDKALAVNMRRNTIENAVKRGNGDFDGNNYEKIRYEGYSLGGTAIMVDCLSD
FT                   NRNRTISDIRHAFLKHGGNLGRDGSVSYLFTKQGFISFDTGNENQIMEIALDEGAQDII
FT                   TNDDDSIDVITTPEDFFTIKDVLTTSGLEPSHAEVTMEPASRVELNLSDAEKFMKLIDH
FT                   LEDLDETKKIYHNADISDKVMVRL"
FT   gene            complement(433379..434329)
FT                   /locus_tag="Rmag_0395"
FT   CDS_pept        complement(433379..434329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0395"
FT                   /product="quinolinate synthetase A"
FT                   /note="TIGRFAM: quinolinate synthetase complex, A subunit;
FT                   PFAM: Quinolinate synthetase A; KEGG: pae:PA1004
FT                   quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02162"
FT                   /db_xref="GOA:A1AW55"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW55"
FT                   /protein_id="ABL02162.1"
FT                   /translation="MLSTQEQIKTELKTHNAVLVAHYYVDAKLQTLAEATGGIVSDSLE
FT                   MARFSQNCDAHTIIIAGVKFMGETAKILSPEKRVLVLNSHATCSLDEDCPIDQFSELCD
FT                   QHPDRIVVVYANTSAQVKARADWVVTSSSALNVVKHLKDNGEKILWAPDKHLGHYVQTQ
FT                   TNANMLLWQGACVVHERFKADALKVLKTLHPEAAVLVHPESPQSVVNLADVVGSTSALI
FT                   DAVKNRPETTFIVATDNGIFHKMHEVAPNKKLIEAPTMGEGADCESCAHCEWMAMNTLE
FT                   NCLNTLQIGNNEIFINTDICKKAKNAIQKLLDFTV"
FT   gene            complement(434336..436087)
FT                   /locus_tag="Rmag_0396"
FT   CDS_pept        complement(434336..436087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0396"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="TIGRFAM: aspartyl-tRNA synthetase; PFAM: GAD domain
FT                   protein; tRNA synthetase, class II (D, K and N); nucleic
FT                   acid binding, OB-fold, tRNA/helicase-type; KEGG:
FT                   sde:Sde_0913 aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02163"
FT                   /db_xref="GOA:A1AW56"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW56"
FT                   /protein_id="ABL02163.1"
FT                   /translation="MRTHFCGELNKDNIGQTVEIYGWVNRRRDHGGVIFLDMRDKHGIA
FT                   QVVINPDNADFSLAETVRNEFVLKITGTIIARGEGLTNPKLSTGKIEIKAQNIEILNTS
FT                   KPVPFQIDATDTSEEVRLRYRYLDLRSDTMQNRLRLRSRVTRYMREFMDEHDFLDIETP
FT                   FLTKATPEGARDYLVPSRTHSGKFFALPQSPQLFKQLLMMSGFERYYQIVKCFRDEDLR
FT                   ADRQPEFTQLDVETSFMSENEIMTMMEKMTRGLFKLVINVDLGDNFPTITYADSMAKYG
FT                   LDRPDMRISMQIVSIDKIMQGVDFKVFSGPANYDDSRVAALKVPNGASISRKNIDKYTK
FT                   YVSIYGAKGLAYIKLNKNGPASPILKFLGDEVIAKVIEMTDAKTGDIIFFGADKSKIVN
FT                   EALGNLREQLAKDLDLFDTQWAPIWVVDFPMFEVGDDGSLNTTHHPFTAPSVDAKTLEK
FT                   TATTALSKAYDLVINGSEVGGGSIRIHQIDMQKTVLKLLGISDQEIQDKFGFFLNALEY
FT                   GCPPHGGMAFGLDRLMMIMTGANSIRDVVAFPKTQTAACLLTDTPTSISRKLLRELSVK
FT                   INLPEKD"
FT   gene            complement(436092..436694)
FT                   /locus_tag="Rmag_0397"
FT   CDS_pept        complement(436092..436694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0397"
FT                   /product="protein of unknown function DUF502"
FT                   /note="PFAM: protein of unknown function DUF502; KEGG:
FT                   mfa:Mfla_2385 protein of unknown function DUF502"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02164"
FT                   /db_xref="GOA:A1AW57"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW57"
FT                   /protein_id="ABL02164.1"
FT                   /translation="MKRLRNYFISGLLFWIPLGLSIVVIKFFLELVNNIVPTQYLPEAL
FT                   FNLDNTIPGSGIIWVIFIMLITGALVNNFIGRKLIQLWEKLLNKIPGFRSIYSALKQLS
FT                   DTVFSPSGKSLKKALLVEYPRKGMWTIAFQTGNYGGEVERKVGQKIINIYVPSTPNPTS
FT                   GFFIMLSKNDVIELDMSVDEAFKLIISTGVVTPIQKR"
FT   gene            complement(436749..437525)
FT                   /locus_tag="Rmag_0398"
FT   CDS_pept        complement(436749..437525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0398"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24; KEGG: lpp:lpp1684 methionyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02165"
FT                   /db_xref="GOA:A1AW58"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW58"
FT                   /protein_id="ABL02165.1"
FT                   /translation="MSIAIKSKDDIEKMRVAGYLAANAIDMISPYVKAGISTDELDKIC
FT                   HDYIVNHQGAIAAPLNYHGFPKSICTSVNHVVCHGIPGFKRLKKGDIINIDITIIKDGF
FT                   HGDTSKMFIIGKSSVKAQLICRIAQECLYIGIKQVKPGIHLGEIGKAIGTHANKNNCAV
FT                   VRDYCGHGIGTEFHAEPQVVHYDDGKSDISPILEAGMTFTIEPMINLGGFEVITSKVDN
FT                   WTVTTKDHTLSAQWEHTILVSQNGCEILTLRDEESV"
FT   gene            complement(437525..438550)
FT                   /locus_tag="Rmag_0399"
FT   CDS_pept        complement(437525..438550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0399"
FT                   /product="peptidase M48, Ste24p"
FT                   /note="PFAM: peptidase M48, Ste24p; KEGG: vvy:VVA0973
FT                   Zn-dependent protease with chaperone function"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02166"
FT                   /db_xref="GOA:A1AW59"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW59"
FT                   /protein_id="ABL02166.1"
FT                   /translation="MDFREHQDKAKKNTIIIWSLYLILLLISSMLIGYTLFIGLNLAQF
FT                   YQPEYQQYSFNEKFIAANQIVFQNQEQLLGFLEFSLMVLLAMLSATAFGFYQKSNGHKV
FT                   ALAFGGKLISDEDKLSIEEKQTLNIVAEQALAANIPAPALYIIPDNAINAFAAGKTTQE
FT                   AIVAITQGSMVSFNRTQLSGVIAHEIGHIVNHDIKLNIQISAFVFGFTALFFLARMIFY
FT                   QAAYNRRMDGRAKLILFAIAAIIALIGMMTVWFGRILQAAMSRQREYLADASAVQFTRY
FT                   PNGLVEAFEIMQNSGNSGKTKLENPNTEEYTHAMLFGMSGELFATHPPLDKRIKRIQNR
FT                   I"
FT   gene            complement(438696..439304)
FT                   /locus_tag="Rmag_0400"
FT   CDS_pept        complement(438696..439304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0400"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: sde:Sde_3150
FT                   divalent cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02167"
FT                   /db_xref="GOA:A1AW60"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW60"
FT                   /protein_id="ABL02167.1"
FT                   /translation="MEFLTQNWLLITIVVVLLIWIINIYNNLISYKTQYQNSFEQISIQ
FT                   LKRRLDLIGNLVDVAKKYMEHERETLTAITEARAELTQANKVAKKNPGESSVMTNLASS
FT                   QIALDSAMSGFNLKMEAYPDLKASENMMQLSEEMTTTENRIASARQGYNDLVQKFNEYK
FT                   KSFPNVLFAGVFGFGIDAQNLEFSENLEQLNQAPKDLFA"
FT   gene            439862..440203
FT                   /pseudo
FT                   /locus_tag="Rmag_0401"
FT   gene            complement(440344..440419)
FT                   /locus_tag="Rmag_R0014"
FT                   /note="tRNA-His1"
FT   tRNA            complement(440344..440419)
FT                   /locus_tag="Rmag_R0014"
FT                   /product="tRNA-His"
FT   gene            440667..441146
FT                   /pseudo
FT                   /locus_tag="Rmag_0402"
FT   gene            complement(442219..442295)
FT                   /locus_tag="Rmag_R0015"
FT                   /note="tRNA-Arg3"
FT   tRNA            complement(442219..442295)
FT                   /locus_tag="Rmag_R0015"
FT                   /product="tRNA-Arg"
FT   gene            complement(442344..442420)
FT                   /locus_tag="Rmag_R0016"
FT                   /note="tRNA-Pro2"
FT   tRNA            complement(442344..442420)
FT                   /locus_tag="Rmag_R0016"
FT                   /product="tRNA-Pro"
FT   gene            complement(442741..443710)
FT                   /pseudo
FT                   /locus_tag="Rmag_0403"
FT   gene            complement(443731..444399)
FT                   /locus_tag="Rmag_0404"
FT   CDS_pept        complement(443731..444399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0404"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: lpp:lpp1339 DNA polymerase III epsilon
FT                   subunit; TIGRFAM: DNA polymerase III, epsilon subunit;
FT                   PFAM: Exonuclease, RNase T and DNA polymerase III; SMART:
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02168"
FT                   /db_xref="GOA:A1AW61"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW61"
FT                   /protein_id="ABL02168.1"
FT                   /translation="MERLIVLDTETTGIEPSEGHRIIEIGCTEIVDRQITENNEYHEYI
FT                   QPSRNVGDSVRIHGITDKFLTNKPKFKAIVKTFLTYIEGATLIIHNAPFDLGFLNHELK
FT                   LIGIDERIEDKCNIIDSLELSKQQRPGTLHNLDALCRRFEINSSARTVHGALLDAKILA
FT                   QVYLAMTGGQSTLFNNEQTINEQANTNNIIRVERAIGKIKVVYANKQELAAHASYFEKI
FT                   "
FT   gene            444470..444709
FT                   /locus_tag="Rmag_0405"
FT   CDS_pept        444470..444709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0405"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number="2.7.7.6"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, omega subunit;
FT                   PFAM: RNA polymerase Rpb6; KEGG: psp:PSPPH_0198
FT                   DNA-directed RNA polymerase omega chain (RNAP omegasubunit)
FT                   (transcriptase omega chain) (RNA polymerase omega subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02169"
FT                   /db_xref="GOA:A1AW62"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW62"
FT                   /protein_id="ABL02169.1"
FT                   /translation="MARVTVEECLEHVENRFELVLVAAKRAHQLSSGDYKPLLDAGKDK
FT                   PTVVALREIEAGLIDASILSETYEMQEQLSAQQK"
FT   gene            444984..445343
FT                   /pseudo
FT                   /locus_tag="Rmag_0406"
FT   gene            446285..446458
FT                   /pseudo
FT                   /locus_tag="Rmag_0407"
FT   gene            complement(446690..446950)
FT                   /locus_tag="Rmag_0408"
FT   CDS_pept        complement(446690..446950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02170"
FT                   /db_xref="GOA:A1AW63"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW63"
FT                   /protein_id="ABL02170.1"
FT                   /translation="MAKVKILYILILLGVIMKNKSSFSSIVLTIALVAGYFIHNNQVIK
FT                   LNNEISSLTQEYNTKLTALQPNNTKQVAKSSAATSSSTDTL"
FT   gene            complement(446938..447924)
FT                   /locus_tag="Rmag_0409"
FT   CDS_pept        complement(446938..447924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0409"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   tcx:Tcr_0154 porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02171"
FT                   /db_xref="GOA:A1AW64"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW64"
FT                   /protein_id="ABL02171.1"
FT                   /translation="MTILTHRPRRMRKHAHTRKLIRENNLTTSDLIFPIFIIEGENKRQ
FT                   SIDSMPDIKRLSIDQLLIEAAELIELGIQAIALFPIVPSKKKSLHAQEAFNPNGLAQRA
FT                   IRAIKQKYSNLAVISDVALDSFTTHGQDGLINDEGYVLNDETIKVLVKQALSHAQSGSD
FT                   IVAPSDMMDGRISVIRKALEENGFIHTSILAYSAKYASHYYGPFRDAVGSSVNLGTSNK
FT                   ETYQMDPANSNEAIREVGLDIDEGADIVMIKPGLPYLDIVYRVKQTFGIPTFTYHVSGE
FT                   YVMLKAAVQNNWLKEEQVVLETLLAFKRAGADGILTYYAKQAAGWLK"
FT   gene            447965..449833
FT                   /locus_tag="Rmag_0410"
FT   CDS_pept        447965..449833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0410"
FT                   /product="hydroxymethylpyrimidine synthase"
FT                   /note="PFAM: thiamine biosynthesis protein ThiC; KEGG:
FT                   sde:Sde_0369 thiamin biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02172"
FT                   /db_xref="GOA:A1AW65"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW65"
FT                   /protein_id="ABL02172.1"
FT                   /translation="MSQSSKTLKNMSKVNEAFIKPFPSSNKIYVQGSCKDIQVPMREII
FT                   LTDTIGELAEKNAPIHVYDTSGVYTDPNVKIDLRKGLGSIRSTWIEQRNDTEILTKLSS
FT                   NFSNERRDDAELDVLRFEHLQVPRRAKNTKNVSQMYYAKQGIITSEMEYIAIRENCKWQ
FT                   EYKDQIGQNEGESFGANIPDVITSEFVRDEVSKGRAVIPANINHPETEPMIIGRNFMVK
FT                   INGNIGNSALGSSIEQEVDKMVWGIRWGADTIMDLSTGKNIHETREWIIRNSPVPIGTV
FT                   PIYQTLEKVNGIAEDLTWEVFRDTLIEQAEQGVDYFTIHAGVRLQYVPLTINRIIGIVS
FT                   RGGSIMAKWCLAHHTESFIYTHFEDICEIMKQYDVTFSLGDGLRPGCIADANDAAQFGE
FT                   LETLGELTKIAWKHDVQTFIEGPGHVPMQMIKENMDKQLKECGEAPFYTLGPLTTDIAP
FT                   GYDHITSAIGAAQIGWYGCAMLCYVTPKEHLGLPNQDDVKQGIIAYKIAAHAADLAKGH
FT                   PGAQIRDNALSKARFEFRWEDQFNLGLDPDTARKYHDETMPKQAAKTSHFCSMCGPKFC
FT                   SMKITQEIKTIDAGEIAKIKAIQIEMDKKSAEFLKNDSEIYMKEGA"
FT   gene            complement(450077..451333)
FT                   /locus_tag="Rmag_0411"
FT   CDS_pept        complement(450077..451333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0411"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="PFAM: Three-deoxy-D-manno-octulosonic-acid
FT                   transferase domain protein; KEGG: plu:plu4854
FT                   3-deoxy-D-manno-octulosonic-acid transferase (KDO
FT                   transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02173"
FT                   /db_xref="GOA:A1AW66"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW66"
FT                   /protein_id="ABL02173.1"
FT                   /translation="MNRSLYNIIGYLLLPFIILRLIIKSIKTPEFRQRINERLGLIAKI
FT                   QTSIIWVHCVSMGEFKAAIIIIDQLIKQYPNHQLLITTTTPTSSNAVINHYKNKVFHLY
FT                   FPYDLPLIVKRYIKKINPKICLLLETEIWPNLTHELNKNNIPILLINARLSQQSKEKYQ
FT                   RFTSNLIKQTLNKFTLIAAQNKNSANRFIELGTKNDDVIITGNIKFDQSTKPNIKINNI
FT                   LQAMVGRRKIVIFASTHEGEEAQIINEYLKHKHTIDALLVIIPRHPERFDVVYKSFKSA
FT                   NLNVIRRSENQPTQNAQILLGDSMGEMMSYFNIADIVFMGGSLSNTGGHNMLEPATLAK
FT                   PIIFGPNIFNFTEISSDLLKQNAAIQIQNVAGLFKKIVMLLNDEKQCKVLGNNAQQYLY
FT                   SKQGAVKNTLQLIKKFLTS"
FT   gene            451387..452394
FT                   /locus_tag="Rmag_0412"
FT   CDS_pept        451387..452394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0412"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein, HSR1-related; GTP1/OBG sub domain
FT                   protein; KEGG: lpp:lpp2702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02174"
FT                   /db_xref="GOA:A1AW67"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW67"
FT                   /protein_id="ABL02174.1"
FT                   /translation="MKFVDSASIRIEAGKGGAGCLGFRREKYIPDGGPDGGDGGDGGHI
FT                   YFQGQEGFNTLSEFRFKRLFRAKNGQPGSGQNKRGKSAQHLTVEIPLGTKIYDLETDEL
FT                   IGEMIEHEQIILVAKGGFHGLGNTRFKSSINRAPRKTTPGSPGEIREIGLELSIMADIG
FT                   LLGMPNAGKSSLIRQISNAKSKVANYPFTTLHPSLGVVSYYDEHIIMADIPGLIENASK
FT                   GVGLGFEFLKHLFHTKALLHVVDIFPVDGSDPVENFLTIEKELKKYDQKLAKKPRLLAI
FT                   NKMDLLSGGDRETVVQSLLKGTRYNGKVYRISALNGLGCKNLVAGLFKLVKENE"
FT   gene            452387..453157
FT                   /locus_tag="Rmag_0413"
FT   CDS_pept        452387..453157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0413"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="KEGG: tcx:Tcr_0344 glutamate 5-kinase; TIGRFAM:
FT                   glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02175"
FT                   /db_xref="GOA:A1AW68"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW68"
FT                   /protein_id="ABL02175.1"
FT                   /translation="MSKQRWVIKIGSALLTNDGKGLDKTAIISWVRQIKELIQQNIDII
FT                   LVLSGAIAEGMKRLGWNERPENIHKLQAAAAVGQMGLVQTYETLFAQYNIHTAQVLLTH
FT                   DNLANTNQSDNISATLNTLLSLGTVPIVNENDTVATDEIKFGDNDTLAALVVNLVGATQ
FT                   LVILTDQGGIYDADPRQNANAKLINKIHVNDEKLTQVASRACGSLGSGGMYTKVLAAKI
FT                   AAKSDVITIIASGRQVDVLSKLGAGKHIGTLIHC"
FT   gene            453151..453624
FT                   /locus_tag="Rmag_0414"
FT   CDS_pept        453151..453624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0414"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="KEGG: hit:NTHI0077
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02176"
FT                   /db_xref="GOA:A1AW69"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW69"
FT                   /protein_id="ABL02176.1"
FT                   /translation="MLAYIGLGSNLNRPKEQIKNALITLNSTKDVKVVGLSSLYQSKPI
FT                   DDLKQPDYINAICQVDTHLTALELLYVCQGIETKQHRVREKKWGARTIDLDIIIYGVKV
FT                   IASKQLIVPHLQMINRAFVLVPLAELEPNFKVPVLGHIQDLIAKLDITKLIKL"
FT   gene            453621..454403
FT                   /locus_tag="Rmag_0415"
FT   CDS_pept        453621..454403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0415"
FT                   /product="ketopantoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="KEGG: cps:CPS_4312 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; PFAM: Ketopantoate
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02177"
FT                   /db_xref="GOA:A1AW70"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW70"
FT                   /protein_id="ABL02177.1"
FT                   /translation="MNIEALNNFKQSGEKITCLTAYDASFASVFDVCGIDIILIGDSLG
FT                   NVIQGGENTLNVSMDDMVYHTKAVTKGAQNALRISDMPYQSYTNSEQALTNAKLLIIAG
FT                   AQMVKFEGGCEHEASFKIFQNNDIPVCGHLGLQPQSVIEMGGYKTEGRDKQSADKIIKD
FT                   ALALASWGVKVIVLECIPANLAKQVSQSLSIPTIGIGAGVNCDGQILVSYDMLGIHVGY
FT                   VPKFVKNFLIDSGDIKSAVNAFIEAVKDKSFPGEQHSY"
FT   gene            454403..455239
FT                   /locus_tag="Rmag_0416"
FT   CDS_pept        454403..455239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0416"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: sdn:Sden_3175 pantoate--beta-alanine ligase;
FT                   TIGRFAM: pantoate--beta-alanine ligase;
FT                   cytidyltransferase-related domain; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02178"
FT                   /db_xref="GOA:A1AW71"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW71"
FT                   /protein_id="ABL02178.1"
FT                   /translation="MQLCYQNTQITKLVNNWHTQGKTVAFVPTMGGLHQGHLSLIDIAK
FT                   QKADKVIVSIFVNPAQFSKNEDLDSYPRTINADLTALKVNVDGVFIPNIKQIYPKGISK
FT                   YIDVGKIGQILCGRTRPHFFNGVAQVVEILFGIVRPDVAVFGQKDYQQLLVIKQMVKNL
FT                   SLNICIESGEIIREKSGLAMSTRNQYLSKNEAKIATNLHKTLSYFKHEILQNKKVYVLN
FT                   ELAKLDLKQHFKIDYLEVLDANNLKQITDNTHQIVILSAVFLGSVRLIDNIIFKKG"
FT   gene            455242..455820
FT                   /locus_tag="Rmag_0417"
FT   CDS_pept        455242..455820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0417"
FT                   /product="nitrogen-fixing NifU domain protein"
FT                   /note="PFAM: HesB/YadR/YfhF-family protein; nitrogen-fixing
FT                   NifU domain protein; KEGG: hch:HCH_02543 thioredoxin-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02179"
FT                   /db_xref="GOA:A1AW72"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW72"
FT                   /protein_id="ABL02179.1"
FT                   /translation="MFDITDEAKVYVADLFAQQDEKDLGLKVDVEKAGTPAAVVTFNFC
FT                   FPKELSKTYKKFEYEGFYAYIDELNFEYLKDSEVALKDAGTGKKLTITAPNTKGKEPKE
FT                   DAPLEEKIKYVIAANINPGLASHGGFVELVEITKHMDVILNFGGGCQGCSSVKSTLEQG
FT                   VEAQLKMSFPEIKSVRDVTDHSNTDNAYI"
FT   gene            455872..456381
FT                   /locus_tag="Rmag_0418"
FT   CDS_pept        455872..456381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_0164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02180"
FT                   /db_xref="GOA:A1AW73"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW73"
FT                   /protein_id="ABL02180.1"
FT                   /translation="MIITIDASAKERRDAKVAHELFTINMVVVHLFLTLGLIKLLNTNM
FT                   SSAIGLSILISFIIIIYTYFRTKKAKSNDQYLIYLHWQLSLNRYKLLIGAYIFYFLVTS
FT                   LTLIISNDAPVSMDSTRIIDSILNLLGVVPLFFCILISVVLGSGSMFNAGRGEVDQKLA
FT                   QKYPQS"
FT   gene            456381..457310
FT                   /locus_tag="Rmag_0419"
FT   CDS_pept        456381..457310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0419"
FT                   /product="thiamine-phosphate kinase"
FT                   /note="TIGRFAM: thiamine-monophosphate kinase; PFAM: AIR
FT                   synthase related protein domain protein; KEGG: hit:NTHI1618
FT                   thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02181"
FT                   /db_xref="GOA:A1AW74"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW74"
FT                   /protein_id="ABL02181.1"
FT                   /translation="MNEFSLIETYFNWGGSNLANLGIGDDCAVIDIDANYQLVTSVDTF
FT                   IEGVHFPSNTSASDIAYKSLAVNLSDLAAVGARVKYFTLALTLPNINKKWLSQFSTSLK
FT                   SLADEFGIVLVGGDTTKGMLSITINVTGVVKKNKALLRSSAQVGDLIFVSNTIGDAAYA
FT                   WKQLQNNQTPSEYVINQFNRPKPQLFLGQQLSDIANACIDISDGLEQDLTHILTRSNVG
FT                   ASINLDDIPLTYEVKTYIEKTNDWCLVLAGGDDYELCFTAPVKNMNLLKALQNKNNITV
FT                   TQIGIINDSMALTKIGFFDKQCCSYQHF"
FT   gene            complement(457348..457758)
FT                   /locus_tag="Rmag_0420"
FT   CDS_pept        complement(457348..457758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0420"
FT                   /product="transcriptional regulator TraR/DksA family"
FT                   /note="TIGRFAM: RNA polymerase-binding protein DksA; PFAM:
FT                   zinc finger, DksA/TraR C4-type; KEGG: aci:ACIAD0273 DnaK
FT                   suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02182"
FT                   /db_xref="GOA:A1AW75"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW75"
FT                   /protein_id="ABL02182.1"
FT                   /translation="MSQPNYQEIPNYQPKKNEKFMNNSQLEHFRKKLNTWRKQLVDDAE
FT                   STINHIQKDSNQVADINDRATLEEEFALELRTRDRERKLIGKIDKTLYIIELGDYGFCK
FT                   TCGAEISLVRLEARPTADECIDCKTIAEKKEV"
FT   gene            457849..458610
FT                   /locus_tag="Rmag_0421"
FT   CDS_pept        457849..458610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0421"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: tcx:Tcr_1242 HAD-superfamily hydrolase
FT                   subfamily IA, variant 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02183"
FT                   /db_xref="GOA:A1AW76"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW76"
FT                   /protein_id="ABL02183.1"
FT                   /translation="MALEALIFDVDGTLANTEHYGHLKAFNLAFKELGLDWHWSNEIYH
FT                   KLLNVTGGQLRIKYYLKKYNPTFEHQYLDNFVASIHQLKTKIYVRLTNQGAVPLRTGVK
FT                   RLFNEARKANLRLAIATTTTPENVDALIANTLGSEALDWFEVIGAGNIVSKLKPSGDIY
FT                   THVLKQMNLDSTKCLAFEDSHNGIISATQAGLKSIITVNEYTDKHEFDGALVVLDHLGD
FT                   KYKPFNLIKGDATNTSYVDVAYLRELHATHC"
FT   gene            458670..460090
FT                   /pseudo
FT                   /locus_tag="Rmag_0422"
FT   gene            460425..461705
FT                   /locus_tag="Rmag_0423"
FT   CDS_pept        460425..461705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0423"
FT                   /product="isocitrate dehydrogenase (NADP)"
FT                   /EC_number="1.1.1.42"
FT                   /note="TIGRFAM: isocitrate dehydrogenase, NADP-dependent;
FT                   PFAM: isocitrate/isopropylmalate dehydrogenase; KEGG:
FT                   cbu:CBU_1200 isocitrate dehydrogenase, NADP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02184"
FT                   /db_xref="GOA:A1AW77"
FT                   /db_xref="InterPro:IPR004439"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW77"
FT                   /protein_id="ABL02184.1"
FT                   /translation="MQFSTANLISMSYQHIQVPQNGEKISFKKSVIKVPNYPIITYIEG
FT                   DGIGTDVSPVMKKVINAIVAKAYNGSKAIQWMNVYAGERANDIYGEYLPQETLDAIEEF
FT                   SVSIKGPLTTPVGGGMRSLNVAIRQTLDLFICQRPVKYFEGTPSPVKAPEKIDMVIFRE
FT                   NSEDIYAGIEYQAGTAEVKKIIDFLQNEMGTTKIRFPDTSGIGIKPVSKEGTDRLVRSA
FT                   IQYAIDNDKDSVTLVHKGNIMKFTEGGFRDWGYQLACDEFGATTLGHGLWKSFKNKNTG
FT                   TVITIKDIIADAFLQQILLRPEEYSVIATLNLNGDYISDALVAQVGGIGIAPGANLSGT
FT                   TAVFEATHGTAPKYAGLNKVNPGSIILSAEMMLRHMGWTQAADMVLEAMSNVIQNKTVT
FT                   YDLERLMDDATLLSCSEFGDAIIDSIL"
FT   gene            462345..462869
FT                   /locus_tag="Rmag_0424"
FT   CDS_pept        462345..462869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0424"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfa:PF14_0644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02185"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW78"
FT                   /protein_id="ABL02185.1"
FT                   /translation="MKKIIAIATLVAATSASAGFFNNGSNNNGYGYGNGADNWGPFDGG
FT                   SNFGPMNGGSNWGPFSGGNNMGPFNGGSNMGPFNGANNWGPFSNNNDMNNDSDWGFHYN
FT                   NKNKTKNISNVTADGKYSGNANANANGVANAYAKGQANAFAKAQADAYAKGYADAKANV
FT                   TVDSRDQVIAK"
FT   sig_peptide     462345..462401
FT                   /locus_tag="Rmag_0424"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.911 at
FT                   residue 19"
FT   gene            463030..463105
FT                   /locus_tag="Rmag_R0017"
FT                   /note="tRNA-Asn1"
FT   tRNA            463030..463105
FT                   /locus_tag="Rmag_R0017"
FT                   /product="tRNA-Asn"
FT   gene            complement(463180..464358)
FT                   /locus_tag="Rmag_0425"
FT   CDS_pept        complement(463180..464358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0425"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   hch:HCH_04972 aspartate/tyrosine/aromatic aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02186"
FT                   /db_xref="GOA:A1AW79"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW79"
FT                   /protein_id="ABL02186.1"
FT                   /translation="MSVYLSDRVQKVKPSATLTVTAKANELKSQGIKIVPMGSGEPDFD
FT                   TPENIQKAAIHAIKNGQTRYTAVDGTPILKQAIIDKFKRENNLTYTSAEVMVSSGGKQV
FT                   FYNLCQAVLNQGDEVIIPAPFWVSYPDIVLLADATPVIIETGLEQDFKITSEQLEASIT
FT                   NNTKLFVINSPSNPTGAVYSQTELQALVNVLKKHQKILIITDDIYEHIRWGNDDGFVNI
FT                   VMTDKTLKNRTIILNGVSKSYAMTGWRIGYGAGPENIIKAMKKIQGQSTSNPCSIAQAA
FT                   ALEALSGDQSIINTMIHAFEKRHDFIVDALNEIDGVECSKSQGAFYAFPRVKGLISRLG
FT                   LKNDIELSTYCLEVLNIALVSGSDFGAPGYVRFSFATSMNNIKQAIEKLNKI"
FT   gene            464419..466413
FT                   /locus_tag="Rmag_0426"
FT   CDS_pept        464419..466413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0426"
FT                   /product="Excinuclease ABC subunit B"
FT                   /note="KEGG: ilo:IL1789 helicase subunit of the DNA
FT                   excision repair complex, UvrB; TIGRFAM: excinuclease ABC, B
FT                   subunit; PFAM: helicase domain protein; UvrB/UvrC protein;
FT                   SMART: DEAD/DEAH box helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02187"
FT                   /db_xref="GOA:A1AW80"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW80"
FT                   /protein_id="ABL02187.1"
FT                   /translation="MNNKFQLISKFSPSGDQPEAIKTLIDSVNAGVKFQTLLGVTGSGK
FT                   TFTLANVIQQTKRPSLIMAPNKTLAAQLYSEMKEFFPYNSVEYFVSYYDYYQPEAYVPA
FT                   SDTYIEKDSSINEQIEQMRLSATKALLERDDVIIIASVSAIYGLGNPESYMAMLLHLSV
FT                   GEVTNQREILLRLSQMQYSRNDVTLIRGHFRVKGEVIDIFPADSEEQTIRIEMFDEEIE
FT                   QLYWFDPLTGEKLKSLQRVTIYPQTHYVTPKSKILNMLDDIKAELKDRRSELLSVNKLV
FT                   EEQRLTQRVHMDIEMMRELGYCTGIENYSRYLSSQNPGDPPSTLLDYLPDNALVILDES
FT                   HVTVSQIGGMYKGDRARKKTLVDFGFRLPSALDNRPLKFSEFEDRVHQCILVSATPAQY
FT                   ELEVSSVIVEQVVRPTGLLDPEIDIRPVDTQVDDLLSEIRMRVKAGERVLVTTLTKKMS
FT                   EQLSDYLNDHHVKVRYLHSDIDTIERVEIIRDLRLGIFDVLVGINLLREGLDIPEVSLV
FT                   AILDADKEGFLRSERSLIQTMGRAARNINGHVILYAARITKSMQKAMDETKRRRIKQQA
FT                   YNLKNNITPEGIAKPIINILDTDLTSNQIEEDNVQKVFIQLSPVQLAKKIKILEKQMYS
FT                   FANDLAFEHAADMRNQIKQLKDTQFKKIF"
FT   gene            466410..467051
FT                   /locus_tag="Rmag_0427"
FT   CDS_pept        466410..467051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0427"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   mfa:Mfla_2336 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02188"
FT                   /db_xref="GOA:A1AW81"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="InterPro:IPR027621"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW81"
FT                   /protein_id="ABL02188.1"
FT                   /translation="MINIKLNINEIFYSLQGEGREVGLPSVFIRLTGCPLRCTYCDTEY
FT                   AFKGNNLMAIDEIIKKIKQYDTPYICVTGGEPLAQKNCCLLLNELVKNNYQVSLETSGS
FT                   INIQDVNVSVSIVMDIKTPDSGEFEQNKYTNIKKLTTKDQLKFVIRSRADFDWSVAILS
FT                   QYPTAAGTLFSPVFGDITPTQLADWILDQQLNVRMQLQLHKLLWGDEKGK"
FT   gene            complement(467052..467540)
FT                   /locus_tag="Rmag_0428"
FT   CDS_pept        complement(467052..467540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0428"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: rfe:RF_1004
FT                   small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02189"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW82"
FT                   /protein_id="ABL02189.1"
FT                   /translation="MMNKVLLPILIISSVINANSNNNHFGNDLNHNVWCDFEQQFRQFN
FT                   YKMNQIQNFSNFDTKSRRYFDNQTNNYIIQIKVNGLSKENLDISTNNSSIFIKGNVKNI
FT                   QNTIHNSSASSSSFYQSFTLPHDVDTDNINASFNNKILIISIPKRKQPKLQVRKITIQ"
FT   sig_peptide     complement(467484..467540)
FT                   /locus_tag="Rmag_0428"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.938) with cleavage site probability 0.607 at
FT                   residue 19"
FT   gene            complement(467806..468554)
FT                   /pseudo
FT                   /locus_tag="Rmag_0429"
FT   gene            complement(468744..469841)
FT                   /locus_tag="Rmag_0430"
FT   CDS_pept        complement(468744..469841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0430"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="PFAM: chorismate synthase; KEGG: hch:HCH_02421
FT                   chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02190"
FT                   /db_xref="GOA:A1AW83"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW83"
FT                   /protein_id="ABL02190.1"
FT                   /translation="MSGNTIGKLFTITTAGESHGEALIGIVDGCPPRLALTEADLQGDL
FT                   DLRKPGTSCHTSQRHEEDLVKILSGTFEGKTTGTTIALIIQNTDQRSKDYGNIKDTFRP
FT                   GHADYTYDQKYGFRDYRGGGRSSARETAMRVACGGIAKKYLKQVYGIEIKGYLSQLGPI
FT                   KAENFDWFEVHNNPFFCPDASKVRTLEEYMDALRKSGDSVGARINITANNMPVGLGEPI
FT                   FDRLEADIAHGMMSINAVKGVEIGAGFKAITQKGTEHRDAITLSGFKSNHAGGVLGGIS
FT                   SGQDILVSIALKPTSSLRLPIESIDKNGEPIEVVTKGRHDPCVGIRATPIAEAMLAITI
FT                   MDHVMRHRAQNSNVASITPIIPASI"
FT   gene            complement(469882..470232)
FT                   /pseudo
FT                   /locus_tag="Rmag_0431"
FT   gene            complement(470448..470524)
FT                   /locus_tag="Rmag_R0018"
FT                   /note="tRNA-Arg2"
FT   tRNA            complement(470448..470524)
FT                   /locus_tag="Rmag_R0018"
FT                   /product="tRNA-Arg"
FT   gene            470704..471399
FT                   /locus_tag="Rmag_0432"
FT   CDS_pept        470704..471399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0432"
FT                   /product="orotidine-5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="KEGG: mca:MCA1094 orotidine 5'-phosphate
FT                   decarboxylase; TIGRFAM: orotidine 5'-phosphate
FT                   decarboxylase; PFAM: Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02191"
FT                   /db_xref="GOA:A1AW84"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW84"
FT                   /protein_id="ABL02191.1"
FT                   /translation="MKNIKVEDRLIFALDVPEVEQAKDLVIQLDGSVNFYKIGMELLMT
FT                   GQYFSLLDWLLEKDKQVFIDLKFFDVPETVGRTIKRLSQYGATFATIHGNQALMEKASE
FT                   NKGELKILAVTALTSLDRGDLDDLGFDCDVQELVISRAKRAFEAGCDGVVSSGLEVPFL
FT                   REYVDNKLIAVTPGIRPVTNNDDQKRVVDVVTAFKSKSDYVVVGRPIKNATSPYRAAQD
FT                   IQLIIKSCF"
FT   gene            471419..471495
FT                   /locus_tag="Rmag_R0019"
FT                   /note="tRNA-Val1"
FT   tRNA            471419..471495
FT                   /locus_tag="Rmag_R0019"
FT                   /product="tRNA-Val"
FT   gene            472435..473628
FT                   /locus_tag="Rmag_0433"
FT   CDS_pept        472435..473628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0433"
FT                   /product="Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family"
FT                   /note="TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; PFAM: monooxygenase,
FT                   FAD-binding; KEGG: ngo:NGO1678 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02192"
FT                   /db_xref="GOA:A1AW85"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW85"
FT                   /protein_id="ABL02192.1"
FT                   /translation="MKIDIVIIGGGPVGLSFASAMFDSNVKVLLIERSSLDSIADPQVD
FT                   GREIALTHLSLKILKKFGVWDLINQAEVSLLKEAKVFDGDSSSLLNFTIKNTSIDALGY
FT                   LVPNYQIRKALYTKVKQAKNIDIITDISVKNVTQLEDYSQVILSNGDKIKTKLVIAADS
FT                   RFSDIRRKVGIPALMKDFSKVMIVTQMSHEISHNNVALERFYYGRTLALLPMVDKFSSV
FT                   VLTIKTDQSQAMLEMSEVDFNQMMTQSFKGELGQMMQVGERHSYPLVATHAQTFIAKRF
FT                   ALIGDASVGMHPVTAHGFNLGLRGQDILAKLVNEALDNGQDIGAESLLKLYEKKHINLT
FT                   RLMFFGTNGIVALFTNDTPVIKQVRRFVLKFVEHFPPIKYLISHHLTQDKKHKFLPF"
FT   gene            473628..474266
FT                   /locus_tag="Rmag_0434"
FT   CDS_pept        473628..474266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0434"
FT                   /product="Pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="KEGG: tcx:Tcr_1992 pyridoxamine 5'-phosphate
FT                   oxidase; TIGRFAM: pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02193"
FT                   /db_xref="GOA:A1AW86"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW86"
FT                   /protein_id="ABL02193.1"
FT                   /translation="MKIDLTSLRHEFTQSGLNRADLSSNPFEQFKLWFQQAQEANVVEP
FT                   SAMSLATSDDSEISIRVVLLKYFDRHGFVFFTNYNSKKSKQLQINPNVALLFPWLALER
FT                   QIKISGYVKKVNTFESLKYFSSRPKASQLGAWASQQSSNLSSRQILLSQFESMKVKFSK
FT                   GEVPLPDFWGGYRVIPSKIEFWQGRENRLHDRFIYQLSEDKWRIERLAP"
FT   gene            complement(474255..475058)
FT                   /locus_tag="Rmag_0435"
FT   CDS_pept        complement(474255..475058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0435"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="KEGG: ppu:PP0074 shikimate 5-dehydrogenase; TIGRFAM:
FT                   shikimate 5-dehydrogenase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Shikimate dehydrogenase substrate binding,
FT                   N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02194"
FT                   /db_xref="GOA:A1AW87"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW87"
FT                   /protein_id="ABL02194.1"
FT                   /translation="MYKFAVFGNPIKHSLSPNIHIQFAQQTGFEVSYDKILAPIDDFSS
FT                   SAQAFINQGANGFNITVPFKLDAFKFASELTLNAQIAGAVNTIKIEQDKIIGENTDGIG
FT                   LVNDLTHNLGIELKDKVILILGAGGATQGILLPLLKQQPNHVMIANRTPFKAIKLAKDF
FT                   AKFGKTCGFDLDKIKHDPVNIIINATSTSLYGKMPDIASGVANNAICYDLMYGKQTPFM
FT                   DWATINHGSMISDGLGMLIEQAAVAFEFWTGVKPNTEQVLSNLRS"
FT   gene            complement(475090..476844)
FT                   /locus_tag="Rmag_0436"
FT   CDS_pept        complement(475090..476844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0436"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein; KEGG: tcx:Tcr_0703 ribonuclease,
FT                   Rne/Rng family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02195"
FT                   /db_xref="GOA:A1AW88"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW88"
FT                   /protein_id="ABL02195.1"
FT                   /translation="MNHILINAIYSEEIRVGIVKNKKLTGLNIETSLNKKTKGNIYHGK
FT                   ISRVEQSLEAAFVDYGKEKQGFLPFKEVAETLHNDVKAKGEKLTISDVLKEGQEIIVQI
FT                   EKEERGNKGAALSTYINLAGAYMILMPNNPKNHGISRQIVALDRQSLKEIISKIILPNH
FT                   SGLIIRTAGSGKSFEELQWEVDYLSDLWKSINTATLTRSAPFLIYQESDIIIRTLRDHL
FT                   RSDTDSVIIDELEAFQNAKEFVSFVLPHYLDRIKFFDVSEHSLFNHMGIEAQVKSVFNR
FT                   EVSLRTGAIIVFDPTEALTAIDINSARATKGADIEETAYNTNLEATKEIALQLQLRDIG
FT                   GLVVIDFIDMASEEHRVSIEKAMEKATNADRARIQIGTISQFGLLEMSRQRLMNSVTES
FT                   VEKPCSACHGRGTTPTIPTLALTILRQLEDGCNAAKQTAHLTIQSSIEVITYILNEKRQ
FT                   EIIKLEGKHGIKITLLPNPYMQFPNFTINKQKGSKRSQHKSYQSISKPQHVLAENGLSD
FT                   QAEIPAINVNRPSTRVPEKKISLFEKIKNVLFGRKKKQPNKHRINPNNRRPNVNNNQNN
FT                   TTKQQKSQ"
FT   gene            complement(477164..477883)
FT                   /locus_tag="Rmag_0437"
FT   CDS_pept        complement(477164..477883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0437"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   nmu:Nmul_A0336 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02196"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW89"
FT                   /protein_id="ABL02196.1"
FT                   /translation="MKTALVTGGAHRIGAQICHTLHKNNYHVIIHYRNSSKDAKNLTNK
FT                   LNNIRQNSASTLQAELSNIQEVSKLCDIIKSLNLLVNNASVFYPTPVSKLNQHDYQSIM
FT                   DTNVMAPLFLSSTLSDKLAQNQGCIINIVDIHSERPLKNYAIYNISKAAIAMTTKTLAK
FT                   ELAPNVRVCGISPGSILWPENTAELKQVQKDKILKKIALKKQGSAQDIADTILFLANST
FT                   YITGQIINVDGGRTLNQ"
FT   gene            477898..478992
FT                   /locus_tag="Rmag_0438"
FT   CDS_pept        477898..478992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0438"
FT                   /product="protein of unknown function DUF185"
FT                   /note="PFAM: protein of unknown function DUF185; KEGG:
FT                   noc:Noc_0037 protein of unknown function DUF185"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02197"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW90"
FT                   /protein_id="ABL02197.1"
FT                   /translation="MSLEQIIKNTIIQNANPISFDEFMDLALYHPTLGYYRSGLEKFGE
FT                   RGDFITAPETSDLFGFCLARQCAQVLNGTNDILEFGAGSGVLATQILFKLGRLNSLPKK
FT                   YYILELSAELKHRQAQAINKILPELMDRVVWLDELPADFSGVVIANEVLDAMPAKRIVY
FT                   KNNQFYELGVDYCGNEFCWKIFDLPYQSDKTLLPNNMVEDYKTEVNLRAMAWINSLYMA
FT                   TNEVLVLLIDYGMGRNEYFHPQRLNGTLRCYYQHKASENPFVNIGEQDITTSVNFSDIA
FT                   DQASVSGFKVSGYATQALFLISLGIDEYLFEQLDENKYINLAQQVKQLVLPSAMGESFK
FT                   VLALSKKLSIKLTGFIEQDLSNKL"
FT   gene            479009..479809
FT                   /locus_tag="Rmag_0439"
FT   CDS_pept        479009..479809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0439"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="TIGRFAM: putative undecaprenol kinase; PFAM:
FT                   Bacitracin resistance protein BacA; KEGG: noc:Noc_2835
FT                   undecaprenyl pyrophosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02198"
FT                   /db_xref="GOA:A1AW91"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW91"
FT                   /protein_id="ABL02198.1"
FT                   /translation="MNIFQTIVLALVQGLSEFLPISSSAHLILVPELTNWTDQSLAFDV
FT                   VVHMGTLSAVIFYYQAMIKCLFFDFYHSIIKRQTIGESKLAWGVLLGTIPVGLVGMIFR
FT                   DSIATDLRSVEIIAYATLVFGVLLGFASWFSHRNKNQKSTISWVDIGFIGMAQTLALIP
FT                   GTSRSGITITACMLVGLSRKLSIQFAFLLSIPVISLSLILILIDLYHQAQLVNVSLLAM
FT                   GFVVAAISAYVTIVFFIKLIDAVGMMPFVIYRLTLGIFLFFFIL"
FT   gene            480525..483062
FT                   /locus_tag="Rmag_0440"
FT   CDS_pept        480525..483062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0440"
FT                   /product="aminopeptidase N"
FT                   /note="TIGRFAM: aminopeptidase N; PFAM: peptidase M1,
FT                   membrane alanine aminopeptidase; KEGG: noc:Noc_1314
FT                   peptidase M, neutral zinc metallopeptidase, zinc-binding
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02199"
FT                   /db_xref="GOA:A1AW92"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012779"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024601"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="InterPro:IPR035414"
FT                   /db_xref="InterPro:IPR037144"
FT                   /db_xref="InterPro:IPR038438"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW92"
FT                   /protein_id="ABL02199.1"
FT                   /translation="MNKLQPIYRKDYTLSEYLIHTTELEFDLTETQTIVTSKISFYKNP
FT                   KSNKKTNILFLDGIDLELISILVDKAKPDYKLVEQGLEINNLADEFILEIKNCIHPEKN
FT                   TSLYGLYQSNGNFCTQCEAHGFRQITYYLDRPDVLSVFTTHIKADKQKYLVLLSNGNLI
FT                   KQINGSTTWHDPTPKPCYLFALVVGNFALKEDTYITLSGNEVTLKIYVQAHNINKTQFA
FT                   MAALKRSFAWEEKRFGLEYDLDIYMIVAVDDFNMGAMENKGLNIFNTTYVLASIDTVTD
FT                   KDFIDIEAVIGHEYFHNWTGNRVTCRDWFQLSLKEGLTVFRDQEFTSDLHTRSIKRIED
FT                   VNTLRTLQFAEDMSSMQHLVRPEHYIEMNNFYTLTVYEKGAEIIRMVHTFLGEVGFQKG
FT                   MQLYFQRFDGDAVTIDDFIQSMSDANNFDFDQFMYWYSQSGTPEVSIVSDYNHNDKTFK
FT                   VFIRQHSQCDYFFPLRFALLDDTGTKLESGILTVKDKEQIFIFNNMDVEPTPSWLRGFS
FT                   APIKLKSDLTFKQKIFLVRHDSDAFNQWDNAQQLWLSLILIPSSINQDLFFDAIEKVLK
FT                   NTFLDGSCVSLVQDKSLICEILTLPSEQFLHQQQEIIDVFEVHDKREKVINKIIERFKL
FT                   LFSKIYSKLNIYQPYELTPEAVGNRALKNICLYYLAISGEFELAFEQFKSANCMNDKMA
FT                   SLKALIVSDNSYKNIALDGFYHEFKNDTQVMDKYFSIQSSASTANVESIKVLMQHKLFS
FT                   FNTPNRLRSVIGSFSQNYVNFHNQQGYELLTNIIIKLNQSNPQIGAKLTSVYNHWQRFT
FT                   PKLKALQKQQLEKILAIENLSNNIFEIIQAALK"
FT   gene            483059..483517
FT                   /locus_tag="Rmag_0441"
FT   CDS_pept        483059..483517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0441"
FT                   /product="CinA domain protein"
FT                   /note="PFAM: CinA domain protein; KEGG: reu:Reut_A2850
FT                   CinA, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02200"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW93"
FT                   /protein_id="ABL02200.1"
FT                   /translation="MNTLITLLKQKSLTIAVAESCTGGNLSALLTSQSGSSSYFDRGFI
FT                   TYSNQAKIDMLGVKSTTLDRFGAVSEQVALEMVRGVIKNSSANIGVAITGIAGPTSGIK
FT                   NKPIGMVCFGFCTLKRCFTSIKQFSSNRAEVVHTSVDFVIKTLVYELS"
FT   gene            483504..484472
FT                   /locus_tag="Rmag_0442"
FT   CDS_pept        483504..484472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0442"
FT                   /product="tRNA-U16,U17-dihydrouridine synthase"
FT                   /note="TIGRFAM: TIM-barrel protein, yjbN family; PFAM:
FT                   dihydrouridine synthase, DuS; KEGG: noc:Noc_2960
FT                   dihydrouridine synthase TIM-barrel protein YjbN"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02201"
FT                   /db_xref="GOA:A1AW94"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW94"
FT                   /protein_id="ABL02201.1"
FT                   /translation="MNYHSKFSVAPMMDWTDRHCRYFYRLISKNVQLWTEMVTARAILY
FT                   GNKNRLLDFNVCEHPLVLQLGGSEPKEMAQAAKIAQDWGYNEININVGCPSNRVQSSNF
FT                   GVCLMQTPQVVAQCVDAMRQMVDVPITVKSRIGVDNMDSYDELVNFVATVESSGCDNLV
FT                   IHARKAWLKGLSPKENRSVPKLNYERVYQIKRDFPHLAIGINGGIMDMESSLQHLEHVD
FT                   SVMLGRAVYHQPYLLRKVDGLIYQKKSSILSREQVLLAFIEYMKVQHANSVLIRSMTRH
FT                   IFGLYHGQKNAKKFKRLLSGKIVKFEHLYEWLEYTDKNNDQ"
FT   gene            484462..485682
FT                   /locus_tag="Rmag_0443"
FT   CDS_pept        484462..485682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0443"
FT                   /product="cell division protein FtsA"
FT                   /note="PFAM: cell division protein FtsA; KEGG: mca:MCA2424
FT                   cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02202"
FT                   /db_xref="GOA:A1AW95"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW95"
FT                   /protein_id="ABL02202.1"
FT                   /translation="MTNSDNFFASIDIGTSKIVVLIADEEDGKIEVFGHGIGPSDGVKN
FT                   ALIVDIDKVTKAILKVVKAAYLSCNTRIHNVSTNICDLHLSTINQDRQISVSGKKITKE
FT                   HVIEAIKTASATPMPANKQMLSASINRFTIDQDTATIDQPIGLEATVLGAQVHVSIVSN
FT                   QAMNSIHQAVEKSGLGLSEVVLNSIASSRVCITQDEKDSGVCLLDMGAGVSNISVFMGG
FT                   GIAYSHVFKMGGNQITQNIANAFNTSFKEAERLKIEHGYAQLKIAPVDKLIQLKQLDSI
FT                   ENRYLSLHNLVEVIENSYLDICHSIKQNLKTKKLDRSLKSGFVLTGGVSLIDGCEGLFV
FT                   NFFRIRTKLAKVNVNKITGKDMIVSNPIYTCALGLLMHADNNAYLEVVQAYQQTNFVSK
FT                   IKSLLEL"
FT   gene            485688..486599
FT                   /locus_tag="Rmag_0444"
FT   CDS_pept        485688..486599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0444"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="PFAM: UDP-3-0-acyl N-acetylglucosamine deacetylase;
FT                   KEGG: ppu:PP1343 UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02203"
FT                   /db_xref="GOA:A1AW96"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW96"
FT                   /protein_id="ABL02203.1"
FT                   /translation="MIKQRTIKKEVKARGVGIHSGSVVNMTLIPAKEDHGVVFRRMDVG
FT                   GKLVRAHSAFVNEVVLSTGLENQGVKVSTVEHLMSTFSALGIDNVLVELDSFEVPIMDG
FT                   SSAPFIFLVQSAGIKEQDAYKKFFVIKDTIRVENGDSWAQVSKYEGFKVSLEIDFDHKK
FT                   VKESGQKLSINFSKQCYLKEISRARTFGYMKDVEMMQRQNLALGASMDNAIALSDDDVL
FT                   NEDGMRYQNEFVKHKILDIVGDLYLLGSNLIGHYEGYKTGHLLNNQLLSVILAKPDTWS
FT                   IETFEEEGSPIQFYSEDWKNSL"
FT   gene            486667..488406
FT                   /locus_tag="Rmag_0445"
FT   CDS_pept        486667..488406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0445"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate enzyme
FT                   domain protein TPP-binding; thiamine pyrophosphate enzyme,
FT                   central region; thiamine pyrophosphate enzyme TPP binding
FT                   domain protein; KEGG: mca:MCA2270 acetolactate synthase,
FT                   large subunit, biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02204"
FT                   /db_xref="GOA:A1AW97"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW97"
FT                   /protein_id="ABL02204.1"
FT                   /translation="MKLNGAQILINSLKSEGVKYIFGYPGGAVLHIYDALNACNEIKHI
FT                   LVRHEQGAMHAADGYARTSGKCGVVLVTSGPGLTNAVTGIATAYMDSIPMVVVSGQVSS
FT                   AVIGNDAFQEVDAVGITRSCVKHNFLVRDINDLVDVVKKAFYIATTGRPGPVLIDITKD
FT                   TTIAEVEFELGDYPKSIDMRSYQPKIKIEADQITKAITLIVQAKKPIIYSGGGSVIGNA
FT                   DKILRIFTRHTGFPITQTLMGLGAYPASDKQSLGMLGMHGTYEANMAMHDSDCIIAVGA
FT                   RFDDRITGNLDKFCPYAKIIHIDIDPSSVGKNVGVDVSIIGQVNDVLSILIQALKDKQL
FT                   ADITQWWAQIETWRAVDSLAYKTKIGVIKPQSVIEVLYEITKGEAIVTSDVGQHQMWAA
FT                   QYYPFDKPRRWINSGGLGTMGFGLPAAMGAKLAEPEMDVVCVTGEGSIQMMLQELSTML
FT                   QYNTPVKIINLNNGYLGMVRQWQEFFYDKRYSMSYMDALPNFVKLAEGYGHIGIKIEKE
FT                   LDLKPALIKAFTEKDRTVFLDILTDPTENVFPMIPSGAGHHEMLLAGRDKMTSTNDKGL
FT                   NLI"
FT   gene            488403..488879
FT                   /locus_tag="Rmag_0446"
FT   CDS_pept        488403..488879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0446"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="TIGRFAM: acetolactate synthase, small subunit; PFAM:
FT                   amino acid-binding ACT domain protein; KEGG: dar:Daro_3074
FT                   acetolactate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02205"
FT                   /db_xref="GOA:A1AW98"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:A1AW98"
FT                   /protein_id="ABL02205.1"
FT                   /translation="MRYIISVLLENEVGALSRVAGLFSARGFNIESFTVAATNDSTLSH
FT                   MTIVSIGNDGIIEQIVKQLNKLIDVVRVIDLTATEHIERELLLVKVDVNQQTQADIEKQ
FT                   IDAFSCKIVDVSEDIYIIELAGRSQKINDFLASLDVSKILEVSRTGVTGVCIKK"
FT   gene            488924..489928
FT                   /locus_tag="Rmag_0447"
FT   CDS_pept        488924..489928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0447"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="KEGG: tbd:Tbd_1989 acetohydroxy acid
FT                   isomeroreductase; TIGRFAM: ketol-acid reductoisomerase;
FT                   PFAM: acetohydroxy acid isomeroreductase; Acetohydroxy acid
FT                   isomeroreductase, catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02206"
FT                   /db_xref="GOA:A1AW99"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AW99"
FT                   /protein_id="ABL02206.1"
FT                   /translation="MNRYYDKNADLNIIKGMKVSIIGYGSQGHAHANNLKDSGVEVVVA
FT                   LRADSASTEKAFVAGLTVKSIEEATDWADLVMVLAPDEFQAKIYTNSIEPNLKQGATLA
FT                   FAHGFNIHYNRIIPRTDLDVIMIAPKAPGHTVRSEFVKGGGIPDLIAVFQDASGNAKAT
FT                   SLSYACAIGGGRTGILETSFKDETETDLFGEQVVLCGGTTALVQAGFETLVEAGYEPEM
FT                   AYFECLHELKLIVDLMYEGGIANMRYSISNTAEYGDVTRGPRIVTADTKTEMKKILSEI
FT                   QDGTFAKEFVANVDELPAHRDVQRKHQIEQVGESLRSMMPWINKNKIVDQSKN"
FT   gene            489981..490727
FT                   /locus_tag="Rmag_0448"
FT   CDS_pept        489981..490727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0448"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /note="KEGG: tcx:Tcr_0610 CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase; TIGRFAM:
FT                   CDP-diacylglycerol--serine O-phosphatidyltransferase; PFAM:
FT                   CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02207"
FT                   /db_xref="GOA:A1AWA0"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWA0"
FT                   /protein_id="ABL02207.1"
FT                   /translation="MERKAKRGIYLLPNILTTFGLFSGFFAIILATKGQYTDAAIAIFV
FT                   AMLWDGLDGRVARLTNTQSEFGAQYDSMADMISFVVAPALLIYFWLLSDLGKIGWLATF
FT                   VYVAAGALRLARFNTQIGIEDKRYFQGLPSPVAAALIAGLVWTFDVIGVTDYDQYLILA
FT                   SWIILVGSGVLMVSNIRYNNFKEVNLKGRSSFKLLLFTTLIIIVVTLEPSAILFVFFFV
FT                   YALSGLLTTIIEVRKRRHLKKRTKKG"
FT   gene            490882..492417
FT                   /locus_tag="Rmag_0449"
FT   CDS_pept        490882..492417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0449"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: mca:MCA2275 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02208"
FT                   /db_xref="GOA:A1AWA1"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWA1"
FT                   /protein_id="ABL02208.1"
FT                   /translation="MPNKLIIFDTTLRDGEQSPGASMTRDEKVRIAKVLEKMQVDVIEA
FT                   GFAIASVGDFEAVQTVANVVQDSIICSLSRALDKDIDCAGEALKGANASRIHTFIATSD
FT                   IHMKMKLQMTPDQVVEQAVRAVKRAKRYTNDVEFSPEDAGRSDEDFLCRIIEATINAGA
FT                   TTINIPDTVGYNIPHQFGVTIKSLIGRVPNSDKAIFSAHCHNDLGLAVANSLSAVLNGA
FT                   RQVECTINGLGERAGNTSLEELVMAVRTRQDIFDCDTDINATHILSASRLVSSVTGFIV
FT                   QPNKAIVGANAFAHEAGIHQDGVIKYRETYEIMRAEDVGWNANQLVLGKHSGRNAFKVR
FT                   LAELGVEFNNEEGLNDAFRRFKELADKKHEIFDEDLQALVSETQTEAYEAIKLVSLKVC
FT                   TETGEKNTATVVLSIDDKEQTATANTSGAVDATFIAISSLTGIKINLQLYSVSNVTQGT
FT                   DALGEVNVRLECNGRIVNGQGVDTDIITASAKAYVHGLNKVLAATNKAQHPQI"
FT   gene            492414..492833
FT                   /locus_tag="Rmag_0450"
FT   CDS_pept        492414..492833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02209"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWA2"
FT                   /protein_id="ABL02209.1"
FT                   /translation="MNASLRSHYLEVFGIPEFLHIQVKNQDLNVSKINTQCLAIETNPV
FT                   HSFCKIGKTQDFLFKMLGAIGLEKSNIRYVSANINDLNQMLKQYNAKIVLLMSSDLKSS
FT                   SYKHFVTHHPSEVLTNEQLKRETWEVLKRVKQYLK"
FT   gene            492865..493177
FT                   /pseudo
FT                   /locus_tag="Rmag_0451"
FT   gene            complement(493205..494104)
FT                   /locus_tag="Rmag_0452"
FT   CDS_pept        complement(493205..494104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0452"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="KEGG: tcx:Tcr_0532 ornithine carbamoyltransferase;
FT                   TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase, Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase,
FT                   carbamoyl-P binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02210"
FT                   /db_xref="GOA:A1AWA3"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWA3"
FT                   /protein_id="ABL02210.1"
FT                   /translation="MIKHFINLDDLPNHDLTQIIKQAIALKKQYKSGKINKILEHKTLA
FT                   MIFDKSSTRTRVSFEAGMTQLGGHALFLSDKDIQLGRGEPIIDSAIVISSMVDVIMMRI
FT                   SSHKDIHTFAENSSVPIINALSDESHPCQLLSDMMTYQEHNGSIANKTIAWIGDGNNMC
FT                   HTYMQAAKSFNFKLNIATPKNYQPDQDFIEKYANHIHLFTDAQKACQKVDLVVTDVWAS
FT                   MGQEAEQTKRKITFKDFSVNAALMSKAKPSAVFMHCLPAHRGEEVSTNVIDGSQSLVWL
FT                   EAENRLHVQKALLLYLLN"
FT   gene            complement(494117..495262)
FT                   /locus_tag="Rmag_0453"
FT   CDS_pept        complement(494117..495262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0453"
FT                   /product="acetylornithine aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.11"
FT                   /note="TIGRFAM: acetylornithine and succinylornithine
FT                   aminotransferases; PFAM: aminotransferase class-III; KEGG:
FT                   nmu:Nmul_A1041 acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02211"
FT                   /db_xref="GOA:A1AWA4"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWA4"
FT                   /protein_id="ABL02211.1"
FT                   /translation="MSNYMPLKVTFVKGRGCYLTDDKGRQYLDALCGVGVVGLGHCHQD
FT                   ITKAIQTQAANLLHTSNWYHIQHQEDLAEKLCQLSNMDAAFFANSGAEANEVAIKITRL
FT                   HAHSQHINNPTILTFNQSFHGRTMATLSATGNSKIQTGFEPLVSGFIHIDFNNINAIKV
FT                   HENNNNIVAIMLEPIQGEGGIIIPDEHYLNQVQEICFNNNWLLILDEVQTGIGRTGKLF
FT                   AHFYNNITPDLLTLAKGLGNGVPIGACLTKGKASKLLTPGTHGSTFGGNPLVCKTALTV
FT                   LDVIEKDNILDNVLMMGEYITSSFKNKLKDSDKVLEIRSKGLMIAIELNQDCSTLLQKA
FT                   LDNQLLINITGQSIRLLPPLIIDKSDADILIKKVSDLVNAL"
FT   gene            495702..495998
FT                   /locus_tag="Rmag_0454"
FT   CDS_pept        495702..495998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0454"
FT                   /product="SSU ribosomal protein S30P / sigma 54 modulation
FT                   protein"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   ilo:IL0395 S30EA ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02212"
FT                   /db_xref="GOA:A1AWA5"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWA5"
FT                   /protein_id="ABL02212.1"
FT                   /translation="MQLNISGHHLDITEAIKQYSLAKLFKIKHHFNQVININMILGVEK
FT                   DVQKAEAIIHVSGADLFAKAESSDMYNSIDQMVNKLDAQIRKYKEKLNYHRKN"
FT   gene            496056..497408
FT                   /locus_tag="Rmag_0455"
FT   CDS_pept        496056..497408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0455"
FT                   /product="magnesium transporter"
FT                   /note="TIGRFAM: magnesium transporter; PFAM: CBS domain
FT                   containing protein; MgtE integral membrane region; MgtE
FT                   intracellular region; KEGG: hch:HCH_05326 magnesium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02213"
FT                   /db_xref="GOA:A1AWA6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWA6"
FT                   /protein_id="ABL02213.1"
FT                   /translation="MSEVENTSFKNCLRRLMTSLEDLEYEEATSQLAALYPAEIARLLE
FT                   SVPPKGRTQLWLNIDSETQGDILKYLNENVQSKLLSEMNVDGIVKATEGLDMDDLADIV
FT                   PVLPESALHNLLLRLDYKHKNHLKQVLYYPENSAGGLMNIDIITVRSDVTVRTVIRYLR
FT                   LLKEMPIDTDQVFVVDRTYQYLGSIYISTLLTNEAEQNIDSLINKNLRPILATTNDNEV
FT                   ASLFEKRNLISAPVVDENNQLIGRITIDDVVDVIRDEAEHSVMSMAGLNEEEDVFAPVM
FT                   QSTKRRSIWLGVNLITVFIAVFFIGLFEATLQAKIALAILMPVVASMGGIAGTQTLILV
FT                   TRGIAMGRVTTSNLKVLMNKEVAIGFFNGIVWSLVISVATYVWFADLMLSLVIALAVIV
FT                   NLIFAAFSGAFLPLLLIKFKIDPALAGGVILTTITDVIGFVAFLGLAALVI"
FT   gene            complement(497533..498948)
FT                   /locus_tag="Rmag_0456"
FT   CDS_pept        complement(497533..498948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0456"
FT                   /product="phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase C
FT                   terminal; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III; KEGG: noc:Noc_2994
FT                   phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02214"
FT                   /db_xref="GOA:A1AWA7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWA7"
FT                   /protein_id="ABL02214.1"
FT                   /translation="MFKISLLLLRYSIKKMSISQSIFKAYDIRGIVKQDLSPKNVNLIG
FT                   LAIGSESIAKGERNVVVGRDGRLSGVDLMQALKVGLQESGCHIVDIGMVPTPLVYFATY
FT                   TKISTSGVMITGSHNSPEYNGFKIIIAGETLSSERIQALYQRIQISNFSSGHGTSIKMD
FT                   IEQDYIERITRDVKLDRSLSIIVDAGNGIAGNIAPKLFEQLGAKVTKLFCLVDGNFPNH
FT                   HPDPSKLHNLEDIIKKVKSTGADMGFAFDGDGDRLGLIDNKGNVIWADRQMMLYSRDIL
FT                   KRNQGAKIVFDVKCSSLLPKDIVQHGGKAIMSRTGHSFIKAKLKEINAALGGEMSGHIF
FT                   FKERWYGFDDALYTGSRLLEILSKTEKTCTEVFAELPDNINTPEINIHFDEQGQQFDAM
FT                   NKLAKNIDFPNAKITTIDGVRIDYKNSWGLVRPSNTTPCLVLRFEADDEKILKKIQEKF
FT                   KAWLKNNDILIDF"
FT   gene            498962..499339
FT                   /locus_tag="Rmag_0457"
FT   CDS_pept        498962..499339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0457"
FT                   /product="positive regulator of sigma(E), RseC/MucC"
FT                   /note="PFAM: Positive regulator of sigma(E), RseC/MucC;
FT                   KEGG: eca:ECA3281 sigma-E factor regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02215"
FT                   /db_xref="GOA:A1AWA8"
FT                   /db_xref="InterPro:IPR007359"
FT                   /db_xref="InterPro:IPR026268"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWA8"
FT                   /protein_id="ABL02215.1"
FT                   /translation="MKEQFEVIEIDNEIMTLKVNQTGGCHSCEASSGCGTGILANYFNQ
FT                   YSVFNKPYQNGVSVGDFVTLEISSSELFLRAFMLYIAPILTLFLGAAIGMAFFPQQEFW
FT                   HILFSGIGLIVMLFSCRWFFK"
FT   gene            499445..502096
FT                   /locus_tag="Rmag_0458"
FT   CDS_pept        499445..502096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0458"
FT                   /product="2-oxo-acid dehydrogenase E1 subunit, homodimeric
FT                   type"
FT                   /note="TIGRFAM: 2-oxo-acid dehydrogenase E1 subunit,
FT                   homodimeric type; KEGG: sde:Sde_2573 pyruvate dehydrogenase
FT                   E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02216"
FT                   /db_xref="GOA:A1AWA9"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWA9"
FT                   /protein_id="ABL02216.1"
FT                   /translation="MPGQDIDPLETQEWLEAFKSVARVEGDDRAKFLLNQLMDMAHHEG
FT                   MDLPTGVNTSYLNSISKEKEVATDINADIEERISAIIRWNAMVMVVKANQLPYDLGGHI
FT                   ASFASSATLYEVGFNHFYRGPDAEQGADLIFFQGHISPGIYSRAYLEGRLTEAQMLKFR
FT                   QEVGKEGLSSYPHPWLMPDFWQFPTVSMGLGPIMAIYQARFMKYLHHREIKQTNKRTVW
FT                   AYLGDGETDEPESLGAISMAGREKLDNLIFVINCNLQRLDGPVRGNGKIIQELEGMFRG
FT                   AGWNVIKVIWGGKWDALFAKDTQGLLKKRMEEVVDGEYQAYKAKDGAYVRKHFFGKYPE
FT                   LLAMVEHMSDDEIYHLNRGGHDPYKVFQAYHAAKACHDKPTVILAKTVKGYGMGEAGEG
FT                   QNTTHSQKKLGLKQVEIFAKRFDVPVTEEDVKALNFYKPAPDSEEMVYMRARREKLGGS
FT                   LPVRAFDLEQIKIPELSVFETLLKSSNNRKMSTTMALNRVMTLLVRDKQLGPKIVPIIP
FT                   DEARTFGMEGLFRQLGIYSASGQLYQPEDSDKVMWYKEDKKGQVLQEGINEAGAISNWI
FT                   AAATAYATHNTTMIPFYIYYSKFGFQRVGDLAWAAGDMQAKGFLIGGIAGRTTLNGEGL
FT                   QHQDGDSQLVANTIPNCVSYDPTYSYELTVIIRSGLYRMYEKHENIFYYITTMNELYTH
FT                   PEMPKNTEEGIIKGMYKLSVIGKSTTQVQLMGSGTILREVEKAAQMLADDWNVKSSIWS
FT                   VTSFNELTREAQAIDRVNRFNTTSIAQVPYITKCLENAKGPVIVATDYMRNFAEQVRKY
FT                   VPNRYEVLGTDGFGRSDSRAALREFFEVDARYVTIATLKSLVDEGEIEISIVAKAIEKY
FT                   KLNINKPNPMTV"
FT   gene            502167..502445
FT                   /pseudo
FT                   /locus_tag="Rmag_0459"
FT   gene            complement(502426..502749)
FT                   /locus_tag="Rmag_0460"
FT   CDS_pept        complement(502426..502749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02217"
FT                   /db_xref="GOA:A1AWB0"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWB0"
FT                   /protein_id="ABL02217.1"
FT                   /translation="MQLSGIILVLIGFGVYEYSGKVLWIKNNRIRKKLVHFEHAIETLN
FT                   NVAFRQTKKIDELEEILKHLSIKIRQSNNTQESRHKQPNNQTPHLTTYQLFEQWLLPIY
FT                   DST"
FT   gene            complement(503211..505298)
FT                   /locus_tag="Rmag_0461"
FT   CDS_pept        complement(503211..505298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0461"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="KEGG: hch:HCH_01244 polyribonucleotide
FT                   nucleotidyltransferase (polynucleotide phosphorylase);
FT                   PFAM: 3' exoribonuclease; RNA binding S1 domain protein;
FT                   KH, type 1, domain protein; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02218"
FT                   /db_xref="GOA:A1AWB1"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWB1"
FT                   /protein_id="ABL02218.1"
FT                   /translation="MGINTKSFVMGKHTITLETGRIARQAHGAVLVSMDDTQVLVTVVG
FT                   SKKMHPGQDFFPLSVDYIEKTYAAGKIPGGFLKREARPSEKETLTSRLIDRPIRPLFPN
FT                   GFMNEVQVLITVISANSEVDPDIISMLGVSAALSISGIPFNGPIGSARVGYSNGKYTLN
FT                   PTYTELVDSDLDMVVAGTDKAILMVESEASELSEKIILDAIIYAHEQYQVAITNIAEFV
FT                   TQVGVQKWDWEAPATNEVLLSNIKSQFGKQINEAYKIKEKLNRHVKVGEIKTAAIEALV
FT                   NEDKNGNSIDEVSKYFNKVEKSTVRERILNNDPRIDGRDNETVRELKIETGVLENTHGS
FT                   ALFTRGETQALVVTTLGSKREAQLIEKLESSERQNDYFLLHYNFPPYCVGEIGRVGTTK
FT                   RREIGHGRLVRRGIAACLPSIEEFPYTVRVVSEITESNGSSSMASICGASLSLMDAGVP
FT                   IKAPVAGIAMGLVKEGDRFTILTDILGDEDHLGDMDFKVAGTSRGINALQMDIKIQGIT
FT                   REIMEIALKQAKEARLNILGQMNQVICEPNTSNKNTPKTAVIKIQTDKIRDLIGKGGET
FT                   IKGIISTSSASVDVDDNGNVNIFSNDQKSFDTAMQMVKDVTTTPKIGKVYTGKVVKIVD
FT                   FGAFINIKPNQDGLLHISEIAHERVDKVENHLKEGDEIDVKVLSLDRGRIKLSRKVLLE
FT                   K"
FT   gene            complement(507070..508530)
FT                   /locus_tag="Rmag_0462"
FT   CDS_pept        complement(507070..508530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0462"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="KEGG: mca:MCA0291 inosine-5'-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: CBS domain containing protein; IMP
FT                   dehydrogenase/GMP reductase; 2-nitropropane dioxygenase,
FT                   NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02219"
FT                   /db_xref="GOA:A1AWB2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWB2"
FT                   /protein_id="ABL02219.1"
FT                   /translation="MNLLKTAYTFDDVLLAPAHSKTMPKEVGLTTQLTKNITLNIPILS
FT                   AAMDTVTESKLAITIAQEGGIGIIHKNMSVAEQANEVRRVKRFESGIIREPITISPKKT
FT                   ISDVLKMQQQHNISALPVLEGNIIVGLVTSRDVRFETRLGELVENVMTPQNKLITVQEG
FT                   TGMSEVRSLLQKYRIERVVITDHAFNLKGMINVSDIQKSTDFPNACKDSEERLRVGAAV
FT                   GVTIGTSERIDALVEAGVDVIVIDTAHGHSQGVLDRVVKTKRKHPNLSIIAGNIATGAA
FT                   ALDLVKVGADCVKVGIGPGSICTTRIVAGVGVPQISAISEVADALKGTGIPIIADGGIR
FT                   YSGDIAKAFAAGAYCVMLGSMLAGTEESPGEIELYQGRSYKSYRGMGSLGAMNQAHGSS
FT                   DRYFQSDFKADKLVPEGVEGRVPFKGSMRSIIHQMVGGVRSSMGYTGCDTLEKMRTNAQ
FT                   FVQVTSAGMVESHVHDVSITKEAPNYHQ"
FT   gene            complement(508530..509180)
FT                   /locus_tag="Rmag_0463"
FT   CDS_pept        complement(508530..509180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0463"
FT                   /product="SH3, type 3 domain protein"
FT                   /note="PFAM: SH3, type 3 domain protein; KEGG: tcx:Tcr_1504
FT                   SH3-like region"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02220"
FT                   /db_xref="GOA:A1AWB3"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR016476"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWB3"
FT                   /protein_id="ABL02220.1"
FT                   /translation="MNLIKHLLLTLILLCTLANARSFVYITDQVDIPMREDKTFGGNIL
FT                   RSLSSGSKLSILQATEDGWSQVKYENSTGWVISRYLSNNPPARVQLEKLRQRHNANQLL
FT                   TTKQSKRNTELEKQIKTLKNKNIKLSMQISKSQAEKQHIEQIYKDALKLEYSNEKLTTK
FT                   VLQLKAEIQLLESNSTATQDSSSRNWFIVGSLVLFFGIMIGFIFPNFVNRRRY"
FT   sig_peptide     complement(509118..509180)
FT                   /locus_tag="Rmag_0463"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.804 at
FT                   residue 21"
FT   gene            complement(509177..511924)
FT                   /locus_tag="Rmag_0464"
FT   CDS_pept        complement(509177..511924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0464"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="TIGRFAM: valyl-tRNA synthetase; KEGG: tcx:Tcr_1503
FT                   valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02221"
FT                   /db_xref="GOA:A1AWB4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWB4"
FT                   /protein_id="ABL02221.1"
FT                   /translation="MKKTYNPEQIEAKFRSLWEDKNLFSSDSNTTSKNAYCIMLPPPNV
FT                   TGSLHMGHAFQHTIMDILTRYHRVNGDQTLWQPGIDHAGIATQMVVERQLTMQDMTRHE
FT                   VGRDKFIDKIWDWKAKYGGTITSQMRRLGSSVDWKKERFTMDDDLSNAVKKVFIQLFEE
FT                   GLIYRGKRLVNWDPILHTAISDLEVISTEEQGSLWHMRYPVTNTGKVIVVATTRPETML
FT                   GDGAVAVHPDDKRYTHLIGKTIDLPLTNRKIPIIKDDYVDMEFGTGCVKITPAHDFNDF
FT                   EMGLRHHLEVINILTDDAKINNVVYSSYIGMDRFEARKQIIQDLDNQNLLEKIEPHKSI
FT                   IPRGDRTNAVIEPYLTNQWFVKIKPLAQPAIDAVKNGDIRFIPENWNKTYFNWMDNIQD
FT                   WCISRQIWWGHRIPAWYDDKGNIFVADSLEQAQKQAGEGVILIQDEDVLDTWFSSALWP
FT                   FSTLGWPKKTSDLSRFYPTDVLVTGFDIIFFWVARMIMFGLKFTGKIPFKDIYITGLIK
FT                   DGQGQKMSKFNGNVLDPIDLIDGITLRDLLKKRTQGLMQPKMVEKTKKQTKKEFSDGIP
FT                   AFGTDALRFTFAALASFGRDIKFNLKRVEGYRNFCNKLWNASRFVLMKLEGETIDINAQ
FT                   LSTADKWILSRLQNTKANVEKHLNDYRLDLMSQTLYEFVWHDYCNWYLELSKPLLQDDT
FT                   TKAGTRATLIKVLREIVTLLHPIIPFITEEIFEQCNIIANHDNISLMTQSYPKVINNLI
FT                   SVKAEVEIKWLQTFILGIRQIRGEMNIPPLKPLPCFVQNFNTTDKQYLANNINILNSLV
FT                   KMESIDKLTITEQAPESATALVGGMKIFIPLAGLINKNQEIARLNKEIDKLEKQKSQFE
FT                   GKLNNGNFIKGAPKTIINIEKKRLAITLSTINDFNNQLKKISNL"
FT   gene            511979..512170
FT                   /pseudo
FT                   /locus_tag="Rmag_0465"
FT   gene            complement(512915..514504)
FT                   /locus_tag="Rmag_0466"
FT   CDS_pept        complement(512915..514504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0466"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: neu:NE0433 DNA polymerase III (subunits tau
FT                   and gamma) protein; TIGRFAM: DNA polymerase III, subunits
FT                   gamma and tau; PFAM: AAA ATPase, central domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02222"
FT                   /db_xref="GOA:A1AWB5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWB5"
FT                   /protein_id="ABL02222.1"
FT                   /translation="MSEHYQVLARKYRPHSFVKLVGQTHTKKTLINALDANNLHHGFLF
FT                   TGTRGVGKTTIARILAKSINCEQGISSKPCDKCATCVEIDKGQSIDLIELDAASHTGVD
FT                   NMRDILENAQYMPSKNRYKIYLIDEVHMLSKNSFNALLKTLEEPPEHVKFLLVTTDPQK
FT                   LPVTVLSRCLQFTLQQLTHDEILEQLKFIMNAEVLSYEESALGQIADFGNGSMRDALSL
FT                   LDQSISYGKGTVTNADIKAMLGLVHHDDIIKLTTHLFSQDAKAVIDFIKDLSRRGENLS
FT                   NALKDLSSLFHKISISQIVNTESNKTIQNLSTQISNFDLQIFYQMSINGSKDMALAPSE
FT                   QIGFEMTLLRMLAFRSDTQPNTEKKMIEIKSEVKISAPIEEKLQPKVEEKPGITKPTIL
FT                   DINNQQQWETLIQTLEFKNGAQILVKNTLFDNTNNATLTLTLDNQFANLLSDQVQKSML
FT                   TTLRQKNSTLNLVINLGKPNAQTLAQKQTQAHNEKMAKIQTQFLNDKGVQKLEKIFDTK
FT                   ININSIKKINHV"
FT   gene            complement(514527..514641)
FT                   /gene="ffs"
FT                   /locus_tag="Rmag_R0020"
FT   misc_RNA        complement(514527..514641)
FT                   /gene="ffs"
FT                   /locus_tag="Rmag_R0020"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT   gene            complement(514646..515320)
FT                   /locus_tag="Rmag_0467"
FT   CDS_pept        complement(514646..515320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0467"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: pha:PSHAa2630
FT                   mannose-1-phosphate guanyltransferase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02223"
FT                   /db_xref="GOA:A1AWB6"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWB6"
FT                   /protein_id="ABL02223.1"
FT                   /translation="MFGMILAAGRGKRMMPLTKNIPKPLIKVRDLTLIEHSINALKNSG
FT                   ITKIVINISHLGEQIKSYLGNGSKFGVNIHYSDESKGALETAGGIIKALPLLGINPFVV
FT                   INSDVLCDYDLSTLTLPINSLAHLVLIDNPKHNPAGDFSLNNTQLILANTKTYTFSGIG
FT                   IYHPTLFKFYLFEKKLALSKVLKVAIAKNQISAEHYTGYWQDIGTPKRLELANKLVRLN
FT                   VK"
FT   gene            complement(515308..516252)
FT                   /locus_tag="Rmag_0468"
FT   CDS_pept        complement(515308..516252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0468"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   neu:NE0191 domain of unknown function DUF227"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02224"
FT                   /db_xref="GOA:A1AWB7"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWB7"
FT                   /protein_id="ABL02224.1"
FT                   /translation="MYDEHPDKLDIWLKNFFGHQNFEFTHASDDASFRRYFRVQYQQET
FT                   FIAMDALSLKENIGSFIKIAKLLNRHNIHAPKIISVDLKQGFLLLEDLGSTTFLQALNG
FT                   NFNLDLYKIAINELIKIQTINTKNLALKKYDKQLLNAEMQLLIDWYLPKILSSAHLQNL
FT                   QNIFRLLSDNALNSEQVFVHRDYHCRNLMALKDNDLGVIDFQDALIGSNTYDLCSLLKD
FT                   AYFELQPFELQALLQYYYNQANIDIEFLQFEKQFELMGLQRHLKILGIFKRLSIRDNKH
FT                   QYLNDLPLVKKYVQQIANKYPELAVLKELLCLV"
FT   gene            complement(516245..517078)
FT                   /locus_tag="Rmag_0469"
FT   CDS_pept        complement(516245..517078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0469"
FT                   /product="branched chain amino acid:
FT                   2-keto-4-methylthiobutyrate aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class IV; KEGG: noc:Noc_2631
FT                   D-alanine transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02225"
FT                   /db_xref="GOA:A1AWB8"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWB8"
FT                   /protein_id="ABL02225.1"
FT                   /translation="MIFLNNEFIEKNQAHISVMDRGFLFGDGVYEIIPVYNNKIFHLNA
FT                   HLLRLQASLDSVKIKNPYNLKEWYNILSKLLGFYDNKEQSIYLQISRGVSDKRKYSFND
FT                   LTPTVYIESNPLLTKTKQALKAGFSAITQPDIRWHRCDIKSTSLLANVMYLQQAKEKNV
FT                   EEIILYRDNQVTEGATSNVFIIKNNTLFTHPTSAHILSGITRDLVLKSARACHIPIKET
FT                   SFSMNELNIADELWISSSTREIMPITKVDGKLINRGNIGNIWNCIYDYYQSLKNV"
FT   gene            complement(517078..518205)
FT                   /locus_tag="Rmag_0470"
FT   CDS_pept        complement(517078..518205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0470"
FT                   /product="penicillin-binding protein 6, Serine peptidase,
FT                   MEROPS family S11"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: peptidase S11, D-alanyl-D-alanine
FT                   carboxypeptidase 1; Penicillin-binding protein 5 domain
FT                   protein; KEGG: lpf:lpl1517 D-alanyl-D-alanine
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02226"
FT                   /db_xref="GOA:A1AWB9"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWB9"
FT                   /protein_id="ABL02226.1"
FT                   /translation="MQYQLIIKPLVILISSLVLNTQAVIFITPKAPKISTAAYSIVDYN
FT                   SGKVIASSKQHDKRAPASLTKLMTAYVVFQFINDGRISLEDEVRISKKAWKTGGSKSFV
FT                   EVGKSIKLETLLKGMIIQSGNDSAVALAEHIAGTESTFTTYMNEYARQLGMNNSWFENA
FT                   SGLPNDNQYTTAADITLLAIATIRDFPKFYQWYSQKEFTYHGIKQRNRNKLLWSDHTVD
FT                   GLKTGFTKKAGYNLVASAKRAGMRLISVVLGSSSVNARTSQTQKILDYGFRFFETQTIK
FT                   DIKKEVPIASATKDTLKVGTSKVGSFTLVRGQFKLSDQVIQLDTALSAPIKKGDIVGKL
FT                   LIQFRGKTIVSIPLIALENIQQASFFSRMLGAIGF"
FT   gene            complement(519001..520140)
FT                   /locus_tag="Rmag_0471"
FT   CDS_pept        complement(519001..520140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0471"
FT                   /product="cell elongation-specific peptidoglycan
FT                   biosynthesis regulator RodA"
FT                   /note="TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein; KEGG: ppr:PBPRA2891 putative rod
FT                   shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02227"
FT                   /db_xref="GOA:A1AWC0"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWC0"
FT                   /protein_id="ABL02227.1"
FT                   /translation="MKLLSIAKIRHYWHYFKMDTPLFLLIIILSGFGLVVLYSASASSI
FT                   QTIYKQVFHFVLAISAMLVIAQIPPYQLRRLSPYLMLFGIFLLILVLVFGSSSGGAQRW
FT                   LNLGFIRFQPSEIMKVIVPIAIASILSEKTLPPKPLPIFLSIVAIILIVILIAKQPDLG
FT                   TSLLIGASGFYVLFFSGIHVQILKNNWLNFALISSIITSGAYVTWSYLLMDYQKKRILT
FT                   LIDPSSNPLGSGYHILQSKIAIGSGGLVGKGLEQGSQSQLNFLPEHATDFIFAVIAEEL
FT                   GFIGVIFLFILYGLIIYRLLVISFQSEDNFSKLLGASLTLIFFTYIFVNIGMVSGLLPV
FT                   VGVPLPLISYGGSSLITLMSSFGIVMAIRKHKTPRYLQN"
FT   sig_peptide     complement(520006..520140)
FT                   /locus_tag="Rmag_0471"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.954) with cleavage site probability 0.526 at
FT                   residue 45"
FT   gene            complement(520137..520499)
FT                   /locus_tag="Rmag_0472"
FT   CDS_pept        complement(520137..520499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0472"
FT                   /product="protein of unknown function DUF498"
FT                   /note="PFAM: protein of unknown function DUF498; KEGG:
FT                   cvi:CV0994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02228"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWC1"
FT                   /protein_id="ABL02228.1"
FT                   /translation="MEFNQQEASYNSIVSIEERYVKLAHAQFKIPCFISSRYYCEVDMA
FT                   HLDDIDKISLFPLSNQDDIDLLIIGTGATHQFLHPKQQEAIRQMGIGTESMNNKSACRS
FT                   FNLLLSDTRSVGLLLL"
FT   gene            520579..521028
FT                   /locus_tag="Rmag_0473"
FT   CDS_pept        520579..521028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0473"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: hit:NTHI1567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02229"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWC2"
FT                   /protein_id="ABL02229.1"
FT                   /translation="MSNLSNTDIYDADLSSGVTAFDTKNFTMAYQLLAPLATKGNTEAL
FT                   WRVGMMQMNGLGMVENQPLGFENFLQAASQGHAFAHHMLGVAYMTGEGVEKDIVKSIEW
FT                   FEKGAEFGIPGPMYALGMLFEDDKEVKQDLEKAKYWFDKADRVSP"
FT   gene            521034..522398
FT                   /locus_tag="Rmag_0474"
FT   CDS_pept        521034..522398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0474"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   glutamyl-tRNA synthetase, class Ic; KEGG: tcx:Tcr_1216
FT                   glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02230"
FT                   /db_xref="GOA:A1AWC3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWC3"
FT                   /protein_id="ABL02230.1"
FT                   /translation="MKSRFAPSPTGCLHIGGARTALFAWVWAKKQHGKFVLRIEDTDLE
FT                   RSNQASVDAILQGMNWLGLDYDEGPFYQTDRFNRYKQVVRQLLDEKKAYYCECSKERLQ
FT                   ILHEDLIKQGKKVRYDGCCRDKNLNDGVVRFNNPEDGLVIFNDVIKGQISINNKELDDL
FT                   IIVRSDGTPTYNLTVVVDDHDMQIDCVIRGDDHINNTPKQINLYQALGWHLPEFAHLPM
FT                   ILSSDGARLSKRHDAVSIMTYRDAGFLPEALLNYLARLGWSYGDQEIFSMDEIVKLFEL
FT                   KSINKAPASFNQDKLLWLNQKIIKNSSVENLLNNLTWHLQNQAITITNAPNIEAVVQYL
FT                   QNRCKTLVDMAGEVKMFYQDFDTFDEKLAKRYLKDKTPLKHLFAKLEALRIWKANNIKQ
FT                   AVKEVCFELNISFGKVGQPFRLALSGNGNAGSIDIVAELVGKNKALSRLKMAIDS"
FT   gene            522436..524955
FT                   /locus_tag="Rmag_0475"
FT   CDS_pept        522436..524955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0475"
FT                   /product="UTP-GlnB uridylyltransferase, GlnD"
FT                   /EC_number="2.7.7.59"
FT                   /note="KEGG: pae:PA3658 protein-PII uridylyltransferase;
FT                   TIGRFAM: protein-P-II uridylyltransferase; PFAM: amino
FT                   acid-binding ACT domain protein; DNA polymerase, beta
FT                   domain protein region; metal-dependent phosphohydrolase, HD
FT                   sub domain; GlnD PII-uridylyltransferase; SMART:
FT                   metal-dependent phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02231"
FT                   /db_xref="GOA:A1AWC4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWC4"
FT                   /protein_id="ABL02231.1"
FT                   /translation="MIDLSIFKTQYQALQDSIKVIFLNNPEVTQTLVLSRSEGIDQLLK
FT                   DIWQSLNLSNQLCLVAVGGYGRSELHPYSDIDLLILIPDDAHDTYQQSIASFLTFLWDV
FT                   NLEVGHATRDLKDCISVIDDISVVTSLLESRVILGKVSLFLKMKAVIKSSVWSNQSFLV
FT                   EKQKEQHNRHQNLSNTAYNLEPNIKQSPGGLRDIQTIVWVAKWYFDVNTLFELVDKQYL
FT                   TTTEYELLKISQLFLFKVRFALHIIANRREDRLAFQYQKSVATMLGYVDGDSLSVEAFM
FT                   KDYYQTVTRVSRLNDILLQLLEDEILNTQRLNSRFMISYGYIYSINDQVFIQTPSAFME
FT                   IFLLIAKHNYVRGISAKTLRQMQNSISLIDFHYYKKRKNNRLFIELLQQNQGVNKALKL
FT                   MNRYGILEHYIPTFGKIMGLMQYDLFHAYTVDQHTLFVIRNLRRFFVPEFAKEFALCSE
FT                   IAQGIQKPELLLLAGLFHDIAKGRDGEHAQLGAIDVREFCQHHQLKTSDTDLVSKLVEK
FT                   HLLMSAVAQKQDISDFEVIEHFAEQVVTIKFLEFLYLLTNADIRATKDDLWNSWKDSLL
FT                   KKLFYNTKKYLESNNDQRPSVDQRAQGIKQTIIKDSIAQGYQISDVERVLSALPKDYYV
FT                   RYEIDDILWHLSFAIKITSDKIIVSSKISQHNVVDIFVLCDDFKGLFFKLISILERLGL
FT                   DIVDAKILTTKNGRVYNTISVLQDAALKHININQEIKNDLDNFDVSIRTTHDIYTYRHF
FT                   DHKMKVSFNVNEQWNLTQLEINVIDKQGILSNIAYVFFELDISLINARIATMGERVEDV
FT                   FFISNAKNQPLSMVEQLALKEALEERL"
FT   gene            525051..525377
FT                   /locus_tag="Rmag_0476"
FT   CDS_pept        525051..525377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0476"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: ppr:PBPRA3541 putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02232"
FT                   /db_xref="GOA:A1AWC5"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWC5"
FT                   /protein_id="ABL02232.1"
FT                   /translation="MNDKIKVVTDASFEANVVNSSQVVLVDFWAEWCGSCKALMSVLDE
FT                   IADEYDGKVIITKINIDENDQTLLKYGIHGIPTMLLFSDGVVQATKMGALSKAELSTFI
FT                   DANI"
FT   gene            525485..526759
FT                   /locus_tag="Rmag_0477"
FT   CDS_pept        525485..526759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0477"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: vpa:VP3000 transcription termination factor
FT                   Rho; TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; Rho termination factor domain protein; Rho
FT                   termination factor, RNA-binding; Ribonuclease B, OB region
FT                   N-terminal domain; SMART: AAA ATPase; Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02233"
FT                   /db_xref="GOA:A1AWC6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWC6"
FT                   /protein_id="ABL02233.1"
FT                   /translation="MDTFMKLSELKKFSPEELLELAQSLGAENISRAKKQTLIFIILKA
FT                   KAANDEEILGDGILDVLQDGYGFLRSSDDSYTSGADDIYISPNQIRRFNLSIGDLVSGK
FT                   IRAPKKGEKYFALIKVLEVNGEDPNNVKNRVLFASPTPIHPNERLNLEIGNGGTEDITA
FT                   RVIDLVAPFGKGQRGLLVAPPKAGKTMIMQNIATSISVNHTECELIVLLIDERPEEVTE
FT                   MARTVRGEVIASTFDESAKRHVQVAEMVIQKAKRRAEQGKDVIILLDSITRLARAYNTI
FT                   APSSGKVLTGGVDANALQRPKRFFGAARNIENGGSITIIATALIDTGSKMDEVIYQEFK
FT                   GTGNMELHLEKRLSEKRIFPAININASGTRREELITNEKELQKIWILRKILHPMDTVEA
FT                   AEFLIDRLKLTKTNDEFFASMSQKK"
FT   gene            526972..528087
FT                   /locus_tag="Rmag_0478"
FT   CDS_pept        526972..528087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0478"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   mfa:Mfla_0221 permease YjgP/YjgQ"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02234"
FT                   /db_xref="GOA:A1AWC7"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWC7"
FT                   /protein_id="ABL02234.1"
FT                   /translation="MKLPPIVIRTFKLQNSILARYLMRNVSVLLSVVFIVISLVVFGNQ
FT                   LVLIIKETSKEGIPIADLLPLVGLNMIRDVVLILSLSLLLAIILSVSKLYKASEAIVMN
FT                   SLGLGDKHFMVFIQPLVIVIVIFIFILTTVVVPWSKQQRGLIMERSENTPEFSFIKKNE
FT                   FQEFKNNDIVFYASKVSDADNAKEQNMEEIFIYTLVNNEPVITLAKQAQKYTNFNTNSV
FT                   YLRLKNGTRYHGFPSNKNKKILNFKLYDLQIIDGKMQKSISTVTKVESKSTFELLFSNK
FT                   LTEIAEFQWRISQPLSILILSVLGVLLGKTSPRSGKNLGVLVGVVMFIVYNNVLLIAKS
FT                   TLERGESSPIVGLWWVHLVMLLLIFIFYKWN"
FT   sig_peptide     526972..527103
FT                   /locus_tag="Rmag_0478"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.974) with cleavage site probability 0.973 at
FT                   residue 44"
FT   gene            528138..528524
FT                   /locus_tag="Rmag_0479"
FT   CDS_pept        528138..528524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0479"
FT                   /product="GTP cyclohydrolase I"
FT                   /note="PFAM: GTP cyclohydrolase I; KEGG: mca:MCA2441
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02235"
FT                   /db_xref="GOA:A1AWC8"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWC8"
FT                   /protein_id="ABL02235.1"
FT                   /translation="MSYQPNKVLEVFDNPKIERDFIIQINMPEFTCLCPKTGQPDFATL
FT                   HFAYIADKACIELKSLKMYIWLYRNEGAFHEAVTNQILDDLVQVSNPRFIRLKAIFNIR
FT                   GGVYTTIITEHKQKNWTPKAKVDL"
FT   gene            528545..529684
FT                   /locus_tag="Rmag_0480"
FT   CDS_pept        528545..529684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0480"
FT                   /product="poly(A) polymerase"
FT                   /note="TIGRFAM: poly(A) polymerase; PFAM: Polynucleotide
FT                   adenylyltransferase region; KEGG: tcx:Tcr_1528 poly(A)
FT                   polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02236"
FT                   /db_xref="GOA:A1AWC9"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWC9"
FT                   /protein_id="ABL02236.1"
FT                   /translation="MKAIHQSIKFDKKLLDKDALRVINVINKAGFKAYLVGGCVRDLLL
FT                   NLKPKDFDIATNAKPEQVHKLFKRSRLIGRRFRLVHVVFSARKFIEVATFRSGKVQTAK
FT                   NGVVIRDNCYGNIEDDVVRRDFNINALYYDIKTQEIIDYVGGLEDIKAKEMHIIGNPGI
FT                   RFEQDPVRMIRAIRFQTKLEFQLSYEIKSAIFEQASLLGNISTVRLYEECIKLFHNEYG
FT                   FEVYERLEKYGLLKYLFKQTHKNEFIKKALLNTSDRIKKNQSVTPVFLFAVFLWRAYNE
FT                   RFIALKKKQSCSSLAMKQASEEVIINQIKQVSLPRWLSAIIKDIWLMQSRLEKMQPKKV
FT                   KVLLSNPRFRMAYDFLLLRSMSINPELVEAAKFWTKAQQ"
FT   gene            530326..530550
FT                   /locus_tag="Rmag_0481"
FT   CDS_pept        530326..530550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0481"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /note="TIGRFAM: exodeoxyribonuclease VII, small subunit;
FT                   PFAM: Exonuclease VII, small subunit; KEGG: psp:PSPPH_0601
FT                   exodeoxyribonuclease VII, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02237"
FT                   /db_xref="GOA:A1AWD0"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWD0"
FT                   /protein_id="ABL02237.1"
FT                   /translation="MAKKFDFNQGLIDLEKIVKTMESGDLSLENSLDYFSKGVALTKLC
FT                   QSALNEAEQKIFMLTEQDNYTNENPLKDL"
FT   gene            530600..531454
FT                   /locus_tag="Rmag_0482"
FT   CDS_pept        530600..531454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0482"
FT                   /product="farnesyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: pfo:Pfl_5006
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02238"
FT                   /db_xref="GOA:A1AWD1"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWD1"
FT                   /protein_id="ABL02238.1"
FT                   /translation="MDFNIYITRVNAKLDQHLSAQGSLAKAIRYSTLANGKRFRPILAY
FT                   CVANIFNTNLNLVDSSSCAVEFIHTYSLIHDDLPAMDDDDIRHNQPVCHKRFGEAQAIL
FT                   AGDGLQALAFEVLVNDDLISADIKIELLKSLTHASFEMVEGQAIDLSIIAKQVNIATLE
FT                   TMHRKKTGALLSCAVNLGAIVSKMCNNKDSVILNTFSKDIGLAYQIQDDVLDIETPDAL
FT                   LGKNQYSDECKDKPTYPSLLGLDKSKLTYKNLYKKASDDLGLLSVDATELQQLTANLQT
FT                   RLF"
FT   gene            complement(531451..532395)
FT                   /locus_tag="Rmag_0483"
FT   CDS_pept        complement(531451..532395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0483"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="KEGG: nme:NMB1916 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase III; TIGRFAM: 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III C terminal domain protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02239"
FT                   /db_xref="GOA:A1AWD2"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWD2"
FT                   /protein_id="ABL02239.1"
FT                   /translation="MNKFARIIGTGSYLPSTIVTNDDLSKTIDTTNEWIITRTGIKQRH
FT                   KVTNETTCNLAEKAANHALQMAGIDAKDLDLIILATTTPDKIFPATATMLQTAIGASCP
FT                   AFDLQSVCAGFIFALTTAEQYIKTGAANKVLVVGSETLSRIVNWNDRSTAVLFGDGAGA
FT                   VVLSGSNDTGILHSKLFSDGSYLSSLQVSNNYINEIGFIEMSGNEVFKIAVNRLSSLAE
FT                   DTLKEANLNSDKLDWMVPHQANIRIISAVIKRIKIPINKVIVTLENHGNTSAASIPLAL
FT                   DTAVRDGRIKKGDSLLFEGIGAGFSWGSILVQF"
FT   gene            complement(532388..533407)
FT                   /locus_tag="Rmag_0484"
FT   CDS_pept        complement(532388..533407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0484"
FT                   /product="phosphate:acyl-[acyl carrier protein]
FT                   acyltransferase"
FT                   /note="TIGRFAM: fatty acid/phospholipid synthesis protein
FT                   PlsX; PFAM: fatty acid synthesis plsX protein; KEGG:
FT                   tcx:Tcr_0709 fatty acid/phospholipid synthesis protein
FT                   PlsX"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02240"
FT                   /db_xref="GOA:A1AWD3"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWD3"
FT                   /protein_id="ABL02240.1"
FT                   /translation="MTIKVSIDASGGDYGISVTIKAGIKALDVFQDLYLYFVGDESSIK
FT                   AELNKHLSNTFSSRYTIIHASEVVLMNESPAIALRKKKDSSMRVAINLVKTLKVNACVS
FT                   AGNTGALMAISRFVLRTIKGIDRPAIMGRMPTMIGHTHMLDLGANVDSKPEALIEFATM
FT                   GSIAVKHIENIVSPTIGLLNIGEEDMKGSEKIKKTAELLKASNLNYVGFVEGDDIYKGT
FT                   VNLIVCDGFEGNIALKASEGVVLMMGYYLKQAFTRNLLTKLVALIATPVLRDFKSSLNP
FT                   GKYNGASLLGLQGIVVKSHGSANVDSFLAAITEAYVEAHAKISDKISLQISKELEHNE"
FT   gene            complement(533413..533610)
FT                   /locus_tag="Rmag_0485"
FT   CDS_pept        complement(533413..533610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0485"
FT                   /product="LSU ribosomal protein L32P"
FT                   /note="TIGRFAM: ribosomal protein L32; PFAM: ribosomal L32p
FT                   protein; KEGG: neu:NE1644 probable 50S ribosomal subunit
FT                   protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02241"
FT                   /db_xref="GOA:A1AWD4"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWD4"
FT                   /protein_id="ABL02241.1"
FT                   /translation="MAVQKSRKTPSKRGMRRSHNALTNPTLSEDQETGEIHLRHHITVD
FT                   GYYRGKKVIKKTQDIQEINA"
FT   gene            complement(533627..534127)
FT                   /locus_tag="Rmag_0486"
FT   CDS_pept        complement(533627..534127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0486"
FT                   /product="protein of unknown function DUF177"
FT                   /note="PFAM: protein of unknown function DUF177; KEGG:
FT                   yps:YPTB2476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02242"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="InterPro:IPR039255"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWD5"
FT                   /protein_id="ABL02242.1"
FT                   /translation="MQGIPDTIKLFNFSKKGLNFSHIYQVKDFPRMKKLLSNIDDEMKV
FT                   ELSFYIENNSIPCIEGVVKLNAMVNCQRCLNKVNLRLSPSFKLGFLKNEQQGETLDSSF
FT                   ETILNADEAFSTIEFITDEVLISIPMSPMHPHKCQSYQDKERIKQEKHNPFAILKQLKN
FT                   SHK"
FT   gene            complement(534851..535552)
FT                   /locus_tag="Rmag_0487"
FT   CDS_pept        complement(534851..535552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0487"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   mfa:Mfla_0642 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02243"
FT                   /db_xref="GOA:A1AWD6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWD6"
FT                   /protein_id="ABL02243.1"
FT                   /translation="MLFFRSLLYFLGSFITLIILATTTLILFFLPFKFRYAILSKWSMF
FT                   CLWWLAFTLDVKLQVIGKENIPSKPCVIISNHQSTWETLGFQQIFPPQTWVLKQILLWI
FT                   PFFGWGLALLKPIVINRDKKLKALKTIIKEGKARLKKGIFVVIFPEGTRQPYKKLGRYQ
FT                   NGAIAIAKKTSCNVIPVYHNAGAIWPKGSFIKTPGTITVIIGKPINIKEKSVKELTQNI
FT                   RNWTQKQSEKF"
FT   sig_peptide     complement(535487..535552)
FT                   /locus_tag="Rmag_0487"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.742) with cleavage site probability 0.710 at
FT                   residue 22"
FT   gene            535618..536253
FT                   /locus_tag="Rmag_0488"
FT   CDS_pept        535618..536253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0488"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /EC_number="3.1.3.18"
FT                   /note="KEGG: sde:Sde_2151 flagellar FliJ and related;
FT                   TIGRFAM: HAD-superfamily hydrolase, subfamily IA, variant
FT                   3; HAD-superfamily hydrolase, subfamily IA, variant 1;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02244"
FT                   /db_xref="GOA:A1AWD7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWD7"
FT                   /protein_id="ABL02244.1"
FT                   /translation="MSINTILFDLDGTLIDTAPDLAYALNMLLKYNGLSKKPYEKIKPL
FT                   ITLGCKELIKFGFDCDEFHPDFIDRHQKILNIYKNNISQFSKTFSGIDAFIKTIKTRQM
FT                   FWGVVTNKPENLTHLLLEKLDINPDVVVCGDILAFNKPHPAPLLYACAQLAINPNQCLF
FT                   VGDDKNDMLAGQNANIKTVAVTYGYSEVKRDWHYDYLINQAEELLALI"
FT   gene            536253..537389
FT                   /locus_tag="Rmag_0489"
FT   CDS_pept        536253..537389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0489"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   wsu:WS1465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02245"
FT                   /db_xref="GOA:A1AWD8"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWD8"
FT                   /protein_id="ABL02245.1"
FT                   /translation="MDILSLLLGLTIGVVVVYFYLNARLQTLKSDKIRLEVCLDEKIKS
FT                   YENQIDLINIAKVQISKDFKAIAGDILVKNRYDLSIKNSELLTPLQVQLKEFRDKIETI
FT                   TSEQIKERATLSVQIENLKKTSIEIQETTQNLTNALTYDNKQQGDWGEMILSSILSSSG
FT                   LREGYEFDVQKQFKNESGEILKPDVVLHLPEEKDIIVDSKVSLKAYNDYITNQSNKQLL
FT                   KAHVASIEAHINGISIKEYENLQDVLTLDFIFVFIPIESALLIALEKKPGLFTMALKKN
FT                   IVLVSPSTLMMSLKTVHHIWQTERQNQNSEEIARQAGAMYDKLFGFIQSMDDIEKHLDK
FT                   ASKSYKKARAKLSDGKGNLIGRAKKLKELGVQSKKKLN"
FT   gene            537389..538141
FT                   /locus_tag="Rmag_0490"
FT   CDS_pept        537389..538141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0490"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   vfi:VF1039 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02246"
FT                   /db_xref="GOA:A1AWD9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWD9"
FT                   /protein_id="ABL02246.1"
FT                   /translation="MEISTNYSITKGELRDKVILVTGANRGFGRAITLNLAKAGASVIM
FT                   LGRDLGSLESTYDEVLDLGYQEPILYPLDLEGATPEHYKQLQKDILDSFEQLDGLIHNA
FT                   SIIGTMMPIEQYDIKLWYSTMQINVNAPFMLTQALIPALNKSSDARILFLSSSVGRFAK
FT                   AYWGAYSVSKFAIEGMSKTLSEELEKTNIQVNSLNPGRMRTKMRQIAYPAENADNNPLP
FT                   EIKSPAIVYLMSKKAKKLNGKQLILSSV"
FT   gene            complement(538163..538963)
FT                   /locus_tag="Rmag_0491"
FT   CDS_pept        complement(538163..538963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0491"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: eba:ebA6410
FT                   inositol monophosphatase (extragenic suppressor protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02247"
FT                   /db_xref="GOA:A1AWE0"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWE0"
FT                   /protein_id="ABL02247.1"
FT                   /translation="MHPTLNITVKAARKAGDIILRYHNQIDLLTIENKAIHDFVSEVDK
FT                   AAEGAIIDELKYAFPNHSILGEENGEILSNNRFQWIIDPLDGTTNYLHGFPQYAVSIAL
FT                   YENNEPTHAVVYDPFKEELFTASKGEGAYLNEQRIRTTHTNGFENTLIGTGFPFKTPQY
FT                   LDAYLNMFKAIHPKVAGIRRAGSAALDLAYLAAGRLDGFWEIELNIWDIAAGVLLVKEA
FT                   GGFVGDFSGRDKYLKTGNVVAGNDQVFKAILKTIHPHLTADLQR"
FT   gene            538989..539720
FT                   /locus_tag="Rmag_0492"
FT   CDS_pept        538989..539720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0492"
FT                   /product="RNA methyltransferase, TrmH family, group 1"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   1; PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   tcx:Tcr_0615 RNA methyltransferase TrmH, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02248"
FT                   /db_xref="GOA:A1AWE1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWE1"
FT                   /protein_id="ABL02248.1"
FT                   /translation="MDYTFDNVRVVMVNTTEPGNIGAAARAMKNMSLSYLYLVNPKGYP
FT                   SAIATARASGADDVLSNAVVCESLKEALQGVYLVIGASARQRNIKWRQMDVVGACSEIQ
FT                   KTIMAESQKVAVIFGTERTGLTNEELDLCQILMTIPGNSHYFSLNVASAIQVFAYQNYV
FT                   YNTTIEFKKSTNKLANFDELENFYAHLAQVLEYIEYFEDKRPKALLMRRLRRFFTRAMP
FT                   EKEEVAIFRGIFRNIKPFKKL"
FT   gene            complement(539762..541612)
FT                   /locus_tag="Rmag_0493"
FT   CDS_pept        complement(539762..541612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0493"
FT                   /product="heat shock protein Hsp90"
FT                   /note="PFAM: heat shock protein Hsp90; ATP-binding region,
FT                   ATPase domain protein domain protein; KEGG: tcx:Tcr_1609
FT                   heat shock protein HSP90"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02249"
FT                   /db_xref="GOA:A1AWE2"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWE2"
FT                   /protein_id="ABL02249.1"
FT                   /translation="MAEKQIHTFQTEVSQLLDLMIHSLYSNKEIFLRELVSNSSDAVDK
FT                   LKFKSLSDDTLIEGKEELQIHINTNKDASTITITDNGIGMTEAEVNKNIGTIANSGTKK
FT                   FLKSLDEKQTKDSNLIGQFGVGFYSSFIVADKVELITRKAGSKSKKGTKWTSTGKGKYS
FT                   IERVNCLNFGTSVTLHIKKDEKEFLDDYRLRGIISKYSDHITVPIMMIKASEDGKDIEY
FT                   ERINKANAFWSQDKRDLKQENYDEFYKSLTYDFEAPLTQLHNRVEGNIDYTSLLFIPSK
FT                   APHDMWEPKRKGGIKLYAKRVFIMEDNEALMPLYLRFVKGVIDTADLPLNVSREILQGN
FT                   KVVDTIRKASVSRVLKELEKMAKNKPEDYEKFWQEFGMVMKEGVVEDFANKDKIAKLLR
FT                   FTTNKSESAAQTATLECYVKSMQKDQKAIYYITAETYEAAKGSPHLEIFNQKDIEVLLL
FT                   SDRVDEWMVNNFGKFEDVPLKSITKGDLEGLDSKEEKKAKEEVSKNFEKVIEKMQKILD
FT                   TQVKEIKVSSRLSDSPSCLVVDENEMGGNMERIMKSLGQDVPDTKPILEINPNHPLVKK
FT                   LKTKIDEDLVKVLFDQAVLSEGVQLKDPAEFVKRINKLIN"
FT   gene            541734..541964
FT                   /pseudo
FT                   /locus_tag="Rmag_0494"
FT   gene            541961..542497
FT                   /locus_tag="Rmag_0495"
FT   CDS_pept        541961..542497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0495"
FT                   /product="translation factor SUA5"
FT                   /note="PFAM: SUA5/yciO/yrdC, N-terminal domain; KEGG:
FT                   cps:CPS_0027 putative RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02250"
FT                   /db_xref="GOA:A1AWE3"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWE3"
FT                   /protein_id="ABL02250.1"
FT                   /translation="MNFQTRLAASFLKTGGVISNPTDTIQGMTCLPKFESSMARILQLK
FT                   RRSSAKGLILLASDMHYFIDYVEDIALLVDVVINVQPTTYLLKANEYTSELLTGSFDTI
FT                   ALRLTNNQLITDLCVATNSALVSSSANITNKRSAITMLDLKEFFNNKLDFIIPPKTYNT
FT                   QASKIIDLQTREKIR"
FT   gene            542494..543402
FT                   /locus_tag="Rmag_0496"
FT   CDS_pept        542494..543402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0496"
FT                   /product="coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="PFAM: coproporphyrinogen III oxidase; KEGG:
FT                   sde:Sde_0025 coproporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02251"
FT                   /db_xref="GOA:A1AWE4"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWE4"
FT                   /protein_id="ABL02251.1"
FT                   /translation="MIEEIKKYLLMLQFNICEQLEQVDDNAEFIKDVWEKPNNTGNGLT
FT                   KVLSNGAVFEQAGVNFSIIHGNDMPASATVLRPELSGRSFTALGVSLVVHPQNPYVPTS
FT                   HANVRFFFAEKEGETPIWWFGGGFDLTPYYGFDEDAIFWHQSAKQACDPFGKDVYSKYK
FT                   KWCDDYFYLKHRSEQRGIGGLFFDDLNEGSFDECFSFMKSVGDGYINAYRPIVERRKDT
FT                   PYTDHERQFQLYRRGRYVEFNLIYDRGTLFGLQTGGRSESILMSLPPLVRWEYRYEPDP
FT                   GSEEARLYTHFIQPQDWINIP"
FT   gene            543415..543639
FT                   /locus_tag="Rmag_0497"
FT   CDS_pept        543415..543639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0497"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: noc:Noc_2653
FT                   SirA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02252"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWE5"
FT                   /protein_id="ABL02252.1"
FT                   /translation="MKHNLDAKRLLCPMPVIRLSEMIEKIKNSDIIEILATDPGVLYDI
FT                   PAWCKVHGHRVISINEKTNEIILLVEKIG"
FT   gene            543750..545165
FT                   /locus_tag="Rmag_0498"
FT   CDS_pept        543750..545165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0498"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="KEGG: mca:MCA1677 glutamine synthetase, type I;
FT                   TIGRFAM: glutamine synthetase, type I; PFAM: glutamine
FT                   synthetase, catalytic region; glutamine synthetase,
FT                   beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02253"
FT                   /db_xref="GOA:A1AWE6"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWE6"
FT                   /protein_id="ABL02253.1"
FT                   /translation="MSAKNIMKMIEDKEVKFIDFRFTDTIGKEHHVSVPAHAVNAEKLE
FT                   EGQMFDGSSIAGWKPVNESDMIMMPDTLTAVMDPFTAESTLNITCDIIESNDMKGYEKD
FT                   PRFIAKKAEAYLNETGIGDAAYFGNEPEFFIFDSVKWDTGFGLGKAFYEIRSEEADWES
FT                   GSDLEGGNKGHRPRIKSGYFPVPPVDSLHDLRSQMCLAIEEMGVTTEVHHHEVGTAGQC
FT                   EIGALFNTLVKKADETQILKYCVHNVAHAYGKTTTFMPKPIAVDNGNGMHVHQSISKNG
FT                   KNLFDGDKYGNLSEMALYYIAGIIKHAQALNAFTNASTNSYKRLVPGFEAPEMLAYSAK
FT                   NRSAAIRIPFVSNPKGRRIEVRFPDPTANPYLAFSAMLMAGLDGIKNKTEPGKPGDKDL
FT                   YELTEKEKTAIPKVCGSLDQALEALNKDREFLKKGGVFTDNVIDSFIELKMTEVTALRA
FT                   SPHPVEFDMYYSV"
FT   gene            545262..546230
FT                   /locus_tag="Rmag_0499"
FT   CDS_pept        545262..546230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0499"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: ilo:IL1324 biotin synthase; TIGRFAM: biotin
FT                   synthase; PFAM: Radical SAM domain protein; biotin and
FT                   thiamin synthesis associated; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02254"
FT                   /db_xref="GOA:A1AWE7"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWE7"
FT                   /protein_id="ABL02254.1"
FT                   /translation="MEELRNDWTLKEVEILFSLPFNDLLFQAHRIHRQNFDPNQIQVSS
FT                   LLNIKTGACPEDCSYCSQSSKYDTGLEREKLMEIDLVLQQAKEAQDIGATRFCMGAAWR
FT                   NPTDKSLAKVILMIQGVKTMGMETCVTLGMLTQEQAFILKEAGLDYYNHNIDTSKEHYS
FT                   NVVTTRNFQDRLNTLESVQNANIHVCSGGILGLDESQTDRASMLRSLSNLRTHPDSVPF
FT                   NLLVPIPGTPFENIEPPTESEFVRTIAVARIMMPKSVVRLSAGRTKMGEAMQALCFFAG
FT                   ANSIFYGEQLLTTDNPNINSDKDLFARLGINQKKVNNLQSV"
FT   gene            complement(546193..547209)
FT                   /locus_tag="Rmag_0500"
FT   CDS_pept        complement(546193..547209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0500"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: pst:PSPTO4408
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase, family 28;
FT                   Glycosyltransferase 28, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02255"
FT                   /db_xref="GOA:A1AWE8"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWE8"
FT                   /protein_id="ABL02255.1"
FT                   /translation="MSKKILIMAGGTGGHIFPALAIANELKNHSTHIQWLGSNVGIENE
FT                   IVPKHNIKLHTVNSVGLRGKSVVSLIKALFLLSYATLQIMGIFLKFKPNIVLGMGGFTS
FT                   GIGGLVACIFRIPLVIHEQNSISGTTNKILNKIAKKTFQAFDDTFIKSATTSGNPIAFS
FT                   SVDKQTNNKKLNLLIIGGSLGSKPINDISTQLNININIWHQTGRLHFDAVKAQYKNNVV
FT                   KVTEFIKDMANAYAWADVVLCRAGAMTVSELMLSATPSILIPLPHAIDNHQFYNAKILA
FT                   DSNAGILIEQKDLTIELLEKTLLNINKNQIKQMSTNALKLAKPNAAKQIVNYLLSFD"
FT   sig_peptide     complement(547144..547209)
FT                   /locus_tag="Rmag_0500"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.530 at
FT                   residue 22"
FT   gene            complement(547202..548335)
FT                   /locus_tag="Rmag_0501"
FT   CDS_pept        complement(547202..548335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0501"
FT                   /product="cell division-specific peptidoglycan biosynthesis
FT                   regulator FtsW"
FT                   /note="PFAM: cell cycle protein; KEGG: lpp:lpp2668 cell
FT                   division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02256"
FT                   /db_xref="GOA:A1AWE9"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWE9"
FT                   /protein_id="ABL02256.1"
FT                   /translation="MFEKTGQLPDKNLLFAIFALLTFGWILSFSASLGHFNSYAYFIKQ
FT                   TVFIILGLSLGYTVLKIPLYFYKNHSKLFFIITLICLALVFLPEPIGKTVKGSTRWINF
FT                   VLFKFQPSEMMKLVMILFMAGFLVRQEKDLRKPYMGFIKTLIIIGSSSFLSLLEPDLGA
FT                   TFIISATAFAMLLTAGVYLKQLFIVGASVITIFITILFQIPNRVERLISFWREDLWLNE
FT                   SEKVWQTKQALIGIARGDWTGVGLGNGIQKYTKLPEPHTDMIFAIIGEEIGIIGMWFVL
FT                   FAFAYIVLKGFKIAKNALKNNRKYSSYVGFGICTWLSMQFSVNIAMNLGLIPPKGFTLP
FT                   LISYGGSSMIFTLISLAILLRIDMENRCEYSKQKHYV"
FT   sig_peptide     complement(548243..548335)
FT                   /locus_tag="Rmag_0501"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.726) with cleavage site probability 0.267 at
FT                   residue 31"
FT   gene            548464..550077
FT                   /locus_tag="Rmag_0502"
FT   CDS_pept        548464..550077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0502"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tcx:Tcr_1606 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02257"
FT                   /db_xref="GOA:A1AWF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWF0"
FT                   /protein_id="ABL02257.1"
FT                   /translation="MISTANITMQFGEKLLFENISIKFQGGNRYGLIGANGCGKSIFMK
FT                   ILTGELTPSNGTIHISNGERLGVLRQDQFAFENFRVIDMVIMGHSELWEIKKERDRIYA
FT                   LPEMSEKDGIKVAELEMQFAEMDGYMAESSASELLLGLDIPEEQHYGLMSEIAPGWKLR
FT                   ILLAQALFSNPEILLLDEPTNNLDINSIRWLEGVLKERKATMVIISHDRHFLNGVCTHM
FT                   SDLDYGALNIFPGNYDDFMIASTAIQEKMQTDNAKKEAKIKELKHFVSRFSANASKSKQ
FT                   ATSRLKQLDKIILDDIRPSSRISPYIIFNQETKLHRNVLEVEGLFKSFTLQGDTEKDNK
FT                   LEVLKDISFLFEVGDRIAIIGQNGIGKTTLLRTLVGEIKPDKGKIKWSENINIGYYAQD
FT                   HSKDFETDMNVLDWMSQFKSEKDNIQAMRAVLGKMLFGKEDIGKSIKSLSGGEKGRMLF
FT                   GKLMLQNPNVLVMDEPTNHLDMESIEALNLALDNYKGTLIFVSHDREFVSSLSTKVIEL
FT                   KEDSMHYYSGNYEDYLGNKK"
FT   gene            550733..551146
FT                   /pseudo
FT                   /locus_tag="Rmag_0503"
FT   gene            551174..551752
FT                   /locus_tag="Rmag_0504"
FT   CDS_pept        551174..551752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0504"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /note="TIGRFAM: riboflavin synthase, alpha subunit; PFAM:
FT                   Lumazine-binding protein; KEGG: tcx:Tcr_1399 riboflavin
FT                   synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02258"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWF1"
FT                   /protein_id="ABL02258.1"
FT                   /translation="MFTGIIQIVGKIKSIKAGVFCFEAQGSFFNEVKIGDSISVNGVCL
FT                   TAIEIGDDYFKADISQETFRYTIFNHLGINNSVNLEKALRLNQGIDGHLVSGHVDGIAK
FT                   VVDRFIEGESTRFKISTPKNLIKYISKKGSICINGVSLTVNNINDCVFDINIVPYTLKA
FT                   TTLGGLKINNEVNLEVDIIVRYLEQLLHH"
FT   gene            551762..552835
FT                   /locus_tag="Rmag_0505"
FT   CDS_pept        551762..552835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0505"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /EC_number="4.1.2.-"
FT                   /note="PFAM: 3,4-dihydroxy-2-butanone 4-phosphate synthase;
FT                   GTP cyclohydrolase II; KEGG: tcx:Tcr_1398
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02259"
FT                   /db_xref="GOA:A1AWF2"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWF2"
FT                   /protein_id="ABL02259.1"
FT                   /translation="MKSSIEEILKDYSQGKMIILMDDEDRENEGDLIIPATTVTKEDIN
FT                   FMATHGRGLICLTLTQERCKQLNLSLMVAQNNDTNGTNFTISIEAVEGVTTGISAADRA
FT                   KTILDAVAKDAKPDDIVQPGHIFPLMSQPGGVLIRAGHTEAGCDLARLAGLEPASVIVE
FT                   ILNEDGSMARRDDLEIFAKKHDIKLGTIEDLISYRVENEKTIERINEREFKTEFAIFRL
FT                   ISFLDSIHNETHLALIKGKISSNTDTCVRVHMEDAFKDVLQEKSNSFSVIAALKYIAKL
FT                   DSGVLLLLRMQTDQSILENIDNVNGNIRDDIKTYGVGAQILSDLGIKRMKILGSHRKLY
FT                   GLKGFGLEVTEYIDTSK"
FT   gene            552846..553349
FT                   /locus_tag="Rmag_0506"
FT   CDS_pept        552846..553349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0506"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="PFAM: 6,7-dimethyl-8-ribityllumazine synthase; KEGG:
FT                   fnu:FN1505 6,7-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02260"
FT                   /db_xref="GOA:A1AWF3"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWF3"
FT                   /protein_id="ABL02260.1"
FT                   /translation="MKFKFNKNGNNNFLAKAKVAIIVGYFYQDIGDKLLSAAQETLAKY
FT                   GINANNINVFYVPGAFEIPLLAKKLASQKLSNKNLYDGIVALGAIINGETPHFEFVCNE
FT                   CARGVSDVSYQYEIPTAFGILTTNNMEQTIGRAGGYKGNKGEKATMAMIEMLYLMQQVD
FT                   TQTF"
FT   gene            553352..553774
FT                   /locus_tag="Rmag_0507"
FT   CDS_pept        553352..553774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0507"
FT                   /product="NusB antitermination factor"
FT                   /note="TIGRFAM: transcription antitermination factor NusB;
FT                   PFAM: NusB/RsmB/TIM44; KEGG: yps:YPTB0936 transcription
FT                   termination; L factor"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02261"
FT                   /db_xref="GOA:A1AWF4"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWF4"
FT                   /protein_id="ABL02261.1"
FT                   /translation="MTFKTSKQRSRERVVQALYQYLVSGGEILQIEQQFLNQKQGKISK
FT                   AFFSNLFINILKNKSLLDEIIAPTINRETEQLGAVEHAILYLGAFELKFSPGVPYKIVI
FT                   NESLELAKLYGAEGAHKLINVSLDKLAQTLQPRIDE"
FT   gene            554198..554566
FT                   /locus_tag="Rmag_0508"
FT   CDS_pept        554198..554566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02262"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWF5"
FT                   /protein_id="ABL02262.1"
FT                   /translation="MKKIFTIVLLTSTLSANAFWSSNNTPWGNGYNNYNAYGYQEDNGI
FT                   FGYNPYDFWDPRWYAEEMGNMFDEFDNNGWNNNNYYGYGRNGYGRNGYGFAPNGYVNTP
FT                   WGPGVAPEMTMPVVPIAR"
FT   sig_peptide     554198..554254
FT                   /locus_tag="Rmag_0508"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.987 at
FT                   residue 19"
FT   gene            554952..555344
FT                   /locus_tag="Rmag_0509"
FT   CDS_pept        554952..555344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0509"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   rfr:Rfer_1209 histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02263"
FT                   /db_xref="GOA:A1AWF6"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWF6"
FT                   /protein_id="ABL02263.1"
FT                   /translation="MDINCLFCQLSEERIIGQCDLTITFLDSYPVSPGHTLIVPKRHVA
FT                   TYFDITEQEQNAIAKAIQKSKLILDEEFSPDGFNIGMNNGEVAGQSIMHLHVHMIPRYK
FT                   NDVKNPKGGVRWVISNKADYWSNSDK"
FT   gene            complement(555356..555847)
FT                   /locus_tag="Rmag_0510"
FT   CDS_pept        complement(555356..555847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0510"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: stt:t4237 single strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02264"
FT                   /db_xref="GOA:A1AWF7"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWF7"
FT                   /protein_id="ABL02264.1"
FT                   /translation="MAGINKVILVGNLGQDVELKYTSNGKAVTTLSVATSESWTDKNTG
FT                   QKVDKTEWHRVSLFGKLAEIASQYLHKGSKVYVEGNLRTRKWQDQTGTNRYTTEIVVGF
FT                   NGTLQMLDRHDNVDIGGGAPQTQQSASSTPVPQQQTATAPVLDPIAPVDNSEFDDDIPF
FT                   "
FT   gene            complement(555862..557037)
FT                   /locus_tag="Rmag_0511"
FT   CDS_pept        complement(555862..557037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0511"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   tcx:Tcr_0326 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02265"
FT                   /db_xref="GOA:A1AWF8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWF8"
FT                   /protein_id="ABL02265.1"
FT                   /translation="MNKQERAFAFKISLIMATRMLGLFMIFPIFSVYASEYTSTTPYLI
FT                   GLSIGIYGLTQALLQIPFGYLSDKYGRKPMLIIGLIIFFIGSVVAAKSTDIIGIVIGRA
FT                   LQGAGAISAVLMAFLADFVSENQHSKANAFVGVQIGIAFMLALLLGPIISSNLSISGLF
FT                   WVIALLSVIALIIVSTLPNAKPKEQYSLSIANIKKVINIDLLRLDFSVFALHLILTCAF
FT                   IAIPIFLRENNIVEIKDSWQMYLPIIILSFIGMLPMIILISKYQKIKPIFLSAIALLII
FT                   SQILFYQIQLTYTLFFILLTLFFIAFNTLEAILPSLIASSASSDKRGLAMGLYATSQFL
FT                   GAFVGGIVGGWIYNISNLNNVFLLTTFIAIIWWIIILITKQKIPIKQVTEN"
FT   sig_peptide     complement(556933..557037)
FT                   /locus_tag="Rmag_0511"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.988 at
FT                   residue 35"
FT   gene            complement(557062..557823)
FT                   /locus_tag="Rmag_0512"
FT   CDS_pept        complement(557062..557823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0512"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: noc:Noc_0716 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02266"
FT                   /db_xref="GOA:A1AWF9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWF9"
FT                   /protein_id="ABL02266.1"
FT                   /translation="MKKLFIILPFLTLLLNGCFWQEEAKRESITKGWLPKKFFAQAKEE
FT                   ASSGSTDKAIEIFEQLQAAYPGSKYALQSKLEIAYALYKSKDYNQAIDRLNSYIKLYPE
FT                   HFSTPYAYYLRGAVSQDKSRSFLDDYLTDSAQRDVNSVRDAFNYYLALIYKFPKTEYAE
FT                   EAKIHLVILRNILSRHELFVAIYYTKRGANIAAINRTKFIIEKYPNTPSVPAALHLMAY
FT                   NYDAISANILAKDARRVLKNSYPLYTPHYSL"
FT   gene            557921..560023
FT                   /locus_tag="Rmag_0513"
FT   CDS_pept        557921..560023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0513"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="KEGG: tcx:Tcr_2144 (p)ppGpp synthetase I (GTP
FT                   pyrophosphokinase), SpoT/RelA; TIGRFAM: RelA/SpoT family
FT                   protein; PFAM: amino acid-binding ACT domain protein; TGS
FT                   domain protein; metal-dependent phosphohydrolase, HD sub
FT                   domain; RelA/SpoT domain protein; SMART: metal-dependent
FT                   phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02267"
FT                   /db_xref="GOA:A1AWG0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWG0"
FT                   /protein_id="ABL02267.1"
FT                   /translation="MNLPDRRILISELCNTLENYMSKEQIEGVYQAYIVAATAHDGQYR
FT                   QSGEAYVFHPISVAMILAELKLDYYCIVAAILHDCIEDTSVTYEQIKRDFSDEIAHIVE
FT                   GVSKLTGLEFHSNTDKQAQNFRKLFLAMSDDMRVMIIKLADRLHNMRTLGFMRRDKQLR
FT                   IAKETVEIHAPIARRLGLNSIRVELDNLCFAIIYPFRNKVLVSQIKKQCGNRKKIISHI
FT                   QTEIKNRLDQEGIPNAKINGRRKQPCSIYKKMKIKHLKFSQVLDMYALRVIVADVAQCY
FT                   QVLGIIHNLYKPLPGKFKDYVALPKSNGYQSLHTVLFGPNKIFIEVQIRSSDMHFISEY
FT                   GIAAHWHYKSNSNHKLELADNWLGSLLDIQQNSGTSIDFLEKTKADLFPSEVFVFTPDG
FT                   DIIQLPYKSTMLDFAYMVHTSIGNHTLKAKVDQVNTSISTELKSGQTIEIITDDKATPR
FT                   SSWLQIAITVKARSSIKTYLKNESAAELIQLGEYLLTNALDYQNINTDGIDEIQWLACL
FT                   KALNCDSKEDMYMKIGLSEILVSVALNKLQGTNAKHVIQKISIHKAQGKAISFASCCHP
FT                   IPGDKVAGVLSTSKGMVVHRVICANLVRIKSKNAQWLNIDWQTDKDEEFKAMININVAN
FT                   NRGTLASIASIISKMNINIECLEIQEKDNSIKSLNMVISVTHITQLNEVFVQLKMLKFI
FT                   RDVSRV"
FT   gene            560102..560296
FT                   /locus_tag="Rmag_0514"
FT   CDS_pept        560102..560296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0514"
FT                   /product="protein of unknown function DUF528"
FT                   /note="PFAM: protein of unknown function DUF528; KEGG:
FT                   bur:Bcep18194_A5426 protein of unknown function DUF528"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02268"
FT                   /db_xref="GOA:A1AWG1"
FT                   /db_xref="InterPro:IPR007479"
FT                   /db_xref="InterPro:IPR036762"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWG1"
FT                   /protein_id="ABL02268.1"
FT                   /translation="MNWTDSLDIAIALDEIHPGINPSIVNFVNLKQMVIALDGFDGDEN
FT                   KSGEKILEAIQMNWIEERE"
FT   gene            560293..561567
FT                   /locus_tag="Rmag_0515"
FT   CDS_pept        560293..561567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0515"
FT                   /product="TolB, N-terminal domain protein"
FT                   /note="PFAM: TolB, N-terminal domain protein; WD40 domain
FT                   protein beta Propeller; KEGG: noc:Noc_0145 TolB"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02269"
FT                   /db_xref="GOA:A1AWG2"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWG2"
FT                   /protein_id="ABL02269.1"
FT                   /translation="MKQLLVLILSLYTTLAWTVLEVTILKQDENAFPIVISDFSVIGDA
FT                   NQGKIIAHVIRNNFNRSGEFSASSVNYVINNKPNFDKWKAKKIEAIVLGKLEKISKKVF
FT                   NVEIELLDVFSKKILYKDKFVVHNRGIRRIAHYLSDQIYHVLLGEKGSFDTRLAYISVT
FT                   NKGKGEREYRLEISDSDAQNPQTILKSKKPILSPVWSPDQNKIAYVSFKNARSEVFIQY
FT                   PFVRRKTQKLPYFDGIASAPSWHPNGKNLLLTLSKNGNKDIYSYQLSSKKLTRLTTDVG
FT                   IDTEASYSSEGDKIVFTSNRSGQVQVYIKDLKTNKINRATFKGRYNAKAVFSPDDKSLA
FT                   MVHRVGKDYRIALLDIATKNLTIMTNNQLDESPFFSPNGSMIIFATNKGSSSVLSVVSI
FT                   LGRQTFELASKAGEVREPNWSHYLK"
FT   sig_peptide     560293..560349
FT                   /locus_tag="Rmag_0515"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.658) with cleavage site probability 0.388 at
FT                   residue 19"
FT   gene            561578..562150
FT                   /locus_tag="Rmag_0516"
FT   CDS_pept        561578..562150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0516"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: noc:Noc_0146
FT                   OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02270"
FT                   /db_xref="GOA:A1AWG3"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWG3"
FT                   /protein_id="ABL02270.1"
FT                   /translation="MSKIIFLTTTIVLLSSCSSVDDLYKKVLFKPSVVVIEDRTENTQE
FT                   NVIEVDQSSFESQGFSRSSVDISSIVEPVVVADFRKTNVSFVLYFSYDDTEIDEDSTKQ
FT                   IVKHANFMRNNPELNLRLEGHTDERGTREYNLALGENRALSVKEILGLYDLSSRVKVIS
FT                   FGEEKPILQRHDEDVWQKNRRVEFIYQ"
FT   sig_peptide     561578..561640
FT                   /locus_tag="Rmag_0516"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.911 at
FT                   residue 21"
FT   gene            562157..562825
FT                   /locus_tag="Rmag_0517"
FT   CDS_pept        562157..562825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0517"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   psp:PSPPH_3765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02271"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWG4"
FT                   /protein_id="ABL02271.1"
FT                   /translation="MYYFGLITFLSIFAWQPVSAGINTDKMVMNHNQKIKRLMRKNKSL
FT                   LGKIELLEQQQKISTGKIKELFNLITYQKFSTTIGKTTLRVREYDQKAKRIYTQARSLL
FT                   VTDQYDQAIKLFKQYLATYPNNNYTSDVQYWLAKSYLAKDNFYNARNAFVAFQKQNPLH
FT                   YKFSNSLFELARVYIELNQQDKARSLLNTMLVKFPSHKIINRAKQLLSKIIISKPKINK
FT                   "
FT   sig_peptide     562157..562219
FT                   /locus_tag="Rmag_0517"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.893) with cleavage site probability 0.873 at
FT                   residue 21"
FT   gene            562828..564117
FT                   /locus_tag="Rmag_0518"
FT   CDS_pept        562828..564117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0518"
FT                   /product="Anthranilate synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="PFAM: Anthranilate synthase component I and
FT                   chorismate binding protein; Anthranilate synthase component
FT                   I domain protein; KEGG: tcx:Tcr_0715 anthranilate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02272"
FT                   /db_xref="GOA:A1AWG5"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWG5"
FT                   /protein_id="ABL02272.1"
FT                   /translation="MKVMPIPDVTLEALSYANPVRYPFLLESVKHNANNRFSILFAHPG
FT                   KQIVLNHLEEFNFLDELTVSIDTPFIHSDLPFTGGWFVYLSYELIGQIEPTLKQIMHTS
FT                   GQPITIAVQISTAIIIDHTSHKTYLLDQFDNQHRIEQVLADIGQLKAIPERKLVGTLFS
FT                   EKGSKFLSGVAKSREYIKAGDVFQVNLSRQWQYHLTNDIAPTQIYKALKKTNPAPFSVL
FT                   AQFQTFSIISSSPERLFSVDGNVIQTRPIAGTHPRGIGSEDKRLKQQLINHPKERAEHI
FT                   MLLDLERNDLGRVCEYGSIKVDEIMVLESYPFVHHIVSNIKGKIKPNTTIKHLISALFP
FT                   GGTITGCPKIRCMQIIQELEQMPRQAYTGSLGYISSNGKMDFNILIRTISKQDNLLTLR
FT                   AGAGIVFDSIAKQELQETKHKARGMLQIFT"
FT   gene            complement(564419..565042)
FT                   /locus_tag="Rmag_0519"
FT   CDS_pept        complement(564419..565042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0519"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   proteins; KEGG: cps:CPS_1844 conserved hypothetical protein
FT                   TIGR00427"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02273"
FT                   /db_xref="GOA:A1AWG6"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWG6"
FT                   /protein_id="ABL02273.1"
FT                   /translation="MNLLFEHAVTIFMAFFAIMNPIASTAVFAGLTRNMEKHEQTKVAI
FT                   KSLIITFVIILLFSVLGKSIFHLFGITLPALRIAGGILVFLVGYHMLQGNVSKLHTTQE
FT                   SNHSNVAVSPLAVPLLAGPGTIATAMNYSAAEGWGETSVTISVFAFLCLITFFCFIFSS
FT                   KILLIIGRDGLGIVTRLMGLILAVIGVQMLIVGIDGAIYISTVN"
FT   sig_peptide     complement(564953..565042)
FT                   /locus_tag="Rmag_0519"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.922) with cleavage site probability 0.746 at
FT                   residue 30"
FT   gene            complement(565433..567313)
FT                   /locus_tag="Rmag_0520"
FT   CDS_pept        complement(565433..567313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0520"
FT                   /product="NAD+ synthetase"
FT                   /EC_number="6.3.5.1"
FT                   /note="KEGG: tcx:Tcr_1372 NAD+ synthetase; TIGRFAM: NAD+
FT                   synthetase; PFAM: Nitrilase/cyanide hydratase and
FT                   apolipoprotein N-acyltransferase; NAD+ synthase; ExsB
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02274"
FT                   /db_xref="GOA:A1AWG7"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWG7"
FT                   /protein_id="ABL02274.1"
FT                   /translation="MTNKTKDYLSKVRNKTGFSDYKISQKYSINQSNLSKYKSGKAALS
FT                   ETHAWLFANILNINPAEVVAHTKLEHAKITGSKSKTIFWKEQLEKLANNSKSIKIDIAQ
FT                   INPIVGDLDGNTQKIIKLTKEAHIRGCDLLVFPELSLIGYPPEDLLLREEFIQQVQDKV
FT                   TLISQTISEDISIIFGAPSKKNDVLYNGAYLVQNSKLWVYHKQNLPNYGVFDEKRYFEP
FT                   GHKAFIFECQGKRIGLVICEDAWTPKIISTTANQGAQIIISINASPFQVGKHSQRIEQI
FT                   KQRVLTTKTNFIYVNMVGAQDELVFDGASFVMNSNADITLQLPLFKEKIQSVSFTSPTT
FT                   LPDTDPIEKTIYNALVLATKDYIEKNGVFNGVVMGLSGGIDSALTLAIAADAIGTRNIK
FT                   AIMMFYEYTSSMSLEDAKIQATAMNIDYHEISIHTIVDSFNTQLNILFNGMKADTTEEN
FT                   LQARIRGTLLMAISNKLGKIVLTTSNKSEMAVGYATLYGDMSGGFAPLKDVSKTLVYQL
FT                   AKYRNTLSTIIPKRVIDRAPSAELTPNQIDQDSLPPYDELDAILELFIEQRYSVERIIK
FT                   QGFNEQTVKRIIQMVLNNEYKRRQSAPGPKISQNAFGKERRYPITSKFQP"
FT   gene            567633..568058
FT                   /locus_tag="Rmag_0521"
FT   CDS_pept        567633..568058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0521"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1900 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02275"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWG8"
FT                   /protein_id="ABL02275.1"
FT                   /translation="MGLFSKHKKKRKFDKNQDWSKGFKRNNTFKNIVKQQGLNFKENID
FT                   IDSDLYVSCTKKGLSCNYAEISSDQIKILKQCSIESSADELMKILKRTHKTRFKNDILN
FT                   PLLEYGFFERTIPEKPKSPKQKYRLTKQFVNVIKITN"
FT   gene            568082..569077
FT                   /locus_tag="Rmag_0522"
FT   CDS_pept        568082..569077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0522"
FT                   /product="Ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="PFAM: ferrochelatase; KEGG: tcx:Tcr_1864
FT                   ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02276"
FT                   /db_xref="GOA:A1AWG9"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWG9"
FT                   /protein_id="ABL02276.1"
FT                   /translation="MLALYDLMKIGILLTNLGTPDAPTKAALRRFLSEFLSDPRVIDPP
FT                   NKLIWWLALNVVILNIRPKRLAKNYAKIWNKIGIGSPLLSITKLQLEGVKKILLEQHEN
FT                   LVFEMGMRYGNPSISSALDKLRAKGCEKIIVLPLYPQYSNTTTLSTLDAINQTLDSWVQ
FT                   KPEIAFIEHYYDNNGYLQSLTNSVLEHQTKHGKPDKLMISFHGIPQRYVDNGDVYYDHC
FT                   VSTAKLLAKKLDLDESDYLFSFQSIFGREPWTKPQTKERLKTLAGDGVVHIQVICPGFL
FT                   ADCLETLEEIECENRNYFIQAGGRQFSYISALNDRDDHIKMLIDLISTHL"
FT   gene            569353..571626
FT                   /locus_tag="Rmag_0523"
FT   CDS_pept        569353..571626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0523"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="KEGG: eca:ECA1199 ribonucleoside-diphosphate
FT                   reductase 1 alpha chain; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase, alpha subunit; PFAM:
FT                   ribonucleotide reductase large subunit; ATP-cone domain
FT                   protein; Ribonucleotide reductase large subunit, N terminal
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02277"
FT                   /db_xref="GOA:A1AWH0"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWH0"
FT                   /protein_id="ABL02277.1"
FT                   /translation="MNQDIKVIKRNGQQESIDMEKIHRVVHWASQDLKGVSVSQVEINA
FT                   QLAFFDGIKTEDIHETIIKSAADLISIEVPDYQYLAARLTIFHLRKKAFKSFTPTPLFE
FT                   HIKKFTDLSIYDKEILNKYSKEEIETLGAYIDHWRDMNFSYAAVKQLEGKYLVQNRVTG
FT                   EIYESPQLLYVLIGMYLFQEYEASIRMDIVKRFYDAVSLFKISLPTPIMAGVRTPIRQF
FT                   SSCVLIEVDDDLDSISAGAGAIVKYVSQRAGIGINGGKIRAIGSPIRGGEAIHTGCIPF
FT                   YKHFHTAVKSCSQGGVRGGAATLFYPLWHLEVESLLVLKNNTGTDENRIRHLDYGVQFN
FT                   GLMYQRFLKDDDITLFSPHDVPGLYDAFFANQEEFKRLYEQYEQNDSIRKQAIKARELF
FT                   AKFMQERANTGRIYLQNVDHCNTHSAFDAKQAPIKQSNLCMEITLPTKPLYSVQDEQGE
FT                   VALCTLSAVNLGALDSLNEMEALTDIIVRSLDCLLDYQDYPIKAAELSSKSRRTLGIGV
FT                   TNLAYYLAKNGVKYSDGSGNQLIHKTFEALQYYSLKASNTLAKELGVCPLFSQTQYSQG
FT                   IMPIDSYKKDIDAFCDCKLELDWDTLRQNIKSTGLRNSTLTALMPCESSSQISNSTNGI
FT                   EPPRGFVSIKQSKDGILKQIVPEYERLKNQYELLWDIKDNEGYLQLCGIMQKFVDQSIS
FT                   TNMHYDPSQFEGNRVPMKLFLMDLFRAYKYGIKTLYYHTTRDGGDDWQEKEEDNACADG
FT                   VCKL"
FT   gene            571709..572845
FT                   /locus_tag="Rmag_0524"
FT   CDS_pept        571709..572845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0524"
FT                   /product="ribonucleoside-diphosphate reductase class Ia
FT                   beta subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="PFAM: ribonucleotide reductase; KEGG: eca:ECA1198
FT                   ribonucleoside-diphosphate reductase 1 beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02278"
FT                   /db_xref="GOA:A1AWH1"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWH1"
FT                   /protein_id="ABL02278.1"
FT                   /translation="MSYSIFNKKISNTLIQPMFFGDSMNVTRFDKQKFEIFEKLTEKQL
FT                   SFFWRPEEIDVSKDKIDFSKLLPNEKHIFVSNLQYQILLDSVQGRAPNIAFLPIVSLPE
FT                   VENWIETWSFSETIHSRSYTHIIRAIINEPGVIFDDIMKTDEIIQRAESASKHYDGLIK
FT                   YTQAYLLHGTGKLKIQEEEVSIDLYCLKKQLYLTIMSVNILEAVRFYVSFACSFAFAER
FT                   KVMEGNAKIIKMIARDEALHLTGTQHMLNLMSSGKDDLDMQKISKECQDEVITMFREAC
FT                   EQEKDWAEYLFRDGSMIGLNAQILKQYLEYITNVRMKALNLSLIFDECTNPLPWINHWL
FT                   DSDNVQVAPQETEITSYLVSAIDNTLDEQDSDFNDFEL"
FT   gene            572854..573117
FT                   /locus_tag="Rmag_0525"
FT   CDS_pept        572854..573117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0525"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: sgl:SG1586 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02279"
FT                   /db_xref="GOA:A1AWH2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWH2"
FT                   /protein_id="ABL02279.1"
FT                   /translation="MFRIEVDNINSKTESLYVYGDRSILTELEQHNVFINHSCRQGYCG
FT                   SCILQLLFGDVIHQDSFIPLSKGEILACRAIPVTNIKIGSRD"
FT   gene            complement(573467..574141)
FT                   /locus_tag="Rmag_0526"
FT   CDS_pept        complement(573467..574141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0526"
FT                   /product="putative dUTPase"
FT                   /note="KEGG: tdn:Tmden_0484 putative dUTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02280"
FT                   /db_xref="InterPro:IPR014871"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWH3"
FT                   /protein_id="ABL02280.1"
FT                   /translation="MNQIKQMFELQKQLNNNINGPEWSSGITKDGRYISWLRCIYMEAT
FT                   EAIDSFNWKHWKDIERAHDLDNAKVELVDIWHFIMSEAIHFGDTQFAQNYENIKPEREA
FT                   NPELVIEILEKLVAAASGANVDKSKNTLYEITGLFFKALATMSMDVPELYKRYLVKNQL
FT                   NTFRQKHGYKEGIYIKNWGTMEDNVIAFRIMKEHPDLMPEQLYKELEKEYNLVINPCLI
FT                   SG"
FT   gene            complement(574556..575143)
FT                   /locus_tag="Rmag_0527"
FT   CDS_pept        complement(574556..575143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0527"
FT                   /product="RNAse T"
FT                   /EC_number="3.1.13.-"
FT                   /note="KEGG: vpa:VP2114 ribonuclease T; TIGRFAM:
FT                   ribonuclease T; PFAM: Exonuclease, RNase T and DNA
FT                   polymerase III; SMART: Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02281"
FT                   /db_xref="GOA:A1AWH4"
FT                   /db_xref="InterPro:IPR005987"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWH4"
FT                   /protein_id="ABL02281.1"
FT                   /translation="MLIKDRIRGYLPVVIDTETGGFNEKTDAMLEICAIVIGIDKMNNL
FT                   YPKGSQHFHIEPFKGGMLESSALKFNGIDVDNPFRMAVKEIDAIKQIYTKVYAELKQES
FT                   CTRAILVGHNAFFDLGFLHAATDRCKLKSPFHQFSTLDTVSLSALHYGETVLAKAMRKA
FT                   NIEWDDSCAHSALYDTQKTAELFCKIFNTKPI"
FT   gene            complement(575133..575555)
FT                   /locus_tag="Rmag_0528"
FT   CDS_pept        complement(575133..575555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0528"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   reu:Reut_A2066 amino-acid N-acetyltransferase (ArgA)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02282"
FT                   /db_xref="GOA:A1AWH5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWH5"
FT                   /protein_id="ABL02282.1"
FT                   /translation="MIKAEQIFTLVKPFVEEGKILPRTKAQINENIGDFVYLIDDNQLL
FT                   ACAGLKNCKEDVGEIYSLAVSKKSQKIGLSLKLLNKIMKKAKAEKFSKVFALTKYGTDW
FT                   FIKNGFIQMKITDLPKKRQVLFNQDRNSSIFFKDVN"
FT   gene            575616..577295
FT                   /locus_tag="Rmag_0529"
FT   CDS_pept        575616..577295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0529"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: mca:MCA2082 dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02283"
FT                   /db_xref="GOA:A1AWH6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWH6"
FT                   /protein_id="ABL02283.1"
FT                   /translation="MRRKIMYNPRKYSSQVVDGFERAPSRAMLYPVGFTKEDFNKPQVG
FT                   IASTWSMVTPCNMHINKLADETLKGVNATGGKAIIFNTITISDGISMGSEGMKYSLVSR
FT                   EVIADSIETVVGCQGFDGVVAIGGCDKNMPGCIIGLVRLNRPSIFVYGGTIQPGKNHTD
FT                   VVSVFEAVGQFANHTIDAIELENIEKIAIPGPGSCGGMYTANTMASAIEALGMSLPNSS
FT                   AQDAISDDKNNDCVQAGQAVLNLLNKDIKPRDIMTMKAFENAITVIIALGGSTNAVLHL
FT                   IAMASAAEVNLKIDDFTRIGQKVPVIADLKPSGKYMMSELVKIGGTLPLMKMLLDAGLL
FT                   HGDCLTVTGKTLAENLENVKPYADSQEIIRALDNPIKKDSHLRILRGNLATDGAVAKIT
FT                   GKEGLSFKGNAKCFSREEDALEAILNNQIITGDVIVIRYEGPVGGPGMREMLAPTSAVM
FT                   GKGLGDKVALITDGRFSGGTHGFVVGHITPEAFEGGVLAVVKDGDEILIDAQNNVLELL
FT                   VEQAIIDKRLYNWTQPKPNYTKGVLAKFAKLAKSASEGAVTD"
FT   gene            complement(577629..579746)
FT                   /locus_tag="Rmag_0530"
FT   CDS_pept        complement(577629..579746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0530"
FT                   /product="RNAse R"
FT                   /EC_number="3.1.-.-"
FT                   /note="KEGG: mfa:Mfla_1626 ribonuclease R; TIGRFAM: VacB
FT                   and RNase II family 3'-5' exoribonucleases; ribonuclease R;
FT                   PFAM: ribonuclease II; RNA binding S1 domain protein;
FT                   Ribonuclease B, OB region N-terminal domain; SMART: Cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02284"
FT                   /db_xref="GOA:A1AWH7"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWH7"
FT                   /protein_id="ABL02284.1"
FT                   /translation="MSDPYYKRESKKYNKPIPSRGYILSFFEKKSHKLHELCNLLSIDH
FT                   HQKKPLTHRLRAMVRDQQLNCDQRGVYHKFSEKNWVMTGTVIANPKGFGFITLDKGGKD
FT                   LRLSSKQMQLVFHGDRVKVRLLNQRGDTQIIKVIKSIETVVGRLHLEKDGAYVVVDDKR
FT                   IKHNISISKINREHLDEQIVIVKITKSPTLKSLAVGEIVQILGSYMDEGVETDSALYRN
FT                   GIPVDFSPEALIQTDKLPSIVTDSDKKGRIDITKMKLVTIDDEDSRDFDDAVYAQTTSK
FT                   GWKLVVSIADVSHYVKEGLYLDKDATDRGNSVYFPHHVVPMLPEVLSNGLCSINPDVER
FT                   LCMTCEMNIDTHGNLLDYKFYPAVMLSHARLTYTKVSQILEHHDVDLTQQYASVMDNLN
FT                   TLYDLYKALKYAKIKRGVMDFDRIESQILFNDNGKIDNIIARSRNDAHKLIEECMLMAN
FT                   QASAKFLNHHNEDFLYRIHPKPTVEKVEVTRQFLTAIGLTLEGGTQPDSKDFAKVLASA
FT                   KGRDDETIIKTVVLRTMKQAVYTPVNEGHFGLAFENYTHFTSPIRRYPDLLVHRAIKRV
FT                   LDKKSRKPSKKMLEIGAHLSMTERRADDASRDVEQWLKCEYMRDKIGNTFNGVISGVAS
FT                   FGIFIELTDVFVEGMIAIRDMKDDYYIFDDIHHQLKGERTGKIYQLGNTIKIQVASVNL
FT                   DDRQMAFVPTK"
FT   gene            complement(579751..581067)
FT                   /locus_tag="Rmag_0531"
FT   CDS_pept        complement(579751..581067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0531"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG:
FT                   pha:PSHAa0275 adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02285"
FT                   /db_xref="GOA:A1AWH8"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWH8"
FT                   /protein_id="ABL02285.1"
FT                   /translation="MSKNVVIIGTQWGDEGKGKVVDLITDKVASVVRFQGGHNAGHTLV
FT                   INGKTTILHLIPSGILRNHVECLIGHGVVLSMSALLKEIAELEVADIDTTKRLKISPGC
FT                   PLILPYHIELDNAREIKRGKAAIGTTGNGIGPAYEDKVARRGLRVSDLLDPNLFASKLK
FT                   EVMEYHNFFLTHYYNANPVDYQTTLDEVLSQVEQTKHMIVDVTEQIHQHIANDENILFE
FT                   GAQGALLDIDQGTYPFVTSSNTTSGAAVTGSGIGVTDIDYVLGIVKAYTTRVGGGPFPT
FT                   ELIYDVALDKGDEIGKVLGTVGHEFGATTGRQRRCGWLDMVTLKRSFNLNAVTGICLTK
FT                   LDVMDTLETIKICTSYEIDGVETTIPPFSAEDYAKAKPIYIKIPGWKTSTIGTDSFDSL
FT                   PVEAQSYIRKIEQLANLPVDILSTGPDRLQTLILKHPFE"
FT   gene            complement(581125..582081)
FT                   /locus_tag="Rmag_0532"
FT   CDS_pept        complement(581125..582081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0532"
FT                   /product="ATP phosphoribosyltransferase regulatory subunit"
FT                   /note="KEGG: tbd:Tbd_0606 ATP phosphoribosyltransferase
FT                   regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02286"
FT                   /db_xref="GOA:A1AWH9"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWH9"
FT                   /protein_id="ABL02286.1"
FT                   /translation="MGAWQLPEGIDELTDDQALVFESLRRQLLDLYADKGFGLVIPPMV
FT                   EHVNSLLLTSDTIDEKTFKLLDPISGKMLGVHADITPQIARIDAKRGSDLVEKYCYINS
FT                   ILKTKADDFYASRSPIQAGAELYGSDKISADVEVIGLMLKSLKLLSISPIVLSLGNVTI
FT                   FDALIAQENISIQTVAQLRTIFSCRSTPDLAVFLNKNALKNADLFIRLIKLEGKSDILS
FT                   EALTIFSHLNQAKVAIEDLIAIDKQLNTKGIKAIFDLSELQIHEYYTGIVFSAYNENYS
FT                   KALAQGGRYNGIGKSFGKSRAATGFSFDLKFLSQNHF"
FT   gene            complement(582087..582944)
FT                   /locus_tag="Rmag_0533"
FT   CDS_pept        complement(582087..582944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0533"
FT                   /product="protease FtsH subunit HflC"
FT                   /note="TIGRFAM: HflC protein; PFAM: band 7 protein; KEGG:
FT                   tcx:Tcr_1091 HflC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02287"
FT                   /db_xref="GOA:A1AWI0"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWI0"
FT                   /protein_id="ABL02287.1"
FT                   /translation="MQKIGLAIIAVLFLVLSSVLYTVNETQTVIKLRLGEIITVEESPG
FT                   LKFKMPFVNNIIKFDNRIQTLDEPAERFLTSEKKNVIVDSYVKWRIIDAEQFYKSTGGN
FT                   IVRTNNRLTQIIKTGLKSEFSKRTIADVVSNERSEIMSNIVRLAKKDIAQFGIEIVDVR
FT                   IKRIDLSQEVSNSVYRRMQAERQRVAKEFRSKGAEKAEIIRAAADKKRTIILANAYRDS
FT                   EKIRGEGDAASANNYAQAYNKNTDFYAFYRALASYKKSFSNQSNILILNPNTEFFRHFS
FT                   PQIK"
FT   sig_peptide     complement(582876..582944)
FT                   /locus_tag="Rmag_0533"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.849 at
FT                   residue 23"
FT   gene            complement(582944..584095)
FT                   /locus_tag="Rmag_0534"
FT   CDS_pept        complement(582944..584095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0534"
FT                   /product="protease FtsH subunit HflK"
FT                   /note="TIGRFAM: HflK protein; PFAM: band 7 protein; KEGG:
FT                   tcx:Tcr_1090 HflK protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02288"
FT                   /db_xref="GOA:A1AWI1"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWI1"
FT                   /protein_id="ABL02288.1"
FT                   /translation="MTWNDNNKNPWSGSNQTPPELEKVIKDFKNKFDGLFNNKKLSSAG
FT                   TSKIPSRGGFKYILILVLLVWLLSGIYIIDPAEKGVVLRFGAFQEETSQGPHWHIPYPI
FT                   ETLNRINVEQVRTAEIGYRNVVNNNRRFGGNVSSESLMLTKDENMIEAKFAIQYRINDV
FT                   QAYLFNVANPDTTLRHVSESAIRQVVGQNTMDYILTEGRANIADNIKEKSQNLLDKYKT
FT                   GLLITTVNMQDAQPPEQVQSAFSDAVKAREDKQRLINEAQTYANDILPKSRGKAARMLE
FT                   ESKAYKSEMISKSEGEASRFKQILAEYEKAPKVTRERLYRETMENVLASTSKVVVDSKA
FT                   NSMMYLPIDKLINARQINTQESSTQHNNQGGNVREIFRNRGAR"
FT   gene            584160..586427
FT                   /locus_tag="Rmag_0535"
FT   CDS_pept        584160..586427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0535"
FT                   /product="Organic solvent tolerance protein"
FT                   /note="PFAM: OstA family protein; Organic solvent tolerance
FT                   protein; KEGG: rso:RSc0515 probable organic solvent
FT                   tolerance transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02289"
FT                   /db_xref="GOA:A1AWI2"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWI2"
FT                   /protein_id="ABL02289.1"
FT                   /translation="MQFIITAYNVKIIIFIKITTIMKKQLALYLLFILLSSIISAESLV
FT                   LDCQNNALLFQKQVLSDKIKDLDVQANYSEVVKDDHYLLKGNVSLNSSTYFLSADEISI
FT                   NKFSKTSIATGHVKFQDNELMLTGDKAVVEKQGEVTHTTLNKVKFHYPNSMINGRAQVV
FT                   TNDGTKQVFSSGSYSLCPLGNSDWQMKAGKITLNSSANKGVAEDVTIEFLGKTIFYSPH
FT                   YEWVLEGRGSGFLAPTFGSYNESVTNKGNNYQVRIPYYFNVAPDRDFLLVLNQLSSRGS
FT                   ALEGKYRQLITNNGYLGYGRFEIEGLYLDKDKITDNRRWLLNSKLDLFSTKTNLSIITN
FT                   RVSDSNYFKEITHSNISDTKLQSHVDLSYKNQKKNLTMSLFAESEQLINNGSASYTRAP
FT                   ELSFNKGYKVLGGRNVNLSLISTKFIHKNSNITTNKTGVRTYVQAKFSRSLRTNNYSLT
FT                   PSLNLSTTDYTMNDVANQKRNIASFNLDSKFFLERKISLFGTNLTQTLIPRLAYNYTPK
FT                   KDQSVLPNFDSDDKNDSYEGLFSGKKFTGIDRIASANDLTFGLESDFIDEEMGDTYLSL
FT                   KIAQVYRFDDIGMNGSGVLTSQRKYSDATMSANLMIRDFAFNNSLQYNPKTNKISKRNS
FT                   SVGYILSPKKFLTLAHHNDNGKKLAELYGAYPLTQKIHVFAGINRSISDSITNKETTGI
FT                   AYASCCWAMRLAHFKEHVSGNDYAYVTKFELVLKGLSVTSSNLYKRLKEDVPNYLVNLD
FT                   NF"
FT   sig_peptide     584160..584285
FT                   /locus_tag="Rmag_0535"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.965 at
FT                   residue 42"
FT   gene            586429..587325
FT                   /locus_tag="Rmag_0536"
FT   CDS_pept        586429..587325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0536"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: lpn:lpg0298 peptidyl-prolyl cis-trans isomerase D
FT                   (SurA)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02290"
FT                   /db_xref="GOA:A1AWI3"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWI3"
FT                   /protein_id="ABL02290.1"
FT                   /translation="MNKTLLLICAFSLNAFTIPNSIIAIVNDDLVTFDQISVDIKSNHT
FT                   KVQKLVLVNQQIDLILQLQKIKQLNITPKENAINSMLGNIASNNNLNLMQLQSLPKFDE
FT                   VIDHVKQSLSLEGLRQFIVENLDIKLTEVEIIKQLIKTPNHSNKLTQQIKIAQIAVNSI
FT                   DQVDSLLRSKDSLIKDFLIDLSEKINKGDSFSTLAKLYSQDASYKNGGKSDWLNLLKLP
FT                   EIFKQNLKNLSVGDLSQPFKIGQVWRIVKIIDKRSVDNYLIELKTKLIRQKENIYFNDW
FT                   IKKLRKEAYIEIFDNKL"
FT   sig_peptide     586429..586482
FT                   /locus_tag="Rmag_0536"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.928) with cleavage site probability 0.558 at
FT                   residue 18"
FT   gene            587326..588069
FT                   /locus_tag="Rmag_0537"
FT   CDS_pept        587326..588069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0537"
FT                   /product="23S rRNA Gm-2251 2'-O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase, substrate binding; KEGG: eca:ECA3621
FT                   probable tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02291"
FT                   /db_xref="GOA:A1AWI4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWI4"
FT                   /protein_id="ABL02291.1"
FT                   /translation="MSKSIIITSFHAVQAQLKSNPTCFIKVFILNKRCDKRLNTLTSEF
FT                   NNFGISVQRCTKIQLDKLSNHQTHQGVAAEILLPTLPDQGELISYVSKLDNAGFILILD
FT                   SIQDPRNLGACLRSANAAGVHCVVINKNGSAPINSLVHKTSAGALNQLKIFQVTNLSRT
FT                   IKALQQKNIWVIGLDGSVNISIYQIDLTIPNAIIMGAEGSGLRRLTKQSCDQLAKIPMQ
FT                   GKVESLNVSVATGVTLFEVNRQRLL"
FT   gene            588492..589796
FT                   /locus_tag="Rmag_0538"
FT   CDS_pept        588492..589796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0538"
FT                   /product="isocitrate lyase"
FT                   /EC_number="4.1.3.1"
FT                   /note="TIGRFAM: isocitrate lyase; PFAM: isocitrate lyase
FT                   and phosphorylmutase; KEGG: son:SO1484 isocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02292"
FT                   /db_xref="GOA:A1AWI5"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWI5"
FT                   /protein_id="ABL02292.1"
FT                   /translation="MNRQEQTNVLTKDWAENPRWKNVKRAYNAKDVVRLRGSIQPEYTY
FT                   ARLGSEKLWKLINDSSKKGYVNCMGAITAGQAMQQAKAGIEAIYLSGWQVAADGNTSET
FT                   MYPDQSLYAYDSVPTMVRRINNTFKRADEIQWAKGINQNDQEYVDYFLPIIADAEAGFG
FT                   GVLNAYELMKNMIVNGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLTSARLAADV
FT                   MGIPTIVLARTDAEAATLLTSDVDPRDERFVTGKRTPEGFYIVKNGLEQAISRGISYAP
FT                   YADLVWCETGKPDLGFAREFAQAVLVNNPEQLLAYNCSPSFNWKKNLNDSQIASFQEDI
FT                   AAMGYKYQFITLAGIHNMWYNMFELAHEYAQGEGMKHYVEKVQEPEFAAAEKGYTFASH
FT                   QQEVGAGYFDDVTTVIQGDTSSVTALTGSTEAAQF"
FT   gene            complement(590165..591170)
FT                   /pseudo
FT                   /locus_tag="Rmag_0539"
FT   gene            complement(591321..592335)
FT                   /pseudo
FT                   /locus_tag="Rmag_0540"
FT   gene            592398..592676
FT                   /locus_tag="Rmag_0541"
FT   CDS_pept        592398..592676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0541"
FT                   /product="protein of unknown function DUF493"
FT                   /note="PFAM: protein of unknown function DUF493; KEGG:
FT                   neu:NE1487 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02293"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWI6"
FT                   /protein_id="ABL02293.1"
FT                   /translation="MTTINLTSETLFNFPCDYHIKVLGKDCEALQRTIYSIVERYTDKL
FT                   HPNQITKKHSSKGNYMSFSIHIIASSRIQLDAINQDLQDCHLVSYVL"
FT   gene            592683..593297
FT                   /locus_tag="Rmag_0542"
FT   CDS_pept        592683..593297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0542"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: cvi:CV3096
FT                   lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02294"
FT                   /db_xref="GOA:A1AWI7"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWI7"
FT                   /protein_id="ABL02294.1"
FT                   /translation="MRIIDLGRQNYLNVWEQMKIFTNARNKNTQDELWTVEHNPVFTQG
FT                   ISSKSEHILSSSDIPIIQTDRGGQITYHGPGQVVIYCLIDLKRLGVGVKKMIEIIENSI
FT                   IDLLKTYAIKAHLKSDAPGVYVDNAKIAALGLKIKQSRTYHGLSLNVDMDLSPFMQINP
FT                   CGYQDLKVTQLCNLTENRDTLNTIAEKLSQILINHVARNRH"
FT   gene            593275..594222
FT                   /locus_tag="Rmag_0543"
FT   CDS_pept        593275..594222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0543"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: vfi:VF0742 lipoic acid synthetase; TIGRFAM:
FT                   lipoic acid synthetase; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02295"
FT                   /db_xref="GOA:A1AWI8"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWI8"
FT                   /protein_id="ABL02295.1"
FT                   /translation="MLQEIDIKSLKGKSKVVRLKIKPDSERLPIKKPNWIRIKHVASQK
FT                   VEQLKKTLRSQKLFTVCEEAQCPNLSECFNHGAATFMIMGQICTRRCPFCDVAHGKPKA
FT                   LDVDEPKHLANTIKKMQLKYVVITSVDRDDLRDGGAQHFKTCIDNIRLSTPKVKIEILT
FT                   PDFRGRIDKVLEVFKSCSPNVFNHNLETVPSLYQKVRPGANYNYSLRLLKAFKQQHPFV
FT                   ITKSGLMLGVGESEKQVINVLKDLRKHNVDMLTLGQYLQPSKHHLAVEAYIHPNQFDKY
FT                   KKIALKLGFSQVASGPMVRSSYHADLQIKGELIS"
FT   gene            complement(594313..597717)
FT                   /locus_tag="Rmag_0544"
FT   CDS_pept        complement(594313..597717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0544"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   gme:Gmet_3127 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02296"
FT                   /db_xref="GOA:A1AWI9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWI9"
FT                   /protein_id="ABL02296.1"
FT                   /translation="MTNKNYEVYEDFELGIAGKLSKAFITSPLSIIIFFAMLSAGIIGL
FT                   ISTPRQEDPQISVPLIDLFVEYPGASSEEVSNIIVKPLERLMSNILGVKHVYSVSDKSH
FT                   GIITVEFDVGQEMNASIIKVRDKMLANLDFMPPGAKQPLIKPKEIDDVPIINLTLWSKS
FT                   LDDGQLRSLSLELLQQLAKVKDTNNGFIVGGRKEIFHIDAYPGRLAGHGISIQQIANTI
FT                   GNANVRGHTGNIELNGFRMEVYSGDFFSKVEDIENLVITVSDGKPIYVRDVADVYYAPE
FT                   DAEHMVSYYTGKANKTGKKATGEQAVTIAIAKKYGTNGVEVAQNILAKVEALKGRLIPD
FT                   NVEVSVTRNYGESAKNKVNALIKKLFIATGAVTMLVWFALGIRPAIVVTLVIPVVLLMT
FT                   IFSAWMLGMTIDRVSLFALIFSIGILVDDAIVVTENIYRRWLIDNKITIGTAIDAVREV
FT                   GNPTILATFTVVAALVPMAAVSGMMGPYMAPIPVLGSVAMMFSLFAAFVFTPYFIMVFA
FT                   PPLNVLRKMHKKEEKETKIMFDFFHSTISKLFNIKAYGWSFLIGLVVVFFISMSMFYTT
FT                   SVPVKMLPLDNKSEFGVVLDMPDGTALANTASTLHKMAQVLRNMPEVVAVQSYSGTAKP
FT                   FDFNGLVRHYYLRQSPSEGELQIQLVEKSERDRSSHEISLEARTLVKQIVEDAGANYAV
FT                   VEMPPGPPVLRPVVAEVYGPDKETRHKLANDLTELFKESNTMTDIDNLMRDKYPVINFQ
FT                   VDTAKASRFGVSVMTIKETLSMAMSSFNVGTIRLKNALEPSRICLQIPLSKRSQLSYLT
FT                   QLPVPSQHGGMIPISELGSFSYKKEDDLIFHKDLADVEYVLGEPKGRLSAPIYAMMGVD
FT                   DLLLKYQTIDGKQLQGEYLGPPTDQTVPSFEWTGEWTVTYETFRDMGSAFAVALVVIYM
FT                   LVVWQFGNFIIPAIIMVPIPLTLLGIVPGHWLLGAEFTATSMIGWIALAGIIVRNSILL
FT                   VDFTVQEYAKGMPFFDSVINSCSSRTRPIMITAFALVGGSSVILSDPIFQGMAISLLFG
FT                   VLVSTVLTLVVIPLGTLSAGEAACRNIAVNMGLLPGDADADVKYNVEKPVKAKKIDKDP
FT                   KEWIKTVLDRKDQAKNELLKKEDKSDL"
FT   gene            complement(597725..598900)
FT                   /locus_tag="Rmag_0545"
FT   CDS_pept        complement(597725..598900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0545"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: pha:PSHAa2832 multidrug efflux system
FT                   (AcrA/AcrE)"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02297"
FT                   /db_xref="GOA:A1AWJ0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWJ0"
FT                   /protein_id="ABL02297.1"
FT                   /translation="MNSSVLLLFTSILLMFSLSSQTQITSFGAPFRNVNQSVNNFESAY
FT                   NVQVVSGMSLDKRVLLGGSVISSSQVNLVAQVSGDVLSIGGQEGDMFKQDSILVTLEQE
FT                   SIQAQRDSAYAEIASANEALRNAGVQYSQSIVSPNSGGMFGSVPGMFSMFTDPMLKISG
FT                   QGNPDFDKFANRTSRYTNYQQAKNKLKQVESRLKQVESRLKDVNISAPFDGVIVAKSIN
FT                   KGDVVQPGQILIKFANIKNLQVEVNVPSRLVRSLKLNKTYRIKLDIANIVVDAKLSQIY
FT                   PIADNAKHSVKVKFDLPANVPVLSGAYAEVEIFETDSGVLTPTIPEVAIMWRSSLPSVF
FT                   VINSSTNKTELRFIRLGEQVGKNKKSVLSGLKIGERIVANPNILMVSGMSI"
FT   sig_peptide     complement(598832..598900)
FT                   /locus_tag="Rmag_0545"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.869 at
FT                   residue 23"
FT   gene            599097..600095
FT                   /locus_tag="Rmag_0546"
FT   CDS_pept        599097..600095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0546"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="KEGG: sde:Sde_0738 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase; TIGRFAM: 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase; PFAM: Pyridoxal phosphate biosynthetic
FT                   protein PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02298"
FT                   /db_xref="GOA:A1AWJ1"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWJ1"
FT                   /protein_id="ABL02298.1"
FT                   /translation="MTTIAFTVGEPSGIGPDLAVIYAQKKSNKNLLLFADPDVLLNRAK
FT                   QLNLNIKIVESEQASSAYELPIYPIKVNTPVKCGILNKNNAQYVLNTLDRATEYCLNAQ
FT                   CDALVTGPVHKSIINQAGIHFTGHTEYLANLSNTDKTVMMLATSDLKVALATTHMPLSE
FT                   VPQNITTQSLQKTISIIHQFLLNDGIDTPKIIVCGLNPHAGEDGYLGMEEIEIINPLIK
FT                   KLNSQGCDLVGSVPADTAFTPDALIGVDCVLTMYHDQGLPVLKTLGFKKAVNITLGLPF
FT                   IRTSVDHGSALSLAGTGNISLGSLNTALNYAQILIANRKKRQLSQVASSYA"
FT   gene            600088..600840
FT                   /locus_tag="Rmag_0547"
FT   CDS_pept        600088..600840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0547"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; KEGG:
FT                   pfo:Pfl_5135 16S rRNA dimethylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02299"
FT                   /db_xref="GOA:A1AWJ2"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWJ2"
FT                   /protein_id="ABL02299.1"
FT                   /translation="MHKACKRFGQNFLVDHRIIDRIIATIAPKRDDNLLEIGPGQGAIT
FT                   LPLLDYVDQLNVIEIDRNLISILESLKHSNLIVHQGDVLKFDLNVVPIPIRVIGNLPYN
FT                   ISSHVLFYLLKNLNKIKDMTFMLQKEVVERIAANNGSKIYGRLSVMMQAFFDVQMIFIV
FT                   PPESFNPAPRVESAVVHLKPLTQPKTKDIKILEKVVKLAFSQRRKTLKNCLKSILTQKQ
FT                   TNIDLSQRAEMLTIDNFITLTKDYEKQH"
FT   gene            600824..601195
FT                   /locus_tag="Rmag_0548"
FT   CDS_pept        600824..601195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0548"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: neu:NE1573 ApaG
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02300"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWJ3"
FT                   /protein_id="ABL02300.1"
FT                   /translation="MKNNIEIEVKVTYLEHQSDVYASQYSYAYTITIINKGNVGVQLLT
FT                   RHWRIQDETGYIEDVIGEGVIGQQPHLASGESFQYASGAIIKTLTGSMKGSYGMVDDYG
FT                   ERFNVQIPEFVLSKPYTLH"
FT   gene            601195..601992
FT                   /locus_tag="Rmag_0549"
FT   CDS_pept        601195..601992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0549"
FT                   /product="bis(5'nucleosyl)-tetraphosphatase, ApaH"
FT                   /EC_number="3.6.1.41"
FT                   /note="KEGG: tbd:Tbd_0168
FT                   bis(5'-nucleosyl)-tetraphosphatase (symmetrical); TIGRFAM:
FT                   bis(5'-nucleosyl)-tetraphosphatase (symmetrical); PFAM:
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02301"
FT                   /db_xref="GOA:A1AWJ4"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWJ4"
FT                   /protein_id="ABL02301.1"
FT                   /translation="MSDYLIGDIQGCFDALQALLKTIKFSSDKDRLFFLGDVVNRGKKS
FT                   LATLRFIKDLKNNASMVLGNHDFYLLACSLGSKKPNEKDTFMDIINANDADSLLDFLHN
FT                   QPLVIKYKNVLMIHAGVPPNWDIDRLLQQSKQVQKHLQSTNISQFLDKIYGNKPNIWSK
FT                   DLTELEQCRYTINALMRLRFCKANGELEFSHKMNYTHPPKGFKAWFIHKNRLLKNIDIF
FT                   FGHWSSLSDVNQTHIYPMDHGCIWHGRLSAIRLKDRKVFSISC"
FT   gene            complement(601989..602804)
FT                   /locus_tag="Rmag_0550"
FT   CDS_pept        complement(601989..602804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0550"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: cvi:CV2528
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02302"
FT                   /db_xref="GOA:A1AWJ5"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWJ5"
FT                   /protein_id="ABL02302.1"
FT                   /translation="MLINFVKMHGLGNDFMMVDNLAGDITFNAEQIANLANRHLGIGFD
FT                   QLLLVETSNTKNVDFRYVIYNADGLEVEQCGNGARCFAFFVSKKGLSNNNPIVVETRSG
FT                   IINLYLNDDNTVRVDMGKPSFNPADILLLVPQQSTYYQIEGFDLGAVSIGNPHCVMLVE
FT                   DVNTVDVSSIALRIQQSELLPNQANIGFMQILNTHEINLRVYERGSGETLACGSGACAA
FT                   VVYGVEQGLLKENVVAHLNGGDTLIEYIQGGHVFLSGPVQFVFEGKVEI"
FT   gene            602892..603245
FT                   /locus_tag="Rmag_0551"
FT   CDS_pept        602892..603245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0551"
FT                   /product="protein of unknown function DUF971"
FT                   /note="PFAM: protein of unknown function DUF971; KEGG:
FT                   eba:ebB94 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02303"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWJ6"
FT                   /protein_id="ABL02303.1"
FT                   /translation="MQTPTNINLNKVKTLLTITFDKIDYPLSAEYLRVYSPSAEVVGHG
FT                   KGQEILQLNKKNVTILRIQPTGNYAVILFFSDNHDSGIYSWSHLHKLALNHDKLWHKYL
FT                   QRLKDAGHTYPQL"
FT   gene            603252..604589
FT                   /locus_tag="Rmag_0552"
FT   CDS_pept        603252..604589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0552"
FT                   /product="putative membrane-associated zinc
FT                   metalloprotease"
FT                   /note="TIGRFAM: putative membrane-associated zinc
FT                   metalloprotease; PFAM: PDZ/DHR/GLGF domain protein;
FT                   peptidase M50; KEGG: neu:NE1711 membrane-associated
FT                   Zn-dependent proteases 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02304"
FT                   /db_xref="GOA:A1AWJ7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWJ7"
FT                   /protein_id="ABL02304.1"
FT                   /translation="MAFISSLGFFLITIGILVTVHELGHFLVAKKLNVKVLRFSIGFGK
FT                   ILKSFKYGETQYTLCVLPLGGFVKMLDENETLVEASEKHRAFNQQSVYKRIMIVAAGPI
FT                   ANFLLAVILYTVVFVIGVNGVKPIVGTLESPSIAQQSGIKIGDQLLSINGVLTPTISEF
FT                   SINFIQSLDENHLYVDVISGASNLKKLEFNLSGDFLSNPEQGVDRYLGFKFAMPKLEAI
FT                   IDQVVPNSPASIAGLQTNDKILSANHVYINSWYDFVNVIQNSSNKEINLQIKRNGNILN
FT                   TILTPKIENGLAKAGVRVLVPTGYLNKWLVLVKKNTFDAFIAANEKVYQLTLLNLKMIK
FT                   KMIMGDTSLNQISGPISIANYAGKSAQVGFTSFLSFLALISIGLGLLNLLPIPLLDGGH
FT                   LFFYLIELIKGSAISQSFQQVLTKFGLFIVISLTVVALYNDLSRLL"
FT   gene            604593..606881
FT                   /locus_tag="Rmag_0553"
FT   CDS_pept        604593..606881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0553"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: eba:ebA5996 probable
FT                   outer membrane protein/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02305"
FT                   /db_xref="GOA:A1AWJ8"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWJ8"
FT                   /protein_id="ABL02305.1"
FT                   /translation="MKKIITLFILVANILACSVTLAAPIKNIEILGLNVISRGTVLSYL
FT                   PIEKGDNYNNQVSRQIIRALYKTNFFKDIEVSQETQILKIKLTENPHIKYIEVINYSNK
FT                   VIQEKSLNQILKTRGLSQGKIFNKRQLDKLITQLKAVYTSKGYYDVIIAKTIKIDTQNR
FT                   VGIELNISEGKVAKISSMKITGNHIFDENELLNLFEIGQADFFVINYFTEKDHYSKVAL
FT                   DAGIESMKSFYINAGYLDFKINEVKTDLSEDKQSISINLQISEGIEYKIGTIQFTGDLL
FT                   NNSIEYLRKLLSFKKGDVFERKKMMQSLQAINDIFSNQGYAFSDVKVATLENTSAHTIN
FT                   LSIDIAPNKKVYINRITIVGNTRTQDEVIRREINIHEGSLYSNTELNESIEKIKRLGFF
FT                   SDVKMQVSKLEGFKDKINLHFSVEEIQTGIFSIGLSHSNSTGASLNLGVQERNFLGTGN
FT                   TLNLSLSNSKAARDISFYFSDPYFTQDRHSISYGVFSKKLDASELKLDEYKIDENGFSL
FT                   GYSVPITKKIRIGADLRASKRDINCGTTLSDDHEPIQCASEDETELKLGLNWSNNTLND
FT                   FNFPTKGQKNSLNFSLALPVADFRYYKLDASHKSYYPLKNDLILSFKGNLGFAQGYDDK
FT                   ELPFFKRYYGGGSSSVRGFDFNSLGIKYIGSDKVKGGELSFLTSASVISPIKFIDDNKN
FT                   MRISAFVDLGSISEKASGFDLYELRLSIGVAFSWLTPIGPLGFYAAKPLIKKSGDKIKT
FT                   FDFTLGTSF"
FT   sig_peptide     604593..604661
FT                   /locus_tag="Rmag_0553"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            606924..607922
FT                   /locus_tag="Rmag_0554"
FT   CDS_pept        606924..607922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0554"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="TIGRFAM: UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase; PFAM: transferase hexapeptide repeat
FT                   containing protein; UDP-3-O-[3-hydroxymyristoyl]
FT                   glucosamine N-acyltransferase, LpxD; KEGG: ftl:FTL_0537
FT                   UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02306"
FT                   /db_xref="GOA:A1AWJ9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWJ9"
FT                   /protein_id="ABL02306.1"
FT                   /translation="MYTLGEIAKTINAKLVGDANIEITGIATSLSANQTQLTYINGNKY
FT                   KQMLINSKAGVVILNNNLLKNCPTNALVVDNVYLAFAKATHLFKKQTVHCQGTHSSAKI
FT                   NYAKIAPNCIIGKNVVIGNHCTIAPNVVIEDDVIIGNYTLIQPNVSILQGCSIGNNVVI
FT                   SPGVVIGSEGFGNAQDQQKHWYSIAHLGYVIIGSNVSIGANTTIDRGTIEDTQIHNGVQ
FT                   IDNLVHIAHNVIIGQDSAIAATVTIGGSCTIGKRCMIGGGATIASHISLVDDIIVTGAS
FT                   TVDKNLSEQGHYTGFTSINKHQKWKKIQVWLLNLDKIAHYLNIKLKELKGK"
FT   gene            607924..608367
FT                   /locus_tag="Rmag_0555"
FT   CDS_pept        607924..608367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0555"
FT                   /product="3-hydroxyacyl-[acyl-carrier-protein] dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ; PFAM:
FT                   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase,
FT                   FabA/FabZ; KEGG: hch:HCH_05240
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02307"
FT                   /db_xref="GOA:A1AWK0"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWK0"
FT                   /protein_id="ABL02307.1"
FT                   /translation="MEMSIQDVKNYLPHRYPFLLIDRVLELEIGKSIVALKNVTFNEPQ
FT                   FTGHFPEQPIMPGVMIVEALAQATGILAFKSEAGKPIDGQIYMLVGIDKVRFKRMVEPG
FT                   DQLRLEVEVITIKRGIWKFKCKATVDNQIITSAELMCTQRTAG"
FT   gene            608391..609182
FT                   /locus_tag="Rmag_0556"
FT   CDS_pept        608391..609182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0556"
FT                   /product="acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="TIGRFAM:
FT                   acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase; KEGG: pae:PA3644 UDP-N-acetylglucosamine
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02308"
FT                   /db_xref="GOA:A1AWK1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWK1"
FT                   /protein_id="ABL02308.1"
FT                   /translation="MAIDPSAIIDPSAKIHKNTEICAYVIIGANVEIDSGTIVEVHVVI
FT                   QGPTKIGKNNHIYSFASIGGDPQDITYVEGQESSLIIGNDNLIREFCTINRGTEKENSI
FT                   TRVGSNNMLMAYVHIAHDCQVGDHIIMSNNASLAGHVRIHDWAILGGFTLVKQFCMIGM
FT                   HTYVGMGCQINKDIPAYMVASGVQTRVRSINVEGMRRRGFSPNAIAAIKRAFKVVYRES
FT                   GLLDQSLKELEQSESDHPEVVQFVKCIRSSKVGIMRGPTEE"
FT   gene            609242..610729
FT                   /locus_tag="Rmag_0557"
FT   CDS_pept        609242..610729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0557"
FT                   /product="integral membrane protein MviN"
FT                   /note="TIGRFAM: integral membrane protein MviN; PFAM: multi
FT                   antimicrobial extrusion protein MatE; virulence factor MVIN
FT                   family protein; KEGG: tcx:Tcr_0493 integral membrane
FT                   protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02309"
FT                   /db_xref="GOA:A1AWK2"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWK2"
FT                   /protein_id="ABL02309.1"
FT                   /translation="MTFLSRILGLVRDYFIARYFGANGLTDAFLIAFRIPNFFRRLFGE
FT                   GAFSQAFVPILAEAKTNNTQAEVQNIINHIGTKFLFVLILITLITVVIAPVIIFMFAWG
FT                   FYFSPDPMQFNLASDMLRITLPYLLFISLTAFSGAILNTYDQFAVPAFTPVLLNISMIL
FT                   SAIYLSKHMDTPIMALAWGVFFGGITQLLFQIPFLIKIKKLPKLALGDHQAIKTLKKRM
FT                   LPALFGVSVSQINLLIDTMIASVLVSGSVSWLYYSDRLLELPLALIGIALATVSLAKLS
FT                   QHFADKNDEKFAQTINNTLTIGLLLGLPACAGLVLLAEPLIITLFQYDQFDAFAVFQSS
FT                   SSLMAYGSGLMAFIFVKILAPIFLSRGDAKTPVKVGVIAMISNVFLNVILGFYFAHVGL
FT                   AIATSISALLNASLLYYYLNKQSIFNVSSNLYQTFFKALVASFIMTVFILIFGSEVELY
FT                   LKADVSSRITLLGTTIVLAIIIYFASLKLLNIGIKKQ"
FT   gene            610726..610995
FT                   /locus_tag="Rmag_0558"
FT   CDS_pept        610726..610995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0558"
FT                   /product="Fe(II) trafficking protein YggX"
FT                   /note="PFAM: Fe(II) trafficking protein YggX; KEGG:
FT                   dar:Daro_3583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02310"
FT                   /db_xref="GOA:A1AWK3"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWK3"
FT                   /protein_id="ABL02310.1"
FT                   /translation="MNTVKCIKLGQQLEALDRAPYPGELGQKILSNVSKQGWKLWLEYQ
FT                   TMLINENNLNLMDSNAQSYLKEQMDKFFFSKEDVDDIQGYKPNE"
FT   gene            610988..611599
FT                   /locus_tag="Rmag_0559"
FT   CDS_pept        610988..611599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0559"
FT                   /product="Guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="KEGG: pha:PSHAa2790 guanylate kinase; PFAM:
FT                   guanylate kinase; SMART: guanylate kinase/L-type calcium
FT                   channel region"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02311"
FT                   /db_xref="GOA:A1AWK4"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWK4"
FT                   /protein_id="ABL02311.1"
FT                   /translation="MSNGVLFVISAPSGCGKTSLVKALIKKIDHLCVSVSHTTRAPRLG
FT                   EVQGENYFFVSKDEFNKIKNNNGFIESAQVFDNDYGSAKQLVQNLLNNDSDVILEIDWQ
FT                   GFRQIKQTFNHSVGIFILPPSQAVLKKRLTDRGQDKQSIIGRRMHDADNEMQHFNEFDY
FT                   LIINDNFDVALNNLSIIVQAERLTLAQQSIKHKDLLKTLI"
FT   gene            611648..612490
FT                   /locus_tag="Rmag_0560"
FT   CDS_pept        611648..612490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0560"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; PFAM:
FT                   sigma-70 region 2 domain protein; sigma-70 region 4 domain
FT                   protein; KEGG: ilo:IL0229 DNA-directed RNA polymerase sigma
FT                   32 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02312"
FT                   /db_xref="GOA:A1AWK5"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWK5"
FT                   /protein_id="ABL02312.1"
FT                   /translation="MNQEFALLPAKKISNLEVQKYPPILNSEQEHELAVKLYENHDLSA
FT                   ARKLVLSHMRFVAFIAHGYKGYGLEQADLVQEGTIGLMKAVKRFNPNRNVRLASFAVYW
FT                   IRAEIHEFIFKNWKIVKVATTKAQRKLFFKLKQAKAHIYSSLNEEQADKIANDLGVRRK
FT                   DVLEMESRLQFNDVTFEVSDDEDSLAPEQYLTNENVQTPEQLLLINDSKQNQQQQLYKA
FT                   LSSLDERSLDILQSRYLKEEKTTLHTLADKYGISKERVRQLETKAMQKLKSNLQEQSL"
FT   gene            612560..612847
FT                   /locus_tag="Rmag_0561"
FT   CDS_pept        612560..612847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0561"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: mca:MCA0706
FT                   chaperonin, 10 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02313"
FT                   /db_xref="GOA:A1AWK6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWK6"
FT                   /protein_id="ABL02313.1"
FT                   /translation="MNIRPLHDRVIVRRTQEEKTTESGLIIPDSATEKPSKGEILAIGN
FT                   GKINDNGDVIALDVKVGDQVLFGQYAGNEIKVDGETLLVVREDDIVAIIE"
FT   gene            612860..614494
FT                   /locus_tag="Rmag_0562"
FT   CDS_pept        612860..614494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0562"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: pae:PA4385 GroEL protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02314"
FT                   /db_xref="GOA:A1AWK7"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWK7"
FT                   /protein_id="ABL02314.1"
FT                   /translation="MSAKDIKFGSEARNLMLDGVNMLANAVKVTLGPKGRNVVLDKSFG
FT                   GPTITKDGVSVAQEITLEGKFENMGAQMVKEVASKTNDIAGDGTTTATVLAQALVIEGV
FT                   KSVAAGMNPMDLKRGIDKATETAVNALREFSQPCNDTKAIAQVGTISANSDISVGDIIA
FT                   DAMEKVGQAGVITVEEGSGFENELDVVEGMQFDRGYLSPYFVNNQESMTANLETPFVLL
FT                   HDGKISNIRDLLPTLEAVQKSGKALLIIAEDIDGEALATLVVNNMRGIVKVAAVKAPGF
FT                   GDRRKAILEDIAVLTGGMVISEEVGLSLEKVTEEHLGTAKRIEIGKENTVIVDGAGKKV
FT                   DIDGRIAQIKAQIETTTSDYDKEKLLERLAKLSGGVAVIKVGAATEVEMKEKKGRVDDA
FT                   LHATRAAVEEGVVPGGGVALVRVIKALDGLTGDNHDQNIGIDIAKRAMEAPLRQIVTNG
FT                   GGEASVILNEVAKGKDNYGYNAATEKYGDMLKMGILDPTKVVRAALQHAASISGLMITT
FT                   EAMITDTPQDTPATAAAPDMGGMGGMM"
FT   gene            614731..616614
FT                   /locus_tag="Rmag_0563"
FT   CDS_pept        614731..616614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0563"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: tcx:Tcr_0364 DNA topoisomerase IV, B subunit;
FT                   TIGRFAM: DNA topoisomerase IV, B subunit; PFAM: DNA gyrase,
FT                   subunit B domain protein; ATP-binding region, ATPase domain
FT                   protein domain protein; DNA topoisomerase, type IIA,
FT                   subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02315"
FT                   /db_xref="GOA:A1AWK8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWK8"
FT                   /protein_id="ABL02315.1"
FT                   /translation="MSNYDSSSIEILTGLEAVRKRPGMYTETERPNHLAQEVIDNSVDE
FT                   TIAGYASKISVILYKDGSLSVEDNGRGMPVDIHPKEGKSGVEVILTKLHAGGKFSNDSY
FT                   QFSGGLHGVGISVVNALSTLVEIWIKRDAKEHYITFSNGFKQTELEITRKVGKRNTGTT
FT                   VKFKPDAQFFDTIKFSVTKLRHNLRSKAVLCPGLEVNFYNEIDEATDKWIYKEGLKDYL
FT                   SISLDVLDCLPPTPFIIDYKTDEQQLNCSLAWTQYNTNVVAESYVNLIPTIGGGTHVNG
FT                   LRSGLNEALKEFCEFRNLIPKNIKLTPDDIWQKIAYTLSIKILDPQFSGQTKERLSSRE
FT                   SASFVANVVKDAFSLWLNQHTSIAEQIAQLAIANAQARLKTNKKVIRKKIISGPALPGK
FT                   LSDCTSTDLNQTEVFLVEGDSAGGSAKQARDKEYQAILPLRGKILNTWEVDSEQVLASN
FT                   EIHDIAIAIGLEPNSEDLSGLRYGKICILADADSDGAHIATLICTLFVKHFQKLIQKGH
FT                   IFVAMPPLYRVDAGKYVHYALDDNERDAIIKKIENKNKHVKIQVQRFKGLGEMNPYQLR
FT                   ETTMLPDTRHLIQLTLDDPLQVFQTMDMLLSKKRAADRKKWLEEKGNLANV"
FT   gene            616607..617299
FT                   /locus_tag="Rmag_0564"
FT   CDS_pept        616607..617299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0564"
FT                   /product="preQ(0) biosynthesis protein QueC"
FT                   /note="TIGRFAM: exsB protein; PFAM: ExsB family protein;
FT                   KEGG: cbu:CBU_2083 ExsB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02316"
FT                   /db_xref="GOA:A1AWK9"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWK9"
FT                   /protein_id="ABL02316.1"
FT                   /translation="MSNTRHKIKAVILLSGGLDSTTTLAIAKTKNFECYSLSFDYGQKQ
FT                   KSELKSAENFAKIFGSIKHRVMKISLSNIDFSALTDDKIDIPKFSKSDDIPITYVPARN
FT                   TIFLSYALSWSEVLDCQHIFIGVNTLDYSGYPDCREIYIKAFEVMANLATKQSIEGKKL
FT                   TIHTPLIHLNKAQIIKKGLSLGIDYSLTTTCYQADKSGKACGICDACEYRKLGFIEAKV
FT                   ADPTRYQI"
FT   sig_peptide     616607..616684
FT                   /locus_tag="Rmag_0564"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.961) with cleavage site probability 0.493 at
FT                   residue 26"
FT   gene            617405..617632
FT                   /locus_tag="Rmag_0565"
FT   CDS_pept        617405..617632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0565"
FT                   /product="acyl carrier protein"
FT                   /note="TIGRFAM: acyl carrier protein; PFAM:
FT                   phosphopantetheine-binding; KEGG: mfa:Mfla_1504 acyl
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02317"
FT                   /db_xref="GOA:A1AWL0"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWL0"
FT                   /protein_id="ABL02317.1"
FT                   /translation="MSIEQRVKKVVAEQLDVSGDIDNNASFIDDLGADSLDTVELVMSL
FT                   EEEFDCEIPDDQAENITTVQQAIDYVNNNL"
FT   gene            617710..618948
FT                   /locus_tag="Rmag_0566"
FT   CDS_pept        617710..618948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0566"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="PFAM: beta-ketoacyl synthase; KEGG: bxe:Bxe_A1076
FT                   3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02318"
FT                   /db_xref="GOA:A1AWL1"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWL1"
FT                   /protein_id="ABL02318.1"
FT                   /translation="MGKRRVVITGMGMVCPVGLSVDESWDNILKGHSGIASLTNIDTKG
FT                   QSVTFGGSVKGFEITDYLKPKDAKKMDTFVHYGMAAGIQAIEDSGIEVTEQNAHRIGVT
FT                   IGAGIGGLGTIEKTADLFREKGAKRISPFFVTSSIINMISGNLSIKYGLKGPNFAIVSA
FT                   CSTGTHNIGGASRLIEYDDADVMITGGAEMSTTNCGLGGFAAAHALSTRNDDPINASRP
FT                   WDKDRDGFVLGDGAGVVVLEEFEYAKARGAKIYAQVSGYGMSSDAYHITLPSKGGEGAA
FT                   RCMQNSLKNSGINTDQIDYINAHGTSTPSGDQAETDATKLALDKHAYNIVMSSTKSMTG
FT                   HLLGAAGGIEAIFTALAIKNQIAPPTINIINQDPNCDLDYCANEAREMTINHAISNSFG
FT                   FGGTNGSIVFSKI"
FT   gene            complement(618998..619201)
FT                   /locus_tag="Rmag_0567"
FT   CDS_pept        complement(618998..619201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02319"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWL2"
FT                   /protein_id="ABL02319.1"
FT                   /translation="MIKFILSIVIILALIGGAVQFIATDESWSLVMNKEVALNSIQNGT
FT                   ITIYELISDADKIKSVDLTTVK"
FT   sig_peptide     complement(619139..619201)
FT                   /locus_tag="Rmag_0567"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.870) with cleavage site probability 0.548 at
FT                   residue 21"
FT   gene            complement(619225..621135)
FT                   /locus_tag="Rmag_0568"
FT   CDS_pept        complement(619225..621135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0568"
FT                   /product="Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="PFAM: peptidase M3A and M3B, thimet/oligopeptidase
FT                   F; KEGG: pha:PSHAa0361 oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02320"
FT                   /db_xref="GOA:A1AWL3"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWL3"
FT                   /protein_id="ABL02320.1"
FT                   /translation="MKPNFQPKNIVKTIEKLTRNGLKVVEKASLGTSWNSVVAATDQTA
FT                   LELDKFTSVNSHLNAVMFSDEFNQQYEKTLPIITNFYSNISTNKGLYQAYKTLKKTNLN
FT                   KQQQHIVKDVIKSFELSGVDLEGNFAHRFKSIKKKLSLLSNEFSRNVLKSTNEWKKIVD
FT                   KDELKGYSDNELEKIKTDKGYELSLQMPVYMDVMTYLDNRDLREEVYRAYVSRASELGI
FT                   TSTDYNNKPIMDEILSLRAEMANILGFEHYAQLSIMSKMVSTIDEVLQFLYNLVERSKP
FT                   QAQLELEELKKLSGIDLKPWDFGFYSEKLKEQKFGFKKSDLTPYFPESSVLNGLFSTIE
FT                   NLYQIKIEKIQQDSYHVDVKVLNVSDKNGLIGRIYLDLYARRNKRSGAWMTDYQPLIEP
FT                   HKPVAFVVCNLNSYTKDKPALFEFDEIVTLFHEFGHALHHLLTKVKYPCAAGISGVPWD
FT                   GVELPSQYMEFYAFEKQVIALISKHYKTGQSLPDDLFNKLIASKNFHSALAMLRQCEFS
FT                   LWDLKTHMSNSDTYEVLTQVRSETALMDSIDENRFLNTFGHIFSGSYAAGYFSYKWAEV
FT                   LAADAYYYVQGEGGIGSNASKDFLYNILEIGGSLNFMQQYIKFRGKEPSINALLQANGI
FT                   F"
FT   gene            complement(621148..621235)
FT                   /locus_tag="Rmag_R0021"
FT                   /note="tRNA-Ser3"
FT   tRNA            complement(621148..621235)
FT                   /locus_tag="Rmag_R0021"
FT                   /product="tRNA-Ser"
FT   gene            complement(621341..621584)
FT                   /pseudo
FT                   /locus_tag="Rmag_0569"
FT   gene            complement(621606..623258)
FT                   /locus_tag="Rmag_0570"
FT   CDS_pept        complement(621606..623258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0570"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; KEGG: vfi:VF1754
FT                   methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02321"
FT                   /db_xref="GOA:A1AWL4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWL4"
FT                   /protein_id="ABL02321.1"
FT                   /translation="MTSRKILVTSALPYANGEIHLGHLLEYIQADIWVRFQKMMGNECY
FT                   YVCADDTHGTPIMLKSDELGITPETLIKGVSERHQADFKEFSIGFSKYHSTHSQENKDI
FT                   SANIYHKLNDAGFIKTRIISQAFDPEKQMFLPDRFIKGDCPKCGANDQYGDNCEICGVT
FT                   YSPTELKNAKSIISDATPIAKDSEHYFFDLPQFETQLKAWIKEGHLQDEVSNKLSEWFE
FT                   QGLQQWDISRDAPYFGFQIPDVEGKYFYVWLDAPIGYMASFKKLCDEQGLDFDEYFNKD
FT                   SNTELYHFIGKDIVYFHALFWPAILMGSNYRTPSAIFVHGFLTVNGQKMSKSRGTFIQA
FT                   RTYLNHLNPECLRYYYAYKLSAKIDDIDLNLTDFKQRVNSDLVGKVVNIASRSTGFLVK
FT                   KFNKTLSDYAIDPELYHEFVACGDIIKKHYEARNYNQAMREIMKLADKANQYIDEHKPW
FT                   QLVKKDTKQVHDVTSLAINLFRVLMTYLKPVLPVMAKQAEMFLNIDAFNWQDLKRPLTK
FT                   HQINTFKPLMSRIEDEKIEQVIEASKQNMQVVA"
FT   gene            623343..624425
FT                   /locus_tag="Rmag_0571"
FT   CDS_pept        623343..624425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0571"
FT                   /product="protein of unknown function DUF59"
FT                   /note="PFAM: protein of unknown function DUF59; KEGG:
FT                   tbd:Tbd_2108 ATP-binding protein involved in chromosome
FT                   partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02322"
FT                   /db_xref="GOA:A1AWL5"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWL5"
FT                   /protein_id="ABL02322.1"
FT                   /translation="MADLTNKEIENILSKVVDIYTEQDIVSSNIINDINIDGDKIQVNI
FT                   ELNYPANSYHAILSKTITDTLAKNGINHVSVDIKTKIVKYIVQKGVDVLPEVKNIIAIA
FT                   SGKGGVGKSTTAVNLALALQMEGAKIAILDADIYGPSQPRMLGVSKVKPESTAEGKLLP
FT                   ILGHGIQSMSIGYLVDEDNPMIWRGPMVTQALEQMLRDTLWRGIDYMIIDLPPGTGDTQ
FT                   LTLSQKIPVSGSVIVTTPQDIALIDAKKGLKMFEKVNIPILGIVENMSLHICSECGHQE
FT                   AIFGTGGGETMAADANVEFLGALPLEMDIRTDVDEGTPTVIKDPEGRISEIYKEIAKKV
FT                   SAKLTQQSRATNAFPSITIE"
FT   gene            complement(625471..625809)
FT                   /locus_tag="Rmag_0572"
FT   CDS_pept        complement(625471..625809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0572"
FT                   /product="ferredoxin, 2Fe-2S type, ISC system"
FT                   /note="TIGRFAM: ferredoxin, 2Fe-2S type, ISC system; PFAM:
FT                   ferredoxin; KEGG: reu:Reut_A1064 ferredoxin, 2Fe-2S type"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02323"
FT                   /db_xref="GOA:A1AWL6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR011536"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWL6"
FT                   /protein_id="ABL02323.1"
FT                   /translation="MPQIIVLPHHELCSEGIVIETQSGVSVCDALLANDIEIEHACEMS
FT                   NACTTCHIYLREGFDSVEESDEIEDDLLDKAWGLDPNSRLSCQTIMGDTDLVIEIPKYT
FT                   INQVSENH"
FT   gene            complement(625833..627677)
FT                   /locus_tag="Rmag_0573"
FT   CDS_pept        complement(625833..627677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0573"
FT                   /product="Fe-S protein assembly chaperone HscA"
FT                   /note="TIGRFAM: Fe-S protein assembly chaperone HscA; PFAM:
FT                   Heat shock protein 70; KEGG: pha:PSHAa2667 heat shock
FT                   protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02324"
FT                   /db_xref="GOA:A1AWL7"
FT                   /db_xref="InterPro:IPR010236"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="InterPro:IPR042039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWL7"
FT                   /protein_id="ABL02324.1"
FT                   /translation="MALLQISEPGQVSAIHQHKLAIGIDLGTTNSLVASVMSGQSKVLI
FT                   HENNETILPSVVHCGKDNKLTVGCNAYHYAKTDPTNTIISVKRFMGMSYKEVSTFKNCP
FT                   YQLLENGNNVLFHTATGDLSAVEISASILASLKQCAEKSLGGALFGAVITVPAYFNDAQ
FT                   RQATKDAATLAGLKTLRLLNEPTAAAVAYGLESGEEGVHAIYDLGGGTFDISILSFSKG
FT                   VFKVLAISGDSTLGGDDFDALIVDDCIKQLGINKLTPTQMQKIKQFSRTAKETLSNHEF
FT                   AKFNCIEKSYRITKKKFEILAKVLIKRTLLLTKRAIRDAQVDVEDIKDIIMVGGSTRMP
FT                   LVRFMVSDLFNKPVLCSINPDEVVAKGAAIQANILAGNKSQGDVLLLDVLPLSLGLETM
FT                   GGLVEKVIHRNTTIPIIRAQEFTTFKDGQTAMSVHVLQGERELVKDCRSLAKFDLQGIP
FT                   PMVAGSARIQIEFQVDTDGLLSVSAVEQISGVKTNITIKPSYGLTDVQMEKMLKDSILF
FT                   AKTDIQTRQLHETQVEANRTIQAIDLALKKDKHMLDVKMLNNILTARTILFNMAHSDDE
FT                   KAIKTALENLENTCSKFVEMRMNNTVMKAMQGHNVDEF"
FT   gene            complement(627693..628208)
FT                   /locus_tag="Rmag_0574"
FT   CDS_pept        complement(627693..628208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0574"
FT                   /product="co-chaperone Hsc20"
FT                   /note="TIGRFAM: co-chaperone Hsc20; PFAM: heat shock
FT                   protein DnaJ domain protein; HSCB oligomerisation domain
FT                   protein; KEGG: sdy:SDY_2723 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02325"
FT                   /db_xref="GOA:A1AWL8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWL8"
FT                   /protein_id="ABL02325.1"
FT                   /translation="MENYFELFSLAADFDINITKLNIEYQQQVVKFHPDKFVSGSNKER
FT                   ALALQNTSLINTAFDTLKSPLNRASYLLELNGINVFDEKDTTMTVDFLMSQIELREVLE
FT                   SIQISKDETALDNFTERIDEKIKHNIDSIRASFANIKALNEIKDLVRELKFYEQLNVHA
FT                   KQLMDEWL"
FT   gene            complement(628221..628544)
FT                   /locus_tag="Rmag_0575"
FT   CDS_pept        complement(628221..628544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0575"
FT                   /product="iron-sulfur cluster assembly protein IscA"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; iron-sulfur cluster assembly protein IscA; PFAM:
FT                   HesB/YadR/YfhF-family protein; KEGG: vvy:VV0757
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02326"
FT                   /db_xref="GOA:A1AWL9"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR011302"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWL9"
FT                   /protein_id="ABL02326.1"
FT                   /translation="MAITLTDRAVERVADFLTNRGFGIGIRLSVQTTGCSGLGYNIEFV
FT                   DNTNNDDTVFEGNDIKVIVDAKSLIYLDGTQVDYIKEGLNEGFEFNNPNAKAECGCGES
FT                   FTV"
FT   gene            complement(628551..628928)
FT                   /locus_tag="Rmag_0576"
FT   CDS_pept        complement(628551..628928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0576"
FT                   /product="FeS cluster assembly scaffold IscU"
FT                   /note="TIGRFAM: FeS cluster assembly scaffold IscU; PFAM:
FT                   nitrogen-fixing NifU domain protein; KEGG: par:Psyc_1478
FT                   nitrogen-fixing NifU-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02327"
FT                   /db_xref="GOA:A1AWM0"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWM0"
FT                   /protein_id="ABL02327.1"
FT                   /translation="MAYGEKVMDHYENPRNVGVLDKDAKNVGTGMVGAPACGDVMRLQI
FT                   QVDDNGVIEDAKFKTYGCGSAIASSSLLTEWVKGKTLNEAAEIKNSDIAEELSLPPVKI
FT                   HCSVLAEDAIKAAINDIKSKA"
FT   gene            complement(628988..630202)
FT                   /locus_tag="Rmag_0577"
FT   CDS_pept        complement(628988..630202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0577"
FT                   /product="cysteine desulfurase IscS"
FT                   /note="TIGRFAM: cysteine desulfurase IscS; PFAM:
FT                   aminotransferase, class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG: msu:MS1726
FT                   cysteine sulfinate desulfinase/cysteine desulfurase and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02328"
FT                   /db_xref="GOA:A1AWM1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWM1"
FT                   /protein_id="ABL02328.1"
FT                   /translation="MSTPTYMDYSATTPVDERVAQKMMQYLTTDGNFGNPASNSHYYGW
FT                   KADEAVKKARHQVADLVGADSKEIVWTSGATESDNLAIKGIAHFYHKKGNHIITLKTEH
FT                   KAVLDTCRQLERENYEATYLDPMPNGLLDLNVLKKAIREDTILVSIMHVNNEIGVIQDI
FT                   EAIGNLCRENKIFFHVDAAQSAGKVTIDLSKLPVDLMSFSAHKIYGPKGMGALYVRRKP
FT                   RVRIEAQMHGGGHERGMRSGTLATHQIVGMGEAFAIAQAEMKEENSKIRQLRDRLLAGF
FT                   VNMEEVVINGDMKNRIPGNLNISFNYVEGESLMMAVNDIAVSSGSACTSSSLEPSYVLR
FT                   ALGLSDELAHSSIRFTIGRYTTEAQVDKAINLVRTKVDKLRDLSPLWDMFKDGIDISKV
FT                   EWTAH"
FT   gene            complement(630205..630624)
FT                   /locus_tag="Rmag_0578"
FT   CDS_pept        complement(630205..630624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0578"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: putative transcriptional regulator, Rrf2
FT                   family; PFAM: protein of unknown function UPF0074; KEGG:
FT                   tcx:Tcr_0617 transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02329"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWM2"
FT                   /protein_id="ABL02329.1"
FT                   /translation="MQLTTKGRYAVIAMLDLASNDTGKPITLDIISQRQNISLSYLEQL
FT                   FAKLRRAELVKSVRGPGGGYLLDAKVSDINLTQIIEAVDENIDLRRCKGIKGCNNGRQC
FT                   ISHQLWCEVSQQIRTFLNGKTLQMVIDDHSSNKGV"
FT   gene            complement(630710..631408)
FT                   /locus_tag="Rmag_0579"
FT   CDS_pept        complement(630710..631408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0579"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="TIGRFAM: serine O-acetyltransferase; KEGG:
FT                   tcx:Tcr_0616 serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02330"
FT                   /db_xref="GOA:A1AWM3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWM3"
FT                   /protein_id="ABL02330.1"
FT                   /translation="MKFFEDIKSIFNRDPAARNTFEIITCYSGVQAMLFYRLSHRLWRL
FT                   KFKWLAKFISSLARWFTGVEIHPGAIIGRRFFIDHGMGVVIGETAEIGNDCTLYHGVTL
FT                   GGTTWQKGKRHPTLGNNVVIGAGAKILGPITLGNHVRVGSNSVVVKSINEFQTVVGVPG
FT                   RVLKDQQVKSNHFDSYAVGGDVYDPTVKAINSILAHLHDVDSQLHKVSKKLNIKDQQDT
FT                   SVNDLEIESK"
FT   gene            complement(631473..632279)
FT                   /locus_tag="Rmag_0580"
FT   CDS_pept        complement(631473..632279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0580"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   tcx:Tcr_0183 lipid A biosynthesis acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02331"
FT                   /db_xref="GOA:A1AWM4"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWM4"
FT                   /protein_id="ABL02331.1"
FT                   /translation="MPLRLNHFIGTLIGQCLYLTKSDSRAVVSKNIQLCFPKFNLEQQQ
FT                   ILIKKSLIESGKSLSESGFIWFRNFDDNAKYITKKIGIEYLKSDKTVILLVPHFGCWEL
FT                   VARMVSLSEPVVFMYKALKNKQQNALLLSKREQGDLFMASANKKGIIKLQRAINNKQLI
FT                   AILPDQDPGEVGSILAPFFSQNTRTMTLLARLARKNNAQVVMAWAKRLPIAKGYELNLK
FT                   PVKILSDTNTLEDDVSLMNKAIEDLVITQPEQYLWNYKRFKSVVKY"
FT   gene            complement(632305..633096)
FT                   /locus_tag="Rmag_0581"
FT   CDS_pept        complement(632305..633096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0581"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: tcx:Tcr_0182
FT                   PP-loop"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02332"
FT                   /db_xref="GOA:A1AWM5"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWM5"
FT                   /protein_id="ABL02332.1"
FT                   /translation="MVFTSKINNPKNTHTIKLRMILPKLLVKPVGRAISDFKMIKERDK
FT                   ILLAVSGGKDSLSLFHILRHFLASAPISFELGVVTIDPQVDGFEPQALKSFFKKFDVPY
FT                   FFESFPIMKQAEKSMKGNSYCSFCARIKRGLMYQVARREGYNVLALGQHLDDLAESLIM
FT                   SICHNGKIQTMKAHYINDAKDLRIIRPLAYVRERQLANFAKTICLPVIKDSCPACYQMP
FT                   TERVHFKHWLLTEEKRTPNLYKNLLSAMKPMLNEAKECLND"
FT   gene            complement(633947..635338)
FT                   /locus_tag="Rmag_0582"
FT   CDS_pept        complement(633947..635338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0582"
FT                   /product="Outer membrane protein-like protein"
FT                   /note="KEGG: bfr:BF4142 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02333"
FT                   /db_xref="GOA:A1AWM6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWM6"
FT                   /protein_id="ABL02333.1"
FT                   /translation="MKKNLTTALIFITCLDVQAITQNEFIKRLKDTHPFFTQLDLSVQI
FT                   KKIDQQATTANQDWIVSVNTNFKSEDVNNISSITTYNNLNTTLVDFSATKKIVSLGANI
FT                   TLKHSWKDKNKATTASLNTNRNKFSIDYVHPLLKNASGINDRLNIDLSNIDIQISKLEA
FT                   TEQQEVFILTQLKKFIDLAYAQVRLMINNQRLNLAIQELTLVKQKFTMLVVDKVDVLLQ
FT                   EDAYQSAKQQQLQAQQDLNILRHEMAITLDISFSDVKAEFDLYQRYTTNDDNLKQYLLT
FT                   NSRILKIADLSQDLLKRQLKSDRNNSKVQLDLKFGISSEGEDSRYIDSIFNQSPSWNIG
FT                   LELSYPIGSTQAKSTIEKTQIKLARAKEQKQEKLLNIHAKAKALKQKIQYLVEILESNK
FT                   MQIKIAKARTKEEKRRYNNTNSQTSFVISAQNNEQSVNLNHIQVAKKYQQSVLDFKATI
FT                   DQLLP"
FT   sig_peptide     complement(635279..635338)
FT                   /locus_tag="Rmag_0582"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.784) with cleavage site probability 0.750 at
FT                   residue 20"
FT   gene            complement(635335..635856)
FT                   /locus_tag="Rmag_0583"
FT   CDS_pept        complement(635335..635856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0583"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: csa:Csal_0613
FT                   shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02334"
FT                   /db_xref="GOA:A1AWM7"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWM7"
FT                   /protein_id="ABL02334.1"
FT                   /translation="MSGNSSNIVLVGPMGSGKTSVGRRLACSLKRDFFDSDFEIVARTG
FT                   VAIEHIFDVEGEQGFRKRETQMLADLCEIKNIIIATGGGIVINLKNREMLKHDNFVVYL
FT                   SSTIEQLLKRTINSKSRPLLEQSSNREKIIRDLVSKRESLYQEVADVVIDTTDKKLYVI
FT                   INEIKKVVSA"
FT   gene            complement(636053..636982)
FT                   /locus_tag="Rmag_0584"
FT   CDS_pept        complement(636053..636982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0584"
FT                   /product="branched chain amino acid aminotransferase
FT                   apoenzyme"
FT                   /EC_number="2.6.1.42"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase, class IV; KEGG: hch:HCH_01045
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02335"
FT                   /db_xref="GOA:A1AWM8"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWM8"
FT                   /protein_id="ABL02335.1"
FT                   /translation="MHTFDNRDGLIWFDGEWVDWREAKVHVLTHTLHYGMGVFEGVRAY
FT                   ETQKGPAIFRLEEHTNRLFNSAKIMNMNIGFSKDELNQAQKDAVVKNNLDSAYIRPMCF
FT                   YGSEGMGLRADGLKVHTIIAAWKWGSYLGEDNMKNGIRIRTSSYARHHVNVAMTKAKAN
FT                   GNYINSMLALQEALTDGYDEALMLDVDGFVAEGSGENIFIMQNDVIYTPDLTSALAGIT
FT                   RDTVFKLATDLGYEVIEKRITRDEVCIADEAFFTGTAAEITPIRELDNRTIGLGTCGPV
FT                   TEQLQTLYFDSVYGRNEQYQHWIAKGFC"
FT   gene            complement(636985..638208)
FT                   /locus_tag="Rmag_0585"
FT   CDS_pept        complement(636985..638208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0585"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: hch:HCH_05208 asparate kinase, monofunctional
FT                   class; TIGRFAM: aspartate kinase; aspartate kinase,
FT                   monofunctional class; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02336"
FT                   /db_xref="GOA:A1AWM9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWM9"
FT                   /protein_id="ABL02336.1"
FT                   /translation="MALIVQKYGGTSVVSAERIQAVAQKIKAFKETGNQLVVSVSAMSG
FT                   ETNRMTALAQTIQNTPSLREMDVLLTTGEQVTIALLTMALQQLGCDAISYTGSQVRIMT
FT                   DSEHSKARIKSIDDHRICQSLAQGKVVVVAGFQGVDENGHITTLGRGGSDTTAVALAAV
FT                   LKANECQIYTDVDGVFTTDPRIEPNARKMNVVSYEEMLEMASLGSKVLQIRSVELASKY
FT                   KVPLRVLSSLIDNPVGTLITSEENIVEQAVISGIAYNKDEAKLSLIGVPDKPGIAFKIL
FT                   SQISAANIEVDMIVQSVSAREGLTNFAFTVHRNDFKIASKILDRLCQELSAIAVQSDNK
FT                   VVKVSLVGIGMCSHVGIASKMFEVLHNEGVNIQMISTSEIKISVVIDEKYLELAVRSLH
FT                   VVFELDKE"
FT   gene            complement(640785..641027)
FT                   /locus_tag="Rmag_0586"
FT   CDS_pept        complement(640785..641027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02337"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWN0"
FT                   /protein_id="ABL02337.1"
FT                   /translation="MLIIFIVLIIILSPGKVKDITALISRSKDSKPLTLILERYLNNKP
FT                   KSANIINAQDLPIFRSDKLKGAGMPITDFKNQNKL"
FT   gene            641235..642485
FT                   /locus_tag="Rmag_0587"
FT   CDS_pept        641235..642485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0587"
FT                   /product="Ste24 endopeptidase"
FT                   /EC_number="3.4.24.84"
FT                   /note="PFAM: peptidase M48, Ste24p; KEGG: neu:NE0076
FT                   peptidase family M48"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02338"
FT                   /db_xref="GOA:A1AWN1"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR027057"
FT                   /db_xref="InterPro:IPR032456"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWN1"
FT                   /protein_id="ABL02338.1"
FT                   /translation="MKFNLFTLIFLIATFSYVITLLWLNVRQSKVVIQSFDKIPNEFRK
FT                   KITLEEHQKAAKYTQAKLKLNYFEIIFSTAVLLLWTLGGGLNYLDNIWQAQINNILYTG
FT                   VGFVISLMVIGSLIDLPFSIYRTFVLEQKFKFNQTDTKTFIMDLLKGVLLMLIIGLPLI
FT                   FAILYLMSVMGEYWWIYVWLVFTGFLLLIFWLYPIYIAPIFNKFKPLDNVELKTKINNL
FT                   LERTGFKSNGVFVMDGSKRSSHGNAYFTGIGKNKRIVFFDTLLKSMNDDEVQAILAHEL
FT                   GHFHYKHIKKHMISSFTISLLGLAFLGYLINQDWFFHGLGISNPSNHTALILFTLTIPV
FT                   FSFFIAPVNNYLSRKYEFEADAFAAKHTNADDLVSSLVKLYKNNAITLTPDYLYSTFHD
FT                   SHPSALIRINQLKTYKQ"
FT   gene            642520..642798
FT                   /locus_tag="Rmag_0588"
FT   CDS_pept        642520..642798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0588"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_3003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02339"
FT                   /db_xref="GOA:A1AWN2"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWN2"
FT                   /protein_id="ABL02339.1"
FT                   /translation="MNQLLLSTMLIASNGTLANEEGRELHKESCITCHIIEHDDTFYTR
FT                   NNSRLHNHFELRHQVRNCVSVFSIDWFPDEEKSVVDHLNSEYYKFKK"
FT   sig_peptide     642520..642576
FT                   /locus_tag="Rmag_0588"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.984 at
FT                   residue 19"
FT   gene            642817..643773
FT                   /locus_tag="Rmag_0589"
FT   CDS_pept        642817..643773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0589"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="TIGRFAM: ribosome small subunit-dependent GTPase A;
FT                   PFAM: GTPase EngC; KEGG: hch:HCH_05392 predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02340"
FT                   /db_xref="GOA:A1AWN3"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWN3"
FT                   /protein_id="ABL02340.1"
FT                   /translation="MHHQKWRLKKTQVERIARTNKASNNFEELPVNTNKKQTGLVITRY
FT                   GQRLLVKANSGELYQCTARRNIDLSIAGDQVIFQITQSNQGIVTALIKRHNQLHRAHKL
FT                   IAANIDQLWLVAAIEPHYQFELIDRYLVVAENAKLPINIVVNKIDLASDMKKIKFDFSM
FT                   YENIGYSVNYLSVKKQININQLKTQLNKKSNIFLGQSGVGKSSLINELIPNLNLGVNEI
FT                   SAKSKLGKHTTTNTILYNIPSGGDLIDSPGIREFQLDELINQEILNGFKEFKPLINACK
FT                   FRNCAHIFEPKCAIKLAVKSGKIHQKRYQSYLTLVSS"
FT   gene            complement(644316..644624)
FT                   /locus_tag="Rmag_0590"
FT   CDS_pept        complement(644316..644624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0590"
FT                   /product="protein of unknown function DUF423"
FT                   /note="PFAM: protein of unknown function DUF423; KEGG:
FT                   oih:OB3027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02341"
FT                   /db_xref="GOA:A1AWN4"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWN4"
FT                   /protein_id="ABL02341.1"
FT                   /translation="MNFFWIFIALGGALVVIMDAMSEHILKGIMQVEDITRIQTAITYQ
FT                   MYHTLMIAILAMYSQRVSFKSRSIDQSIWIFIAGIVLFSGSLYLYTFTKLQGFFFIT"
FT   gene            complement(645473..645548)
FT                   /locus_tag="Rmag_R0022"
FT                   /note="tRNA-Lys1"
FT   tRNA            complement(645473..645548)
FT                   /locus_tag="Rmag_R0022"
FT                   /product="tRNA-Lys"
FT   gene            complement(645635..645940)
FT                   /locus_tag="Rmag_0591"
FT   CDS_pept        complement(645635..645940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0591"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: aba:Acid345_4105 histone-like DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02342"
FT                   /db_xref="GOA:A1AWN5"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWN5"
FT                   /protein_id="ABL02342.1"
FT                   /translation="MICGCFYLYMKKTDLILNLSDSSDLSKIDAKIAVEVILQELTQGI
FT                   VSGQGIEIRGFGGFYKKHRKPRQGINPKTSERTQVGEKFVPFFKPGKLLKEIVNKT"
FT   gene            complement(645961..647637)
FT                   /locus_tag="Rmag_0592"
FT   CDS_pept        complement(645961..647637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0592"
FT                   /product="SSU ribosomal protein S1P"
FT                   /note="TIGRFAM: ribosomal protein S1; PFAM: RNA binding S1
FT                   domain protein; KEGG: mca:MCA1413 ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02343"
FT                   /db_xref="GOA:A1AWN6"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWN6"
FT                   /protein_id="ABL02343.1"
FT                   /translation="MSESFAELFENSVEQQNVKVGSLLMGTIVSINREKAIINVGLKSE
FT                   GFISLDEFKNPQGELEVEEGDIVEVALKSIDDGLGNTLLSYTDAKRIKLWQSLELAMNS
FT                   KEVVTGVVTGAVKGGLTVDIGVVKAFLPGSLVDIRPVKDFSYLIGQEIEATVIKMDEIR
FT                   NNIVISRKAVLQEANSADREILLEGLEEGKEIEGLVKNLADYGAFIDLGGVDGLLHITD
FT                   ISWQRVNHPSEKLTIGDKIIVKVLNYDKEKIRVSLGLKQLTASPWDNISDRLPIGKKVP
FT                   GTVSNLTDYGAFVRIEEGVEGLVHVSEMDWTNANARPSKIVKLGQEVEVVVLDVQESKH
FT                   RISLSMKQAQENPWESFEVTHNKGDKILVSVKSITDFGLFVGLPGGIDGLIHLADISWE
FT                   KQSSDQLVSSYSKGQELEVIILNIDAEKERISLGIKQLLEDNFMQYASANRKGSIVKGV
FT                   IMEVDSHGAIISLGEDITGYLKAGEISENRVDDVTSILKIGEEVEVAIVNVDRRTRNIS
FT                   VSIKAKNSVEEKAAMENYNKQSSDASGSTLGDLLKEAKDNK"
FT   gene            complement(647733..648410)
FT                   /locus_tag="Rmag_0593"
FT   CDS_pept        complement(647733..648410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0593"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="KEGG: hch:HCH_04979 cytidylate kinase; TIGRFAM:
FT                   cytidylate kinase; PFAM: cytidylate kinase region"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02344"
FT                   /db_xref="GOA:A1AWN7"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWN7"
FT                   /protein_id="ABL02344.1"
FT                   /translation="MSQNTIPILTIDGPSGVGKGTVARIVAQKQNWNLLDSGAIYRAFA
FT                   LTVDARKIDISNEEALEKIAQTIDLEFKTKLGNELVSVYLNGKDVSNILRTEKIGGMAS
FT                   KIASIGMVRATLLKWQKDFAKAPGLVADGRDMGTTVFPNALFKVYLTASADERANRRLR
FT                   QMQMQGSKGIISQILAKVKVRDKHDSLRKYSPLKPAKDALIIDTTKLSIDEVITQVVAL
FT                   IEA"
FT   gene            complement(648690..650183)
FT                   /locus_tag="Rmag_0594"
FT   CDS_pept        complement(648690..650183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0594"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (D, K and N); nucleic acid binding,
FT                   OB-fold, tRNA/helicase-type; KEGG: tcx:Tcr_0726 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02345"
FT                   /db_xref="GOA:A1AWN8"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWN8"
FT                   /protein_id="ABL02345.1"
FT                   /translation="MSDQDNNKLIIERKSKLALLREAGNPFVNNFKPENLAQDIIQKFD
FT                   SSSKEALAQKNVQVSIAGRMMLKRVMGKASFVHVQDSSGQIQLFITRDELPENFYNEQF
FT                   KKLDIGDIVGATGVLFKTSVGELSIRISDIKLLTKSLRPLPEKFHGLSDQETRYRQRYV
FT                   DLIMNKTSRNTFKRRSQIVSYIRNFFNNHDFIEVETPMLQTIPGGAIAKSFETHHNALD
FT                   MPMYLRIAPELYLKRLIVGGMDRVFEVSRNFRNEGLSTRHNPEFTMIEFYQAYATYHDL
FT                   MNLTEKLFRGIAFDVYGSANIHYQGNDFDFSKPFECISVFDSILQYNPNLTATNLNQDN
FT                   AKKIAEKLGIQVKENWGLGKIQIEIFEATVEEKLIQPTFITEYPTEVSPLARCNDDNPF
FT                   ITDRFELFIGGREIANGFSELNDAENQAERFKKQVEEKDASDDEAMQYDADYIRALEYG
FT                   MPPTAGEGIGIDRLVMLFTNSPSIRDVLLFPHMRSEIGK"
FT   gene            complement(650622..651059)
FT                   /locus_tag="Rmag_0595"
FT   CDS_pept        complement(650622..651059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0595"
FT                   /product="cytochrome C biogenesis protein"
FT                   /note="PFAM: cytochrome C biogenesis protein; KEGG:
FT                   rme:Rmet_2392 cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02346"
FT                   /db_xref="GOA:A1AWN9"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWN9"
FT                   /protein_id="ABL02346.1"
FT                   /translation="MRYFIQFLFLLELINPAHAENVEVKSFVNNQQQRYQALINEIRCP
FT                   VCQGQSIGSSNAGLAKDLREKVRELILKQNTDDNIRKFMTDRYGDFIVFKPPVNKNTYL
FT                   LWFAPFVFLVLGLFFLVRSLLVKKSSIKSTVDTSKAKNLLK"
FT   gene            651095..652942
FT                   /locus_tag="Rmag_0596"
FT   CDS_pept        651095..652942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0596"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: vvu:VV12632 ATPase component of ABC transporter with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02347"
FT                   /db_xref="GOA:A1AWP0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWP0"
FT                   /protein_id="ABL02347.1"
FT                   /translation="MPLITLDNISLSFSDKPILNEINSTIHKGDKIALIGRNGEGKSTF
FT                   MRILAGTIEPDDGKLKIKKGTKISYLEQTLPQDNDKNLFDIVAEGLGEIGIILKKYKHL
FT                   INDGKLEKVDEVQEKIDQLNGWQYLHKIQAILNRFTLNADTILSTLSGGWRRRVMLAQA
FT                   LIQEPDVLLLDEPTNHMDITAILNLECMLKDYHGTLVLISHDRSFVKSIVNRVFDLDRG
FT                   NLSVFNCDYIDYVKRKGEQLHAEEIANTRFDKKLAQEETWIRQGIKARRTRNEGRVRVL
FT                   QSMRELFINRRTKKGQVKIHALNDENRASKLVFEVKKINYQIADLTLIKDFSMPVLKGE
FT                   KIGIIGDNGTGKSTFIKLLLDELQPNSGFIRRSKTIQLAYFDQMREHLDPNMKAMDFVS
FT                   EGRERIDIGGKNKHIIDYLRQFLFTGKQAMTAIKMFSGGEKNRLMLARILSKPANLLVL
FT                   DEPTNDLDVETLELLEEMLIDYSGTLILISHDRTFLNNIVGSTVVMDGNGIINQYAGGY
FT                   NDYLIQKQDKLNQQKDKPKIKITKKPTENTKKLSYKQQKILKNLLKKIEKVEIKIEKVQ
FT                   LQLLDPEFFQQEKSQDSLIALARLKFDLERYYEKWEALE"
FT   gene            652939..653568
FT                   /locus_tag="Rmag_0597"
FT   CDS_pept        652939..653568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bms:BRA0855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02348"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWP1"
FT                   /protein_id="ABL02348.1"
FT                   /translation="MIPLIVDLDHTLINTDLLYESSMGVLNKNPLLIFIYPFWFLHGKG
FT                   HLKEQLTKRFSIDVSTLPYNQNVIDYIKKRKKQGDKIILATASHKLYAFAVSNYLKIKK
FT                   TQAKNKQQDFDLFTHNDQQTTVKKIDLFDDVMASNKNFNLSSYNKAEKLIERFGDKGFD
FT                   YMGDHMRDLPIWEVSNLSILVNASNKVINKTKHLNTLILSKKVHYF"
FT   gene            complement(653849..655633)
FT                   /locus_tag="Rmag_0598"
FT   CDS_pept        complement(653849..655633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0598"
FT                   /product="Excinuclease ABC subunit C"
FT                   /note="TIGRFAM: excinuclease ABC, C subunit; PFAM:
FT                   Excinuclease ABC, C subunit domain protein; excinuclease
FT                   ABC, C subunit domain protein; UvrB/UvrC protein; KEGG:
FT                   plu:plu2027 excinuclease ABC subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02349"
FT                   /db_xref="GOA:A1AWP2"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWP2"
FT                   /protein_id="ABL02349.1"
FT                   /translation="MLIQEKLKNLTTNPGVYQMFDKQDQVIYVGKAKNLKNRVSSYFVK
FT                   THEQNKARVLVANIKDFKVIVTATETQALLLESELIKQHMPRYNILLKDSKSYPYIFIS
FT                   HDKHPRVGFYRGKKCQSAQYFGPYPSAHVVRDSLSLLKKIFKVRQCTNSTYRSRSRPCL
FT                   EYQIGLCSAPCVNKISDENYQSDVLMMSLFLSGKGRETLERVSKKMQLASKNLEFELAA
FT                   RLRDQLIDLRTIQEQHTSSSSNDLDVVSIAQQDGVNGVEVLFIRSGKQIGQVFILPKNS
FT                   NNQDIKQVLSAFLPLYYLGKNTPKQILISHKLSDKKIIASALNTHIIDTPNKDKKHYLN
FT                   IANLTAKENLNQNLLSKFRKKSTLVHLQVILGLGKLPNYIECFDISHMMGEATVASCVV
FT                   FEKGVPKASQYRQFDIKNIIPGDDYAAMNQVVYRRYSKLLKDKKPLPDIIFIDGGLGQF
FT                   NQAIMVMNSIGVDDVQLVGIAKGENRKAGLETLITIKDDNVNKINLLPYDPALMLVNHI
FT                   RNESHRFAIKNHRKKRASRRTTSILESIKGVGKLRRMALLNYFGGLQEIKKASIHEIQK
FT                   VSGINLVLATKIVKKIKS"
FT   gene            655761..656345
FT                   /locus_tag="Rmag_0599"
FT   CDS_pept        655761..656345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0599"
FT                   /product="toluene tolerance family protein"
FT                   /note="PFAM: toluene tolerance family protein; KEGG:
FT                   neu:NE2381 putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02350"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWP3"
FT                   /protein_id="ABL02350.1"
FT                   /translation="MSNITHQAIVNIIDPPNSAALNIMVSVLSSLKELKKQKKDTKQNV
FT                   EALVRLKLLPNIAIGVFTKIALSKHWDGLNIQQKQFFQYYFSESLIQDYVGILSNYDKL
FT                   DSVQISVDPDIKHKDHKAIVKLIININDNLKPSIIFLRMIRLNIWHIYDIVFSGVSIVK
FT                   NYRAQFNSYIKHKGIDSLILKLKKKLERLSK"
FT   gene            656345..657604
FT                   /locus_tag="Rmag_0600"
FT   CDS_pept        656345..657604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0600"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   noc:Noc_2780 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02351"
FT                   /db_xref="GOA:A1AWP4"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWP4"
FT                   /protein_id="ABL02351.1"
FT                   /translation="MYKLIINGGIALNGHVKTAGSKNSSLPILFASILANGPITLTNTP
FT                   HLSDVSTTLRLLMDMGAEFILESDNSLFIDSSNLTNLVAQYNLVKTMRASILALGPMLA
FT                   KYCKAKISLPGGCAIGSRPVNLHLKALEDLGAFIKVENGYIYATAKKLIGTEIHFDQIS
FT                   VTATENIIMAATLATGITTIYNAAQEPEIVDLINCLIKMGAKISGAGTSIITIEGVDEL
FT                   SGVTYAVCPDRIEAGTYLVAATITGGKITIKNVCYQSMRAILVKLLETGADIKTEKNSI
FT                   TLDMKGKRPKAVNIKTSTYPNFPTDMQAQFTALNAIADGYSTITETIFENRFMHIPELS
FT                   RMGASLVLEGNTVVCKGVKSLTGAYLMATDLRASASLVLAGLAAIGTTTIERVYHLDRG
FT                   YEMIEEKLKLLGAQIERVQD"
FT   gene            657610..658227
FT                   /locus_tag="Rmag_0601"
FT   CDS_pept        657610..658227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0601"
FT                   /product="ATP phosphoribosyltransferase (homohexameric)"
FT                   /EC_number="2.4.2.17"
FT                   /note="PFAM: ATP phosphoribosyltransferase; KEGG:
FT                   noc:Noc_2779 ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02352"
FT                   /db_xref="GOA:A1AWP5"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWP5"
FT                   /protein_id="ABL02352.1"
FT                   /translation="MLTIALSKGRILEQTLPLLEKSGLIIAKEELNSRKLILDTNLTDV
FT                   QVIIIRATDVPVFVQHGAADIGIAGKDVLLEHGANNLFEVLDLDITKCKLMVAAESKDK
FT                   LKQNTLKIATKYVNSTKRYFQNKGQSCEIIKLYGAMELAPKVGLAHCIVDLVDTGNTLK
FT                   ANGLIAVERIEEISSRLVVNTASFKTKNAQIKSWIQNIEYNL"
FT   gene            658224..659531
FT                   /locus_tag="Rmag_0602"
FT   CDS_pept        658224..659531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0602"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="PFAM: histidinol dehydrogenase; KEGG: pfo:Pfl_0871
FT                   histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02353"
FT                   /db_xref="GOA:A1AWP6"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWP6"
FT                   /protein_id="ABL02353.1"
FT                   /translation="MITKLTSTQSDFQEKLTSLLVCNSFYNKEVTQTVDDIITNVRNNG
FT                   DSALIDYTNKFDGVNVSNMKNLTIKLPALKQAFNTLNKKQKSALTIAANRVHLYHEKQK
FT                   QSTWTYIEDDGTMLGQKITPLDRVGLYVPGGKAAYPSSVLMNAIPAKVAGVESLIMVVA
FT                   TPNGISNLLVLAAAYISGITQVFTVGGAQAIAALAYGTQTIPKVDKIVGPGNIYVTTAK
FT                   RAVFGQVGIDMIAGPSEILIICDGKTNPDWIAMDLFSQAEHDEDAQSILLCPDTDFINQ
FT                   VEKSIAKLLPTMDRKAIIKTALKDRGVLIHTKDMNEAITLSNQIAPEHLELSVEDPQVM
FT                   LNDIKHAGAIFMGRHTCESLGDYCAGPNHVLPTSGTARFSSPLGVYDFQKKSSLIMVSR
FT                   QGANTLGKVAAILADGEGLQAHAQSAKYRIIHQHKI"
FT   gene            659752..659979
FT                   /pseudo
FT                   /locus_tag="Rmag_0603"
FT   gene            complement(660101..661495)
FT                   /locus_tag="Rmag_0604"
FT   CDS_pept        complement(660101..661495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0604"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /note="KEGG: tcx:Tcr_0998 signal recognition particle
FT                   protein; TIGRFAM: signal recognition particle protein;
FT                   PFAM: GTP-binding signal recognition particle SRP54, G-
FT                   domain; Signal peptide binding (SRP54) M- domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02354"
FT                   /db_xref="GOA:A1AWP7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWP7"
FT                   /protein_id="ABL02354.1"
FT                   /translation="MFDNLTERLQNSFKVLQGKNKLSESNIKEAIREVRRALLEADVAL
FT                   EVIKVFLDQVQTKVLGLKVGQGLTPAQAFIKLVEIELTEIIGGEAESLDLKIQPPAVIM
FT                   LAGLQGAGKTTSIAKLALYLKQRENKKVLVVSADVYRPAAIEQLEVLAKQVEVNFFPST
FT                   IDDKPSDIVASAKKYAQKQFFDVLLVDTAGRLHIDEQMMDEIKVLQKKVNPIETLFVVD
FT                   SMTGQDAAHTAKAFADALPLTGVILTKIDGDARGGAALSVRHITGKPIKFLGVGEKIDT
FT                   LEPFHPERVVSRLLGMGDVLSLVEEISRKVDHKKVQKYTRQMAKGQFDLSDMRDQLLQM
FT                   EQMGGMEALMDKLPGMGQVPQNVKNQMIVGTETKKMIAIINSMTPKERNHIKLIKGSRK
FT                   MRIANGSGTNIQVVNKLIKQFEKMQKKMSSGKIQKMMAKMAGTDGMPDFSKIKLSNMGV
FT                   GNKFLF"
FT   gene            661558..662343
FT                   /locus_tag="Rmag_0605"
FT   CDS_pept        661558..662343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0605"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   mca:MCA1337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02355"
FT                   /db_xref="GOA:A1AWP8"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWP8"
FT                   /protein_id="ABL02355.1"
FT                   /translation="MFLSYFAIALYLAAALLLMRYFVKNETQHQHQKTIFLLVSFAIIV
FT                   QALTFNHFWSEKGIIFGLANSASFVTWMIAVLLFLSSLSKPVHVLGILVYPLVAFTLVF
FT                   SIIFPDTTSKVIPLNISLHVFLSITAYALLALAVCQSVLLKIQEKHLHARKVNDFINKL
FT                   PALQTMETLLFQSLKIGFYLLTLSLLSGFIFIQDIFAQHLIHKTALSIIAWIIFATLVF
FT                   GRKAFGWRGKQAITATQIGFGILVVAYFGSKFVLERLLN"
FT   gene            complement(662388..664175)
FT                   /locus_tag="Rmag_0606"
FT   CDS_pept        complement(662388..664175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0606"
FT                   /product="GTP-binding protein LepA"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM: elongation
FT                   factor G domain protein; protein synthesis factor,
FT                   GTP-binding; elongation factor Tu, domain 2 protein;
FT                   GTP-binding protein LepA; KEGG: tcx:Tcr_0732 small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02356"
FT                   /db_xref="GOA:A1AWP9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWP9"
FT                   /protein_id="ABL02356.1"
FT                   /translation="MKNIRNFSIIAHIDHGKSTIADRFIQFCGGLSDREMSAQVLDSMD
FT                   IEKERGITIKSQSVTLDYQARNNETYQLNFIDTPGHVDFSYEVSRSLSACEGALLIVDA
FT                   SQGVEAQTIANCYTALDQGLEVVPVLNKIDLPAADPDRVVDEIEDVIGVEAHDAVYASA
FT                   KSGMGIEDILEQIVEKIPAPKGNIDSPIKALIIDSWFDNYLGVVSLIRVIDGEIRTKTK
FT                   IKIFSNGKEHLVDEVGVFRPKRKKTNSLKAGEVGFLIASIKNIDGAPVGDTITGAKNSA
FT                   SKPLEGFKPVQPRVFSGIFPISGEDYEKFRDALAKLRLNDAALQYEPENSDALGFGFRI
FT                   GFLGLLHMEIVQERLEREYNLNLITTAPTVIYEILDTKGVIYRIDSPSKIPINQSIAEF
FT                   REPIITANILVTDEYVGVIISLCVEKRGVQKNITYMGGQVSLVYELPLNEVVFDFFDRL
FT                   KSISRGFASMDYRFERYQKSDLIRLDIMINQEPVDVLALIIHRNDSVHKGRELVEKMKK
FT                   LIPRQMFDVTIQACIGSKIISRSNVKALRKNVTAKCYGGDISRKRKLLDKQKKGKKRMR
FT                   SVGKVNIPQEVFLAVLHID"
FT   gene            664217..664666
FT                   /locus_tag="Rmag_0607"
FT   CDS_pept        664217..664666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0607"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   csa:Csal_2817 alkyl hydroperoxide reductase/thiol specific
FT                   antioxidant/Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02357"
FT                   /db_xref="GOA:A1AWQ0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWQ0"
FT                   /protein_id="ABL02357.1"
FT                   /translation="MNKVQPITCTATSDLEINIPDTQGRHIVLYFYPKDATPGCTTEGQ
FT                   DFRDNHQAFADANTVIYGVSKDDLTKHEKFKAKQNFPFELITDVGGTLCELFNVWQLKK
FT                   FMGSEYMGIVRSTFLIDANGNILKHWNKVKVKGHAEEVLAYLQAL"
FT   gene            664663..665367
FT                   /locus_tag="Rmag_0608"
FT   CDS_pept        664663..665367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0608"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /note="KEGG: psp:PSPPH_3670 ubiquinone biosynthesis
FT                   O-methyltransferase; TIGRFAM: ubiquinone biosynthesis
FT                   O-methyltransferase; PFAM: NodS family protein;
FT                   Methyltransferase type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02358"
FT                   /db_xref="GOA:A1AWQ1"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWQ1"
FT                   /protein_id="ABL02358.1"
FT                   /translation="MSNIDFNEVDKFAALASRWWDKNSEFKPLHDINPLRLNYIKEKCG
FT                   CSLKGKKILDVGCGGGILAESLALEGAIVTGIDMAEAGLEVAKLHLIESDLEVDYQKIP
FT                   VEKFTEQYTEKFDVITCLEMLEHVPDPSSIVKACSKLVKPSGQVFFSTINRNIKSYLFA
FT                   IIGAEYILKLLPKGTHDWNKFIQPSEMDEWARDSSLSLKSMIGITYNPLKKTYKFENDV
FT                   SVNYLSYYQKQL"
FT   gene            665379..665687
FT                   /locus_tag="Rmag_0609"
FT   CDS_pept        665379..665687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02359"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWQ2"
FT                   /protein_id="ABL02359.1"
FT                   /translation="MKKILTFLLLTTTGLNGLALSPNKMLAIVGAVKYYNENCGGLNLA
FT                   GLRRMNKGLKRFKMHKIPRPLLEQHPLSISSYQTAEKFGCTGTKNEAYKAGFGQYIN"
FT   sig_peptide     665379..665438
FT                   /locus_tag="Rmag_0609"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.961 at
FT                   residue 20"
FT   gene            complement(665684..666067)
FT                   /locus_tag="Rmag_0610"
FT   CDS_pept        complement(665684..666067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0610"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /EC_number="2.7.8.7"
FT                   /note="KEGG: mfa:Mfla_1012 phosphopantethiene--protein
FT                   transferase domain; TIGRFAM: holo-acyl-carrier-protein
FT                   synthase; Phosphopantethiene-protein transferase; PFAM:
FT                   4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02360"
FT                   /db_xref="GOA:A1AWQ3"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWQ3"
FT                   /protein_id="ABL02360.1"
FT                   /translation="MIYGVGIDIINIKRVEHILSKNKQSFVKRVLSEHEQALFANKGDS
FT                   AAYCAKRFAAKEAFAKALGTGIGKIISFQDLTVRNNENGKPNFFLSEKLRLYLVNKNIK
FT                   QAHLSLSDEKFNTVAFVILETED"
FT   gene            complement(666064..666789)
FT                   /locus_tag="Rmag_0611"
FT   CDS_pept        complement(666064..666789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0611"
FT                   /product="pyridoxine 5'-phosphate synthase"
FT                   /EC_number="2.6.99.2"
FT                   /note="TIGRFAM: pyridoxal phosphate biosynthetic protein
FT                   PdxJ; PFAM: Pyridoxal phosphate biosynthetic protein PdxJ;
FT                   KEGG: neu:NE2322 pyridoxal phosphate biosynthetic protein
FT                   PdxJ"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02361"
FT                   /db_xref="GOA:A1AWQ4"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWQ4"
FT                   /protein_id="ABL02361.1"
FT                   /translation="MSIYLGINIDHIATIRQVRGTNYPSLIEAALLCEKSGADSITLHL
FT                   REDRRHIQDADVEILCNQLTTKMNLEMAATNEMITIASKIKPQDCCLVPEKREELTTEG
FT                   GLDVASQISRMKDVCLRLSESKIIVSLFIDAQKDQIDAARECSAPVIELHTGHYVNATN
FT                   EMQLVEFEKIKTMTTYAHSIGLQVNAGHGLTLENTTSIAKLPEIVELNIGHSIIARAVF
FT                   VGLEVATREMKTLMLEARL"
FT   gene            complement(666872..667268)
FT                   /pseudo
FT                   /locus_tag="Rmag_0612"
FT   gene            complement(667455..668381)
FT                   /locus_tag="Rmag_0613"
FT   CDS_pept        complement(667455..668381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0613"
FT                   /product="GTP-binding protein Era"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding;
FT                   GTP-binding protein Era; PFAM: GTP-binding protein,
FT                   HSR1-related; KH, type 2 domain protein; Miro domain
FT                   protein; KEGG: tcx:Tcr_0735 GTP-binding protein Era"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02362"
FT                   /db_xref="GOA:A1AWQ5"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWQ5"
FT                   /protein_id="ABL02362.1"
FT                   /translation="MNPKQFKISNKTTKLNFKSGFIAVVGRPNVGKSTLVNELIGQKLS
FT                   ITSHRPQTTRHRIHVIDTTDDYQMVFVDTPGIHMGNCKAINSYMNKAASSTIANVDVIL
FT                   WLTEVGKWTKEDSRVLEHITRIKTPVILCINKIDKLKYAKEVLPFLDKVSQKYQPTDLF
FT                   PLSAFKKNDIHALRKLVLHYLPEQALIFDADYITNRSEKFIVSEFIREKLMRHLKDELP
FT                   YDLTVEIEQFEQNGNLQRISARIFVDKASQKNIVIGNKGVMLKLIGTEARKSIEGFLDR
FT                   KVFLKLWVKVKQGWSNDKRALASLGYN"
FT   gene            complement(668378..669043)
FT                   /locus_tag="Rmag_0614"
FT   CDS_pept        complement(668378..669043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0614"
FT                   /product="RNAse III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: ribonuclease III; double-stranded RNA binding
FT                   domain protein; KEGG: vfi:VF2087 ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02363"
FT                   /db_xref="GOA:A1AWQ6"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWQ6"
FT                   /protein_id="ABL02363.1"
FT                   /translation="MKKLQKKINYQFKDLSLLKLALTHCSMGKNNNERLEFLGDSILGV
FT                   IISKELYQRFPNIDEGKLSRLRSHLVRDQTLTQLSAGLELSNSLILGFGELKSGGYRRE
FT                   SIQADAIEAIFGAVLLDSNFETTSTVVLDLFEMLLNNISPDDSLKDPKTQLQEYLQKYG
FT                   NVLPKYELTDTIGKDHNAIFTINCLLKDQNLQVSQSAKSIKKAEQSCAQTLLKKLKES"
FT   gene            669120..669782
FT                   /locus_tag="Rmag_0615"
FT   CDS_pept        669120..669782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0615"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_2487 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02364"
FT                   /db_xref="InterPro:IPR014174"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWQ7"
FT                   /protein_id="ABL02364.1"
FT                   /translation="MFWQEDTKKEHFTLPETIQDAVFNIFAKILPINHSFLLAQTLLKH
FT                   LPWLDEVDAGIFNISVADGNGWTQNHKDGFYYPSKRSKLTIRVPKDKLYETQQLLGKTL
FT                   DLGKYQIKIIKSLKPKLLSDMPVLFSKNIACNEAMSEDDFLQVTFEQLKILGISVKKMM
FT                   VGLEKNIKTDTHIIHTRSLMIADLKKDESVLLQEKGLGDYRLLGCGLFIPHKDITSI"
FT   gene            complement(670751..671545)
FT                   /locus_tag="Rmag_0616"
FT   CDS_pept        complement(670751..671545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0616"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="PFAM: thymidylate synthase; KEGG: rme:Rmet_2568
FT                   thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02365"
FT                   /db_xref="GOA:A1AWQ8"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AWQ8"
FT                   /protein_id="ABL02365.1"
FT                   /translation="MKQYLDFLRLVKNTGTNKTDRTGIGTTSLFGYQMRFDLSDGFPLI
FT                   TTKRVHLPSVVHELLWFLSGATNIKYLQENGVRIWNEWADKNGDLGPIYGVQWRNWQNV
FT                   RGESIDQIMQVIEQIKNTPDSRRIIVSAWNVGELENMALPPCHAFFQFYVALGKLSCQL
FT                   YQRSADVFLGVPFNIASYALLTHMMAQQCDLEVGDFIWSGGDCHIYSNHTKQVEIQLAR
FT                   TPKTLATLKINNKPDSIFDYNFEDFEFINYVFDAYIKATVAI"
FT   gene            complement(671542..672321)
FT                   /locus_tag="Rmag_0617"
FT   CDS_pept        complement(671542..672321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0617"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="PFAM: prolipoprotein diacylglyceryl transferase;
FT                   KEGG: noc:Noc_0233 prolipoprotein diacylglyceryl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02366"
FT                   /db_xref="GOA:A1AWQ9"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWQ9"
FT                   /protein_id="ABL02366.1"
FT                   /translation="MTYPVINPIALDLGFVQIYWYGLMYLMAFFTAYLLASYRIKQLNN
FT                   WNAQQVEDLIFYGAIGVVTGGRLGYMLCYNLPNFLSDPLLIFSIQNGGMSFHGGFLGVL
FT                   LAMILFNRKYNKAFFTTMDFVAPLVPLGLGFGRIGNFINSELWGKTTISPFGMYIEQQG
FT                   VSRYPSQLLEAFLEGLILFIILWVFSNKLYPSMSISALFLIFYGLFRFIIEFVRVPDAQ
FT                   LGYLAFGWLTMGQLLSLPMVALGIMLLRKAYLKKETM"
FT   gene            complement(672337..672413)
FT                   /locus_tag="Rmag_R0023"
FT                   /note="tRNA-Arg1"
FT   tRNA            complement(672337..672413)
FT                   /locus_tag="Rmag_R0023"
FT                   /product="tRNA-Arg"
FT   gene            complement(672441..672746)
FT                   /locus_tag="Rmag_0618"
FT   CDS_pept        complement(672441..672746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0618"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: tcx:Tcr_1782
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02367"
FT                   /db_xref="GOA:A1AWR0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWR0"
FT                   /protein_id="ABL02367.1"
FT                   /translation="MSEIALLEKGEDIEKATRALKAMAHPLRLKILCALKNDELPVLEI
FT                   VKKVGSSQSNISQHIDILRTKNIVESRRDGNKILCRVKDAKVLKLMSNIQAVFCSE"
FT   gene            complement(672775..673356)
FT                   /locus_tag="Rmag_0619"
FT   CDS_pept        complement(672775..673356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02368"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWR1"
FT                   /protein_id="ABL02368.1"
FT                   /translation="MKRLNVILLALMMFTSLTSFAEKVAQDNSPVQAIQTAIIKLNQLT
FT                   TVAYSPKMLNFFVEKEIAPLFDFKHIASEVLLVTNNRLDEEETRFFVNRIKNNMMSTLL
FT                   TRLSQINSTSFQFISARLMMGGSISVQLKVNRYASFGDIYLDLLFHQNENKQWQVFDIV
FT                   LNNGSLINYYQKMVLIKVRRYGIYGMLGRL"
FT   sig_peptide     complement(673291..673356)
FT                   /locus_tag="Rmag_0619"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 22"
FT   gene            673448..674800
FT                   /locus_tag="Rmag_0620"
FT   CDS_pept        673448..674800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rmag_0620"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: hch:HCH_01350 periplasmic protease; TIGRFAM:
FT                   carboxyl-terminal protease; PFAM: PDZ/DHR/GLGF domain
FT                   protein; peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Rmag_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABL02369"
FT                   /db_xref="GOA:A1AWR2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A1AWR2"
FT                   /protein_id="ABL02369.1"
FT                   /translation="MIISMTFLNFFKYSLFLTLFCTFFGICAPVLAKNDVEKQKIEAFF
FT                   KDLKTFTAVFSNIKQLYVDDVDNKKLFNHAIKGMVNGLDPHSDYLEPEEQKNLLENALG
FT                   KFGGLGIIIGMKNKTIQVISPIDDTPAYKAGIQTGDLIVKIGDKPVRGMTLEDGVGLMR
FT                   GKAGTDIKITIVRKNKKPFVVNITREIITIISVKGYLLEKNIGYIRISSFQNPTAKLLK
FT                   QTFNDLVKENNAQLSSLILDLRNNPGGVLNGAVDVSNLFLDKKGLVVYTKGRIPSSNLK
FT                   FKTKPGDIMQGLPIV