(data stored in ACNUC7421 zone)

EMBL: CP000489

ID   CP000489; SV 1; circular; genomic DNA; STD; PRO; 2852282 BP.
XX
AC   CP000489; AAIT01000000-AAIT01000037;
XX
PR   Project:PRJNA13020;
XX
DT   14-DEC-2006 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Paracoccus denitrificans PD1222 chromosome 1, complete sequence.
XX
KW   .
XX
OS   Paracoccus denitrificans PD1222
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales;
OC   Rhodobacteraceae; Paracoccus.
XX
RN   [1]
RP   1-2852282
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Munk A.C., Brettin T., Bruce D., Han C., Tapia R., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Lykidis A., Spiro S.,
RA   Richardson D.J., Moir J.W.B., Ferguson S.J., van Spanning R.J.M.,
RA   Richardson P.;
RT   "Complete sequence of Chromosome 1 of Paracoccus denitrificans PD1222";
RL   Unpublished.
XX
RN   [2]
RP   1-2852282
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Munk A.C., Brettin T., Bruce D., Han C., Tapia R., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Lykidis A., Spiro S.,
RA   Richardson D.J., Moir J.W.B., Ferguson S.J., van Spanning R.J.M.,
RA   Richardson P.;
RT   ;
RL   Submitted (04-DEC-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 4b2f1e668e7d27c34a240334faa6a8ab.
DR   BioSample; SAMN02598290.
DR   EnsemblGenomes-Gn; EBG00001178064.
DR   EnsemblGenomes-Gn; EBG00001178065.
DR   EnsemblGenomes-Gn; EBG00001178066.
DR   EnsemblGenomes-Gn; EBG00001178067.
DR   EnsemblGenomes-Gn; EBG00001178068.
DR   EnsemblGenomes-Gn; EBG00001178069.
DR   EnsemblGenomes-Gn; EBG00001178070.
DR   EnsemblGenomes-Gn; EBG00001178071.
DR   EnsemblGenomes-Gn; EBG00001178072.
DR   EnsemblGenomes-Gn; EBG00001178074.
DR   EnsemblGenomes-Gn; EBG00001178075.
DR   EnsemblGenomes-Gn; EBG00001178076.
DR   EnsemblGenomes-Gn; EBG00001178077.
DR   EnsemblGenomes-Gn; EBG00001178079.
DR   EnsemblGenomes-Gn; EBG00001178080.
DR   EnsemblGenomes-Gn; EBG00001178081.
DR   EnsemblGenomes-Gn; EBG00001178082.
DR   EnsemblGenomes-Gn; EBG00001178083.
DR   EnsemblGenomes-Gn; EBG00001178084.
DR   EnsemblGenomes-Gn; EBG00001178085.
DR   EnsemblGenomes-Gn; EBG00001178086.
DR   EnsemblGenomes-Gn; EBG00001178087.
DR   EnsemblGenomes-Gn; EBG00001178088.
DR   EnsemblGenomes-Gn; EBG00001178089.
DR   EnsemblGenomes-Gn; EBG00001178091.
DR   EnsemblGenomes-Gn; EBG00001178092.
DR   EnsemblGenomes-Gn; EBG00001178093.
DR   EnsemblGenomes-Gn; EBG00001178094.
DR   EnsemblGenomes-Gn; EBG00001178096.
DR   EnsemblGenomes-Gn; EBG00001178097.
DR   EnsemblGenomes-Gn; EBG00001178098.
DR   EnsemblGenomes-Gn; EBG00001178099.
DR   EnsemblGenomes-Gn; EBG00001178100.
DR   EnsemblGenomes-Gn; EBG00001178102.
DR   EnsemblGenomes-Gn; EBG00001178103.
DR   EnsemblGenomes-Gn; EBG00001178104.
DR   EnsemblGenomes-Gn; EBG00001178106.
DR   EnsemblGenomes-Gn; EBG00001178108.
DR   EnsemblGenomes-Gn; EBG00001178109.
DR   EnsemblGenomes-Gn; EBG00001178110.
DR   EnsemblGenomes-Gn; EBG00001178111.
DR   EnsemblGenomes-Gn; EBG00001178112.
DR   EnsemblGenomes-Gn; EBG00001178113.
DR   EnsemblGenomes-Gn; EBG00001178114.
DR   EnsemblGenomes-Gn; EBG00001178115.
DR   EnsemblGenomes-Gn; EBG00001178116.
DR   EnsemblGenomes-Gn; EBG00001178117.
DR   EnsemblGenomes-Gn; EBG00001178118.
DR   EnsemblGenomes-Gn; EBG00001178119.
DR   EnsemblGenomes-Gn; EBG00001178120.
DR   EnsemblGenomes-Gn; EBG00001178121.
DR   EnsemblGenomes-Gn; EBG00001178122.
DR   EnsemblGenomes-Gn; EBG00001178123.
DR   EnsemblGenomes-Gn; EBG00001178124.
DR   EnsemblGenomes-Gn; EBG00001178125.
DR   EnsemblGenomes-Gn; EBG00001178126.
DR   EnsemblGenomes-Gn; Pden_R0001.
DR   EnsemblGenomes-Gn; Pden_R0002.
DR   EnsemblGenomes-Gn; Pden_R0003.
DR   EnsemblGenomes-Gn; Pden_R0004.
DR   EnsemblGenomes-Gn; Pden_R0005.
DR   EnsemblGenomes-Gn; Pden_R0006.
DR   EnsemblGenomes-Gn; Pden_R0007.
DR   EnsemblGenomes-Gn; Pden_R0008.
DR   EnsemblGenomes-Gn; Pden_R0009.
DR   EnsemblGenomes-Gn; Pden_R0010.
DR   EnsemblGenomes-Gn; Pden_R0011.
DR   EnsemblGenomes-Gn; Pden_R0012.
DR   EnsemblGenomes-Gn; Pden_R0013.
DR   EnsemblGenomes-Gn; Pden_R0014.
DR   EnsemblGenomes-Gn; Pden_R0015.
DR   EnsemblGenomes-Gn; Pden_R0016.
DR   EnsemblGenomes-Gn; Pden_R0017.
DR   EnsemblGenomes-Gn; Pden_R0018.
DR   EnsemblGenomes-Gn; Pden_R0019.
DR   EnsemblGenomes-Gn; Pden_R0020.
DR   EnsemblGenomes-Gn; Pden_R0021.
DR   EnsemblGenomes-Gn; Pden_R0022.
DR   EnsemblGenomes-Gn; Pden_R0023.
DR   EnsemblGenomes-Gn; Pden_R0024.
DR   EnsemblGenomes-Gn; Pden_R0026.
DR   EnsemblGenomes-Gn; Pden_R0027.
DR   EnsemblGenomes-Gn; Pden_R0028.
DR   EnsemblGenomes-Gn; Pden_R0029.
DR   EnsemblGenomes-Gn; Pden_R0030.
DR   EnsemblGenomes-Gn; Pden_R0031.
DR   EnsemblGenomes-Gn; Pden_R0032.
DR   EnsemblGenomes-Gn; Pden_R0033.
DR   EnsemblGenomes-Gn; Pden_R0034.
DR   EnsemblGenomes-Gn; Pden_R0035.
DR   EnsemblGenomes-Gn; Pden_R0036.
DR   EnsemblGenomes-Gn; Pden_R0037.
DR   EnsemblGenomes-Gn; Pden_R0038.
DR   EnsemblGenomes-Gn; Pden_R0039.
DR   EnsemblGenomes-Gn; Pden_R0040.
DR   EnsemblGenomes-Gn; Pden_R0041.
DR   EnsemblGenomes-Gn; Pden_R0042.
DR   EnsemblGenomes-Gn; Pden_R0043.
DR   EnsemblGenomes-Gn; Pden_R0044.
DR   EnsemblGenomes-Gn; Pden_R0045.
DR   EnsemblGenomes-Gn; Pden_R0046.
DR   EnsemblGenomes-Gn; Pden_R0047.
DR   EnsemblGenomes-Gn; Pden_R0048.
DR   EnsemblGenomes-Gn; Pden_R0049.
DR   EnsemblGenomes-Gn; Pden_R0050.
DR   EnsemblGenomes-Gn; Pden_R0051.
DR   EnsemblGenomes-Tr; EBT00001756264.
DR   EnsemblGenomes-Tr; EBT00001756265.
DR   EnsemblGenomes-Tr; EBT00001756266.
DR   EnsemblGenomes-Tr; EBT00001756267.
DR   EnsemblGenomes-Tr; EBT00001756268.
DR   EnsemblGenomes-Tr; EBT00001756269.
DR   EnsemblGenomes-Tr; EBT00001756270.
DR   EnsemblGenomes-Tr; EBT00001756271.
DR   EnsemblGenomes-Tr; EBT00001756272.
DR   EnsemblGenomes-Tr; EBT00001756273.
DR   EnsemblGenomes-Tr; EBT00001756274.
DR   EnsemblGenomes-Tr; EBT00001756275.
DR   EnsemblGenomes-Tr; EBT00001756276.
DR   EnsemblGenomes-Tr; EBT00001756277.
DR   EnsemblGenomes-Tr; EBT00001756278.
DR   EnsemblGenomes-Tr; EBT00001756279.
DR   EnsemblGenomes-Tr; EBT00001756280.
DR   EnsemblGenomes-Tr; EBT00001756281.
DR   EnsemblGenomes-Tr; EBT00001756282.
DR   EnsemblGenomes-Tr; EBT00001756283.
DR   EnsemblGenomes-Tr; EBT00001756284.
DR   EnsemblGenomes-Tr; EBT00001756285.
DR   EnsemblGenomes-Tr; EBT00001756286.
DR   EnsemblGenomes-Tr; EBT00001756287.
DR   EnsemblGenomes-Tr; EBT00001756288.
DR   EnsemblGenomes-Tr; EBT00001756289.
DR   EnsemblGenomes-Tr; EBT00001756290.
DR   EnsemblGenomes-Tr; EBT00001756291.
DR   EnsemblGenomes-Tr; EBT00001756292.
DR   EnsemblGenomes-Tr; EBT00001756293.
DR   EnsemblGenomes-Tr; EBT00001756294.
DR   EnsemblGenomes-Tr; EBT00001756295.
DR   EnsemblGenomes-Tr; EBT00001756296.
DR   EnsemblGenomes-Tr; EBT00001756297.
DR   EnsemblGenomes-Tr; EBT00001756298.
DR   EnsemblGenomes-Tr; EBT00001756299.
DR   EnsemblGenomes-Tr; EBT00001756300.
DR   EnsemblGenomes-Tr; EBT00001756301.
DR   EnsemblGenomes-Tr; EBT00001756302.
DR   EnsemblGenomes-Tr; EBT00001756303.
DR   EnsemblGenomes-Tr; EBT00001756304.
DR   EnsemblGenomes-Tr; EBT00001756305.
DR   EnsemblGenomes-Tr; EBT00001756306.
DR   EnsemblGenomes-Tr; EBT00001756307.
DR   EnsemblGenomes-Tr; EBT00001756308.
DR   EnsemblGenomes-Tr; EBT00001756309.
DR   EnsemblGenomes-Tr; EBT00001756310.
DR   EnsemblGenomes-Tr; EBT00001756311.
DR   EnsemblGenomes-Tr; EBT00001756312.
DR   EnsemblGenomes-Tr; EBT00001756313.
DR   EnsemblGenomes-Tr; EBT00001756314.
DR   EnsemblGenomes-Tr; EBT00001756315.
DR   EnsemblGenomes-Tr; EBT00001756316.
DR   EnsemblGenomes-Tr; EBT00001756317.
DR   EnsemblGenomes-Tr; EBT00001756318.
DR   EnsemblGenomes-Tr; EBT00001756319.
DR   EnsemblGenomes-Tr; Pden_R0001-1.
DR   EnsemblGenomes-Tr; Pden_R0002-1.
DR   EnsemblGenomes-Tr; Pden_R0003-1.
DR   EnsemblGenomes-Tr; Pden_R0004-1.
DR   EnsemblGenomes-Tr; Pden_R0005-1.
DR   EnsemblGenomes-Tr; Pden_R0006-1.
DR   EnsemblGenomes-Tr; Pden_R0007-1.
DR   EnsemblGenomes-Tr; Pden_R0008-1.
DR   EnsemblGenomes-Tr; Pden_R0009-1.
DR   EnsemblGenomes-Tr; Pden_R0010-1.
DR   EnsemblGenomes-Tr; Pden_R0011-1.
DR   EnsemblGenomes-Tr; Pden_R0012-1.
DR   EnsemblGenomes-Tr; Pden_R0013-1.
DR   EnsemblGenomes-Tr; Pden_R0014-1.
DR   EnsemblGenomes-Tr; Pden_R0015-1.
DR   EnsemblGenomes-Tr; Pden_R0016-1.
DR   EnsemblGenomes-Tr; Pden_R0017-1.
DR   EnsemblGenomes-Tr; Pden_R0018-1.
DR   EnsemblGenomes-Tr; Pden_R0019-1.
DR   EnsemblGenomes-Tr; Pden_R0020-1.
DR   EnsemblGenomes-Tr; Pden_R0021-1.
DR   EnsemblGenomes-Tr; Pden_R0022-1.
DR   EnsemblGenomes-Tr; Pden_R0023-1.
DR   EnsemblGenomes-Tr; Pden_R0024-1.
DR   EnsemblGenomes-Tr; Pden_R0026-1.
DR   EnsemblGenomes-Tr; Pden_R0027-1.
DR   EnsemblGenomes-Tr; Pden_R0028-1.
DR   EnsemblGenomes-Tr; Pden_R0029-1.
DR   EnsemblGenomes-Tr; Pden_R0030-1.
DR   EnsemblGenomes-Tr; Pden_R0031-1.
DR   EnsemblGenomes-Tr; Pden_R0032-1.
DR   EnsemblGenomes-Tr; Pden_R0033-1.
DR   EnsemblGenomes-Tr; Pden_R0034-1.
DR   EnsemblGenomes-Tr; Pden_R0035-1.
DR   EnsemblGenomes-Tr; Pden_R0036-1.
DR   EnsemblGenomes-Tr; Pden_R0037-1.
DR   EnsemblGenomes-Tr; Pden_R0038-1.
DR   EnsemblGenomes-Tr; Pden_R0039-1.
DR   EnsemblGenomes-Tr; Pden_R0040-1.
DR   EnsemblGenomes-Tr; Pden_R0041-1.
DR   EnsemblGenomes-Tr; Pden_R0042-1.
DR   EnsemblGenomes-Tr; Pden_R0043-1.
DR   EnsemblGenomes-Tr; Pden_R0044-1.
DR   EnsemblGenomes-Tr; Pden_R0045-1.
DR   EnsemblGenomes-Tr; Pden_R0046-1.
DR   EnsemblGenomes-Tr; Pden_R0047-1.
DR   EnsemblGenomes-Tr; Pden_R0048-1.
DR   EnsemblGenomes-Tr; Pden_R0049-1.
DR   EnsemblGenomes-Tr; Pden_R0050-1.
DR   EnsemblGenomes-Tr; Pden_R0051-1.
DR   EuropePMC; PMC2772497; 19767433.
DR   EuropePMC; PMC3925955; 24517536.
DR   EuropePMC; PMC4543880; 26347732.
DR   EuropePMC; PMC5107571; 27895629.
DR   EuropePMC; PMC5987163; 29896187.
DR   GOA; P52221.
DR   InterPro; IPR007078; Haem_export_protD_CcmD.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01727; SAM-SAH.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; CP000489.
DR   SILVA-SSU; CP000489.
DR   UniProtKB/Swiss-Prot; P52221; CCMD_PARDP.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634481
CC   Source DNA and bacteria available from Stephen Spiro
CC   (stephen.spiro@utdallas.edu)
CC   Contacts: Stephen Spiro (stephen.spiro@utdallas.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   There is an unverified repetitive structure in the vicinity of
CC   complement(2413304-2418104)
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2852282
FT                   /organism="Paracoccus denitrificans PD1222"
FT                   /chromosome="1"
FT                   /strain="PD1222"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:318586"
FT   gene            170..616
FT                   /locus_tag="Pden_0001"
FT   CDS_pept        170..616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0001"
FT                   /product="conserved hypothetical protein 701"
FT                   /note="PFAM: conserved hypothetical protein 701; KEGG:
FT                   sil:SPO3893 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68118"
FT                   /db_xref="GOA:A1AXX4"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXX4"
FT                   /protein_id="ABL68118.1"
FT                   /translation="MTDFLPLAYPWIKALHVMAVLSWMAGLFYLPRLFVYHAERGHLGQ
FT                   EPVQSFRIMEDKLLRLIMNPAMIVTWIAGLALVLTPGIVDWTMIWPWTKAAGVLGMTWF
FT                   HMWLAGQRKALLLGQGLSGRRYRMMNEVPTLLMVLIVLSVIVKF"
FT   gene            709..2013
FT                   /locus_tag="Pden_0002"
FT   CDS_pept        709..2013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0002"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: rsp:RSP_1231 transcription termination factor
FT                   Rho; TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; Rho termination factor domain protein; Rho
FT                   termination factor, RNA-binding; Ribonuclease B, OB region
FT                   N-terminal domain; SMART: AAA ATPase; Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68119"
FT                   /db_xref="GOA:A1AXX5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXX5"
FT                   /protein_id="ABL68119.1"
FT                   /translation="MRRIVRAHRLDMTEERLNLSDLKAKSPADLLAMAEEWEIENASTM
FT                   RKGEMMFSILKEHAEEGFEIGGDGVLEVVQDGFGFLRSPEANYLPGPDDIYVSPDMIRQ
FT                   HSLRTGDTVEGVIRAPGENERYFALTKVEKINFENPEKARHKVAFDNLTPLYPNERLKM
FT                   EIEDPTIKDRSARIIDLVAPIGKGQRSLIVAPPRTGKTVLLQNIAHSIEKNHPECYLIV
FT                   LLIDERPEEVTDMQRSVKGEVISSTFDEPASRHVAVSEMVIEKAKRLVEHKRDVVILLD
FT                   SITRLGRAFNTVVPSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALIDTG
FT                   SRMDEVIFEEFKGTGNSEIVLDRKVADKRVFPAMDILKSGTRKEELLVDAKDLQKTYLL
FT                   RRILNPMGTTDAIEFLISKLKQTKTNGEFFDSMNA"
FT   gene            2030..3289
FT                   /locus_tag="Pden_0003"
FT   CDS_pept        2030..3289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0003"
FT                   /product="tRNA modification GTPase trmE"
FT                   /note="TIGRFAM: tRNA modification GTPase TrmE; small
FT                   GTP-binding protein; PFAM: GTP-binding protein,
FT                   HSR1-related; KEGG: rde:RD1_0433 tRNA modification GTPase
FT                   TrmE, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68120"
FT                   /db_xref="GOA:A1AXX6"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AXX6"
FT                   /protein_id="ABL68120.1"
FT                   /translation="MDTIFAEATPPGRGGVSVVRLSGPKAHATLESLAGPVATPRMAAL
FT                   RALRDGDDLIDRALVIWFAEGHSFTGEEVAELHLHGAPVIASRLSQALLARGLRRAEAG
FT                   EFTKRAFLNGRIDLAEAEGLADLLSAETEAQRKLAMRATEGELGRKADELRSKLIRAGA
FT                   LIEASIDFADEEVPDEVPEEALDLIKAVRSDIQGMLASYPATERLRQGYEVAIIGPPNA
FT                   GKSTLLNRIGQREIALVSEIAGTTRDILELHTDLRGLPVTFLDTAGLRESSDPVEAMGV
FT                   ARAVQRAAEADLRIHLSVDGVPEETLVLGDIIVRSKADLGRGEETAISGLTGEGVAELL
FT                   DLVYDRLRVRAADSGLVGHKRQAEALQRAVAALAIDDSLAPEFLAEALRQAAQALAMMV
FT                   GRVGAEDYLDEIFSSFCIGK"
FT   gene            3298..5157
FT                   /locus_tag="Pden_0004"
FT   CDS_pept        3298..5157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0004"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG: rde:RD1_0432
FT                   glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68121"
FT                   /db_xref="GOA:A1AXX7"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AXX7"
FT                   /protein_id="ABL68121.1"
FT                   /translation="MKQFDVIVIGGGHAGVEAAMAAARMGVKTALVTLHRDDIGTMSCN
FT                   PAIGGLGKGHLVREIDALDGVMGKLADTAGIQFRLLNRRKGPAVQGPRAQADRKLYRSA
FT                   AAKIVAGQDGLSLILGEAAELLHERGQVTGLRLADDSELQARQIILTTGTFLNGLIHIG
FT                   EISRQAGRWGGSTSVTLAASLRPLNLPLGRLKTGTPPRILRQSIDWESLHQQPGDEEPV
FT                   MFSYLNTVPEAPQVSCAITHTNPDTHRIIRENLARSAMYGGRIDGVGPRYCPSIEDKVV
FT                   RFADKESHQIFLEPEGLDSDLVYPNGISTSLPEDIQLAYVRSIRGLERAQIAQPGYAVE
FT                   YDYVDPRALAASLEVKNLSGLFLAGQINGTTGYEEAAAQGLVAGLNAALKAQGREALHF
FT                   SRSQSYIGVMIDDLTTRGVSEPYRMFTSRAEFRLSLRADNADQRLTPFGIDIGCVGQER
FT                   RAAFSEKMRRYTAARDRAESVSFTPTELSRSGIEVRHDGARRSLFALLAQQEIPQDQVL
FT                   ALDDQLVLQDPAIIRQLATDALYHQYTDRQGKDAELLRKEEAVAIPAEFDYDALSGLSN
FT                   ELKFKLNQHRPATLAAAANIEGMTPAALTLILAVIRAGNRRSA"
FT   gene            5157..5738
FT                   /locus_tag="Pden_0005"
FT   CDS_pept        5157..5738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0005"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: rde:RD1_0431
FT                   methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68122"
FT                   /db_xref="GOA:A1AXX8"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AXX8"
FT                   /protein_id="ABL68122.1"
FT                   /translation="MSVSRETERLATYAGLLRKWNPAINLIAASTIDQIEARHIADSLH
FT                   LVEIAKNAQGSWVDLGSGGGLPGIVVAIMRPDLELSMVESDQRKGAFLRNAIRELALPH
FT                   AKVLCKRIEALDRLDAANLSARALAPLPQLMAYVERHLSPSGTAWLMKGRNWQAEVSQA
FT                   QSDWKFDLKTHQSATDPDAAILEITGLRHA"
FT   gene            5731..6507
FT                   /locus_tag="Pden_0006"
FT   CDS_pept        5731..6507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0006"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   sit:TM1040_2867 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68123"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXX9"
FT                   /protein_id="ABL68123.1"
FT                   /translation="MPDTRIIAVANQKGGVGKTTTAINLGAALAEQGQRVAIIDLDPQG
FT                   NASTGLGVPLEERELTSYDLLTGERALQETLRDTAIANLRVVPSNRDLASADFELSNRP
FT                   GRTQLLRRKLSAPSEFDYILIDCPPALGLLTVNAMVASDSVLVPLQAEFYALEGLSQLL
FT                   MTVREVRQTANPDLRIEGVLLTMSDNRNNLSQQVEADARSTLSGLVYRTVIPRNVRLSE
FT                   APSHAMPVLQYDPNSKGSHAYRDLAREFLSRQLATA"
FT   gene            6517..7395
FT                   /locus_tag="Pden_0007"
FT   CDS_pept        6517..7395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0007"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition proteins; PFAM: ParB
FT                   domain protein nuclease; KEGG: rsp:RSP_1225 ParB-like
FT                   partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68124"
FT                   /db_xref="GOA:A1AXY0"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXY0"
FT                   /protein_id="ABL68124.1"
FT                   /translation="MAENKLEKRGLGRGLSALMADVDLIPSERPAPRQILPVEQLTPNP
FT                   DQPRRSFAPEALQELADSLKTRGMLQPLIVRPHPTDRGLYQIVAGERRWRAAQIAQLHE
FT                   VPVIVRDLNDTEVLEVAIVENIQRADLNAIEEAASYRQLMDRFGHTQEKLGEALNKSRS
FT                   HIANLLRLLNLPEQVQAWLKEGKLTAGHARALITASNAVELARKVIEKNLSVRETEELV
FT                   RRQAEGPKAQKSRSASQEKDADTRALEGDLTAHLKMKVAINHSGTDGGQLVITYRDLDQ
FT                   LDRLCQILAGD"
FT   gene            complement(7526..8065)
FT                   /locus_tag="Pden_0008"
FT   CDS_pept        complement(7526..8065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0008"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: rsp:RSP_1219 putative
FT                   chaperone protein GrpE (heat shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68125"
FT                   /db_xref="GOA:A1AXY1"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXY1"
FT                   /protein_id="ABL68125.1"
FT                   /translation="MTNENPNGSPLDEEIIDPPADEVPSPEVEALIAERDEYRDRFMRA
FT                   LADAENARKRAEKDRRDAEQYGGSRLARDLLPVHDALTRALEAASEDQRAAAALIEGVE
FT                   LTLRELNNVFAKHGIKVITPAPGEKFDPQQHEAMFEAPVPGTVAGSIIQVMDNGFMLHD
FT                   RLLRPAKVGVSSTPAS"
FT   gene            complement(8073..9128)
FT                   /locus_tag="Pden_0009"
FT   CDS_pept        complement(8073..9128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0009"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="TIGRFAM: heat-inducible transcription repressor
FT                   HrcA; PFAM: Negative regulator of class I heat shock
FT                   protein; KEGG: sit:TM1040_2873 heat-inducible transcription
FT                   repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68126"
FT                   /db_xref="GOA:A1AXY2"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXY2"
FT                   /protein_id="ABL68126.1"
FT                   /translation="MLETALLSDLNDRSREVFRRVVEAYLATGEPVGSRTLTREMSEKL
FT                   SAATIRNVMQDLELLGLLDHPHISAGRMPTQLGLRLFVDGLMEAGPVSSSDREMIEETL
FT                   GDDNRDTGVMLDRVSTALSALTRGASLVLMPKQEAPVRHIEFVSLAPDRSLVVLVFADG
FT                   RVENRVFTPPPGHTASSMREAANFLNAVAEGRTLAELRRSVAHEIEASRQKLDSVAAQL
FT                   VSSGLAQWEGESSDPRLIVRGRANLLAHELADLDRIRTLFDDLERKRDIAEFLELAEQG
FT                   EGVRIFIGSENKLFSLSGSSLVVSPYMNADRKIVGAVGVIGPTRLNYGRIVPIVDYTAQ
FT                   LVGRLISGRKG"
FT   gene            9211..9936
FT                   /locus_tag="Pden_0010"
FT   CDS_pept        9211..9936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0010"
FT                   /product="RNAse PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: rsp:RSP_1221 ribonuclease PH; TIGRFAM:
FT                   ribonuclease PH; PFAM: 3' exoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68127"
FT                   /db_xref="GOA:A1AXY3"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXY3"
FT                   /protein_id="ABL68127.1"
FT                   /translation="MMRPSGRNLSDMRPISIETGIMRHAEGSCLISCGDTRVLCSASIE
FT                   EKAPPFLKGSGQGWVTAEYGMLPRATNTRNRREAAAGKQSGRTQEIQRLIGRALRAGVD
FT                   RRALGERQIVVDCDVIQADGGTRCAAITGGWVALRLAMNKLLKAGIVTADPIMDHVAAV
FT                   SCGIYAGQPILDLDYAEDSEAGTDGNFIMTGAGRLIEVQMSAEGATFSRPEMNQLLDLA
FT                   EAGIAELVRAQNEAVACAG"
FT   gene            9924..10529
FT                   /locus_tag="Pden_0011"
FT   CDS_pept        9924..10529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0011"
FT                   /product="dITPase"
FT                   /EC_number="3.6.1.-"
FT                   /note="PFAM: Ham1 family protein; KEGG: rde:RD1_0427 Ham1
FT                   protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68128"
FT                   /db_xref="GOA:A1AXY4"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXY4"
FT                   /protein_id="ABL68128.1"
FT                   /translation="MRRLTERKLLVATHNKGKLDEIRAMMAPHGIEVTSAGEMGLPEPA
FT                   ETESSFIGNARIKARAAMQATGLPVLADDSGITVDGLDGAPGVYTADWAETPNGRDFMQ
FT                   AMTRTWTELDERGAPEPRTAQFRATLILLWPDGHEEIFEGVAPGRLVWPPRGAHGHGYD
FT                   PIFVPDGHDVTYAEMPSEQKNAISHRARAFRKLETLFA"
FT   gene            10522..10896
FT                   /locus_tag="Pden_0012"
FT   CDS_pept        10522..10896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0012"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: rsp:RSP_1223
FT                   putative translation initiation inhibitor, YjgF family /
FT                   putative endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68129"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXY5"
FT                   /protein_id="ABL68129.1"
FT                   /translation="MRRISTGSPFESALGYSRAVVKGPWCFVSGTTGYDYAAMAMPDSA
FT                   AEQARNALATIFATLAEAGFAASDIVRVQYTITDPALVDEIAPVLGEAMKDALPAATMV
FT                   VAGLIRPEMKVEIEVTAYRE"
FT   gene            10905..12089
FT                   /locus_tag="Pden_0013"
FT   CDS_pept        10905..12089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0013"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /note="KEGG: rsp:RSP_1224 coproporphyrinogen III oxidase;
FT                   TIGRFAM: putative oxygen-independent coproporphyrinogen III
FT                   oxidase; PFAM: Radical SAM domain protein; HemN domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68130"
FT                   /db_xref="GOA:A1AXY6"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXY6"
FT                   /protein_id="ABL68130.1"
FT                   /translation="MPAPAASTAPLAEDWRAGGFGLYVHWPFCAAKCPYCDFNSHVAAA
FT                   IEQGRWLAAYRAEIARLGRETPGRVLNSIFFGGGTPSLMAPETVAGVIEAARAAWPFAN
FT                   DIEITLEANPTSVETGRFRAYADAGVNRVSMGVQALNDDDLRRLGRMHSAGEARAAFDI
FT                   ARDCFTRVSFDLIYARQDQDRAHWRRELGEALGMAVDHLSAYQLTIEPGTAFGARHAKG
FT                   GLKGLPDDDLSADMYLDTQEICAAAGMPTYEISNHARPGAESRHNLIYWRQGDWAAVGP
FT                   GAHGRLTLPSGRWATEAHLAPGAWLEAVEARGNGDSQREMLGLSDRALEYLLMSMRLVE
FT                   GLDVPRYLAHGAELPQDRLMNLAELGLISLRGDRLAATAAGRPVLNAILRELAE"
FT   gene            12091..12444
FT                   /locus_tag="Pden_0014"
FT   CDS_pept        12091..12444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0014"
FT                   /product="protein of unknown function DUF454"
FT                   /note="PFAM: protein of unknown function DUF454; KEGG:
FT                   atc:AGR_C_4462 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68131"
FT                   /db_xref="GOA:A1AXY7"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXY7"
FT                   /protein_id="ABL68131.1"
FT                   /translation="MRYLWFSMGWLTLTLGVIGVFVPVLPTVPFLLLAVWAFMRSSPRL
FT                   GARIMRHPQFGPPIRAWRKRGVIGRGAKIWAVAGMSAGVAWAVWLGLDPRFIAAQALAC
FT                   TAIAAWLVTRPEI"
FT   gene            12535..13119
FT                   /locus_tag="Pden_0015"
FT   CDS_pept        12535..13119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0015"
FT                   /product="glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating,
FT                   GFA; KEGG: sme:SMb20186 glutathione-dependent
FT                   formaldehyde-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68132"
FT                   /db_xref="GOA:A1AXY8"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR014185"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AXY8"
FT                   /protein_id="ABL68132.1"
FT                   /translation="MVDTSGVKIHPAVDNGIKPAQPGFAGGTLHCKCSTNPVRVAVRAQ
FT                   TAHNHVCGCTKCWKPEGAIFSQVAVVGRDALEVLEGAEKLEIVNAEAPIQRHRCRDCGV
FT                   HMYGRIENRDHPFYGLDFVHTELSDEDGWSAPEFAAFVSSIIESGVDPSRMEAIRARLR
FT                   ELGLEPYDALSPPLMDAIATHIAKRSGALAA"
FT   gene            13223..14350
FT                   /locus_tag="Pden_0016"
FT   CDS_pept        13223..14350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0016"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rsp:RSP_2576 alcohol dehydrogenase class III"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68133"
FT                   /db_xref="GOA:A1AXY9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXY9"
FT                   /protein_id="ABL68133.1"
FT                   /translation="MRTRAAVALEAGKPLEVMEVNLEGPKAGEVMVEIKATGICHTDEF
FT                   TLSGADPEGLFPSILGHEGAGVVVEVGPGVTSVKPGDHVIPLYTPECRQCASCLSGKTN
FT                   LCTAIRATQGQGLMPDGTSRFSMLDGTPIFHYMGCSTFSNYTVLPEIAVAKVREDAPFD
FT                   KICYIGCGVTTGIGAVINTAKVEIGAKAVVFGLGGIGLNVLQGLRLAGADMIIGVDLND
FT                   DKKPMAEHFGMTHFINPKNCENVVQEIVNLTKTPFDQIGGADYSFDCTGNVKVMRDALE
FT                   CTHRGWGQSIIIGVAPAGAEISTRPFQLVTGRVWKGTAFGGARGRTDVPQIVDWYMDGK
FT                   IEIDPMITHTLSLDDINKGFDLMHAGESIRSVVLY"
FT   gene            14426..15061
FT                   /locus_tag="Pden_0017"
FT   CDS_pept        14426..15061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0017"
FT                   /product="ATP-dependent Clp protease proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="PFAM: peptidase S14, ClpP; KEGG: hne:HNE_0542
FT                   putative ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68134"
FT                   /db_xref="GOA:A1AXZ0"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXZ0"
FT                   /protein_id="ABL68134.1"
FT                   /translation="MAKHFHLDDDDDDDDERRQEGSKDEGLGLPEGDKIGKLYFKSRTV
FT                   IVAGPITDKLAQRTVAHLLALAEDSDEPINMLISSPGGHVESGDMIHDVIKFIRPTVRT
FT                   IGSGWVASAGALIFVGADKENRYCLPNTRFLIHQPSGGIGGTSTDMMIQAEQVRLMRDR
FT                   LNQIFAEATGQPVERIEKDTQRDFWLNTQEALDYGLLGKVIRSVDELK"
FT   gene            15058..15579
FT                   /locus_tag="Pden_0018"
FT   CDS_pept        15058..15579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0018"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sus:Acid_2411 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68135"
FT                   /db_xref="GOA:A1AXZ1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXZ1"
FT                   /protein_id="ABL68135.1"
FT                   /translation="MSAGGTGILIRPATPDDHQAIWAILEPVYRAGETYCIPPDISRDE
FT                   ALADWFAAPFTVFVAELDGRVLGTSHVGRNRPGPASHVANASFATHPDARGHGIARELV
FT                   GHAKDWARAQGFRAMQFNFVVSTNADAVHSWQKAGFDIVGRLPAAFLHPRHGYVDALVM
FT                   FHDLTEGKNP"
FT   gene            15576..16415
FT                   /locus_tag="Pden_0019"
FT   CDS_pept        15576..16415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0019"
FT                   /product="Carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /note="PFAM: putative esterase; KEGG: sil:SPO3829
FT                   S-formylglutathione hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68136"
FT                   /db_xref="GOA:A1AXZ2"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AXZ2"
FT                   /protein_id="ABL68136.1"
FT                   /translation="MTLAYETVSENRSFGGIQGVYRHQSQATGTPMTFAIYLPPDARHG
FT                   KVPVLWYLSGLTCTHENAMTKAGAQEWAAEYGIAVIFPDTSPRGEGVANDETYDLGQGA
FT                   GFYVDATEAPWAPHFRMWHYVTHELPELVFNNFPLDREAQGITGHSMGGHGALTIAMTF
FT                   PERYRSVSAFAPIAHPSESDWGRKQFAAYLGDDKAAWKRHDSTILMREKGYPGEVLIDQ
FT                   GASDQFLDLLKPEALAHAMAERRQPGTFRMQQGYDHSYFFVQSFMADHIRWHAERLG"
FT   gene            16615..18417
FT                   /locus_tag="Pden_0020"
FT   CDS_pept        16615..18417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0020"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="PFAM: Pyrrolo-quinoline quinone; KEGG: rsp:RSP_2578
FT                   putative pqq dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68137"
FT                   /db_xref="GOA:A1AXZ3"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXZ3"
FT                   /protein_id="ABL68137.1"
FT                   /translation="MKNLMNGACLALLMSGTAALANDSVLAEIAKPQQWAIQMGDYANT
FT                   RYSTLDQINKDNVKDLRVAWTFSTGVLRGHEGSPLVIGDVMYVHTPFPNRVFALDLNDN
FT                   GKILWRYEPQQDPNVIAVMCCDTVYRGLSYADGMILLGQADTTVVALDATSGEVKWSTK
FT                   IGDPGIGETLTATVVPVKDKVLVGISGGEYGVRGRMTALNLTDGSEAWKAWSTGPDEEL
FT                   LVDPETTTHLGKPIGADSSLNSWEGDQWQIGGGTIWGWFSYDPDLNLVYYGTGNPSTWN
FT                   PSQRPGDNKWSMTIMARDADTGMAKWFYQMTPHDEWDYDGVNEMILTNQTVDGQERKLL
FT                   THFDRNGLAYTMDRETGELLVAEKYDPVVNWTTGVDMDPNSETYGRPAVVAEYSTAQNG
FT                   EDENTTGVCPAALGTKDQQPAAFSPKTNLFYVPTNHVCMDYEPFRVAYTAGQPYVGATL
FT                   SMYPAPNSHGGMGNFIAWDNTTGEIKWSVPEQFSVWSGALATAGDVVFYGTLEGYLKAV
FT                   DAQTGEELYKFKTPSGIIGNVMTYEHGGKQYVGILSGVGGWAGIGLAAGLTNPNDGLGA
FT                   VGGYASLSQYTELGGQLTVFELPG"
FT   sig_peptide     16615..16680
FT                   /locus_tag="Pden_0020"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.991 at
FT                   residue 22"
FT   gene            18519..19199
FT                   /locus_tag="Pden_0021"
FT   CDS_pept        18519..19199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sme:SMb20174 putative cytochrome c protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68138"
FT                   /db_xref="GOA:A1AXZ4"
FT                   /db_xref="InterPro:IPR022411"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXZ4"
FT                   /protein_id="ABL68138.1"
FT                   /translation="MTSKTTASLLAICVACAASAIAGTALAQTAETPPAQAGAGAAAAV
FT                   SGDAQQQPAAEAPAEEEEETPAVAATDGKLVLPNGQDITPDHMENGRWYTAEDIPTYKI
FT                   AEDGAVDWATFSGYRRYSAECHVCHGPDGEGSTYAPALRKSVLTMGYYDFLEIAASGKQ
FT                   EVNTAANLVMPAFGTNKNVWCYIDDIYAYLLARGTGDLPRGRPAKREDKSDEFVAQEDS
FT                   CMSG"
FT   sig_peptide     18519..18602
FT                   /locus_tag="Pden_0021"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.965 at
FT                   residue 28"
FT   gene            19196..20008
FT                   /locus_tag="Pden_0022"
FT   CDS_pept        19196..20008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0022"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="SMART: extracellular solute-binding protein, family
FT                   3; KEGG: rsp:RSP_2580 putative methanol oxidation protein;
FT                   TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68139"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR022448"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXZ5"
FT                   /protein_id="ABL68139.1"
FT                   /translation="MRRALTLAVLATCAVLPALAQVADLRSKTEFRVCADPAAVPMSSQ
FT                   DGKGFENRIAQLFAEKLGVPVAYTWFPQGPGFIRKTLRAGLCDVVIGYAQGDEMVQNTN
FT                   HYYTSAYGIVTRNDSPLASVEALDDPALGGHPIGVVAGTPPASNLARAGLAKNMRGWDL
FT                   FVDRRVEDPVGDMLAQVKSGELAAAVIWGPLAGPLVKQDPELQFTPLLKESGGPRMFYR
FT                   ITMGVRLGEQEWKRELNSLIRRHQDEIDAILRDAGVPLLDDYGKALKQ"
FT   sig_peptide     19196..19258
FT                   /locus_tag="Pden_0022"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.947 at
FT                   residue 21"
FT   gene            20005..20535
FT                   /locus_tag="Pden_0023"
FT   CDS_pept        20005..20535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0023"
FT                   /product="rhodanese"
FT                   /note="KEGG: rsp:RSP_2581 rhodanese"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68140"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR022376"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXZ6"
FT                   /protein_id="ABL68140.1"
FT                   /translation="MRWAWAALAVVLAGAAQAQVPEPPSFHGEPYRSETPATLAGAQVI
FT                   DAAEAMRLHAQGVPFIDVLPRTARPEGLPEGTFWNEPPHLSIPGAAWLYDTGYDRLAPA
FT                   EQARLAEGLARLSGGDRAAPMVIFCKRDCWMSWNAAKRAVALGYRGVIWFPDGVEGWQE
FT                   QGGSLEPASPAGP"
FT   sig_peptide     20005..20061
FT                   /locus_tag="Pden_0023"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 19"
FT   gene            complement(20567..21118)
FT                   /locus_tag="Pden_0024"
FT   CDS_pept        complement(20567..21118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rde:RD1_0896 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68141"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXZ7"
FT                   /protein_id="ABL68141.1"
FT                   /translation="MIRLLALTMGAALALAPAAEAHGPPRLKLEMQQKLDATPDEVWTA
FT                   IGRFDDMSWHPAIASLELTGDGSADQPETSTRVLHLKSDAGDPTITEVLSKWQPEKHCY
FT                   AYRIEAVEVTVLPVTNYAATLCVKDEGGKAVVNWKGGFYRGYPNNEPPPELSDEAAIKA
FT                   VTGVYQAGLDALAERFGKAE"
FT   sig_peptide     complement(21053..21118)
FT                   /locus_tag="Pden_0024"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(21122..21679)
FT                   /locus_tag="Pden_0025"
FT   CDS_pept        complement(21122..21679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_2574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68142"
FT                   /db_xref="InterPro:IPR021698"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXZ8"
FT                   /protein_id="ABL68142.1"
FT                   /translation="MDAHAGRAHGLRMAFLRLILIVCAAALAGAGTGAAQPAHGSAPSP
FT                   DSAVWFGLHFIDTSTEGAINGVREDETRRIEMAETVIAEDLRSRGFTLLDPPADQVARI
FT                   KNPTQSNGSDSRIARDMGAHYAISGEVQKVSNLILSLNLYIRDAESGDTVRAGVVDIRG
FT                   NTDESFRRGYLYLLKNIIFLEE"
FT   sig_peptide     complement(21557..21679)
FT                   /locus_tag="Pden_0025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.553 at
FT                   residue 41"
FT   gene            21795..22982
FT                   /locus_tag="Pden_0026"
FT   CDS_pept        21795..22982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0026"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="KEGG: rsp:RSP_2582 hypothetical protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68143"
FT                   /db_xref="InterPro:IPR022478"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXZ9"
FT                   /protein_id="ABL68143.1"
FT                   /translation="MKGRIIILLAGLSMANPALAQDSPDAQTVRAAVLRVDVPSLPPIS
FT                   RLDAPPQDLGFAGARLAIEDNDTTGRFMGQDFEALEVTATPETAAAEMDKLLAEGIPFI
FT                   VTLADDAETLALADQAGDRALVLNARARGDHLRGKDCRFNVIHAAPSHAMLADALAQFL
FT                   MWKKWPNWFLVAGSHPEDVALADAYRRAATKFGARIVEARTYEDTGGSRRSDSGHVQVQ
FT                   QQMPVFTQRAPAHDVLIAADENGVFADWLPYATWDARPVAGSAGLVPRSWAPSLEAWGA
FT                   TQFQNRFEKLAGRPIREEDYQTWIALRMIGEAATRTQSTDPATLKEFMLSENFEVAGFK
FT                   GQKLTLRDWDHQLRQPILLATGSVTASVSPQDQYLHQNSALDTLGFDRPETECKF"
FT   sig_peptide     21795..21857
FT                   /locus_tag="Pden_0026"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            22991..23962
FT                   /locus_tag="Pden_0027"
FT   CDS_pept        22991..23962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0027"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: rsp:RSP_2583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68144"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="InterPro:IPR022456"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY00"
FT                   /protein_id="ABL68144.1"
FT                   /translation="MKVSTAILTSALCLGFALPAAANRVFVSNEKGNDVTVLDSETLEV
FT                   IGTYPVGARPRGITISPDGKELYVCASDDDLVRVFNPETMEEMHTLPSGPDPELFVLHP
FT                   SGNPLYIANEDDNLVTVVDTQTHKVLAEIPVGVEPEGMGVSPDGKVVINTSETTNMAHF
FT                   IDSESFEIFANVLVDSRPRFAQFNDAGTKLYVSSEIGGTVSVIDPATQEITRKISFEIP
FT                   GVLPEAIQPVGVRVTSDGSKVFVALGPANRVAVINGETDEVEDYLLVGQRVWQMAFTPD
FT                   EKYLFTTNGNSNDVSVIDVAALTVVKSVPVGQQPWGVVVAPN"
FT   sig_peptide     22991..23059
FT                   /locus_tag="Pden_0027"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.958 at
FT                   residue 23"
FT   gene            23986..24555
FT                   /locus_tag="Pden_0028"
FT   CDS_pept        23986..24555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_2584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68145"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY01"
FT                   /protein_id="ABL68145.1"
FT                   /translation="MTRLLTILLLMAGLALPATAQETTPEAGAEAGAAADGAAAAEQDD
FT                   DDDDNGEAAGAAEGVHEAGSKFDFGFSGIMARDNRTQLAPLTLASGKPVATAEYKLKSG
FT                   GFYRIDINADGSQELALSGGHFFRAIWVNEIVINDIEIRPMGVHSLEFDDAGTATISFI
FT                   AIVPGRYTLSIPGSQGETQQAVFNIQ"
FT   sig_peptide     23986..24048
FT                   /locus_tag="Pden_0028"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            24593..25312
FT                   /locus_tag="Pden_0029"
FT   CDS_pept        24593..25312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0029"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rsp:RSP_2586 ABC multidrug efflux transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68146"
FT                   /db_xref="GOA:A1AY02"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022467"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY02"
FT                   /protein_id="ABL68146.1"
FT                   /translation="MPQDALSIQHVSHSFGRVPALKDVSLTVPRGGFTALLGVNGAGKT
FT                   TLFSLITRLYDNRSGRIEVAGHDLRRQPGAALARLGVVFQSRALDADLTVAQNLEYHAA
FT                   LHGIPRREARARSVEVLAQVDLSDRLHARVSALSGGQSRRAEIARALIHRPEILLLDEA
FT                   TVGLDVKSRAEVVALTRELVRGGVSALWATHILDEIRPEDGLVILHKGEVLARGNAGEI
FT                   GGDDLTATFLRLTGEPA"
FT   gene            25309..26127
FT                   /locus_tag="Pden_0030"
FT   CDS_pept        25309..26127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0030"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: rsp:RSP_2587 ABC
FT                   multidrug efflux transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68147"
FT                   /db_xref="GOA:A1AY03"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR022403"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY03"
FT                   /protein_id="ABL68147.1"
FT                   /translation="MSRRLTPRMWLTAFLGIARRETLRFVNQRGRFLAALVRPLVWLFI
FT                   FAAGFRAVLGLSITPPYQTYVLYEVYVTPGLCAMIQLFNGMQSSLSMVHDRETGAMRTL
FT                   LVSPFPRWFLLASKLVAGVIVSIIQVYTFLAIAWFWDVRPPAIGYLAVLPALFLSGLML
FT                   GAMGLFLSSAIRQLENFAGVMNFVIFPMFFASSALYPLWRMNESSPLLHDICAVNPFTH
FT                   AVELVRFALYARFDLLSFSVVSGCLILFFAGAVVMYDPAKGLWARRKGGA"
FT   gene            26124..26714
FT                   /locus_tag="Pden_0031"
FT   CDS_pept        26124..26714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_2588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68148"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY04"
FT                   /protein_id="ABL68148.1"
FT                   /translation="MRYLVLALCLAAGAAQAENGTDPEWPCVQRKQPNLSLGQMWSGPE
FT                   PDEAARDLARTPGIAALADRLEQRRLPLAEAEAEIAEFAKTADNQQLTALVVAIFDRIE
FT                   PHRAALIAGIARYGHKQVDLAQRIQDHRAKMEEMQKAEAPDFDAIDAEEERLDWDMRIF
FT                   QDRQQALTYVCETPVILEQRVFALARAIAAGLQ"
FT   sig_peptide     26124..26177
FT                   /locus_tag="Pden_0031"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.986 at
FT                   residue 18"
FT   gene            26711..27313
FT                   /locus_tag="Pden_0032"
FT   CDS_pept        26711..27313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0032"
FT                   /product="molybdenum cofactor guanylyltransferase"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   sit:TM1040_3754 molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68149"
FT                   /db_xref="GOA:A1AY05"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY05"
FT                   /protein_id="ABL68149.1"
FT                   /translation="MSPVPAVILAGGLSTRMGGGNKALRMLAGETLLSRVIARLSPQCG
FT                   PLAINANGEPGQFEEYGLPVIADGIAGFAGPLAGVLAGMEWAAGEGADSVVSVSVDTPF
FT                   LPEDLVHRLREAAGRSGVAIAASPDDSGQLRDHPTCALWPVSLRGELRDALESGLHRIG
FT                   QFAAAHDPGRAVFDSRPVDPFLNLNTPEDLARAARLV"
FT   gene            complement(27310..28041)
FT                   /locus_tag="Pden_0033"
FT   CDS_pept        complement(27310..28041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0033"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sit:TM1040_3658
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68150"
FT                   /db_xref="GOA:A1AY06"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY06"
FT                   /protein_id="ABL68150.1"
FT                   /translation="MRTVAALIVTVLLLWQGIIWLAGMPPFLLPSPLRVLDALWLNRAE
FT                   IARHAGFTLTEVVLGFALGSALGAALAVAMGFSQKLTGVLRPILTFSQTIPVFALAPIL
FT                   TLWLGFGMAPKIAMTVLIVFFPVASAFLDGLMRTPQAALDLAQVMGASRIRIMRHLRIP
FT                   AALPSLATGLRLAAVYAPIGAVIGEWVGGARGLGALMIHANGRMKTDLVFAALLVLSVM
FT                   TVIFARAVAIALHRLLRRYGV"
FT   gene            complement(28038..28796)
FT                   /locus_tag="Pden_0034"
FT   CDS_pept        complement(28038..28796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0034"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sil:SPO0052 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68151"
FT                   /db_xref="GOA:A1AY07"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY07"
FT                   /protein_id="ABL68151.1"
FT                   /translation="MTAAAASVRGRAWVGDAPLFAPVDLVLHPGGWTCLLGPSGVGKST
FT                   ILRLIAGMETGARFEGEVTRNRPVALMAQDSGLIPWLDVTGNVTLGARLRGTLRASASS
FT                   QHADGQPGQEADPTARAVALIEAVGLTDRAHHLPANLSGGQRQRVALARTLFEDRPLVL
FT                   LDEPFSALDARTRAQMQDLAARLLDTRTVLLVTHDPAEAARLGDRILLLRETGLTDWPI
FT                   ASPRPKAAARPYDAPEVLSLQADLMRGMMA"
FT   gene            complement(28793..29467)
FT                   /locus_tag="Pden_0035"
FT   CDS_pept        complement(28793..29467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0035"
FT                   /product="transcriptional activator, TenA family"
FT                   /note="PFAM: TENA/THI-4 domain protein; KEGG: rde:RD1_3613
FT                   transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68152"
FT                   /db_xref="GOA:A1AY08"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY08"
FT                   /protein_id="ABL68152.1"
FT                   /translation="MNRYGHAFAAWRAEAQPDWDAYTRHPFVEGLRDGTLPQSRFLTYL
FT                   VQDYLFLKNFSRAWALAVVKAGDLDEMRACSATVHTLLDHEMSLHVQTCARAGMGPEVL
FT                   ADAQEAVTNIAYTRYVLEAGYSGDFLDLLAALMPCVIGYGEIGLRLATEATPDTPYREW
FT                   IDTYAGAEYQAACVSAGALLDSAIRKRLGEAPEKSPRWAALSDRFATATRLEVAFWELG
FT                   RE"
FT   gene            complement(29464..30435)
FT                   /locus_tag="Pden_0036"
FT   CDS_pept        complement(29464..30435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0036"
FT                   /product="NlpA lipoprotein"
FT                   /note="KEGG: sit:TM1040_3655 NlpA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68153"
FT                   /db_xref="GOA:A1AY09"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY09"
FT                   /protein_id="ABL68153.1"
FT                   /translation="MKHLTLAAAFAMLALPAHAQDKVTLILDWFVNPDHAPIIVAQEKG
FT                   FFAEEGLEVEVVAPADPSDPPKLVAAGRADYAISYQPQLHLQVHEGLPLKRVGTLVATP
FT                   LNCLMVKADGPVQEIADLKGKKIGYSVSGVEEALVGQILKTAGLTMQDVEMVNVNWSLS
FT                   PALIAGQVDATIGAYRNFELTQMRLEGAEGKCFFVEEQGVPTYDELIFIANPADLDLDR
FT                   TRRLLHAVERGVQYMVNHPEESWELFSATAPDLKDELNAEAWKDTLPRFSQSPAALDQG
FT                   RYARFEAFLHEAGLVDGVLPVSDLALDVGAQDMEAQDMGAAQ"
FT   sig_peptide     complement(30376..30435)
FT                   /locus_tag="Pden_0036"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(30432..31394)
FT                   /locus_tag="Pden_0037"
FT   CDS_pept        complement(30432..31394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0037"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: sit:TM1040_3654
FT                   UBA/ThiF-type NAD/FAD binding fold"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68154"
FT                   /db_xref="GOA:A1AY10"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY10"
FT                   /protein_id="ABL68154.1"
FT                   /translation="MNRYARQMVLPEVGAEGQERIAAAHALVVGAGGLGVPVLQYLAGA
FT                   GIGRITLVDPDTVEESNLHRQPLYRMKDIGQPKVRAAAQAVARLNPAVEIEALADRLTP
FT                   LNAPVLVAAANVVLDCADSYAASYTLSDACLAAGKPLISASALGLAGYVGGFCGGAPSL
FT                   RALFPDPPDSGQTCATAGVLGPVVGMLGCIQAQMALRLLLGTTPSPLGEFIRFDNGRFT
FT                   QFRFDAAPEADGPRFIAREDIRAADLVIDLRPEDEAPRKATPDALRIPGYGAAGPLPDP
FT                   GQRVVLACRSGLRSWRAADALSRRWSGEITLLALGDDDR"
FT   gene            complement(31391..31987)
FT                   /locus_tag="Pden_0038"
FT   CDS_pept        complement(31391..31987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0038"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="PFAM: thiamine monophosphate synthase; KEGG:
FT                   rde:RD1_0750 thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68155"
FT                   /db_xref="GOA:A1AY11"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY11"
FT                   /protein_id="ABL68155.1"
FT                   /translation="MRLPRFYPIFDSSDWLRRALPLGVKLVQIRIKDQPPARLLGELAL
FT                   CQELCREHGAMLVVNDHWQAAIDLGCDFIHLGQEDLDEADIPAIRKAGLRLGISTHDHA
FT                   ELDRALALRPDYVALGPVWPTILKKMKWEQQGLDRVREWRRLVGATPLVAIGGVTPERA
FT                   LEAFTAGADVASAVTDITLNPDPEGRIREWLRVAA"
FT   gene            complement(31984..32748)
FT                   /locus_tag="Pden_0039"
FT   CDS_pept        complement(31984..32748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0039"
FT                   /product="thiazole-phosphate synthase"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   rde:RD1_0749 thiazole biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68156"
FT                   /db_xref="GOA:A1AY12"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AY12"
FT                   /protein_id="ABL68156.1"
FT                   /translation="MPVFYGTRVESPLMLGTAQYPSPAIMAEAFRASRAGIATVSLRRE
FT                   GGAGQDFHRLIKDLGIPVLPNTAGCHSVREAVTTAQMARELFETPWLKLEVIRDDDTLC
FT                   PDVIALVEAARVLSDDGFQVFPYCTEDLSVCGRLLDAGCQVLMPWGAPIGSGRGLNNPY
FT                   GLRSLRAHFPDVPLVVDAGIGLPSHAAQAMELGYDAVLLNTAVAKAGDPVAMARAMALA
FT                   IEAGQLAHGANPIEARDMAAPSTPLFGMAVLG"
FT   gene            complement(32750..32947)
FT                   /locus_tag="Pden_0040"
FT   CDS_pept        complement(32750..32947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0040"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: bmb:BruAb1_0211 thiamine
FT                   biosynthesis ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68157"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY13"
FT                   /protein_id="ABL68157.1"
FT                   /translation="MKITLNGAARDLTGPTVQDALAEIGLGAAKVATALNGAFLPAAAR
FT                   PETTLKDGDALEVVAPMQGG"
FT   gene            complement(32931..33908)
FT                   /locus_tag="Pden_0041"
FT   CDS_pept        complement(32931..33908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0041"
FT                   /product="glycine oxidase"
FT                   /EC_number="1.4.3.19"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   rde:RD1_0747 thiamine biosynthesis oxidoreductase ThiO"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68158"
FT                   /db_xref="GOA:A1AY14"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY14"
FT                   /protein_id="ABL68158.1"
FT                   /translation="MNQITILGSGVMGLCIATELAARGIAPRIIDPAGKPGSQACSWRA
FT                   GGMLAPYCEAESAEPVVLRLGVDAADWWQANGAEVDRRGTLVLAPSRDRTELDRFARLT
FT                   EAHQPVTAEEIAALEPELAGRFPRGLHFATEAHLNPRAALLALRDRLEERGIRIETEGN
FT                   PTGMVVDARGLAARDELHDLRGVRGEMLVIRCPEVTLTRTVRLLHPRIPLYVVPRGEGV
FT                   YMIGATMLETGGKYRVTARSAVEMLSAAYALHPGFAEAEILELGSDARPAFPDNLPRLR
FT                   RRGGTLYANGLYRHGYLLAPAVARMAADYLVEGRKPEFMDEDHP"
FT   gene            complement(33905..34759)
FT                   /locus_tag="Pden_0042"
FT   CDS_pept        complement(33905..34759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0042"
FT                   /product="hydroxymethylpyrimidine kinase /
FT                   phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="KEGG: sil:SPO0045 phosphomethylpyrimidine kinase;
FT                   TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68159"
FT                   /db_xref="GOA:A1AY15"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY15"
FT                   /protein_id="ABL68159.1"
FT                   /translation="MPGRNERRAMSGLQPHPIALTIAGSDSGGGAGIQADLKTFSALGV
FT                   YGASVITAITAQNTRTVAAVEPVSPAMVAAQIDAVFGDLEVRAIKIGMVGGVDAITVVA
FT                   DRLAALLADNPVPVVLDPVMVAKSGDALLPDEAVSALREQLIPLATVLTPNLPEAARLL
FT                   DREPAATPEEMRRQGEALRALGAAHVLMKGGHATEDTCTDLLVGSEPLILTAPRQQTHN
FT                   THGTGCSLSSAIAAGLAQGLTVAQAATRAHGWLQGAIARADELAVGLGHGPVHHFHQLW
FT                   RQA"
FT   misc_binding    complement(34800..34903)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 90.54"
FT   gene            35028..35630
FT                   /locus_tag="Pden_0043"
FT   CDS_pept        35028..35630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0043"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: rpa:RPA4047 haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68160"
FT                   /db_xref="GOA:A1AY16"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY16"
FT                   /protein_id="ABL68160.1"
FT                   /translation="MKSVIFDLGGVLIDWDPALAFADVFTSRAEAEAWMKRIGFADWNR
FT                   IQDGGRSFAEGVAAARAVHGDEARHLAGYPLAFPVAIEKTVPGTWAIAEALLARGVPLY
FT                   ALTNWSAETWPHALELHPRLGGLFTDILVSGQVGVLKPEPAIYRLLMDRNGLVAEDCIF
FT                   IDDSAANAEGARALGIDAIHFTGAEALGEELARRGLF"
FT   gene            35726..36292
FT                   /locus_tag="Pden_0044"
FT   CDS_pept        35726..36292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sit:TM1040_3505 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68161"
FT                   /db_xref="GOA:A1AY17"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY17"
FT                   /protein_id="ABL68161.1"
FT                   /translation="MRYRSLYFIPVALLLLAGAAVGYTKVMARIGSGQPPAYALPEQQA
FT                   DRIVVSKGDKTMYLLRGDRILKTYRIAMGSNWNQGHKQREGDERTPEGTYRIDWRNPRS
FT                   IAHLSLHVSYPNAEDSERARQAGYSPGGNIMIHGLPNGWGAMGRLHRLLDWTDGCIAVT
FT                   NDEMREIWSLTPNGTSITIKAEWAP"
FT   sig_peptide     35726..35794
FT                   /locus_tag="Pden_0044"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.753 at
FT                   residue 23"
FT   gene            complement(36357..36791)
FT                   /locus_tag="Pden_0045"
FT   CDS_pept        complement(36357..36791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0045"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: bja:bll6386 3-dehydroquinate dehydratase;
FT                   TIGRFAM: 3-dehydroquinate dehydratase, type II; PFAM:
FT                   dehydroquinase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68162"
FT                   /db_xref="GOA:A1AY18"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY18"
FT                   /protein_id="ABL68162.1"
FT                   /translation="MPTVYVLNGPNLNLLGQRQPEIYGSTTLADVERDCKALGAELGLE
FT                   IAFHQSNHEGAIIDLIHEARLKAQAIVINPAAFTHTSVAILDALNTFDGPVIEVHISNV
FT                   HKRESFRHHSYVSLRAEGVIAGFGIHGYLLALRHVAKLVG"
FT   gene            complement(36818..37519)
FT                   /locus_tag="Pden_0046"
FT   CDS_pept        complement(36818..37519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0046"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rsp:RSP_2281 two-component
FT                   trancriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68163"
FT                   /db_xref="GOA:A1AY19"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY19"
FT                   /protein_id="ABL68163.1"
FT                   /translation="MTDTPLIAILDDEPEIRRLLSSALEEAGFRTVSFARATEFEAALR
FT                   RIQPDACLIDLGLPDRDGLALVHRLASESGAAIIIISGRAQVQDRVTGLELGADDYIIK
FT                   PFDPAEVVARIRARLRKPQRETGPGRQQIRFAGWSADFDRYTLTSPEGAETPISHAEAE
FT                   VLRLFLDNPRRLISRAQMLETLGGTAGESFDRAMDVRISRLRTKLGEDPKNPRLIKTIY
FT                   GAGYIFLAELG"
FT   gene            complement(37512..39392)
FT                   /locus_tag="Pden_0047"
FT   CDS_pept        complement(37512..39392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0047"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; PAS fold-4 domain
FT                   protein; KEGG: rsp:RSP_2280 PAS sensor hybrid histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68164"
FT                   /db_xref="GOA:A1AY20"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY20"
FT                   /protein_id="ABL68164.1"
FT                   /translation="MLGTDMPSNDRHAELTRSGLNLIQQAISIFDADLRLAVSNRPYQA
FT                   MFGLPDKLTRAGATFQDTIRYLVHRGEYGPQDDPEAAIRERVDQARTFQPHYMERKRAD
FT                   GRWISVEGAPLSQGGWIAVYTDITHIKRQEELLRARSEELSERVLENAERLSAANRALA
FT                   ATNAALEEAKRILTESEARTRHVTAMVPAHIAHMDRDYRYTFSNNQISMVFPGSNASII
FT                   GRQCETVLGAETFARIRPHLDRAIAGQPQVFEITHPPSGRRIRIALTPDQNGRGVYILS
FT                   TDVTAEVQAREALTHAAKRAVAAQMTSGLAHDFGNLLTIILGLQGRLARAGLPPEQAED
FT                   VQATLAAARRGVRLLDGISALTGGREHQPQPVELRAMLDDLAAMTRPTLGAGVALDSRI
FT                   GELPARVMLDPGALQDALLNLILNARDAMRGQGRITVEARPAGRWLEISVTDTGPGFSD
FT                   EALARATEPFFTTKGSQGTGLGLSMVYDQIKLSGGTLRLGNAESGGARITIRLPLRAVR
FT                   PHLVLLVEDDDAIRAHIREMLTAQGHSVIEAGSLSEARGLTDLAGLTLILSDLQLGDGS
FT                   GADLRGCGLPLILMTALPPGDPRRSGLDCPVLTKPFGDTELALAMAETDD"
FT   gene            39505..41481
FT                   /locus_tag="Pden_0048"
FT   CDS_pept        39505..41481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0048"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rsp:RSP_2279 long chain acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68165"
FT                   /db_xref="GOA:A1AY21"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY21"
FT                   /protein_id="ABL68165.1"
FT                   /translation="MQNAEAAQAGLQSIPALLARNAERFGDRPAYREKEFGIWQSWTWA
FT                   EAATEIRDLALGFLVLGLNRGDHVAIIGRNRPAHYWAMVAAQMCGAVPVPLYQDAVAEE
FT                   MAYVLDHCGARFVVCGDQEQVDKVLEVGDRAPSVQHLVYTDKRGMRKYDHARMNALADV
FT                   QAEGRAAQQRLGHELDERIAELGYDDTCVMLYTSGTTGKPKGVVLSNRNIIETGKNTAS
FT                   FDQLTAREEVLAYLPMAWVGDFIFSVGQAYWAGFTVNCPEGAHTMMTDLREIGPTYFFA
FT                   PPRVFEGQLTSVMIRMEDASRIKRRLFKHYMEIARRIGPALLDGKPVGALDRLRYMLGN
FT                   LLVYGPLKNTLGYSRIRVGYTAGEAIGPEIFDFYRSLGINLKQLYGQTEASVFITQQPD
FT                   GQVRSDTVGVPSPGVELKIAENGEVFYRSPGTFVEYYNNPDSTASTKDAEGWVATGDAG
FT                   FFEEESGHLRIIDRAKDVGRMADGRMFAPKYVENKLKFYPNILEAVVFGAGRDMCTAFV
FT                   NIDLTAVGNWAERNNIAYASYQELAGHPQVYATIKEHVEAVNESVAQDPMLSGCQISRF
FT                   LVLHKELDPDDGEMTRTRKVRRNIIAEKYADLIEALYDGRDTVSTRTEVTYEDGRKGEI
FT                   RATLKIEDARTFPTRTMQKVAAE"
FT   gene            41478..42287
FT                   /locus_tag="Pden_0049"
FT   CDS_pept        41478..42287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0049"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sit:TM1040_0114 ABC transporter related; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68166"
FT                   /db_xref="GOA:A1AY22"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY22"
FT                   /protein_id="ABL68166.1"
FT                   /translation="MTQTTITPDGRQIGDVLMDLRNITLRFGGVTAIKDISFDIREGEI
FT                   RAIIGPNGAGKSSMLNVISGFYVPQEGEIWFKGYRRGPMKPYEVARLGIARTFQNIALF
FT                   DGMSVLDNIMTGRLNMMKAPIWSQALWWGRAEREEVENREQVEKIIDFLEIQNIRKTPV
FT                   GRLPYGLKKRVELARALAAEPKILLLDEPMAGMNVEEKEDMCRFILDVNDEFGTTIALI
FT                   EHDMGVVMDLSDRVVVMDYGRKIGDGTPDEVRNNPEVISAYLGVAHE"
FT   gene            42298..43278
FT                   /locus_tag="Pden_0050"
FT   CDS_pept        42298..43278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0050"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rsp:RSP_2277 ABC branched amino acid transporter family,
FT                   inner membrane subunit; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68167"
FT                   /db_xref="GOA:A1AY23"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY23"
FT                   /protein_id="ABL68167.1"
FT                   /translation="MEFLYASEVLLNGLMAGVMYSLVALGFVLIYKASGIFNYAQGVMA
FT                   LFAAMTLVGIMEGRVPFAHLINAAFGVHLSSFGWTVPGLLAILLTALIMVGLAIAIEKL
FT                   VLKHLVGQEPIILFMATIGLAWFLEGLGDVMWGADVKVLDVGLPQGISETVETMTDGLF
FT                   GYGFFIDRLDIWATVIAAVLVAALVGFSQYTKQGRAMRAVADDHQAALSVGISLQFIWI
FT                   MVWSIAGFVALVAGIMWGTKSGVQFSLSLIALKALPVLMLGGFTSIPGAIVGGLIIGMG
FT                   EKLFEYFVGPAVGGATENWFAYVLALLFLVFRPQGLFGERIIERV"
FT   gene            43354..44460
FT                   /locus_tag="Pden_0051"
FT   CDS_pept        43354..44460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0051"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rsp:RSP_2276 ABC branched amino acid transporter family,
FT                   inner membrane subunit; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68168"
FT                   /db_xref="GOA:A1AY24"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY24"
FT                   /protein_id="ABL68168.1"
FT                   /translation="MSKRRSREGRMFYREAGDFKTSYRDDGQTFPIKLDRWGYYAILAV
FT                   AFLVVPLVIDSYWANAVLVPFLIYAIAALGLNILTGYAGQVSLGTGGFMAVGAYAVYKL
FT                   MVAFPGVPIVVHIILAGAITAVVGMLFGLPSLRIKGFYLAVATLAAQFFLVWLFNKVPW
FT                   FYNYSASGQINAPERTILGWAVTGPATSASAKYLICLCFAVGLAWMARNLTRGSVGRKW
FT                   MAIRDMDIAAEIIGVNPLTAKLSAFAVSSFFVGIAGALLFSVYLGAAEASEAFGINKSF
FT                   LVLFMIIIGGLGSIFGSFAGAAFLVLLPVLLKNVLVAQFGWPTDLAAHIELMIVGALIV
FT                   FFLIVEPHGLARLWALTKEKLRLWPFPH"
FT   gene            44505..45785
FT                   /locus_tag="Pden_0052"
FT   CDS_pept        44505..45785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0052"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="KEGG: rsp:RSP_2275 ABC branched amino acid
FT                   transporter family, periplasmic substrate-binding subunit;
FT                   TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68169"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY25"
FT                   /protein_id="ABL68169.1"
FT                   /translation="MKLKLATVALGAVMAAAPAMADLVVPNLSYRTGPYGANGTQYADG
FT                   FNDYFTLLNERDGGIGGEKIRTPECETAYNTEKGVECYEATKGSGALVYNPLSTGITYQ
FT                   LIPKVAADKIPLYTPGYGRTSAKNGKVFEWVFNAPANYWDGASVAIKYLLDQNGGSLEG
FT                   KKIALVYHNSAYGKEPIRTLQELGKKHGFTLTELPVDPPGQEQKSQWLQIRRDKPDYVL
FT                   MWGWGVMNQTAIQEAANIRFPMENFIGTYWSGSEVDVKPVGAGANGYKALTFHGVGMDY
FT                   PIYEDMKKHVIDPGKASQGGQFVGSVLYSRGMYAGVVIAEAIKKAQELAGTSQITAAQL
FT                   RDGFEALDITPERLAELGLPDFGPEIKMSCDNHGGSGMARLQQWDASAGKWTLITDFTQ
FT                   PDQDVLDPLILEDSEAYAKEAGISPRC"
FT   sig_peptide     44505..44570
FT                   /locus_tag="Pden_0052"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            45839..46663
FT                   /locus_tag="Pden_0053"
FT   CDS_pept        45839..46663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0053"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rsp:RSP_2274 ABC branched amino acid transporter
FT                   family, ATPase subunit; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68170"
FT                   /db_xref="GOA:A1AY26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY26"
FT                   /protein_id="ABL68170.1"
FT                   /translation="MFDAAPQRETLLEVNNIEVIYNHVILVLKGVSLSVPKGGITALLG
FT                   GNGAGKTTTLKAISNLLHSERGEVTKGSISYRGERIQDMDPASVVKKGIIQVMEGRHCF
FT                   EHLTIEENLLTGAYTRTDGSAAIRQDLEMVYSYFPRLKERRKSQAGYTSGGEQQMCAMG
FT                   RALMSRPETILLDEPSMGLAPQLVEQIFEIVKAVNEGEGVTFLLAEQNTNVALRYAHYG
FT                   YILESGRVVMDGPADALRENPDVKEFYLGMSDQGRKSFRDVRSYRRRKRWLA"
FT   gene            46682..47899
FT                   /locus_tag="Pden_0054"
FT   CDS_pept        46682..47899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0054"
FT                   /product="phenylacetate-CoA ligase, putative"
FT                   /note="KEGG: sil:SPO3289 phenylacetate-CoA ligase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68171"
FT                   /db_xref="GOA:A1AY27"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY27"
FT                   /protein_id="ABL68171.1"
FT                   /translation="MTFYDKLETRSADERALWQAAELPAAIARAGTAPALARILGDVAP
FT                   DQVTTREALAKLPVIRKSELSEAQKRTPPFGGFTTRPAPDFENVFQSPGPIYEPGRRGE
FT                   DWWRLGRFLHAAGVGRGDIIHNCFGYHLTPAGMMFESAARAVGAATLPAGTGQTELQVR
FT                   AAVDIGTTVYAGTPDYLKIMLDKAEELGERLSFTRAVVSGGALFPSLRQGYADRGIATT
FT                   QCYATADLGLIAYESPAMEGMIVDERVIVEIVRPGTGDPVPEGEVGEVVVTTLNPDYPL
FT                   VRFATGDLSAVLPGVSPCGRTNMRIKGWMGRADQTTKIKGMFVRPEQVAALVARHPEIS
FT                   RARVVADRSGDMDVMTVLLETGADDAARYEGTVLDTLKLRGRVELVAPGSLPNDGKVIE
FT                   DRRSYD"
FT   gene            complement(48379..48504)
FT                   /locus_tag="Pden_0055"
FT   CDS_pept        complement(48379..48504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0055"
FT                   /product="LSU ribosomal protein L36P"
FT                   /note="PFAM: ribosomal protein L36; KEGG: hne:HNE_3350
FT                   ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68172"
FT                   /db_xref="GOA:A1AY28"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AY28"
FT                   /protein_id="ABL68172.1"
FT                   /translation="MKVRNSLRSLKSRHRDCQVVRRKGRIYVINKTNPRFKARQG"
FT   gene            complement(48588..48662)
FT                   /locus_tag="Pden_R0001"
FT                   /note="tRNA-Val1"
FT   tRNA            complement(48588..48662)
FT                   /locus_tag="Pden_R0001"
FT                   /product="tRNA-Val"
FT   gene            48847..49710
FT                   /locus_tag="Pden_0056"
FT   CDS_pept        48847..49710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0056"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /note="PFAM: N-formylglutamate amidohydrolase; KEGG:
FT                   rde:RD1_0718 N-formylglutamate amidohydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68173"
FT                   /db_xref="GOA:A1AY29"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY29"
FT                   /protein_id="ABL68173.1"
FT                   /translation="MTREEPTFDLMRPQRWLGGVIFASPHSGRAYPDWFLAESRLNAQQ
FT                   LRSSEDAFVDRLIQPALDHGATMLTARVPRCVVDLNRGPEEIDPLVVSGAPPGLTNPRI
FT                   MAGLGVIPRVVSQGRAIHDRPIPRTEAESRIARLWHPYHRALSALIDEAVARFGGAILI
FT                   DMHSMPRDALAHLPRPRPDMVLGDRNGVSAAPRISAGVADAVVAEGFRLRRNSPFSGAY
FT                   ITQTYGRPRNNVHVVQLELDRSLYMDEGRIEPRADFELFQARFARVITRLARLRPDASD
FT                   AAFAAE"
FT   gene            49729..50616
FT                   /locus_tag="Pden_0057"
FT   CDS_pept        49729..50616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0057"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="PFAM: band 7 protein; KEGG: rsp:RSP_1401 band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68174"
FT                   /db_xref="GOA:A1AY30"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY30"
FT                   /protein_id="ABL68174.1"
FT                   /translation="MPPEFAEMIGQNLALIVLALVILFAVSRAVRIVPQSEKYVVERFG
FT                   RLHAVLGPGINFIVPFLDRVAHRISVLERQLPTSRQDAITADNVLVQVETSVFYRIIEP
FT                   EKTVYRIRDVDAAITTTVAGIVRSEIGTMELDQVQSNRAPLIERIRESLANIVDDWGIE
FT                   VTRAEILDVNLDEATRAAMLQQLNAERARRAQVTEAEGRRRAVELAADGDLYAAEQQAK
FT                   AKRLLADAEAYATAAIATAIREGGIEAAQYQIAMRQVDVLAEVGKGQGKQTVIVPASAV
FT                   EALGDAFRMLRGGK"
FT   gene            50750..51301
FT                   /locus_tag="Pden_0058"
FT   CDS_pept        50750..51301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0058"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: sil:SPO3279 NUDIX
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68175"
FT                   /db_xref="GOA:A1AY31"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY31"
FT                   /protein_id="ABL68175.1"
FT                   /translation="MAGWAADGAGGHRGADRGDLAGAAAYLRQEPGRGATLDTRHQRQL
FT                   GFVGANLVLTHGAHLLTCLRDDYRWIRFPAHWDLPGGAAEPGETPVECALRELEEEFGL
FT                   RLSAGRLTGQPFVSVHAPPRASWLFCGTITAAEIAAIRFGDEGQEWRMMPIAEFVAHPR
FT                   AVPHFRDRVRLVLAGAGCGI"
FT   gene            51353..51982
FT                   /locus_tag="Pden_0059"
FT   CDS_pept        51353..51982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0059"
FT                   /product="Glutathione S-transferase, N-terminal domain"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   KEGG: bpe:BP1270 putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68176"
FT                   /db_xref="GOA:A1AY32"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY32"
FT                   /protein_id="ABL68176.1"
FT                   /translation="MSRMQLYRRNGWGSAIVEAQLAHYGLEAEGVEVADLFLDSAARRE
FT                   LMRISPAGQIPVLILPDGRVLSESAAITLHLADMTERDDLVPAAGAAERPRFLRWLIFL
FT                   VAQVYPCFTFGDDPARFLTDPAAQKELGEATTARLQELWTALEGAVGAPWFLGERFSAL
FT                   DIYLAVMTNWKPGPEWFEAHAPKVWSIARATVARDDLAPVFQRNFG"
FT   gene            complement(51983..52687)
FT                   /locus_tag="Pden_0060"
FT   CDS_pept        complement(51983..52687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0060"
FT                   /product="orotidine-5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="KEGG: rde:RD1_0720 orotidine 5'-phosphate
FT                   decarboxylase; TIGRFAM: orotidine 5'-phosphate
FT                   decarboxylase; PFAM: Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68177"
FT                   /db_xref="GOA:A1AY33"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY33"
FT                   /protein_id="ABL68177.1"
FT                   /translation="MTQTPDERLIVALDVPNALAGLELAEKIGDAAGFYKIGLGMLTGG
FT                   GLALANELKQEHGKRIFLDMKFFDIGATVEAAVRGIAQYDLDFLTVHGDPHVVRAAKQG
FT                   ASGSGLKILAVTILTSLDRADLDAGLIVPGDVAEIVATRAARAFEAGADGIIASPREAA
FT                   AIRALPEAAGRLIVTPGVRPAGSDAGDQKRIETPATAIANGADHIVVGRPIWQAADPRA
FT                   AAQAIAAELAGL"
FT   gene            52790..53563
FT                   /locus_tag="Pden_0061"
FT   CDS_pept        52790..53563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmr:Mmar10_0746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68178"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY34"
FT                   /protein_id="ABL68178.1"
FT                   /translation="MQFNITIQRDPEDPRSGPITVGWLRATDKGGVLFEPPERVSFRDT
FT                   NRASAKSAARCPAVIALEARYFMIKCPFDLHIGFDRDEQGRARLINRAGAAGAVRSGRM
FT                   SDVLVLVSEAEWRYPDRPTIQMKLPYIFIADEPVYMTQLDSFAHYRRRPLPGTIFGGRF
FT                   PINIWPRQLMWAFEWHETDKDLILKRGEPLFYVQLEGDGPERPLQLVEAERTPELQSYI
FT                   DHVSGVVNFANQTFSLFRAAEAARPARLLVAKQRR"
FT   gene            53670..56297
FT                   /locus_tag="Pden_0062"
FT   CDS_pept        53670..56297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0062"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; Clp N
FT                   terminal domain protein; ATPase associated with various
FT                   cellular activities, AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: sit:TM1040_0130 ATPase AAA-2"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68179"
FT                   /db_xref="GOA:A1AY35"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY35"
FT                   /protein_id="ABL68179.1"
FT                   /translation="MDMEKFTERSRGFLQAAQTIAIREENQRVMPEHLLKALMDDDQGF
FT                   ASNLIARAGGDAQAVRQAVDQAVEKQPKVSGGQGQVYIDPSMVRVLDEAEKLAKKAGDS
FT                   FVPAERVLTALAIVNTNARDALAAGKVTAQALNSAINDVRKGRTADTASAEDSYEALSK
FT                   YARNLTEAAAEGKIDPIIGRDEEIRRAMQVLSRRTKNNPVLIGEPGVGKTAIAEGLALR
FT                   IVDGDVPESLRNKQLWALDMGALIAGAKYRGEFEERLKSVLKEIENAAGEIVLFIDELH
FT                   VLVGAGKTDGAMDAANLIKPALARGELHCVGATTLDEYRKYIEKDAALARRFQPVMIEE
FT                   PTVEDTISILRGIKEKYELHHGVRISDAALVAAATLSHRYITDRFLPDKAIDLMDEAAS
FT                   RLRMEVDSKPEELDALDRQILQMQIEAEALKKEDDAASQDRLEKLEKQLSELQEKSATM
FT                   TARWQAERDKLEGSRNLKEQLDRARAELDQAKREGNLARAGELSYGIIPGLERQLAESE
FT                   GSEDGPMVEEAVRPEQIAEVVERWTGIPTSKMLEGEREKLLKMEDVLSKRVIGQSEAVT
FT                   AISNAVRRARAGLNDPKRPLGSFLFLGPTGVGKTELTKAIAEYLFDDDSAMVRIDMSEF
FT                   MEKHSVARLIGAPPGYVGYDEGGVLTEAVRRRPYQVILFDEVEKAHPDVFNVLLQVLDD
FT                   GQLTDGQGRTVDFKQTLIVLTSNLGAQALSALPEGADSGQARAQVMDAVRAHFRPEFLN
FT                   RLDEIIIFHRLTRENMDGIVRIQLWQLETRLAQHKIGLDLDEAALKWLADEGYDPVFGA
FT                   RPLKRVMQRSLQNPLAEMILAGEVLDGQTVHVSAGPDGLIVGNRVSTAHLGPADESGPR
FT                   VPLH"
FT   gene            56428..57324
FT                   /locus_tag="Pden_0063"
FT   CDS_pept        56428..57324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0063"
FT                   /product="oxidoreductase, molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase, molybdopterin binding; KEGG:
FT                   rsp:RSP_1410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68180"
FT                   /db_xref="GOA:A1AY36"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY36"
FT                   /protein_id="ABL68180.1"
FT                   /translation="MTMKWSEVTPEADYLNRRAFLAAGIAALATPALGLGGAPSAFSTD
FT                   EAVNSLEDITHYNNFYEFGTGKSDPAQYSGSLKTSPWSVTIDGMVDRPGNYGVEDLAPE
FT                   SALEERIYRLRCVEAWSMVIPWLGVPLAGALDKAGVQPGAKFVAFRTLHDPEQMPGQRS
FT                   RILDWPYREGLRLDEAMHPLTILATGLYGRVLPNQNGAPIRLVVPWKYGFKSIKSVVGI
FT                   TLTDTQPQCSWQMMQPGEYGFYANVNPQVDHPRWSQATERRIGKGLFGGRQDTLMFNGY
FT                   GDQVAGLYAGMDLAKHY"
FT   sig_peptide     56428..56559
FT                   /locus_tag="Pden_0063"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.907) with cleavage site probability 0.679 at
FT                   residue 44"
FT   gene            57324..57950
FT                   /locus_tag="Pden_0064"
FT   CDS_pept        57324..57950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0064"
FT                   /product="Ferric reductase domain protein transmembrane
FT                   component, N-terminal domain"
FT                   /note="PFAM: Ferric reductase domain protein transmembrane
FT                   component, N-terminal domain; KEGG: sit:TM1040_0134 ferric
FT                   reductase-like transmembrane component-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68181"
FT                   /db_xref="GOA:A1AY37"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY37"
FT                   /protein_id="ABL68181.1"
FT                   /translation="MVQHLNRWLRHVPVWAVWLLGLVPLGLLVWDALQGHLGVDPVRDI
FT                   EHRLGRTAIYFLLATLTVTPLLRLTRLNLMRFRQALGLICFAYVACHLVAWVVFDMAFL
FT                   WAQMLKDVVKRPYLVFGMLAFAMLLALALTSNRFSIRRMGAGWRKLHRLVYPAAILAGV
FT                   HWLWALKVWESWPLTILGTILLLLFLRLLRKWGWSGVFGVVRRAG"
FT   gene            57925..58224
FT                   /locus_tag="Pden_0065"
FT   CDS_pept        57925..58224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68182"
FT                   /db_xref="GOA:A1AY38"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY38"
FT                   /protein_id="ABL68182.1"
FT                   /translation="MVWFGALVDCWAGGVACWVCSEFPILFQLLIILCHFFEFCLLRVP
FT                   GGRPKYPLTETTGRSERDGTRRWKVRFWRQSGNERPDGASLEWRNFRVFLSSAF"
FT   gene            58447..59902
FT                   /locus_tag="Pden_R0002"
FT   rRNA            58447..59902
FT                   /locus_tag="Pden_R0002"
FT                   /product="16S ribosomal RNA"
FT   gene            60071..60147
FT                   /locus_tag="Pden_R0003"
FT                   /note="tRNA-Ile1"
FT   tRNA            60071..60147
FT                   /locus_tag="Pden_R0003"
FT                   /product="tRNA-Ile"
FT   gene            60210..60285
FT                   /locus_tag="Pden_R0004"
FT                   /note="tRNA-Ala1"
FT   tRNA            60210..60285
FT                   /locus_tag="Pden_R0004"
FT                   /product="tRNA-Ala"
FT   gene            60609..63451
FT                   /locus_tag="Pden_R0005"
FT   rRNA            60609..63451
FT                   /locus_tag="Pden_R0005"
FT                   /product="23S ribosomal RNA"
FT   gene            63563..63677
FT                   /locus_tag="Pden_R0006"
FT   rRNA            63563..63677
FT                   /locus_tag="Pden_R0006"
FT                   /product="5S ribosomal RNA"
FT   gene            63740..63816
FT                   /locus_tag="Pden_R0007"
FT                   /note="tRNA-Met1"
FT   tRNA            63740..63816
FT                   /locus_tag="Pden_R0007"
FT                   /product="tRNA-Met"
FT   gene            complement(64006..64503)
FT                   /locus_tag="Pden_0066"
FT   CDS_pept        complement(64006..64503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhe:BH15450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68183"
FT                   /db_xref="InterPro:IPR041635"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY39"
FT                   /protein_id="ABL68183.1"
FT                   /translation="MPRIPRVKAADDFWAFSKAGRVLAALHVNYEQVEPYPVTFIRGDT
FT                   SLVPPPDPERFYRVEQMKFAGKRPKLDRSTVIYNASITISGIPLEAYDYVVNGKPALEW
FT                   VMERQCVKTDKASGIVNDANRYAIETVGDPVYPLRLFQRIITVSLETMKIVKALPALGD
FT                   LS"
FT   gene            64712..65059
FT                   /locus_tag="Pden_0067"
FT   CDS_pept        64712..65059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0067"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: sme:SMa1613
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68184"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY40"
FT                   /protein_id="ABL68184.1"
FT                   /translation="MIGPGTGVRVYLACGVTDMRKGISGLAALAQDVLRQKPAGGAVFA
FT                   FRGRRGDRLKLLHWDGQGFCLYYKVLEKGRFPWPMRGDGAVRLTSAQLAMLWEGIDWRR
FT                   PDWGAPPARVG"
FT   gene            65122..66750
FT                   /locus_tag="Pden_0068"
FT   CDS_pept        65122..66750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0068"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: sme:SMa2171
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68185"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY41"
FT                   /protein_id="ABL68185.1"
FT                   /translation="MSNAAQTLPDDPALLKSLIAALQAENAKISATLRAHDQLIQSLRL
FT                   RIARLKKQVFGQSSEKIEREIEQLELALEDLMIAAAEGQPDVVNDGQNDDGLETAPADE
FT                   AAERPSRRRPRVSDSTPRERRELDPGSCCPDCGGDLRLVGEDVSEMLDLIAAQLKVVQI
FT                   ARLKKSCRRCERMVQMPAPSRPIPGSMAGANLLAHILVSKFDDHLPLYRQHEIFTRMGA
FT                   DIPDSTLVDWCGRAMKVLAPLIERIEVDVMASDLLHADDTPIRVLDRAGRDKGVGKGVK
FT                   KGRIWAYVRDQRPWAGASPPGAVYAFAPDWKEEHVHGHLANTRGILQADGYKGYAKLYE
FT                   PEPDGKPRLREAACWAHLRRDFHDEWTKTKSTIAREALDRIGALYDIEREITGHPADIR
FT                   LAARRKHSVPKVEVFFAWSEQQLSRIPGKGDLAKAFRYGLSRRDAFSLFLEDGRVAIDN
FT                   NPAERALRPIGVGRRNWLFAGADTGAETLARAMTIVETAKMNGLDPQAYLADILARIHD
FT                   HKINRLDDLLPWNWSPLPSALHEAA"
FT   gene            66750..67046
FT                   /locus_tag="Pden_0069"
FT   CDS_pept        66750..67046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMa1608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68186"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY42"
FT                   /protein_id="ABL68186.1"
FT                   /translation="MATVTHVCTLDYIAKMLGEDPELLKAIVYNDDNLTYGSIISVYTG
FT                   PDDTVTALTDDGIDELKDMLRDARITTETWHAFLDDFVDDAELVARIKAQSPR"
FT   gene            complement(67024..67266)
FT                   /locus_tag="Pden_0070"
FT   CDS_pept        complement(67024..67266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nma:NMA2178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68187"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY43"
FT                   /protein_id="ABL68187.1"
FT                   /translation="MPIEIERKFLLANEDWRAAVSRSTRLRDGILAFYDGRKIRIRFYD
FT                   EKATLTVKGPRKGLARDEFEYEIRNRPIVTAATEP"
FT   gene            67303..67578
FT                   /locus_tag="Pden_0071"
FT   CDS_pept        67303..67578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY44"
FT                   /protein_id="ABL68188.1"
FT                   /translation="MTHSSSQFDDGQRSRRRWPQQEKLQRPCSDRCQDRPGRVRCTRSG
FT                   QAGPLPVCHAAKHMTSRRHESGIMIWPRNPRTTVRRTPLCVSPARH"
FT   gene            67679..69196
FT                   /locus_tag="Pden_0072"
FT   CDS_pept        67679..69196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0072"
FT                   /product="CHAD domain containing protein"
FT                   /note="PFAM: CHAD domain containing protein; KEGG:
FT                   neu:NE1494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68189"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY45"
FT                   /protein_id="ABL68189.1"
FT                   /translation="MITGDETYYLSATRLGDLAGRDVQNLTPLLEWAEGSRPFAIRDCF
FT                   DQSLRMSRRLLLEDGSRLELISAAGEVLRQPATPQARFVAEFAKGPVKIALAGLSPLRA
FT                   LLPVASGMARSGRLALVDGEGKTRARAELRELQPTDGNAVILVRPQGLRGYDRALHDLV
FT                   AHLRDCGGTPFGAGNLYRMIDPANTGYVARPKIEVGREETAFDAANDLIDGHLPVARAN
FT                   EQGIVADLDTEFLHDYRVALRKIRSVLSLFKGVYDPEQTAGLKARFSALMVPTGPLRDL
FT                   DVYLLAQQDFCDLVPERMHAGLDRMFARLRDRRAAEHAKLAAHLRSKGYQKEIKALAKL
FT                   FARRRKLLPGPNASRASFDLACELIWKRYRRIRRIAAGLTAETPDEEVHALRIECKKLR
FT                   YLMEFFGPVFPRGDFQKVLKPLKELQDSLGLFNDYAVQQTRLQAFADDLGDAPHKLDIA
FT                   QSVGALVIVLHQKQLAEREKIAATFARFNSGRMQRTIRRLFHEGKGS"
FT   gene            69196..69945
FT                   /locus_tag="Pden_0073"
FT   CDS_pept        69196..69945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0073"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   neu:NE1495 ParA family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68190"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY46"
FT                   /protein_id="ABL68190.1"
FT                   /translation="MQIIACYSNKGGVGKTATAVNLAYAFAASGRRTLLCDLDPQGASG
FT                   FYFRVKPSKKLIDAQFFEDDQRFAKAIRGSDYDNLDILPANISFRDFDVFLSRMKNSQS
FT                   RLKKALKAVKSDYDVVVLDCPPNISMLSENVFHAADAVVVPVIPTTLSQRTFDQLLEFF
FT                   QASDLPENRIHAFFSMVQGIKSLHGETIAGMTEAHPGRFAQATIPFASEIERMGLTRAP
FT                   VLATAPGSRAGKAYQALFEEIEGRVKA"
FT   gene            69942..70397
FT                   /locus_tag="Pden_0074"
FT   CDS_pept        69942..70397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0074"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: adenylate cyclase; KEGG: neu:NE1496
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68191"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY47"
FT                   /protein_id="ABL68191.1"
FT                   /translation="MKEIERKFLVEGPVPKGLYARPILQGYLTAATDSVEIRLRREGDD
FT                   YSLTLKSDGGLTREEREIALGAAEFEALWPATEGRCVEKTRHRGTLPGGQAFELDVFSG
FT                   HLAPLMLVEVEFPSEEAALAFAPPAWFGQEVTEDKRFKNKALALSRP"
FT   gene            complement(70419..70706)
FT                   /locus_tag="Pden_0075"
FT   CDS_pept        complement(70419..70706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: jan:Jann_1003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68192"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY48"
FT                   /protein_id="ABL68192.1"
FT                   /translation="MQIEYEEFIGKARYIARPSGPHVELVVTDPTPQLRVAYYTAMSKG
FT                   ARSRTMARALVKRMVEDARKTGRQIVPLCPFVRDEAEKNPDWADVIRDQA"
FT   gene            complement(70813..71199)
FT                   /locus_tag="Pden_0076"
FT   CDS_pept        complement(70813..71199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68193"
FT                   /db_xref="GOA:A1AY49"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY49"
FT                   /protein_id="ABL68193.1"
FT                   /translation="MNPFCQHALVAPGDRHVNRRDSEDYSGSQIGHCINRAKRKRPASS
FT                   ANQRDCSPFSSSDDDQPSAYLVVFLFLVSGWAIMIIALTATACWILDMSLMSIIYGYLG
FT                   GGVFGAMVAIIGSLLVHETRHDAG"
FT   gene            71248..71667
FT                   /locus_tag="Pden_0077"
FT   CDS_pept        71248..71667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0077"
FT                   /product="transposase"
FT                   /note="KEGG: gox:GOX2729 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68194"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY50"
FT                   /protein_id="ABL68194.1"
FT                   /translation="MARNLMSNDEWAFFERFILAVRSPNGRKPTNHRLVLDGIFWIART
FT                   GSPWRDLPEEFGKWSSVYRQFRRWTLAGLWEQILEALNESRIVPDALQMIDSTVVRAHH
FT                   QAAGAKGGLRAKVSAAREVASRPRSICGSMRQACP"
FT   gene            71795..72022
FT                   /locus_tag="Pden_0078"
FT   CDS_pept        71795..72022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0078"
FT                   /product="truncated transposase"
FT                   /note="KEGG: gox:GOX2722 truncated transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68195"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY51"
FT                   /protein_id="ABL68195.1"
FT                   /translation="MEVRDVVPVIPMRKTRKLRVAVDRRLYRLRNLVERCFNKLKNARR
FT                   VATRYDKTAESFLGFIDITSIRLWLRHLST"
FT   gene            72151..72867
FT                   /locus_tag="Pden_0079"
FT   CDS_pept        72151..72867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0079"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: nar:Saro_0441 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68196"
FT                   /db_xref="GOA:A1AY52"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY52"
FT                   /protein_id="ABL68196.1"
FT                   /translation="MTGEQKGIRVLLVEDEETVLQLHGAVLVGAGCVVDEAPTLACFRD
FT                   RIARSRYDIVLLDLCLPDGNALEAISEIRRGTSAGIIVATSNRDPDDRLTGLEQGADEY
FT                   LEKPVHPRELVARVRNLAGRLAVAKREEKMELVHHFQGWSVDLAARTVRLHDGDTLQLT
FT                   ENEFRLLDVLIRNAAKPVHRERLLTALGSDEEATDRAVDKAIYRLRVKLHAVLGHATPL
FT                   IETVHGFGYRFIAEIL"
FT   gene            72869..75208
FT                   /locus_tag="Pden_0080"
FT   CDS_pept        72869..75208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0080"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region, ATPase domain
FT                   protein domain protein; histidine kinase A domain protein
FT                   domain protein; KEGG: ccr:CC0026 sensory box histidine
FT                   kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68197"
FT                   /db_xref="GOA:A1AY53"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY53"
FT                   /protein_id="ABL68197.1"
FT                   /translation="MAGVPPDSRRAAMADEAESMTTFAVLRPDGLISYCSAPFAHLLGS
FT                   EERVVVGTPIGAWLRPVEGAGSGWFAVVRQSEGHLLRTGGVGQFRYRLDPMAGGGAVLH
FT                   LMQGTGNLDPIYARAFQLNPGLSALSVLDTGEHLDVNDAWLRNMEYRREEVIGRTASEM
FT                   QVWEQGDTSRTEIVRRLREDGKIENFQARMRTRTGKLRDILVSAELVEHAGRKLAFFAS
FT                   HDITEVKKAQEELEALNRQLEQRIAERTAEIVRKNRELAEAAERAQAANEAKSQFLSVM
FT                   SHEIRTPLNALLNMAELLIEDGNPAPAAAHLSGIASSARALAAIVDDVLDFSRIESGHL
FT                   EIYPAATDIGRLCEEAVRGVAPLAHRKGLDIVLTFGQRLPATAMVDPLRLRQILFNLVG
FT                   NAIKYTRKGWIEVRADVTGETAEPQLLVEVIDTGIGIRPNDLERIFERFSRIGADANHE
FT                   IHGAGLGLNISAGLARAMGGTIRVESEVDRGSAFRVTLPLVTCGELAEDPLRQPLQGRV
FT                   ALLGPATRTRSTFEAILKRQGVVAQRVLSASGAQVITMESGRSAIDCAMRQSFDILLLD
FT                   LRMPDLSGYETAVRIRALGGWAADVPIVAVSANIAPDKAQMQAAGIDGFLAKPFTPTAL
FT                   RAKVQGHLHHSAGDTEPDDSIRADATPVLDESFLAAQVTYAGPDAVGKAIAGFLGNLDG
FT                   RLSRIWSGADARERADAAHMLAGAAGALGLLDLATHCRRLASDRGDSPTASLRQDRDIL
FT                   ASSAGRAVAALREVRDKLAAGSSRQD"
FT   gene            75555..77324
FT                   /locus_tag="Pden_0081"
FT   CDS_pept        75555..77324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0081"
FT                   /product="regulatory protein, LuxR"
FT                   /note="PFAM: regulatory protein, LuxR; KEGG: sil:SPO1388
FT                   transcriptional regulator, LuxR family/hydrolase,
FT                   alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68198"
FT                   /db_xref="GOA:A1AY54"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY54"
FT                   /protein_id="ABL68198.1"
FT                   /translation="MLESKPKTPLADQHFFLSPQLSEGQSSDDDIDLNIIASTYRSIID
FT                   EHAFDEMVASWETKLASSGGDAEHPKVSKGLFSQLLTFRNTLEKLDVPTESDPLKLAVS
FT                   EVPGPATVLSPNGNVAVINIAGERAFGTRQGAFMDVAVIAPNSLEDYCALLRAATGQGN
FT                   AAQAILTILPATEGYGESFLAEGYLIRVPGQSGAHIAIRSLEIAWGPRIAEQLQQAFGL
FT                   TQAESEVAHLFFRLRNLESIAAERGVSLLTVRTQIKTIMAKMGAPSNIDLMRLLAMIAS
FT                   REHVGLRGEAPVWHDPLGREKLIEMPDGRKIAWTWIGAKRGAPVVMLRGLPMTYLLPGG
FT                   GEARLRDAGICLYVPSRPGHGNSTMDSSLDVMSDNLVALRVFLDQVIGRPCLGVGLASG
FT                   TLPLVVEAVANPARFHGILAVGFSCGIDPSGVQRLPQIQRIMLQLADSAPWVAELMAKS
FT                   GHRMMRQHGLDWYLERAFRHTPLNQQTVRNPDWTALIRNACEHLLKQGHATFVRELQLS
FT                   RHRMDTALRELRIPMRYLAPTEDPGIDLASCRQLERINPLITVEPVTDAAELVFYQRND
FT                   LILDRIIALVHRN"
FT   gene            77426..77737
FT                   /locus_tag="Pden_0082"
FT   CDS_pept        77426..77737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68199"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY55"
FT                   /protein_id="ABL68199.1"
FT                   /translation="MSARSIFGLVVLQREGLMSDATIMRRRRQAPEYVATPDMAAFTIG
FT                   QIAITALREEGGLSVEILRRHLARVASGQEDAVASRVSPDMALGALRYIETSLQNKVA"
FT   gene            complement(77791..78135)
FT                   /locus_tag="Pden_0083"
FT   CDS_pept        complement(77791..78135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68200"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY56"
FT                   /protein_id="ABL68200.1"
FT                   /translation="MIRQAPLRGSDPKLSAWLHEQDRLASLVSETETPARTRRHTREAH
FT                   HLGLNTKRLEQVIQRPFQFMVLTEEIHPGLANSSEVPGNVPHFLPAERVETRLGRMHCK
FT                   PHSLPMNKVI"
FT   gene            78314..78568
FT                   /locus_tag="Pden_0084"
FT   CDS_pept        78314..78568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0084"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc2496 hypothetical signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68201"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY57"
FT                   /protein_id="ABL68201.1"
FT                   /translation="MKAGANSFAPMEIDREERSFVNAVSGSGARYVSGELVWWTKGNNA
FT                   TLESALDGAARRNASRDLAIPTRGRAVRSGPGQPGAFPI"
FT   gene            79049..79255
FT                   /locus_tag="Pden_0085"
FT   CDS_pept        79049..79255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68202"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY58"
FT                   /protein_id="ABL68202.1"
FT                   /translation="MAFGIAARVFGYPLARAEAPITIEGVSLDLNGRWIATLVNHDWSF
FT                   ESGGATTEIIAEFGADDDDAAAS"
FT   gene            79239..79514
FT                   /locus_tag="Pden_0086"
FT   CDS_pept        79239..79514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68203"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY59"
FT                   /protein_id="ABL68203.1"
FT                   /translation="MQRHPEDQIGRKDFLPNLLSQDFKTDVPLQSASFPAAGGAASPSA
FT                   MMPCPIRFRLAQHRDGRRAAFRSGAAGISPPGRTVAPLLGRSPAHR"
FT   gene            79557..80267
FT                   /locus_tag="Pden_0087"
FT   CDS_pept        79557..80267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0087"
FT                   /product="acylneuraminate cytidylyltransferase"
FT                   /note="PFAM: acylneuraminate cytidylyltransferase; KEGG:
FT                   aeh:Mlg_2324 acylneuraminate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68204"
FT                   /db_xref="GOA:A1AY60"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR020039"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY60"
FT                   /protein_id="ABL68204.1"
FT                   /translation="MKIAIIPARGGSKRIPRKNIRPFGGRPMIAWPIAAARDSGLFDHV
FT                   IVSTDDAEIAETALAHGAEVPFPRPVELADDFTPTRAVINHAIRAMEEAQGREVTLACC
FT                   IYATSGFLDASDLVGAHGLLAAEPAAGFVFAALHFPHPPQRALCRGPEGGVAMLHPEHA
FT                   GTRSQDLCETFHDAAQFYWGRRDAFLSGAPMFSTLARPWILPRDRALDIDTPEDWDWAE
FT                   RLLALRQAAGEIPA"
FT   gene            80264..81310
FT                   /locus_tag="Pden_0088"
FT   CDS_pept        80264..81310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0088"
FT                   /product="flagellin modification protein FlmD"
FT                   /note="KEGG: ccr:CC2854 flagellin modification protein
FT                   FlmD"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68205"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY61"
FT                   /protein_id="ABL68205.1"
FT                   /translation="MSLPPVVFRCTANARIGMGHLARCREMARELGARGQACHIAGLPD
FT                   SLRQPGDTMLFASWTPLPEDGPATEDAARVVALCRTEGTRYLVLDDYRGGDIAYQQVLA
FT                   DAGLRWLQQFDSSGEGDFLAPILVNASPYERPEQYRPRLRNPETRLLFGPRYAVLRPEF
FT                   ARIAVREDGRPVRRILAAFGGGDDRGALDLVLAALGDLPDVALRLVSGRGNPRNAELAA
FT                   RLAGVDPARIELLVDPPAMAERIAECDLGIIAGGTMSYELAHCGLPMLLVALAPNQRRS
FT                   CLGWQELTGTPFLGQIGDVMPDRLRAEVHRFVTGPELRRQVAARGRAEVDCKGAARLCD
FT                   ALMESDKA"
FT   gene            81485..82816
FT                   /locus_tag="Pden_0089"
FT   CDS_pept        81485..82816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvu:DVU1387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68206"
FT                   /db_xref="InterPro:IPR012353"
FT                   /db_xref="InterPro:IPR032589"
FT                   /db_xref="InterPro:IPR032610"
FT                   /db_xref="InterPro:IPR032622"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY62"
FT                   /protein_id="ABL68206.1"
FT                   /translation="MIDLSHVFDRLFPICRSITGPGLRESLEILGEYMPLKQHAVASGE
FT                   QVLDWTVPNEWSVEGAQLIGPNGEMICDFAINNLHLVNYSIPMQASLSLEELQPYLHSL
FT                   PHLPDAIPYVTSYYNPRWGFCLPHRQRTALPDGTYRVDIRTTHAPGAVNFATTRLEGDS
FT                   DETVLISSYLCHPSMANNELSGPLGLLRLYEHIKAMPHRNYTYEFLLCPETIGSIAYLS
FT                   QFGAEIGPRLAGGMVLTCLGGHRPTLNFKLSRRDWLGRPGTMDRLARHFAVTYPDQFEL
FT                   RPFTPVSGSDERQFCSPGYDFPVIQAARTVYGQFVEYHTSMDDKRFMRIEQVERAADRL
FT                   AEFIEVFDTEGAPLKNTQPYGEPQLGRRGLYPTINSPMNRGNSTDNATDQRQTLNRLLM
FT                   ILSLSDGSRGLLETAERIGCGPDQLLPIIRELRRQDILVAERRV"
FT   gene            82819..83619
FT                   /locus_tag="Pden_0090"
FT   CDS_pept        82819..83619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA3144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68207"
FT                   /db_xref="GOA:A1AY63"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY63"
FT                   /protein_id="ABL68207.1"
FT                   /translation="MSITIITGDHPRHRYLADRLAEAGILTGWIIEQRKPFVPEVPAGL
FT                   PDDLGRLFALHFRRREEAEERFFGQPSLPDGLRMHYVTPDSLNEQASVDFLKTCAPRIV
FT                   LSYGCHKIADAVMAALPGTTFWNTHGGLSPQYRGVTTHFWPSYMLEPQMTGMTLHETTS
FT                   AIDGGAIIHQTVAPLDRNDGLHDIAGRTVKAYADELPPLLRTVLERDLPSGKVQKTSGK
FT                   IWTSADWRPDHLRLIYEVYNDRIAAAAVDGLIQGRTPICMSVLA"
FT   gene            complement(83710..84885)
FT                   /locus_tag="Pden_0091"
FT   CDS_pept        complement(83710..84885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68208"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY64"
FT                   /protein_id="ABL68208.1"
FT                   /translation="MQNSLLQLLTWTEATGRVLQHAHQVGRKHKLRAGFVSLFGYRLPD
FT                   CLPRFYCDKFGDPERFFAVQAANGYQNYFTNFSTNISERFVLRNMTRHPEARSASFPLP
FT                   QNFERYFKAHRAQAAEILAQQEAVTKVRRSTGDQKARAPEAEEAMARIAAWRARGGKVA
FT                   CAFGKVVCDSGVPFDGGPTHASMKDWINHCIRTVRGSDTLLLIKPHPHELNNQIATFPT
FT                   EFFSDLIEEEIGENVIFLGHRWFDMHDMAGLMDLGVIYNGTTSVELGIMGIPCILAGHF
FT                   APIDYPIGHIAPQTRAEFETYLRFEKPAIVAPDIRERAALWLHYMRSPDFTLPYRFHAR
FT                   PVTNKKIYPPYWFGEDLKALQTGENATPSRLARRVLGQEAEPGGQRMPSST"
FT   gene            complement(85055..86716)
FT                   /locus_tag="Pden_0092"
FT   CDS_pept        complement(85055..86716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68209"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY65"
FT                   /protein_id="ABL68209.1"
FT                   /translation="MSTMTASLGRSWTERKWARRLFRGTPFRLARFFMAWGMPAAAIPV
FT                   LRVPMALYPPAPDLLLMRAQAARRAGRIKQAKALCEALRPTLEMAVLQQNLRQVLAIYV
FT                   EFEANMVRTSLAAGRYLSGLLCAENRRKLLLEACADLPEQPFIIQIRALCQALDGEYKE
FT                   AAGRITDLMRERGEHGRKSASKAELALLRETWTVVDRIAFANVDWAGDDVQTESSVLFE
FT                   RAQASETADALVAGKLLHEQLLQSREQEKFLALCQEDFDKAVALNVRLNAIRHMLRVGL
FT                   RRLPDYTPAHEQARQCLDAITPEIARQMQQVPRQKQLKSAYVNQMVTVLTLARTLRRAD
FT                   LAQRIVQHFVDLSEDPAANPVLWFAAANIANEVADQEQSRIIMDNTGHLPPQTQVHVRD
FT                   YFRWANLVGAYDEARKFSSTMPANLKRSFGMIQFVDTLPVRQRLRARRQDPRGISYPPL
FT                   AGAPPAKPSPHDADRRAGIPATHGAGAGQGAPATGSQGRHLHPGAQYQPVAQLSANGVA
FT                   GLQAAGLGRGAVGRRALAAREDRDRGDRYPERGDLP"
FT   gene            complement(86854..87855)
FT                   /locus_tag="Pden_0093"
FT   CDS_pept        complement(86854..87855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0093"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility C-terminal domain; KEGG:
FT                   son:SO3271 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68210"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR020025"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY66"
FT                   /protein_id="ABL68210.1"
FT                   /translation="MFDNKSILITGGTGSFGKKYVQTLLSRFKPRKIIVFSRDELKQFE
FT                   MQQKFNDPCIRYFIGDVRDRERVLQATRGVDYIIHAAALKQVPAAEYNPVECIKTNIDG
FT                   AQNVIHGAITNNVEKVIALSTDKAANPINLYGATKLASDKLFVAANNMVGERRTRFAVV
FT                   RYGNVVGSRGSVVPFFQGLIDQGAKSLPITDTDMTRFWISLQQGVDFVLKNFTRMHGGE
FT                   IFVPKIPSVRIVDLARAMAPGLEQHVIGIRPGEKLHEIMCPADDSHLAVEYDDHFVLSP
FT                   SIRFYDHDVDYFSNGIGESGKAVGRGFEYNSGTNTHFLSVDEIVEFNAKAMA"
FT   gene            complement(88201..88311)
FT                   /locus_tag="Pden_0094"
FT   CDS_pept        complement(88201..88311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0094"
FT                   /product="transposase IS116/IS110/IS902"
FT                   /note="KEGG: nha:Nham_3939 transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68211"
FT                   /db_xref="GOA:A1AY67"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY67"
FT                   /protein_id="ABL68211.1"
FT                   /translation="MAQFRRERDFAAWLELVPRQHSSGGRDRLGRVSKAG"
FT   gene            complement(88450..89019)
FT                   /locus_tag="Pden_0095"
FT   CDS_pept        complement(88450..89019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0095"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain; Resolvase
FT                   helix-turn-helix domain protein; KEGG: bpm:BURPS1710b_2170
FT                   DNA invertase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68212"
FT                   /db_xref="GOA:A1AY68"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY68"
FT                   /protein_id="ABL68212.1"
FT                   /translation="MKVGYARVSTEDQKLDLQIAALRRAGCQKIFKDRGISGSSMERPG
FT                   MKSMLRSLRPGQTLVVWRLDRLGRSLSGLVLLIEELGERGVEFQSLCESLDTASSGGRL
FT                   VFHIMAALAEFERSLISERTKAGMQEARDRGLRLGRPPSMTRDQVAEAMRESGKLPIKE
FT                   VAVRYNVSPRTLRRHLRQLRQCNELA"
FT   gene            89344..89625
FT                   /locus_tag="Pden_0096"
FT   CDS_pept        89344..89625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_1581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68213"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY69"
FT                   /protein_id="ABL68213.1"
FT                   /translation="MQIRYEEVSDKARYIACPKGECVELVVTEPEPGMRVAYYTAIPGG
FT                   REDRAIARALIQRLVEDARIRGQVVVPLCPFVRAEAQKNPDWSDVIRH"
FT   gene            complement(89793..90434)
FT                   /locus_tag="Pden_0097"
FT   CDS_pept        complement(89793..90434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68214"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY70"
FT                   /protein_id="ABL68214.1"
FT                   /translation="MSIGTELSVRLRQRGRLRQAFLAKRPNPPKRGLNIPGSHPSPDRG
FT                   LAAGVPGVHASVRAQRGGCQHDAGSMQFRPAHLTCVLARSGGNSQTHGIAGTTFPWDSG
FT                   GPRPGGWRAEWLAGQIIVGAESGWKAVPSRHMRCRTTAIRRPGATIARLLPRRLATRAD
FT                   DVLSHDARPRCSRTVRRHSVVVRTVRTSWPPTAAPCHPGQTSRRQRGHSC"
FT   gene            complement(90443..90688)
FT                   /locus_tag="Pden_0098"
FT   CDS_pept        complement(90443..90688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0098"
FT                   /product="Conjugal transfer TraD family protein"
FT                   /note="PFAM: Conjugal transfer TraD family protein; KEGG:
FT                   rpc:RPC_4518 conjugal transfer TraD"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68215"
FT                   /db_xref="GOA:A1AY71"
FT                   /db_xref="InterPro:IPR009444"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY71"
FT                   /protein_id="ABL68215.1"
FT                   /translation="MRSWQVERRKRTRHLIELGGLVIKAGIVDLTGDDRAMIYGALLWI
FT                   ADRLQSDAGEYARELWTGKGKNVFEAERAKGAHDAI"
FT   gene            complement(90690..91028)
FT                   /locus_tag="Pden_0099"
FT   CDS_pept        complement(90690..91028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpe:RPE_3258 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68216"
FT                   /db_xref="GOA:A1AY72"
FT                   /db_xref="InterPro:IPR009444"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY72"
FT                   /protein_id="ABL68216.1"
FT                   /translation="MEDAMRKPRDYDAELKALEDKARELKTRKVQQLGELVIATGADAL
FT                   TADELAGALVVLAETTDAGKRDAWAKRGVAFFRGKSRRSAPTPDRNAGSAQTQPGGAQS
FT                   AASGAGAA"
FT   gene            91189..94185
FT                   /locus_tag="Pden_0100"
FT   CDS_pept        91189..94185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0100"
FT                   /product="plasmid mobilization system relaxase"
FT                   /note="PFAM: MobA/MobL protein; KEGG: rpc:RPC_0149
FT                   MobA/MobL protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68217"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="InterPro:IPR014136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY73"
FT                   /protein_id="ABL68217.1"
FT                   /translation="MAIYHLHVKVIGRKAGSSAVASAAYRSASRMRDERIDRVQDFSAK
FT                   RGVVHSEVMLPDNAPEHLGDRERLWNDVEAFEVRKDAQLAREVEFAIPREMTQAQGIEL
FT                   ARDFAQAEFVDQGMIADLNVHWDIGEDGMPKPHAHVMLTMRSVDENGFGQKVRDWNRTE
FT                   MVERWRERWAEHVNERLAELDIDARIDHRSLEAQGIGLEPQSQIGAPAQRIEGEGIEAA
FT                   DRADMHREIARNNGARIIADPSVALDAITHQQSTFTRRDMAKFAHRHSDGIDQFNEVMG
FT                   AMRNAPDLVELGKDGRGEDRFTTRDMIEAEQRLHRAAEMMAGKGRHEVSDWNREAALAR
FT                   AEQRGLVLSGEQADALAHVTDGRDLGIVVGYAGTGKSAMLGVAREAWEAAGYEVRGVAL
FT                   SGIAAENLEGGSGIASRTIASMEHGWKNGRDMLTSRDVLVIDEAGMVGTRQLERVLSHA
FT                   QEAGAKVVLVGDPQQLQSIEAGAAFRSIHERHGGAEIGEVRRQREDWQRDATRDLATGR
FT                   TGDAISAYDRNGMVHSADTREQARGDLIDRWDGQRQHNPDSSRIILTHTNAEVRELNEA
FT                   ARDRMRAAGDLGEDVRLTVERGERSFAAGDRVMFLQNERGLGVKNGTLGTIEDVSPQSM
FT                   SVRTDDGRSISFDLKDYDRIDHGYAATIHKAQGMTVDRTHVLATPGMDAHGSYVALSRH
FT                   RDGMDLHYGRDDFASQDRLINTLSRDRAKDMATDYEQQIDPAQDYAERRGITFRARVAQ
FT                   IMRRLMPERVRDAIDDYIDSLRAPGEHVPAGPDREAARREVQRDLEVTSRKTGIEPEEL
FT                   LRRASSGQAFVRHARAVDAIFAAQDLGVAATPGQVQELHEARAGFDQHYPHGSRDAEAV
FT                   YKRNPGFAADVASGDPDRAAPARRALQLETGMRRNPGLRADRFVERFREVRQASESRYA
FT                   AGDYSGYHAARAEMGNMAMSLERDPQMESLLETRKKQLGIGMDFDSGMRLGRQLALSHG
FT                   LGRGRSIGL"
FT   gene            complement(94406..94681)
FT                   /locus_tag="Pden_0101"
FT   CDS_pept        complement(94406..94681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68218"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY74"
FT                   /protein_id="ABL68218.1"
FT                   /translation="MRSDSYGMLKASSVRTVTDPLRGTMQSLAVPPDLSEDLCLLTLSR
FT                   ELDALTYRRRDVYPRRRFDPTRPPYLARQLPYADHKKTRFRSRVSR"
FT   gene            94879..95094
FT                   /locus_tag="Pden_0102"
FT   CDS_pept        94879..95094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0102"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /note="PFAM: Prophage CP4-57 regulatory; KEGG: rpe:RPE_3260
FT                   phage transcriptional regulator, AlpA"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68219"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY75"
FT                   /protein_id="ABL68219.1"
FT                   /translation="MPAPDRIIRMKTVLARTGLSKSTLYRKMAEGTFPPRLKISVNGAG
FT                   WHESDIDRWIADPVRWRPKVEAGHGR"
FT   gene            95326..95817
FT                   /locus_tag="Pden_0103"
FT   CDS_pept        95326..95817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0103"
FT                   /product="protein of unknown function DUF132"
FT                   /note="KEGG: rru:Rru_A1415 protein of unknown function
FT                   DUF132"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68220"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY76"
FT                   /protein_id="ABL68220.1"
FT                   /translation="MSLSRERSQTGILTSYEMSVYGLSMRLVLDTNVIVAAFRSRNGAS
FT                   NLLLRAVDRGVLTPLCSTALFLEYEAVLSREETRKATGHSLEDVTGVMSALAAVSEGVD
FT                   ISFRTRPMLSDVADEMVLEAALNGQAEAIVTHNVKDFRPALTLGVTIATPGEIVRRLNT
FT                   "
FT   gene            95814..96074
FT                   /locus_tag="Pden_0104"
FT   CDS_pept        95814..96074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0104"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_1920 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68221"
FT                   /db_xref="GOA:A1AY77"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY77"
FT                   /protein_id="ABL68221.1"
FT                   /translation="MTQAQRYKYPLQLPQSLKETAARLAQEDGVSLNQWIVSAVAQKIG
FT                   AVETAADFLKARAGTAKRGDLTAFLDRAPDVPPMPKDAIKD"
FT   gene            96094..97743
FT                   /locus_tag="Pden_0105"
FT   CDS_pept        96094..97743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0105"
FT                   /product="Recombinase"
FT                   /note="PFAM: Resolvase, N-terminal domain; Recombinase;
FT                   KEGG: nwi:Nwi_2841 resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68222"
FT                   /db_xref="GOA:A1AY78"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY78"
FT                   /protein_id="ABL68222.1"
FT                   /translation="MTRAALYARYSDDKQNEASIEDQFRLCREHAGRERWQIVGSYEDA
FT                   AISGASTILRPGIQRLMRDAQHGEFSILLAEALDRISRDQADVATLFKQLKFAGVTIVT
FT                   LAEGEITELHVGLKGTMNALFLKDLAMKTHRGLRGRVEKGKSGGGLCYGYKVVKKLDGN
FT                   GEPIRGDREIIPEEADTVRRIFREFASGKSPKAIAVDLNRDGVPGPLGRAWGDTSIRGH
FT                   RNRGTGIVNNELYAGVLVWNRLRFVKDPSTGKRVSRPNPESAWIRTEVPHLRIVDDALW
FT                   NAVRERQKQIAEIFGPNLANTREDRMKRLHLANRPVSLLSGLMTCGCCGGKIGIILSDR
FT                   LGCLNHHRRGTCTNNRTILRDKLEARVLTGLQERLVSAEAVKEAVRAYVEETNRLNQQR
FT                   RTQQETDRRALAKIERAIAGIIAAIEDGMYQPSMKARMDELERQKAEIVARMAEAPADM
FT                   PDVHPNVAANYSRNVARFAEALRDPDGGREAAEALRSLIGGIIVTPGEKRGEVHAELRG
FT                   ELMGILGIAAVQPEQGRTSVMSPVAAGPRNQR"
FT   gene            complement(97636..99429)
FT                   /locus_tag="Pden_0106"
FT   CDS_pept        complement(97636..99429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0106"
FT                   /product="Recombinase"
FT                   /note="PFAM: Resolvase, N-terminal domain; Recombinase;
FT                   KEGG: nha:Nham_3864 recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68223"
FT                   /db_xref="GOA:A1AY79"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY79"
FT                   /protein_id="ABL68223.1"
FT                   /translation="MRVAIYARYSSDQQREASIADQFRMCRLRAEKEGWTVVEEYSDHA
FT                   ISGSSMIQRPGIQALILDSSRGRFDMVLAEALDRISRDQEDIAGIYKRMCYADIKMFTL
FT                   SEGEITQLHVGLKGTMNALFLKDLADKTRRGLRGRVEDGKSGGGNSYGYDVVKRFDGNG
FT                   EPIRGDRTINEAQAAVIRRIFADYDSGLSSRTIAMTLNREGVPGPMGREWGPSTIHGNR
FT                   ERGTGILNNELYVGRLVWNRLRYVKDPDTGRRVSRLNPESEWVTQDVPDLRIVDQALWD
FT                   AVKARQGELAFSTRSRPEGNPLNDRRRPKHLFAGLVKCGCCGGGYSMISKDLLGCSTAR
FT                   NKGTCDNRVNIRRDALEASVLNGLKKHLMEPELFREFCTEFTREVNRLRMERGADLEVA
FT                   RRDLDRTTRELDKAIDAILQGVPPLTLKDKITQLEARKAELTEKLANADEPPPLLHPNM
FT                   AALYAQRIAKLSENLQQEDSRAQAAEILRSLVEQVTLVPEDGELAIVLRGDLGAILRFA
FT                   AGRKNPDFLSEAEALDNLLAQSGGSRKPWRGQQKTSSAVALEVSQLSLVAGACGHWRHN
FT                   RCSPLFRLDGGDTENAHQLAA"
FT   gene            99430..99915
FT                   /locus_tag="Pden_0107"
FT   CDS_pept        99430..99915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68224"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY80"
FT                   /protein_id="ABL68224.1"
FT                   /translation="MRVSASVGMLVMPLALFGLDEIPCRPSGEHADQFGKAWVGGGQGR
FT                   SGLSGWFQDHPEPFRIRVPLPCHRPVPLPARQDPRQKNRGVGPGGITGRFGRIASDLGA
FT                   AQRKPALPRLLQGVLRGCILVGWRKNTGKSRDISSQVTPSAGFRSSRTEPCGRVESS"
FT   gene            complement(100054..101091)
FT                   /locus_tag="Pden_0108"
FT   CDS_pept        complement(100054..101091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0108"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: rsp:RSP_3201
FT                   putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68225"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY81"
FT                   /protein_id="ABL68225.1"
FT                   /translation="MRYRTLGPSGLLVSELCLGTMTFGGSEGMWGQIGKLRQDEADSLV
FT                   RAAFDAGINFIDTANVYAGGESERILGQTIRNLGIPRDEVVIATKVLGVMGEGPNARGA
FT                   SRGHIMAQAKASLQRLQMDHIDLYQIHGFDPLTPITETLEALDTLVRQGHLRYVGLSNW
FT                   AAWQIVKAVGIAEASKLAPILSLQAYYTLVGRDLEREIVPMLQAEGLGLMVWSPLAGGF
FT                   LSGKYSDGNTANDGRRASFDFPPVDLERGDAAIAVMREIASARGCTVAQVALAWLLHQP
FT                   VVTSVIVGAKRIEQLQDNIRSTEVALTAEDLAALDTVTRLPAEYPGWMLERQSQYRATF
FT                   ASQKG"
FT   gene            101268..102167
FT                   /locus_tag="Pden_0109"
FT   CDS_pept        101268..102167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0109"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC-type transcriptional regulator domain
FT                   protein; KEGG: rsp:RSP_3202 transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68226"
FT                   /db_xref="GOA:A1AY82"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY82"
FT                   /protein_id="ABL68226.1"
FT                   /translation="MENDHLAPLKHLIARQWQAHGRETPIEGLLLTSVTAPTGPIHAVY
FT                   RPSLCVVVQGVKTSMLGDRAYRYDAGKCLIASMEVPIRAEISHATPDRPYLAFSLALDP
FT                   GTISDLLLALDGTDDAPAGAALAVHAFGPELADPLCRLLALCDRPRDIAILAPLARREI
FT                   TWLLLNGPMGPALRQIGLAGSRMARIGRAIACIREGFADQLNVRRLADVAGMSPATFHR
FT                   HFKAVTAMTPVQYQKQLRLQEARRLLLSEHADVARIGYAIGYESPSQFNREYRRLFGSP
FT                   PGRDGQEIRRSLTPQVGG"
FT   gene            complement(102305..102685)
FT                   /locus_tag="Pden_0110"
FT   CDS_pept        complement(102305..102685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68227"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY83"
FT                   /protein_id="ABL68227.1"
FT                   /translation="MGTLVRRVLVRFWMGWAQPRALRWMFNVATSTPPQPMFSVFARLA
FT                   PCKSVDFRLSPPINGQQVSPFQRLALYVVELMGISSLARRAAHNLKSAGPNLTEQLITA
FT                   THFRRVTKPRLNQFGAATTPHC"
FT   gene            complement(102697..103602)
FT                   /locus_tag="Pden_0111"
FT   CDS_pept        complement(102697..103602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68228"
FT                   /db_xref="GOA:A1AY84"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY84"
FT                   /protein_id="ABL68228.1"
FT                   /translation="MTKNNIAREQNSEPVLRFLKARTIVYRKANLLVGLQILLTAVVPA
FT                   LMAVAGIWLLDWKSLFALAGLSIALVDMLIIDRRLGKLSVDAAKLAEEFDCRLFSLPWS
FT                   EILVGQRLSPETVQGYVVKFRQKKEPAILNWYPEAVSTIPRYLGVLLCQRTNLWYDSEL
FT                   RSHYAALIKWAGVVGFILCFVLAWRLNYTLQTTVLSIFSPMFPFFAWSIRTYWRQTDVS
FT                   AAQARNLSSAETLWKQAVRGTLSETKLWPEIRDLQNAIYARRSASPLILPFLYSVLRPG
FT                   MENRMSVAAEKFIEDSGLNS"
FT   gene            complement(103599..105035)
FT                   /locus_tag="Pden_0112"
FT   CDS_pept        complement(103599..105035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0112"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_3174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68229"
FT                   /db_xref="InterPro:IPR040511"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY85"
FT                   /protein_id="ABL68229.1"
FT                   /translation="MKLTATFKSFLQDTVNLNDSRIASLESSVDAIKKFIRQSEYKPKF
FT                   IAFHEQGSWAHETIIKPLNGDEFDADLLLAVEPVDGWSASDYVAKLGKIFSESATYKDK
FT                   TKVYDFCVTIVYANDKRIDISPLVKDRGGIRRYEVCDRGNDAFVQSEPMEYTAWIKQRN
FT                   GYSGSNSFRKVTRLIKYIRDIKGTFTCPSVLLTTLIGNQIDWYDHGSAAFSDTPTTLKT
FT                   VLGRLDDWLQARPKKPRVQNPKLATEDFASQLTDDQYENLRKVMKRYRTWVDDAYDEKD
FT                   RDESIKKWQRVFGSDFAKGEVLTKAAAQIVSPYRALLDTTARHSSDLVEAFYRFGAKLL
FT                   PAGFYTPPYLRQPTWRTNGHVSENVYVIASWHRHKNSGGRRIEDGEILPSNGGVWLAPR
FT                   VGFDQDVPDNCRVEWRVTNTGVVALTAQAGRGDFYPASTGTRRWEELRYRGVHFVEAFI
FT                   VLRSGDILVGKSKPFHVVIE"
FT   gene            complement(105698..106597)
FT                   /locus_tag="Pden_0113"
FT   CDS_pept        complement(105698..106597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0113"
FT                   /product="TIR protein"
FT                   /note="SMART: TIR protein; KEGG: bmb:BruAb1_0274
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68230"
FT                   /db_xref="GOA:A1AY86"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="PDB:3H16"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY86"
FT                   /protein_id="ABL68230.1"
FT                   /translation="MSANDRAIETLRREIAKLQTDGAAIARKDAGIRAKLASAMAAQAK
FT                   AKTAPALRLKQAEASRLEKELMATSKSQADIATKIAKKQSSLSAKLVVQANEAKKADAK
FT                   AKKNQERVSKTQEEATRKLEAGYRKLTLENQSLEQRLQRELSAMKPTAGPTTNADLTSA
FT                   PPHDIFISHAWEDKADFVEALAHTLRAAGAEVWYDDFSLRPGDSLRRSIDKGLGSSRFG
FT                   IVVLSTHFFKKEWPQKELDGLFQLESSGRSRILPIWHKVSKDEVASFSPTMADKLAFNT
FT                   STKSVDEIVADLMAIIRD"
FT   gene            complement(106933..107211)
FT                   /locus_tag="Pden_0114"
FT   CDS_pept        complement(106933..107211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0114"
FT                   /product="SH3, type 3 domain protein"
FT                   /note="PFAM: SH3, type 3 domain protein; KEGG: rsp:RSP_6161
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68231"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY87"
FT                   /protein_id="ABL68231.1"
FT                   /translation="MRTHLAALLALMVAAGCAVGSGAVVKGVGPGDLLKLREGPGLEHN
FT                   IIIGLPDGTRLTRQNCVTNNGKVWCRVFLTDRPAISGYVSADYLAHR"
FT   sig_peptide     complement(107149..107211)
FT                   /locus_tag="Pden_0114"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.402 at
FT                   residue 21"
FT   gene            complement(107337..108014)
FT                   /locus_tag="Pden_0115"
FT   CDS_pept        complement(107337..108014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0115"
FT                   /product="yecA family protein"
FT                   /note="TIGRFAM: yecA family protein; PFAM: SEC-C motif
FT                   domain protein; KEGG: rpe:RPE_2282 YecA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68232"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY88"
FT                   /protein_id="ABL68232.1"
FT                   /translation="MGRSDRDLDHLHELLWALPQENHPMSLSELDGYVTGILSCPDLIP
FT                   PSEWLLHVWGETGDARFPDLATAEATISAVMAHYNAIASEIARSPWLEPIYEVDPNSDE
FT                   TLWEPWVDGFTRALRLRPEAWQAVLEQADEETRSALIFLMALQDINEGTSTFTDEEIDE
FT                   IDLDAPDLIPNCVAAILLVSRPGGVLEAGNLPHAPTRIKRPGRNDPCPCGSGRKYKQCC
FT                   GKS"
FT   gene            complement(108141..108776)
FT                   /locus_tag="Pden_0116"
FT   CDS_pept        complement(108141..108776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0116"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: atc:AGR_L_286 chloramphenicol
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68233"
FT                   /db_xref="GOA:A1AY89"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY89"
FT                   /protein_id="ABL68233.1"
FT                   /translation="MDNYFESPFRGITLDQQVTNPNIVVGRYSYYSGYYHGHGFDDCAR
FT                   YLLPDEGADRLIIGSFCSIGSGAGFIMAGNQGHRNDWISSFPFYWMPEVPAFAGAANGY
FT                   QPVGDTVIGSDVWIGSEAVIMPGIRIGDGAVIGTRALVTRDVEPYAIVGGNPAKVIRKR
FT                   FDDRQIGLLLEMRWWDWSDEQLHAAIPLLTSGEVEGLHRYWLEKIRAA"
FT   gene            109037..109393
FT                   /locus_tag="Pden_0117"
FT   CDS_pept        109037..109393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68234"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY90"
FT                   /protein_id="ABL68234.1"
FT                   /translation="MTEIAPQPRIKLSKLRDIGWSLWDPIGLLDPESRAGRWDDEANLS
FT                   FADEYDGYLIAAASQLRRGTPRDEVVAFLVDIETRHMAMRDSPSVRLRAEAVVEAILAD
FT                   ETIWTWPDAQGRFG"
FT   gene            109402..109755
FT                   /locus_tag="Pden_0118"
FT   CDS_pept        109402..109755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcl:ABC1987 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68235"
FT                   /db_xref="InterPro:IPR014580"
FT                   /db_xref="InterPro:IPR023204"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY91"
FT                   /protein_id="ABL68235.1"
FT                   /translation="MTRHQIFTTSFASVYPHYVAKAEKKGRSRAEVDEIILWLTGYSPE
FT                   QLAARLQDRTDFETFFAQAPRMNPARSLIKGVVCGVQVEEVEDPLMREIRYLDKLIDEL
FT                   AKGKPTEKILRKG"
FT   gene            109994..110410
FT                   /locus_tag="Pden_0119"
FT   CDS_pept        109994..110410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_3831 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68236"
FT                   /db_xref="GOA:A1AY92"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY92"
FT                   /protein_id="ABL68236.1"
FT                   /translation="MILILLAVMLTALTCIVAWYLATWALPVMVAVETFRLAHATEAGF
FT                   LLSVLAAGTAALLSVGLVLLVLFKAKNPILCLLARAVFVIPAMIAGYAVVHGVTHDAID
FT                   SAIALKLLCGTAGLITGIAALINLNGFGELAPQA"
FT   sig_peptide     109994..110086
FT                   /locus_tag="Pden_0119"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.736 at
FT                   residue 31"
FT   gene            110943..111620
FT                   /locus_tag="Pden_0120"
FT   CDS_pept        110943..111620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0120"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   nha:Nham_0569 DNA methylase N-4/N-6"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68237"
FT                   /db_xref="GOA:A1AY93"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY93"
FT                   /protein_id="ABL68237.1"
FT                   /translation="MTAQENTPRNLVINADCVEAMQAFGTGSVDFILTDPPYVTRFRDR
FT                   QGRTVANDDNARWLRPAFAQMHRVLKDGGFCVSFYGWNKVDLFVEAWKAAGFRIVGHLV
FT                   FRKRYASSARFLRYEHEQAYLLAKGDPELPAQPVPDVLDFPYTGNRLHPTQKPVAALRR
FT                   LIGAFTQPGDLVLDPFSGSGSTLAAAHLLGRDWLGVELDVSHYQTIGRRMAALQERDRK
FT                   AAA"
FT   gene            111692..111982
FT                   /locus_tag="Pden_0121"
FT   CDS_pept        111692..111982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68238"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY94"
FT                   /protein_id="ABL68238.1"
FT                   /translation="MRWIVTKDHHGGCIGLGEDADGVPARGKPGDGDALPSEFRLYTAR
FT                   GRLLFEGRCGDIDADWWHGMEPLLYAWTTFRCRRLTWRPAGTDEPWRPLRP"
FT   gene            112280..112741
FT                   /locus_tag="Pden_0122"
FT   CDS_pept        112280..112741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0122"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   atc:AGR_L_1711 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68239"
FT                   /db_xref="GOA:A1AY95"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY95"
FT                   /protein_id="ABL68239.1"
FT                   /translation="MFEIRTSTGQDTARVMDIWRRAVDATHDFLAPHDRAAIEDELSIF
FT                   LPQVHLSLAVDHTDNPLGFMFLHEGHLEALFIDPDHHGRGMGTALIRAALADHPDLTTD
FT                   VNEQNPKALGFYERIGFERTGRSPCDGQGRPYPLIHLRYRPPAWRQIIP"
FT   gene            113488..113898
FT                   /locus_tag="Pden_0123"
FT   CDS_pept        113488..113898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0123"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: nha:Nham_4669 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68240"
FT                   /db_xref="GOA:A1AY96"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY96"
FT                   /protein_id="ABL68240.1"
FT                   /translation="MQNIVILAGTIRQAPETRTTRSGTDVTRFKLVTSRPLYSEGRVVR
FT                   DETGYRVEDAEWHRVVAFNGLGRTIQQYCESGTKVLVRGRIHYTKWQDAEGQDRYGCEI
FT                   VAETVDFLSRALQSEADDKDEGRFIDEDDIPS"
FT   gene            113876..114208
FT                   /locus_tag="Pden_0124"
FT   CDS_pept        113876..114208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68241"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY97"
FT                   /protein_id="ABL68241.1"
FT                   /translation="MKTTSPPEREAREPGGFSRRVFPCPHRIALRPRRPEKASRPDRPA
FT                   GKPPARACCLPPTPTQSFSREEETGAWERGWGARQRHRWALHGRQRVVANGELCFRAEG
FT                   EIGVRR"
FT   gene            114444..114647
FT                   /locus_tag="Pden_0125"
FT   CDS_pept        114444..114647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68242"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY98"
FT                   /protein_id="ABL68242.1"
FT                   /translation="MHTATFEINIPGNPLAGRINLEDIEMGMDADTGVKARASRDSMTL
FT                   TVRVAANDAADAANWLRKMGLI"
FT   gene            115048..115260
FT                   /locus_tag="Pden_0126"
FT   CDS_pept        115048..115260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68243"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY99"
FT                   /protein_id="ABL68243.1"
FT                   /translation="MNNPNTVTELIAEAANALIRRDPHRLEELERISRGWMQTHDEELA
FT                   QIILLQAMTEAADLLLDTPSEIESA"
FT   gene            complement(115281..115730)
FT                   /locus_tag="Pden_0127"
FT   CDS_pept        complement(115281..115730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_3838 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68244"
FT                   /db_xref="InterPro:IPR018754"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA0"
FT                   /protein_id="ABL68244.1"
FT                   /translation="MRTSEGLHGIVADAGGDHRLWFPHGMARIRLAIVVPLDEDLMVRL
FT                   NSIQRFHRLLTGRPVRPIPSLQALSASERHRATLMLRAWDGAESGASRRDIAGVLFRTD
FT                   FSGLSAAEWKSASERRQLARILAEARSMVGGEYLTLLRGGQHRRR"
FT   gene            complement(115825..116091)
FT                   /locus_tag="Pden_0128"
FT   CDS_pept        complement(115825..116091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68245"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA1"
FT                   /protein_id="ABL68245.1"
FT                   /translation="MPSSTDWRSPGYDNRFRTLDRARMTFQFLRRNRRYRAEYSRIRQH
FT                   IGREAPVADATREEIARMARRWGLMFPGRSRTSGIGSPAALAS"
FT   gene            complement(116238..116501)
FT                   /locus_tag="Pden_0129"
FT   CDS_pept        complement(116238..116501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68246"
FT                   /db_xref="InterPro:IPR018754"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA2"
FT                   /protein_id="ABL68246.1"
FT                   /translation="MAADAFEDTPPQSERLTGYDEAHLTTYLRLLDAEEEGADWREVAR
FT                   IVFGLDVAADPDRAKRVHDSHLARARWMTEAGYRQILKPRMR"
FT   gene            complement(116687..116923)
FT                   /locus_tag="Pden_0130"
FT   CDS_pept        complement(116687..116923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0130"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   mlo:msr6108 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68247"
FT                   /db_xref="GOA:A1AYA3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA3"
FT                   /protein_id="ABL68247.1"
FT                   /translation="MPGDSSGMRLRERVARNLRRLRQEKSLSQEELADRADINRNYVGM
FT                   LEREENAATVDMLEKLAAVLEVDPVELLRRDKD"
FT   gene            117115..117384
FT                   /locus_tag="Pden_0131"
FT   CDS_pept        117115..117384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0845 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68248"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA4"
FT                   /protein_id="ABL68248.1"
FT                   /translation="MQNEPDPDWPRFVRTEEAARLLDLSPRTLEKHRCGGTGPVYRKLG
FT                   GRVVYTIADLRAWIEGSARQSTSEMAKIARKPDRTLAEARRAGR"
FT   gene            117381..118250
FT                   /locus_tag="Pden_0132"
FT   CDS_pept        117381..118250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0132"
FT                   /product="putative replication protein A"
FT                   /note="KEGG: nwi:Nwi_0846 possible replication protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68249"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA5"
FT                   /protein_id="ABL68249.1"
FT                   /translation="MSSPISARRICGGRQMELFRPVASDIAARDSRDLMSWPFFSLAKS
FT                   RRVVPIDFHMGPVSIRVEATPEHGMATIWDADILIWAASQIVEARNQGLRTSRLMAATP
FT                   YEILTFIRRGDSARSYLRLKAALDRLQSTTVATSIRQPAERRRHRFSWINEWKELLDDQ
FT                   RRPLGIELILPDWFYAGVMDDALVLTIDRAYFDLKGGLERWLYRLVRRHGGRQPGGWSF
FT                   DLRHLHLKSGSLSPFKRFAFEVRAIVQRQPLPGYRLSLAVGSDGLPRLCFQPAPANPFA
FT                   AAPRAARR"
FT   gene            118506..119006
FT                   /locus_tag="Pden_0133"
FT   CDS_pept        118506..119006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_2334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68250"
FT                   /db_xref="InterPro:IPR021263"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA6"
FT                   /protein_id="ABL68250.1"
FT                   /translation="MSARHPEQPRPDPGSTTFVDLIWQEKRVEHWLRFGRFCHEHRIDR
FT                   QRRTVGFASDSTFAVVRWAGNDYGTVVSRLDILRAVAPGEPFQTLPFIRPGAEILLRVS
FT                   GWPKVERVLQAVDAVEALGIDPCLVSLEHWRHVHNRIAAGEPFRTYAKAQHAAWLKRRR
FT                   VGA"
FT   gene            119003..120622
FT                   /locus_tag="Pden_0134"
FT   CDS_pept        119003..120622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0134"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: C-5 cytosine-specific DNA methylase;
FT                   transposase IS116/IS110/IS902 family protein; KEGG:
FT                   mlo:mll5964 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68251"
FT                   /db_xref="GOA:A1AYA7"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA7"
FT                   /protein_id="ABL68251.1"
FT                   /translation="MTMPRASLSLPLHVLDLFSGAAGGWSLGLHRAGFMTIAACEIVEW
FT                   RRILYSENFPHVRLYADIRDLTATRLVSDLGCLPDIVVGSPPCQDISSANTKGKGIEGE
FT                   RSGLYLEAVRLVGECRPRWFAFENRSYGCLPEAAVVRLWARQMVKEAAMNTQVHQHKSH
FT                   VIAHDEVSAIFISLELSKSTWLVTSISPGAGEKMSRHTVKGGDVAALMDRFDALRHKAL
FT                   QRTGRDFPIVTIHEAGLDGFWIHRILEREGVESHIVDAASIAVPRRHRRVKTDKVDGET
FT                   LVRTLLAWKRGEPRVCSMVRVPSPEDEDRRRPSRERKVLIAERVSHVNRIKGLLYSQGV
FT                   AYEPLHRNRRQNLEELRTGDGRPLSPCLKRQILRELDRLELLLEQIRNVEAERDADLKE
FT                   ERKTDTPPVGVLAALKGIGPEFAAVIWAEGLSRPFENRRQVAAYAGLAPTPWQSGSVNR
FT                   EQGVSKSGNPRLRTTMIQLAWLWLRHQPRSELSCWFQQRVAGHGGRVRKTMIAAMARKL
FT                   LVALWKYLTAGVVIEGAAMKTV"
FT   gene            121111..121665
FT                   /locus_tag="Pden_0135"
FT   CDS_pept        121111..121665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68252"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA8"
FT                   /protein_id="ABL68252.1"
FT                   /translation="MRLEGESGARKAMKDSGLSDLFRNRPLPTPMASDGMKDGAGGGAG
FT                   STYPLRMNLATPRKTDADRGGRGDLLSQLRGHNSRHAGMSRAPETLPTPTKRDSRMDGW
FT                   SPAYDRRKSPTMDAVMDGAMTNRAPDKWAGARALAAILRNHGLTGTAALPITYGWMMGF
FT                   PPGWLARALRSAVARGRLRRA"
FT   gene            121919..122851
FT                   /locus_tag="Pden_0136"
FT   CDS_pept        121919..122851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0136"
FT                   /product="protein of unknown function DUF736"
FT                   /note="PFAM: protein of unknown function DUF736; KEGG:
FT                   mes:Meso_3845 conjugal transfer protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68253"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA9"
FT                   /protein_id="ABL68253.1"
FT                   /translation="MTRRTRTAYLAATGLAVLVIGAVSVTEIAPRLIWNASASVPLGLY
FT                   AVQPVGNLTLGDLVAVTLPEPLAQFIVARGYVGPGVPLLKRVAALPGTRVCRRGSTITG
FT                   DGQVLGEARERDRFGRPLPTWQGCRLIAEGEVFLMNQDAEDSLDGRYFGPLPLGSVTAR
FT                   IVPLWTDAEDHGRFRRPAAGAETVPDPTTNHQPTESNMPQIGEFTRTQSGYEGRIRTVT
FT                   LDLQLVFVPTHADVENAPDYRLHLDGEDGPEIGAGWTHSGERAGTYISVALDDPVLAQP
FT                   IRARLFQSDEQGRNWGLHWSRPRKRDERD"
FT   sig_peptide     121919..121996
FT                   /locus_tag="Pden_0136"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.354 at
FT                   residue 26"
FT   gene            122855..123550
FT                   /locus_tag="Pden_0137"
FT   CDS_pept        122855..123550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0137"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   mes:Meso_0517 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68254"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYB0"
FT                   /protein_id="ABL68254.1"
FT                   /translation="MPVSVLRHTDGRAYAARGIAILLLSGLTIATLPAAGLLAQTVQPV
FT                   VRESRDPFASHVAEASLRFGIPAHWIRAVRHVESAGNPQAVSPKGAMGLMQIMPKTWAA
FT                   LRARHALGDDPFDPRDNIFAGAAYLREMHDRYGTIAGMLAAYNAGPGRYDEHLISGRLL
FT                   PAETRAYVAALAPLMGGVTLPGSPPAVAPPRDWREAPLFTGSMTGSPDAERVQPGGLFL
FT                   RRSDAGAVQ"
FT   sig_peptide     122855..122974
FT                   /locus_tag="Pden_0137"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.724) with cleavage site probability 0.702 at
FT                   residue 40"
FT   gene            123600..124181
FT                   /locus_tag="Pden_0138"
FT   CDS_pept        123600..124181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68255"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYB1"
FT                   /protein_id="ABL68255.1"
FT                   /translation="MKIAYADPPYIGCAHLYCDRPDYAGEVDHAALIDRLERDYDGWIL
FT                   HAAATPHSFAVLAPLVEPTGARWMAWVKGFAAFKRNVPVAWAWEPVIVKAARKPVVSKR
FT                   LVLRDWVQESITLRRGLTGAKPEAVCLWAFEMVAARPEDTLDDLFPGTGAVTAAWHSWQ
FT                   RKFTLPGDPVPALPPSDSARRGRSRTGGAS"
FT   gene            124423..126159
FT                   /locus_tag="Pden_0139"
FT   CDS_pept        124423..126159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll0044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68256"
FT                   /db_xref="InterPro:IPR021795"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYB2"
FT                   /protein_id="ABL68256.1"
FT                   /translation="MSNEDDFRIRPGGIRSSRSQRARPFVVQALAAAQKAGGRVSRSGR
FT                   IVSPGTSRFGRGRTAAVRANRLITRRTRLCTVKVRVVRRTGQAAALPRHLGYLGRDGVT
FT                   RGGEKARMFDPHSDDADIKDFAERSEDDRHHFRFIVSPEDAADMADLKRFTRELMAQAE
FT                   KDLGTELDWIAVDHWNTDNPHVHVILRGRADDGKDLVISRDYIREGLRDRAQDLITREL
FT                   GPRHDHEIHRSLMRQVEAERWTALDRQLLRDAGKPGVIDMAPHVDGPRDDYLPQKVGRL
FT                   RHLERLGLADQVGQAQWVIRPEAEIMLRELGERGDIIKRIHRALSGQGIDRGVSDYVFA
FT                   SEADGPILGRLVERGHDDELKGSAYVVIDGVDGRTHHIRLPHFDAAGDSAPGSIVELRS
FT                   YEDAKGARRTALAVRSDLDIRAQVTANGATWLDRQAVSRDPVALSEAGFGVEVRQAMKR
FT                   RAEHLIEEGLAERQGSRVIFARRLLDRLREREVGALAEKLAAETGMSYDRANTGDHVAG
FT                   TYRRRFALASGRFAMIDDGLGFKLVPWTPSLERHLDRHVSGVARADGGVDWSFGRKRGL
FT                   GL"
FT   gene            126242..126493
FT                   /locus_tag="Pden_0140"
FT   CDS_pept        126242..126493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0140"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: rru:Rru_A0090
FT                   prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68257"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYB3"
FT                   /protein_id="ABL68257.1"
FT                   /translation="MKELQLRDAKATLSAVVDQAVAGEPTVITRHGRKEAVLLSFEEFQ
FT                   RISRVPDFADLLLAFPGEPDDIPERARKPARALRDTGL"
FT   gene            126578..126934
FT                   /locus_tag="Pden_0141"
FT   CDS_pept        126578..126934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0141"
FT                   /product="PilT protein-like protein"
FT                   /note="KEGG: rru:Rru_A0091 PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68258"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYB4"
FT                   /protein_id="ABL68258.1"
FT                   /translation="MRAHSDRLYLSAITIAEIEAGIARAVRIGASAKAPALRRWLAAIE
FT                   HFYASRILPFGIGEARQAGAILDRARAHDSGFEDIAIAATAAAHDLTVLTANEQHFAPL
FT                   GVPFANPLKELPAP"
FT   gene            127107..129131
FT                   /locus_tag="Pden_0142"
FT   CDS_pept        127107..129131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0142"
FT                   /product="TRAG family protein"
FT                   /note="PFAM: TRAG family protein; KEGG: mes:Meso_0515 TraG
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68259"
FT                   /db_xref="GOA:A1AYB5"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYB5"
FT                   /protein_id="ABL68259.1"
FT                   /translation="MSGTKILWGQITVVFLIVLIFVWSGTQWTAWRLGFQPQLGPAWFA
FT                   LWGIPVYYPPALFWWWYFYDAYAPRIFVEGGIIAAAGGFLAIGTAIILSVMRAREAADV
FT                   ETYGSARWAERPEIERAGLLGPDGVVLGKLGADYLRHDGPEHVLCFAPTRSGKGVGLVV
FT                   PTLLTWPGSAIVHDIKGENWQLTAGFRARHGRVLLFDPTNAQSAAYNPLLEVRRGEWEV
FT                   RDVQNIADILVDPEGSLEKRNHWEKTSHALLVGVILHVLYAEEDKTLARVAAFLSDPRR
FT                   SIEATLAAMMKTPHLGEAGPHPVIASAARELLNKAENERSGVLSTAMSFLGLYRDPVVA
FT                   QVTSRCDWRIADLIAGEQPSTLYLVVPPSDISRTKPLIRLVLNQIGRRLTEDLRGKDDR
FT                   HRLLLMLDEFPALGRLDFFESALAFMAGYGIKSFLIAQSLNQIEKAYGPNNSILDNCHV
FT                   RVSFAANDERTAKRVSDALGTATEMKAMKNYAGHRLAPWLGHIMVSRSETARPLLTPGE
FT                   VMQLPPEDEIVMVAGTPPIRARKARYYVDPRFRERVLAPPDTREVMPSRQMDDWTGLPP
FT                   PKLDDVGQGAGAAAVPNAALAQVDTNSSGDSDNAGLRREPGLEPYQDIAPQPVTLPENE
FT                   FDPDFEAPEQQAVRNRGLARDMRRVARQISMNQDDGLEL"
FT   gene            129135..129545
FT                   /locus_tag="Pden_0143"
FT   CDS_pept        129135..129545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll0042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68260"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYB6"
FT                   /protein_id="ABL68260.1"
FT                   /translation="MPEHADKKRRLSVYLDPELMLLLADYADRRGKSRSLVAEAAIASF
FT                   LTPDVDERQEAAMTRRLDRIDRNVQRLERDIGIANEAFAIFVRSWLTATPAPLDAAARA
FT                   QGGDRYDRFLEALGRRLVSGPRLQQEVPEERG"
FT   gene            complement(129586..129894)
FT                   /locus_tag="Pden_0144"
FT   CDS_pept        complement(129586..129894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0144"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   sme:SMb20627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68261"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYB7"
FT                   /protein_id="ABL68261.1"
FT                   /translation="MRRPVAWTRAALDDIKEQIAFIAQDNPAAARRVADRIRDTGTALG
FT                   DMATGRPGRVTGSYEKSVSRLPYIIAYELRAIAGRESVVILRVIHTSQDWPDEDWPH"
FT   gene            complement(129891..130160)
FT                   /locus_tag="Pden_0145"
FT   CDS_pept        complement(129891..130160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0145"
FT                   /product="transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: sme:SMb20628 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68262"
FT                   /db_xref="GOA:A1AYB8"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYB8"
FT                   /protein_id="ABL68262.1"
FT                   /translation="MTASTTMTIRVSPETKQKLERIAGETRRSKSFLAAEAVSAYVERE
FT                   LEIIDGIRRGMADAAAGRVVSHEDAMAEIHAVIDAAEATRAGKA"
FT   gene            complement(130357..130599)
FT                   /locus_tag="Pden_0146"
FT   CDS_pept        complement(130357..130599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_0499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68263"
FT                   /db_xref="InterPro:IPR018733"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYB9"
FT                   /protein_id="ABL68263.1"
FT                   /translation="MTKLKLGPIADDTPVKLTVELPAGLHRDLVLYGELLGRSGGQGAV
FT                   APQKLVVPMLERFIASDRGFAKARRSISVRGQPNG"
FT   gene            complement(130604..131779)
FT                   /locus_tag="Pden_0147"
FT   CDS_pept        complement(130604..131779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0147"
FT                   /product="conjugation TrbI family protein"
FT                   /note="PFAM: conjugation TrbI family protein; KEGG:
FT                   mes:Meso_0500 conjugation TrbI-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68264"
FT                   /db_xref="GOA:A1AYC0"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYC0"
FT                   /protein_id="ABL68264.1"
FT                   /translation="MSDREAAAAPMRLRAEPPRVTRLSRKVLAGLGGIAALGIGAALIF
FT                   ALQTRDVERGGEELFSTENRTTADGLAELPRDYSGPVLGPALPGDLGKPILNARNRGEP
FT                   VPAPAPDIASPLEAVPAMDAAEQQRLAEEEAARLSGVFFQGGPRPAGGPDTGAGSAGSA
FT                   SGGSGTMGEPGATSAQDRHAAFLGAAADRITVVPDRVEAPASPYILQAGSVIPAALVTG
FT                   IRSDLPGQIIAQVTQPVYDSPTGSILLIPQGTRIIGEYDADVTFGQRRVLLVWNRLIYP
FT                   DGRSLVLERLPGADASGYAGLEDGVDYHWGELMKVAGLSTLLAVGTELAAGDEEDRLIR
FT                   AIRDGAQDTVNQAGQQIVQRQLQVAPTLTIRPGFPVRILVSRDLVFENAGG"
FT   gene            complement(131779..132783)
FT                   /locus_tag="Pden_0148"
FT   CDS_pept        complement(131779..132783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0148"
FT                   /product="Conjugal transfer protein TrbG/VirB9/CagX"
FT                   /note="PFAM: Conjugal transfer protein TrbG/VirB9/CagX;
FT                   KEGG: mes:Meso_0501 conjugal transfer protein
FT                   TrbG/VirB9/CagX"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68265"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014142"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYC1"
FT                   /protein_id="ABL68265.1"
FT                   /translation="MIPITFRKPGPAIVLLFATMLAGCATQKSPQVSYDDHVPPLPSPP
FT                   AAVADPAPKPLHVPPDWTPARGGNTAESPIGRVANANLAARVEPRREGYYNAIQVYPWS
FT                   EGALYQVYAAPGQITDIALEPGESLTGAGPIAAGDTARWIIGDTESGSGVFHRVHVLVK
FT                   PTRPDISTNLVIATDRRRYMLELRASEEAWMPAVSWHYPESSAPAQRRTVPAAPAIPGK
FT                   ASRNHRYGVQVQGASPPWRPVSVFDDGRRVYVVFPRGIAQGEMPPLFVIGPDGAPEIVN
FT                   SRVYGNVMIVDRLFGVAELRLGSGKRQQVVRIIRMEQTRAVAQPTRAPTKGSS"
FT   sig_peptide     complement(132700..132783)
FT                   /locus_tag="Pden_0148"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.967) with cleavage site probability 0.599 at
FT                   residue 28"
FT   gene            complement(132780..133469)
FT                   /locus_tag="Pden_0149"
FT   CDS_pept        complement(132780..133469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0149"
FT                   /product="Conjugal transfer protein"
FT                   /note="PFAM: Conjugal transfer protein; KEGG: mes:Meso_0502
FT                   conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68266"
FT                   /db_xref="GOA:A1AYC2"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR035658"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYC2"
FT                   /protein_id="ABL68266.1"
FT                   /translation="MNLFRRPTTHYGKTPEPVTPYQKATQVWDERIGSARVQARNWRYM
FT                   AFACLFLAAGFASALVWQSARGTVVPWVVQVDDLGQAQAVAPAAADYRPTDPQISWHLG
FT                   RFVEQVRSIPADPVILRQNWLRAYEFTTDRGAAALNDHARGNDPFAKLGEQQVSVEVSS
FT                   VIRASPDSFRVAWTEKRYENGQLSNTERWTAILTVVLQTPRTAETLRANPLGIYVNAIS
FT                   WSREMSQ"
FT   gene            complement(133466..134785)
FT                   /locus_tag="Pden_0150"
FT   CDS_pept        complement(133466..134785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0150"
FT                   /product="TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /note="PFAM: TrbL/VirB6 plasmid conjugal transfer protein;
FT                   KEGG: mes:Meso_0503 TrbL/VirB6 plasmid conjugal transfer
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68267"
FT                   /db_xref="GOA:A1AYC3"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="InterPro:IPR014150"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYC3"
FT                   /protein_id="ABL68267.1"
FT                   /translation="MGGSGVIDNFLAVFTSYIDSGFGLLGGEVAFIATTLIVIDVTLAA
FT                   LFWAWGAEDDILARLVKKTIFVGVFAWLITNWNSLARIVFDSFAGLGLMASGTGFTAAD
FT                   LMRPGRVAQTGLDAGRPLLESISDLMGWVAVFENLIQILCLFFAWALVILAFFILAVQL
FT                   FVTLIEFKLTTLAGFVLIPFGLFGKTAFMAERVLGNVVSSGIKVLVLAVIIGIGSTLFS
FT                   QFTTGFGGVAPTVDDAMAIVLAALSLLGLGIFGPGIANGLVSGGPQLGAGAAVGTGLAV
FT                   GGAALVAGGATVLGAKGGAMAARGGAATAGAASAAYTLHSAGESGLGGALSGVAGIGKG
FT                   AGIAALSPLRKAAASISKSHAAGVKTAFTGTGGSTTQGTLGGVGASVPTPSSPGSPPAW
FT                   AQRLRGQAVGRGATVAAHAVRSGDSHGPGASVSLSESDKP"
FT   gene            complement(134793..135080)
FT                   /locus_tag="Pden_0151"
FT   CDS_pept        complement(134793..135080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0151"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_2319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68268"
FT                   /db_xref="InterPro:IPR027587"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYC4"
FT                   /protein_id="ABL68268.1"
FT                   /translation="MEGKAMVRLIAILFLAIVMTVTLIRMERAGDLPPLPGRQSQSQPE
FT                   DPLREGQRRCQRMGAAAAEDAECLRIWAETRDRFLGRTPAQSAATSSSEE"
FT   gene            complement(135101..135901)
FT                   /locus_tag="Pden_0152"
FT   CDS_pept        complement(135101..135901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0152"
FT                   /product="conjugal transfer protein TrbJ"
FT                   /note="KEGG: mes:Meso_3855 conjugal transfer protein TrbJ"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68269"
FT                   /db_xref="InterPro:IPR014147"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYC5"
FT                   /protein_id="ABL68269.1"
FT                   /translation="MTRSTTVTMRRHIRAIASTTALALALATPLALAPLLTTPAHAFFG
FT                   GFGRIVYDPTNHAENLLTAARSLEQINNQIASLQNEAQMLINQARDLASLPHSSLQQLQ
FT                   QNVTRTQQLLDEAQNIAFEVQEVDQAFEREYGTPDLSTSEQQLLADARTRWSNTMGGLQ
FT                   DAMRVQSGVTNNIEAQRAEMAALVEQSQNADGALQASQAGNQLLALQSQQLSDLTALLA
FT                   ATGRAEALSEAERSAAAEQGRIQRERFLTPGAGYQPGNARMFND"
FT   sig_peptide     complement(135773..135901)
FT                   /locus_tag="Pden_0152"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.934 at
FT                   residue 43"
FT   gene            complement(135898..138516)
FT                   /locus_tag="Pden_0153"
FT   CDS_pept        complement(135898..138516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0153"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: mes:Meso_2321 ATPas"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68270"
FT                   /db_xref="GOA:A1AYC6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYC6"
FT                   /protein_id="ABL68270.1"
FT                   /translation="MMNLAEYRRNASRLADYLPWAALIAPGVVLNKDGSFQRTAKFRGP
FT                   DLDSAVAAELVAVAGRLNNAFRRLGSGWAIFVEAQRREDSSYPESRFPDPASALVDAER
FT                   KADFEQAGSHFVSDYFLTLLWLPPAEEAARAESWLYEGRETSGMNPWELLRGFIDRSDR
FT                   VLALLDGFMPECAWLDDGETLTYLHSTISTNRQRVRVPEVPMHLDALLSDQSLTGGLEP
FT                   RLGKQHLRVLTITGFPTATTPGILDELNRIAFPYRWSTRAILIDKTDATRLLTRIRRQW
FT                   FAKRKSIAAILKEVMTSEPSALVDTDAANKANDADLALQELGADVAGMGYVTATITVWD
FT                   EDARIADEKLRLVEKIVQGRDFTVMVETVNAVDAWLGSLPGHAYANVRQPPVSTLNLAH
FT                   MIPLSAVWAGDERDTHFDAPPLFYGKTEGATPFRFSLHVGDVGHTLVVGPTGAGKSVLL
FT                   ALMALQFRRYEGPQVFAFDFGGSIRAVALAMGGDWHDLGGGLSEGDEDSVSLQPLARIH
FT                   ESAERAWAADWIAAILGREGIAVTPEVKDHLWTALTSLASAPVGERTITGLAVLLQSNE
FT                   LKQALRPYCIGGPYGRLLDAEAEHLGSASVQAFEIEGLVGTGAAPAVLSYLFHRIGDRL
FT                   DGRPTLLIIDEGWLALDDEGFSGQLREWLKTLRKKNASVIFATQSLSDIDNSAIAPAII
FT                   ESCPTRLLLPNERAIEPQITAIYRRFGLNDRQIEILARATPKRDYYCQSRRGNRLFELG
FT                   LSEVGLALCAVSSKSDQARIAAILAEHGREGFLAAWLRDRSVDWAAELIPDLANLAPED
FT                   ADMLESVLFGSETARAQCGMAPVDVGSLDRETGPDDGEIDLDGTKAASIPAEREEEETA
FT                   P"
FT   gene            complement(138528..138809)
FT                   /locus_tag="Pden_0154"
FT   CDS_pept        complement(138528..138809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0154"
FT                   /product="conjugal transfer protein TrbB"
FT                   /note="KEGG: mes:Meso_0507 conjugal transfer protein TrbB"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68271"
FT                   /db_xref="GOA:A1AYC7"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="InterPro:IPR016704"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYC7"
FT                   /protein_id="ABL68271.1"
FT                   /translation="MAMSFEVLDTVPGFSVPVHRALTEPILLGGASRSVAILNGTLAGA
FT                   VGLGLQLWLAGILIWAVGHLAAVWAAKRDPLFVEVGRRHLRIPGHLAV"
FT   gene            complement(138809..139138)
FT                   /locus_tag="Pden_0155"
FT   CDS_pept        complement(138809..139138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0155"
FT                   /product="Conjugal transfer protein TrbC"
FT                   /note="PFAM: Conjugal transfer protein TrbC; KEGG:
FT                   mes:Meso_2323 conjugal transfer protein TrbC"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68272"
FT                   /db_xref="GOA:A1AYC8"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYC8"
FT                   /protein_id="ABL68272.1"
FT                   /translation="MIHALRIRHHVAIAAIFVWTSLVLAPTAHAAGSSMPWEAPLQSIL
FT                   DSVEGPVAKIVAVIIIIVTGLTLAFGDTGGGFRRLIQIVFGISIAFAASSFFLSFFSFG
FT                   GGALV"
FT   sig_peptide     complement(139046..139138)
FT                   /locus_tag="Pden_0155"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 31"
FT   gene            complement(139135..140139)
FT                   /locus_tag="Pden_0156"
FT   CDS_pept        complement(139135..140139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0156"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   mes:Meso_2324 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68273"
FT                   /db_xref="GOA:A1AYC9"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014149"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYC9"
FT                   /protein_id="ABL68273.1"
FT                   /translation="MAGSDHIEAMVERGARMLRTALGPAISALLRDPGIVEVMLNPDGR
FT                   IWIDRLRDGLAETGQVLSPADGERIIRLVAHHVGVEVHARSPRVSAELPETGERFEGLL
FT                   PPVVVAPAFAIRKPAVAVFTLDDYVAAGIMTRMQAEALRLGVATRANILVAGGTSTGKT
FT                   TLTNALLAEVAKTQDRVVVIEDTRELQCAAPNLVAMRTKDGVATLSDLVRSSLRLRPDR
FT                   IPIGEVRGAEALDLLKAWGTGHPGGIGTIHAGSGIGALRRLEQLIQEAVITVPRALIAE
FT                   TVDLVAVLSGRGSNRHLTELVRINGLGPDGDYRIAPVIPDTDTHIAENTGEPE"
FT   gene            complement(140328..141215)
FT                   /locus_tag="Pden_0157"
FT   CDS_pept        complement(140328..141215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0157"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: nwi:Nwi_0252 transcriptional
FT                   regulatory protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68274"
FT                   /db_xref="GOA:A1AYD0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD0"
FT                   /protein_id="ABL68274.1"
FT                   /translation="MDLRHLRYVVATARNGSFSAAALELEVQQPIVSRRIRELEEELGT
FT                   ALFDRSTAGAKLTPVGEDFADMAGRILDDFQRLTDRTRAAVEGRRGSVALGFYRSLSSG
FT                   SFRFALRRFRESHPDIGLDLLEAPFVELMADLHSGKLDVAVILGDPDRCPVLNTMAIGT
FT                   EHLMVALPEDHPLAEKPFVYWSDLKGERFLISHQDPGPDIRNILIAKLAAPSDGPEIAN
FT                   LHLSRESILSLVGAGEGISLQCECASGLTGLGAVFRPVHDGNGATRIGYIACWHPDNGN
FT                   PALQTFLEALKSGT"
FT   gene            complement(141246..141467)
FT                   /locus_tag="Pden_0158"
FT   CDS_pept        complement(141246..141467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0158"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr6069 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68275"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD1"
FT                   /protein_id="ABL68275.1"
FT                   /translation="MEEYIGLDVSMKETAVSIHRDGKRVWRGKCASAPKVIAKVIRKRA
FT                   PIAKRVVFDFVATAVPELGQVAHQQERA"
FT   gene            complement(141627..141974)
FT                   /locus_tag="Pden_0159"
FT   CDS_pept        complement(141627..141974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68276"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD2"
FT                   /protein_id="ABL68276.1"
FT                   /translation="MVKGSLPSLSELDVWTGTAFADTSGALRRKRAEIHWGSRRRRIGP
FT                   HKEAGYTSAIANSEPEQIRTLQSGGVIYIHTRPIRCDRTDLKAAIRQVNRQHADRRRHN
FT                   CAPRSVPIKPS"
FT   gene            complement(142033..145134)
FT                   /locus_tag="Pden_0160"
FT   CDS_pept        complement(142033..145134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0160"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   atc:AGR_L_494 RND pump protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68277"
FT                   /db_xref="GOA:A1AYD3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD3"
FT                   /protein_id="ABL68277.1"
FT                   /translation="MFLTRISATHPVFATMMMVALVVFGAFSYPRLGLDQYPDVDVPIV
FT                   VVMTTYPGATPETVETEISRPIEEAINTVGGLDQVTSTSYEGRSVVVAEFRLDVAGPAA
FT                   VQEVRDKLAPLEAGFPADVDKPVVSRFNPSDQPILSVAISGPRFDVAELTALAEQRIIR
FT                   QLTTISGVGQVTLVGGRMKQVDIVIDETRLRALSVGIDEVLAALRGGNQNRPAGNLVTG
FT                   FSDLGIQVQGRIDEPADFLDMIVARRGGGPVYLRDVATVTDGAADAESLALYDGRPALA
FT                   LDIVKVQDANTVQVADEVIARLDRLNEELAESGVTLSVVTDASLPIRESVAQVQATLIE
FT                   GAALAVAIVFLFLNSWRSTVITGLTLPIAMIGTLAVISVLGFTLNTLSLLALTLSIGIL
FT                   VDDAIVVRENITRHLHMGKSHLQAALDGTGEIALAVLATTATIVAVFLPVAFMDGIVGR
FT                   FFYEFGVTVSAAVLISLFVAFTLDPMLSSVWYDPDAQPDAKRGPIGRLIARFERGFERL
FT                   AEAYRHLIGWTLRHRLVTLIATAGIFIGSIFMVPLVGAEFTPTADEGRFQINVQTPVGS
FT                   SLDYTAAKVGQIEAALREFPELDTLYSTVNTGTATGKHRAAILVGLVPQGERTRTPLML
FT                   ADPIRQRLSVIPGIEIAIVQQGLGGGDSPIRLSVLGDDQAELERIAAGLMERMRGIPGM
FT                   VDIASSADAASSVIAVRLRSEAASDLGLGIHQIGAALAPLIGGEDVTTWTDSSGETHDV
FT                   VVRLPAERRADTDALGDLMLTTGGTDAGGAPVMVRLDQVARFVQVETASEIRRLDMTRE
FT                   VQISADISGRVLGDATADLEALIATLDLPQGYRIQFGGDSSTMQETMGHMITALLMAVT
FT                   FIYIVLASQFGNFLQPLAIMAALPLSLIGVLLGLMVAGSTINMFSLIGFIMLMGLVTKN
FT                   GILLIDFANRERRRGLPLNEALVNAGAIRFQPIVMTTLAMIVGMIPLALAVGGGGAQRA
FT                   PMAHAVIGGLISSTILTLIVVPVILSCIDGFWKRVARFLPEAPN"
FT   sig_peptide     complement(145048..145134)
FT                   /locus_tag="Pden_0160"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.950) with cleavage site probability 0.830 at
FT                   residue 29"
FT   gene            complement(145138..146280)
FT                   /locus_tag="Pden_0161"
FT   CDS_pept        complement(145138..146280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0161"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   atc:AGR_L_492 nodulation protein NolF"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68278"
FT                   /db_xref="GOA:A1AYD4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD4"
FT                   /protein_id="ABL68278.1"
FT                   /translation="MKLWIAALALVAMMGTGFFLAFPLPGSSNGASRVIDAATGAHAGV
FT                   PRQHRAMQLLPREVLRVAPATIAERLTVSGEVRPVQRVILRAQSGGVVAELGAREGEAV
FT                   RAGDMLVRFDTEELAATLALRQSEVEATEARLRFARQALERIERLAERTVATQEQLDQA
FT                   RRESAVLQAQLDGLRAQAGIARAALRDAEIRAPFDGVVASRSVDVGERASAEAELMTLV
FT                   DPTRLEARVLIATRDVPRIAPGQAAELRIDGLEGETIEGSVLRINPVANDGSRFISVHI
FT                   GLDDPDGRLRGGMFATGTILVEERADVLALPATALREDGDGAYVLRLAEGQIERRPVVT
FT                   GAAWSGGRIEIRDGIASGDTILIAPLPGLGEGVLAEVSGG"
FT   sig_peptide     complement(146188..146280)
FT                   /locus_tag="Pden_0161"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.935 at
FT                   residue 31"
FT   gene            complement(146505..147182)
FT                   /locus_tag="Pden_0162"
FT   CDS_pept        complement(146505..147182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0162"
FT                   /product="MltA-interacting MipA family protein"
FT                   /note="PFAM: MltA-interacting MipA family protein; KEGG:
FT                   ccr:CC0351 putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68279"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD5"
FT                   /protein_id="ABL68279.1"
FT                   /translation="MAQDRMIFGLGAASAPEYQGSDQQSARAIPLIDIARGPFFMNLRN
FT                   GIGAYPLEYGDFRFGTSIVYIPGFDLPHALGEVSGSAGARLFTDWERGGVNATFGVTRA
FT                   VSGDLEGTLVDASLSYRHNVTPKLTLIPVIGTTWSDSDYTNSYFGVTPAQAAAAGISSF
FT                   SPGGGFKDVSIGLTANYRVTERVNLTASATMSKLLGDAKDSPIVFDDTQAFGFIGVSYR
FT                   FGN"
FT   gene            147265..147627
FT                   /locus_tag="Pden_0163"
FT   CDS_pept        147265..147627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68280"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD6"
FT                   /protein_id="ABL68280.1"
FT                   /translation="MLCSVLRDEFPQGTVSAMMRSGSCLPGRDCSGMPCQLRCVNVSYL
FT                   GDPLSIRFVCASYPRGMVSGSARVTPGSEAMYSHLPAGSFVRRAMMIVLVASPDMLAAA
FT                   SGSEPENLPQGENGDV"
FT   gene            147614..148240
FT                   /locus_tag="Pden_0164"
FT   CDS_pept        147614..148240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0164"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: sco:SCO1193
FT                   TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68281"
FT                   /db_xref="GOA:A1AYD7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD7"
FT                   /protein_id="ABL68281.1"
FT                   /translation="MAMSETRGDKARRRRGPALEEAILDAAWEELTTHGYEKLTLEAVA
FT                   RRAGTSRPVLSRRWDSLSKLASAAIVRYALHNPTEVPDLGGLREELILLLRQIARRSSP
FT                   KVVRLIYEMRKDLEAAFSSFADIRTQVGVAGYPMQQILDRAVARGEVRPDFVTPRLLRL
FT                   PVDLARHEMMMTFQPLAESDILEIVDDIVLPLWTGGSGTRQRPSA"
FT   gene            148397..148627
FT                   /pseudo
FT                   /locus_tag="Pden_0165"
FT   gene            complement(148664..149005)
FT                   /locus_tag="Pden_0166"
FT   CDS_pept        complement(148664..149005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0166"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein, ArsR; KEGG: nwi:Nwi_3123
FT                   transcriptional regulatory protein, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68282"
FT                   /db_xref="GOA:A1AYD8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD8"
FT                   /protein_id="ABL68282.1"
FT                   /translation="MEDKQALAAFAALSQETRLRIVRLLGTAGPEGLPAGAIGEAMDGA
FT                   TSSRMSFHLGPLEHAGLVTSRREGRQIIYSVTYQALSDLIAFLMRDCCQGRPEICAPAV
FT                   AALSCSSAI"
FT   gene            149251..150348
FT                   /locus_tag="Pden_0167"
FT   CDS_pept        149251..150348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0167"
FT                   /product="gentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.4"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: mes:Meso_3565 cupin 2, conserved barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68283"
FT                   /db_xref="GOA:A1AYD9"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD9"
FT                   /protein_id="ABL68283.1"
FT                   /translation="MMQTEAKSNMMMPEETAELRQLYADFEAEHLHPLWTQIDDLMPVV
FT                   PAPKAVPHVWRWSRLFPLAQRSGDLVPVGRGGERRAIGLANPGLGGKAYVTPTLWAAIQ
FT                   YLGPRETAPEHRHAQNAFRFVVEGEGVWTVVNGDPVRMSRGDFLLTPGWHFHGHHNDTD
FT                   QPMAWIDGLDIPFSYQNDVGFFEFGADRVTDYATPRYSRGERLWCHPGLRPLSGLANTV
FT                   SSPIGAYRWEHTDRALTEQLLLEEEGQPATVGQGHAAVRYINPTTGGDVMPTIRAEFHR
FT                   LRPGVQTAGRREVGSSVFQVFEGQGAVVLNGTEHRLEKGDMFVVPSWVKWLLQAETGFD
FT                   LFRFSDAPIIERLHFARSQVDEADR"
FT   gene            150370..151140
FT                   /locus_tag="Pden_0168"
FT   CDS_pept        150370..151140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0168"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_3566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68284"
FT                   /db_xref="GOA:A1AYE0"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYE0"
FT                   /protein_id="ABL68284.1"
FT                   /translation="MDIDDSRAALRARQGKGARYDNPAAPADELALARLGTAYFARKLN
FT                   ELPDAALDGAALVPGWSRRHVVAHVGFQARALARLVEAAREGRTEEALSEPEAQNEDVD
FT                   FGATLPAHALRHLFDHSKVHLDVEWRDLQAQGWRARVHALTGSPVQIADTPWLRAREIW
FT                   MRAVDLGNGGSLLDFPPGLIDRLLAELAADLPHALHPLDRNAMLGAPRGSVVRGRAADL
FT                   LRWITGRGAHRLEFPDGPLPEPPFWPACGREGRA"
FT   gene            complement(151137..151964)
FT                   /locus_tag="Pden_0169"
FT   CDS_pept        complement(151137..151964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0169"
FT                   /product="regulatory protein, IclR"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: dar:Daro_0384
FT                   regulatory proteins, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68285"
FT                   /db_xref="GOA:A1AYE1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYE1"
FT                   /protein_id="ABL68285.1"
FT                   /translation="MQDESEGGANARGGIQALDAALVVLRGLAEFDGPVALADLARAVS
FT                   MPPSKVHRYLASFIHAGFVKQATRSGRYELGPTSASLGIAALSRSDFVNQAADALPELT
FT                   EATGMTTLISVWGTQGATVIRWCRAPSPMVTSFGLGSNMPLLTSASGRVFLSWLPRPVI
FT                   SARLGLEIERAIEAGLSWPDLDLSMDSIEHLIDRIRADGFATIDGRYVPGLRAMAVPIT
FT                   NWQGEAEAAVTMISTSEQILSADHPAARHLLDFAARHSSQRNWAETTARRTGG"
FT   gene            complement(151979..152380)
FT                   /locus_tag="Pden_0170"
FT   CDS_pept        complement(151979..152380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0170"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   gka:GK1990 4-hydroxybenzoyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68286"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYE2"
FT                   /protein_id="ABL68286.1"
FT                   /translation="MEPFLTEFTVEWGDCDEAGIVFYPNYFYWLDCTFQRLLRARGLGQ
FT                   RQTRDRFGAVTPLLDVALRFRAPVRYDEVLRIEARIAEWQERRFRIGYTLTSGERLIAE
FT                   GHELRAWAVQTDDGLKGAPIAEEFRRLLE"
FT   gene            152463..153608
FT                   /locus_tag="Pden_0171"
FT   CDS_pept        152463..153608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0171"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /note="PFAM: monooxygenase, FAD-binding; KEGG: bja:blr0106
FT                   probable monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68287"
FT                   /db_xref="GOA:A1AYE3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYE3"
FT                   /protein_id="ABL68287.1"
FT                   /translation="MKRIAVLGGGPGGLYFAYLWKSRHPADSVTLFEQNPEGATFGFGV
FT                   VFSDRAMDFLRADDPETADRITEKMETWSDITLVHHGQRVTIDGVGFSAIGRLELILLM
FT                   QERARDAGVDLRFGTVIGSVAELADYDVIVAADGVNSLVRRSFEGDFQTSISYLDEKFA
FT                   WFGTTKRFETLTQTFVTCEHGTFNAHHYRYSPTMSTFIVECDRASWLKAGFDQLGPDEA
FT                   KTRCEEIFAEALDGHGLVANKSNWRNFPWIWNDRWSHRNMVLIGDALHTAHYSIGSGTR
FT                   LALEDVQALVAALEAHPGDPGAAFAEYEATRRPIVEKLVRAAKTSAAWYADFPAHMQLA
FT                   PLDMAYSYITRSGRIDDQRLTAMSPRFMAEYGAARTVPAAG"
FT   gene            153619..155283
FT                   /locus_tag="Pden_0172"
FT   CDS_pept        153619..155283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0172"
FT                   /product="benzoate-CoA ligase family"
FT                   /note="TIGRFAM: benzoate-CoA ligase family; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: bja:blr0107
FT                   probable coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68288"
FT                   /db_xref="GOA:A1AYE4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011957"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYE4"
FT                   /protein_id="ABL68288.1"
FT                   /translation="MTVLESTRTATTDIEDRVPLDALGSREIGFAIPETYNASAILFDN
FT                   LDRGRGGHMAVIGPGGSRTYAQLCAEASRFGNALLGAGLTQGDRILLFLDDSPAYPAAL
FT                   FGAIRAGLVPLLINTLTPPELLNFYLKDSSSRVAIADAAFAARFDDVACAETALERLVV
FT                   VNGAAPEDSPVPVQTAEAFLQGVSDSLAPAPTGRNDMAFWQYSSGSTGRPKGIVHLQHD
FT                   MAYTALSFGRHVLDLQPGDICFSVPKIFFAYGLGNSLTFPFSVGATSVLLPGQPRPAAV
FT                   FEAIATCRPTHFFGLPTLYTAMTSAPEAATADLSSLKLCLSAAEVLANEVAEAWRALSG
FT                   HDIIEGLGSTEVLHIYLSNTREARRPGAAGLRVPGYEVAIRDPDGNDVPDGEQGVLWVR
FT                   GDSNAPFYWNRPDKTADAMRGDGWIYTGDRMRRDADGFYYFLGRADEFVKVSGQWVYPL
FT                   EVELCLADHPELRECAVLAVEMADRRMTLHAFVTAEDPGADRAALADRLKRHVKATLLP
FT                   YKYPRSVIFLDHLPKTGTGKIDRQALLAIDLDDHDVF"
FT   gene            155383..156093
FT                   /locus_tag="Pden_0173"
FT   CDS_pept        155383..156093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0173"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rme:Rmet_4907 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68289"
FT                   /db_xref="GOA:A1AYE5"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYE5"
FT                   /protein_id="ABL68289.1"
FT                   /translation="MTDFAFPPPAPASLAIEGSETRFPVRRIFCVGRNYAAHAREMGKD
FT                   PDRDPPFFFTKPADAVVDTGAAIPYPPQTADFHYEIELIVAIGQDGANVSVEGARELIW
FT                   GYGVGIDLTRRDLQLQARDMGRPWDWGKAFDLSAPIAPLHPVAQVGHPEQGRIWLAVNG
FT                   AVKQDADIAELIWDVPEIVSTLSHSMVLRRGDIIMTGTPAGVGAIVPGDHVTGGIDGLG
FT                   EIAIDILPGAERAS"
FT   gene            156090..156743
FT                   /locus_tag="Pden_0174"
FT   CDS_pept        156090..156743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0174"
FT                   /product="maleylacetoacetate isomerase"
FT                   /EC_number="5.2.1.2"
FT                   /note="TIGRFAM: maleylacetoacetate isomerase; PFAM:
FT                   Glutathione S-transferase, N-terminal domain; KEGG:
FT                   mlo:mlr1135 maleylacetoacetate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68290"
FT                   /db_xref="GOA:A1AYE6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYE6"
FT                   /protein_id="ABL68290.1"
FT                   /translation="MTRPVLHNYYRSSTSYRVRIALALKGVDYDYAALHLRKGDQRSDA
FT                   FLALNPQGLVPALEWGDGQILTQSLAIIEYLDEIIPQPPLLPSDPAGRARVRSLADMIA
FT                   LDIHPINNLRVLAYLKNHFGADDEATAEWFRHWVSEGFAALEARLARDPQTGTFCHGDR
FT                   VGLADICLAAQITNNARFGVDMTPWPTIRRIGEALAGIEAFRQAAPDRQPDNET"
FT   gene            156769..157950
FT                   /locus_tag="Pden_0175"
FT   CDS_pept        156769..157950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0175"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="KEGG: bja:blr1052 putative ABC transporter binding
FT                   protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68291"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYE7"
FT                   /protein_id="ABL68291.1"
FT                   /translation="MKLATAFLATALMATTAHAQEPIRIGFITTLTTPAAAIGNDMVDA
FT                   VNLAIDHVGGEIAGHPIQVIFEDDGLQPELGRQKAEKLVRQEKVDVVSGFIWSNVLMAA
FT                   RRTVLDSDTFLISTNAGPSDLAGKLCSPDFFSLRGQNDVVPMALGQIMNERGVEKLYVM
FT                   TPNYSAGTDMAAGVENTFEGEVVGRDFTKWGEDPQLDFSAELAKVGASGADALFAFYPG
FT                   RAAIFARQFEQSGLADRVKLYTVYTFDQIALPTLQEAGIDVALGSVTVDYWSPDIDTPA
FT                   NVKFVEDFKERYGRLPSNYAAAAYDLIPYLKAAVEQSGGDIKDRDAVREALIRADYESV
FT                   RGRYSLARNHFPIDNYRSLEIAPDANGAWSMRSDGLELAGLVDPYVDQCGNDS"
FT   sig_peptide     156769..156828
FT                   /locus_tag="Pden_0175"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            157992..158912
FT                   /locus_tag="Pden_0176"
FT   CDS_pept        157992..158912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0176"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG: bja:blr1064
FT                   ABC transporter permease protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68292"
FT                   /db_xref="GOA:A1AYE8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYE8"
FT                   /protein_id="ABL68292.1"
FT                   /translation="MDTVLFVNQLLNGIQLGLILFLLAAGLSLVFGIMDFINLAHGVFY
FT                   MLGAYICATVAIASGSFILGFVVALPAVLVLGLATEWLIVRHFYKRDHLDQVLVTFGLV
FT                   LCADTAVKYLWGPQGLSVPLPAWLGGQVALGGITLPAYRLFIVAVAAVVALALWQVIAR
FT                   TRVGMMVRASASNEEMARALGIETRMIFALVFAIGAVLAGIGGIMVAPITGASIGMGNQ
FT                   IVILALVVIIIGGIGSIFGAFVAAIGVGLIDTLGRAYLPSILGAVFSPSVASSAGPALA
FT                   SILIYLTMTLVLVFRPSGLFPPANR"
FT   gene            158917..159918
FT                   /locus_tag="Pden_0177"
FT   CDS_pept        158917..159918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0177"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG: bja:blr1065
FT                   ABC transporter permease protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68293"
FT                   /db_xref="GOA:A1AYE9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYE9"
FT                   /protein_id="ABL68293.1"
FT                   /translation="MTRSIPAEDGAKLTSAPARPRPATDCDLVAAFVILAALAVAPFAL
FT                   AAIGHDFWTDVILRAMILGIAAVSLNFIIGLGGLVSLGHAVFLGIGGYSVGILADLGID
FT                   NGPAQLGAALLFSAAFAWLTGMIALRTRGVHFIMITLAFAQMVYFTMMGLRQFGGDDGL
FT                   TINYSTTFGPLDLGDKDVLYYVVLAVLGAAMLGFARVRRSDFGLLLKAAKGNERRVSAV
FT                   GFNAYRYRLAAYVAAGTLCGLAGFLDANFTGFVTPSAMSWISSGELIFIVIVGGIASVS
FT                   GPIAGALVFLLIEEWMGGLTVYWHFWFGLFLIAIILFARNGLVGLLNQRRPR"
FT   gene            159915..160664
FT                   /locus_tag="Pden_0178"
FT   CDS_pept        159915..160664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0178"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bja:blr1066 ABC transporter ATP-binding protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68294"
FT                   /db_xref="GOA:A1AYF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYF0"
FT                   /protein_id="ABL68294.1"
FT                   /translation="MTPALQVNRLNKYFGGLHATRDVSMTLPRGELHAVIGPNGAGKTT
FT                   LISQLFGELRPSSGQVLIEGRDVTHRPTHERAGLGMARSFQITTLVRDLTVAENVILAL
FT                   LARQGHAGRFWRRVDRNAGLQADAAGALARIGMPATQLGRRVSDLSHGEQRMLELAIAM
FT                   VGDPTLILLDEPMAGLGSEESRAMTRFLAQLKGKTTVLLVEHDMEAVFELADRLTVLVR
FT                   GEVVAVGTPAQIRDDERVRDAYLGEDA"
FT   gene            160664..161365
FT                   /locus_tag="Pden_0179"
FT   CDS_pept        160664..161365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0179"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bja:blr1067 ABC transporter ATP-binding protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68295"
FT                   /db_xref="GOA:A1AYF1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYF1"
FT                   /protein_id="ABL68295.1"
FT                   /translation="MLKVQNLTSGYDRSQILFDISFEVGAGEVVCLMGRNGMGKTTTVR
FT                   ALMGLLPAWDGAVEFEGRQLNGMSAARVAKRGLGLVPEGRQIFPNLTVHENLRVAAANR
FT                   RGQPDPWTVERIYELFPGLHERIGSHGNLLSGGEQQMLAIGRALMTNPSLLILDEATEG
FT                   LAPVIRDQIWDCIARLRGLGQSIVVIDKHVKRLLDVADRFYVVEKGRTVWSGDPDRVRA
FT                   EDDRIKGYLTV"
FT   gene            161423..162874
FT                   /locus_tag="Pden_0180"
FT   CDS_pept        161423..162874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0180"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mlo:mll7197
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68296"
FT                   /db_xref="GOA:A1AYF2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYF2"
FT                   /protein_id="ABL68296.1"
FT                   /translation="METLLHIDNEPVSATDGATFERVAPHTGQTVTRGAAAGIRDSLAA
FT                   VDAASRAFVEWSRSGPGQRRALLLKAADEIEARMGDFVAAMQAEVGANALWSQFNVMLA
FT                   ANLFREAAGLATQIQGETIPTDKPGTLSMTLRQPCGVVLSIVPWNGPVVLAARAIAYPL
FT                   VCGNTVVFRASETSPRTHELIAQAVYAAGFPAGTLNFITHDLSTAPEAIEALIAHPAVR
FT                   RVNFTGSTAVGRIIGEKAGKHLKRCILELGDKSPLVVLDDARVDDAVTAGIFGAFLYQG
FT                   QICMTTERIIVDEKIADDYVAKFAARARELPLGDPTTQAACVLGPVISMKAADRLKGLL
FT                   DDAVAKGARIVAGGHGEGAMMPATVLDGVTPEMRIYAEETFGPIVSIIRAKGTEDAIRI
FT                   ANDTEFGLSAGVFGQDVTRALEVAARLETGSVHINGATVQNEAQAPYGGTKASGFGRFD
FT                   GRAVIDEFTELKWLTIEQSGQGYPF"
FT   gene            162937..164652
FT                   /locus_tag="Pden_0181"
FT   CDS_pept        162937..164652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0181"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: xcv:XCV2149 choline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68297"
FT                   /db_xref="GOA:A1AYF3"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYF3"
FT                   /protein_id="ABL68297.1"
FT                   /translation="MRNDKGGAIERLERAFIAGRISRRTFICSVLATGLVAAGAVGALA
FT                   DELEAIRQIQAERLADLPQRFDYIVVGSGSAGCALVGTLADRTDGNILLIEAGDWDTAP
FT                   TIDDPRAWFANLGTERDWGDVALPGPGVNGRAIPEHTGRVVGGGSSINATIWARPTRAD
FT                   MDHWAEASGDEAWNYQASREIYKRMENWRGALNPEFRGTDGPVWVQPAQDVLPLVDATL
FT                   AAVAEIGLPVVDDLNAERELTGNGFGLMNQIIKDGRRHSLARAFLYPVLGRGNVTLLVN
FT                   TSVNHVLIEGDTAVGVECLRDGQVQTFHADREIILSAGGFNTPKLLMLSGIGDEAHLAD
FT                   HGIDTRMHAPEVGRNVQDHILHGGCIFEAPEPVEHRNSAANISGYLKTDSALDHPDVSI
FT                   VQIELPYASEVIGQEYAPPAGAWALCGGLVAPQSRGTVRLASADPAARPVIDMQFLSHP
FT                   EDVEYLARAIRLAREIAHAPALKDHMLREVAPGRDLQGDELANFIRNGATTYFHAAGAC
FT                   RMGRDEGAVVDAQLRVNGIRHLRIADSTIMPRIVTVPTMPVCALIGVRMADMLA"
FT   sig_peptide     162937..163074
FT                   /locus_tag="Pden_0181"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.973 at
FT                   residue 46"
FT   gene            164730..165875
FT                   /locus_tag="Pden_0182"
FT   CDS_pept        164730..165875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0182"
FT                   /product="RNAse Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="KEGG: rme:Rmet_3785 beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68298"
FT                   /db_xref="GOA:A1AYF4"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYF4"
FT                   /protein_id="ABL68298.1"
FT                   /translation="MRKRWTLRGLCASTAASVILMASAVGAEQGSETSDPTSETELVIL
FT                   GGGAGRTSYGGDPTGGFSAAVVVGEDRYIVDFGRGWQERYYEAGLGNERAHTGFSGLEG
FT                   LKAGFVTHLHSDHIIDLPRLLLFGSTEGLRKRTDPVVIVGPASRGDLPPLASNLEREER
FT                   LVSPENPTPGIKSTVEQIFAAYASDLNDNIRDSGMPHPDTYIEVREIALPEGTPGPDVS
FT                   VAPEMAPFEIYRDENISVSAILVDHAPMYPSYALRFETPDGVIVFSGDTNMNPNLVEIA
FT                   RDADILVLEVISTDWANNLFPEPRSSADIAKLHHLLESHTPVEEVGQVAAQANVGRLVL
FT                   SHLAPATVPDEEWLAGVSGFEGEVLVGRPLLRLGLSEANNP"
FT   sig_peptide     164730..164810
FT                   /locus_tag="Pden_0182"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.579 at
FT                   residue 27"
FT   gene            complement(165932..167233)
FT                   /locus_tag="Pden_0183"
FT   CDS_pept        complement(165932..167233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0183"
FT                   /product="D-amino acid dehydrogenase small subunit"
FT                   /EC_number="1.4.99.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bpa:BPP2721 D-amino acid dehydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68299"
FT                   /db_xref="GOA:A1AYF5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYF5"
FT                   /protein_id="ABL68299.1"
FT                   /translation="MQNIAVIGAGITGVTTAYELAARGFAVTVYDRNRYAAMETSFANG
FT                   GQLSASNAEVWNYPATIAKGLTWLMKPDAPLSLSLKPGWHKYSWLAQFLGNIPNYRANT
FT                   TRTAELAVAARQRMRDIAAREGIAFDRDDRGILHFYATEAQMAHARRVSELLAAGGVER
FT                   VELDAEGIRRLEPRLKGDFIGGFHTPGDATGDIHLFTTGLARASARLGVTYRMETEILS
FT                   CRHDGTDTHIRYRDAEGQVRHAIHPAIVVCAGIGSRAIARGLGDRVNIYPVKGYSITVN
FT                   LEDDISVQAAPELSLLDDAAKIVTSRLGRARFRVAGTAEFAGENRDIRACRIRPLVEWV
FT                   NRHFPAVSTRQCVPWAGLRPMTPSMMPKVGPGRRAGVFYNTGHGHLGWTLSAATADLVA
FT                   QSVEAQLRRPGAVMPLTAENMPPARAALVGASDR"
FT   misc_binding    complement(167279..167368)
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   80.32"
FT   misc_binding    complement(167369..167446)
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   56.05"
FT   gene            complement(167506..168204)
FT                   /locus_tag="Pden_0184"
FT   CDS_pept        complement(167506..168204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oih:OB0952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68300"
FT                   /db_xref="GOA:A1AYF6"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYF6"
FT                   /protein_id="ABL68300.1"
FT                   /translation="MTDQTMEGFYKSRFIPRAHRIGRLSLLIAMVLCMMPALYLSFVLD
FT                   AFPGIGPILTGFLAIAAFVGIIWVVEPISYFPVLGVCGTYMSFLSGNIGNMRMPVVISC
FT                   QSAVEAEAGSRKAEVAAVIGIAVSVLVNLVFLVALVLIGAALIEVLPPAVAEAIKSYTL
FT                   PALYGAVLVMFMNSATRRNALTGILAGLAVFLSPIPSLFGSAAAGILAIIVAVALNWGK
FT                   RTPEAGKNPA"
FT   gene            complement(168231..168968)
FT                   /locus_tag="Pden_0185"
FT   CDS_pept        complement(168231..168968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oih:OB0951 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68301"
FT                   /db_xref="GOA:A1AYF7"
FT                   /db_xref="InterPro:IPR032479"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYF7"
FT                   /protein_id="ABL68301.1"
FT                   /translation="MENVLQIANGPVLWLFAILVISVVVAQALMYLRMTLIFSNRYEIL
FT                   TPEERTRIYKTAAINSIGPAVAIFFVAVSLVAMVGSPVTLMRVGVIGSAVFEFVAADQG
FT                   ARAVGAELGRDSYTLQAFAASVWVMTLGGMGWLLSTFFLTKGLDRTQDRMALSNPALIR
FT                   AVGTATPIAIFFLLGANAAVSKSWLSNITIAADNLAAVVTSAGCMVALHAAGKHRPWLR
FT                   EWAVGLSLIAGIAVGFGVGRILA"
FT   gene            complement(169001..170164)
FT                   /locus_tag="Pden_0186"
FT   CDS_pept        complement(169001..170164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0186"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: bja:blr5691 amidohydrolase; TIGRFAM:
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68302"
FT                   /db_xref="GOA:A1AYF8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYF8"
FT                   /protein_id="ABL68302.1"
FT                   /translation="MGMIEDIVAQQAEFIGWRHALHENPGIGFQETFAAELVEAKLREF
FT                   GLDEVHPGIGGTGVVGVLRGRRQSNRAIGLRADMDALPIHEETGKPYASKVPGVMHACG
FT                   HDGHTATLLATAWHLSRDRDFAGTVHFIFQPAEEGLGGALAMIRDGLLERFPCDRIYAY
FT                   HNFPGIERGHICTRPGRMMAGCSFFTIRLQGRGGHAALPQTTVDAAQMASNIVVTAQSI
FT                   VARNLDPNETGIISFTDVYAGTNSHNVIPDKAELKGCLRYFDKGVGALMKQRLEEVAKG
FT                   VSATYGGHAEIAFDDNFVPLVNDPQATVIALSVAAETVGAENVRGNVAPFTGSEDFAYM
FT                   TEQVPGSYVLVGAGPGAMPHNPGFDFNDEILATAASYFCRLVRAELA"
FT   gene            170313..170816
FT                   /locus_tag="Pden_0187"
FT   CDS_pept        170313..170816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0187"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: sil:SPO1261
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68303"
FT                   /db_xref="GOA:A1AYF9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYF9"
FT                   /protein_id="ABL68303.1"
FT                   /translation="MLRNWSKAFRQGNAVYQLNMLANATIRSFEDGFVEIVGLDIRTIR
FT                   VLRLIGDNPGITFAEIAVLGALERSLASRLIQTLVRQDLVERRNDPNDARRFGLHITPI
FT                   GQETRRRADMLSDLGLEILFQKLDPAEAAAFVRTLGKLADWIDSDEFERKIRQTYADAS
FT                   ERLK"
FT   gene            complement(170847..171662)
FT                   /locus_tag="Pden_0188"
FT   CDS_pept        complement(170847..171662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0188"
FT                   /product="regulatory protein, IclR"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: bps:BPSS2127
FT                   IclR transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68304"
FT                   /db_xref="GOA:A1AYG0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYG0"
FT                   /protein_id="ABL68304.1"
FT                   /translation="MCPARSEGRRTMGAAKSTATQAKEPPNYSAPALEKGLDILELLHE
FT                   SETALTQKEIATRLGRSVSELYRMVSILVRRNYVANYGDKFGPTTKLFKLSQAHPPVRR
FT                   LLTAAIPIMEELSRDVDFGCDLRVYNRGSQTVLAAVDAPSGLGFSVRTGSEIAVAPSAS
FT                   GRVLIAFQDSDTMELRIREAFDGRPESELRAFRKEVHEVAVKGYAALQSRQYEGLYAVS
FT                   YPILDVNHHAVAALTVPMLPRIDGVRQVAREDVITALRDAAARLSKRIG"
FT   gene            complement(171675..173552)
FT                   /locus_tag="Pden_0189"
FT   CDS_pept        complement(171675..173552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0189"
FT                   /product="TRAP C4-dicarboxylate transport system permease
FT                   DctM subunit"
FT                   /note="PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: rpe:RPE_1982 TRAP
FT                   C4-dicarboxylate transport system permease DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68305"
FT                   /db_xref="GOA:A1AYG1"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYG1"
FT                   /protein_id="ABL68305.1"
FT                   /translation="MFELLASNLAPIMFLSLIGILLLGYPVAFSLAANGLLFFFVAVEL
FT                   SPYAPGTIALSWNLLVALPDRVFSIMSNEVLLAVPFFTFMGIVLQRSGMAEDLLETFGQ
FT                   FFGSVRGGVAYAVVFVGTLLAATTGVVAASVIAMGMISLPVMMRYGYDRRVASGTIMAS
FT                   GTLAQILPPSTILIVLADQLGTSVGDMYTVAFLPSLMLTLSFMLFILLVSIFRPSYVPA
FT                   LPPEALLYREPNGTRGVWQVLALFVVSGIIASLTVRASGMEKTIDVVIFTLCGLSIAAL
FT                   VIALMSRLLGRAALVAGGVLALGFAALAMTRDAGSLAATLAWAASAVCAYVALHGASAR
FT                   GARTRLISAIAERVAFVLVPPVLLIFLVLGTIFIGLATPVEAGAMGAVGSVVLALAKRL
FT                   ADRRPDRLNLAMMTQATYSTAKLCAFILFILIGARVFALTFFGINGHLWVEHLLTGLPG
FT                   GQRGFMIFTVVVIFVLGCFLDFFEIAFIAIPLLLVPAITLGVDPLWLGLVIAITLQTSF
FT                   LTPPLGFSLFFLRSIAPKAAYKDEISGKMIDGVSTRQIYLGGIPFVIIQLLLVIVVLFA
FT                   PEIFMGVGGQAPVMDMEDAMRTLEGFTIDIDPTGGIAVPQIDLTFPSGN"
FT   sig_peptide     complement(173454..173552)
FT                   /locus_tag="Pden_0189"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.953) with cleavage site probability 0.731 at
FT                   residue 33"
FT   gene            complement(173552..174082)
FT                   /locus_tag="Pden_0190"
FT   CDS_pept        complement(173552..174082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0190"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component; KEGG: mlo:mll5171 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68306"
FT                   /db_xref="GOA:A1AYG2"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYG2"
FT                   /protein_id="ABL68306.1"
FT                   /translation="MTNFLLRSSRAIDYLNRGIGKAASWAIVMAILVSALNALSRHLFG
FT                   VTSNAWLELQWYLFGAVFMLCAAWAMQDNEHVRIDVFSSRFSPRTREIVEMAGHLLFLF
FT                   PFVALMLWLSMQFFLKTLASGEMSPNQGGLPLWPAKALIFIGFLQLTLQWLSEVIKTGF
FT                   RLRDLPNTEGEVS"
FT   gene            complement(174180..174593)
FT                   /locus_tag="Pden_0191"
FT   CDS_pept        complement(174180..174593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0191"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: cme:CMP184C hypothetical
FT                   protein, conserved Pfam: Glyoxalase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68307"
FT                   /db_xref="GOA:A1AYG3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYG3"
FT                   /protein_id="ABL68307.1"
FT                   /translation="MKLELHHINVCTKDVPHLNEFYRKILNLGGVDDDEHVQDTTKGYY
FT                   SGVEFVTDGKIEFHLATTDLGVSYRTNQPVNPLERGHIAFRTDDIEAFKKHLTDNGVPF
FT                   ADYGVWAMAGWYQIFFQDPEGTIIEVHQINYGK"
FT   gene            complement(174620..175390)
FT                   /locus_tag="Pden_0192"
FT   CDS_pept        complement(174620..175390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0192"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: tma:TM1724 3-oxoacyl-(acyl carrier protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68308"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYG4"
FT                   /protein_id="ABL68308.1"
FT                   /translation="MANRLAGKVALVSGGGGGIGSEAGRIFCEEGASVVLVDLSGEAVE
FT                   AAAERIRSAVPGANVRPFAADLGIEAAAYEAADKAIEAFGGIDIVVNNVGIRRYDALAD
FT                   ATWDMWEDIIRVNLLSYASLTRAALPSMRERGEGSVVNVSSCHAVLGRKGMGAYDASKA
FT                   AVLGFTRTLAWEEAPHGIRANAICPGYTLTPFHVTRAEQAGKSRDELAAFEPPCVLGRW
FT                   AEPKEMAYPLLWLASDEASYVTGATLMVDGGMPV"
FT   gene            complement(175536..176624)
FT                   /locus_tag="Pden_0193"
FT   CDS_pept        complement(175536..176624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0193"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: mlo:mlr5166 periplasmic mannitol-binding protein;
FT                   SmoM"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68309"
FT                   /db_xref="GOA:A1AYG5"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYG5"
FT                   /protein_id="ABL68309.1"
FT                   /translation="MRRRKFLGSVGIGAAATTLAAPAIAQSAPQITWRLQSAFPTSFAA
FT                   LYPAATTMAKYVEEMTEGRFRIQPFAAGEIVGPNQIADAVAQGTVEMGHTASQYYHGKD
FT                   PAFSLGTLLPFGFNTRMMDAWQMQGGGLDLLNTFYAKHGFFALPGGNVTAQMGGWYRKE
FT                   INSVSDLAGLKMRVGGLPGSIMAKMGVVPTAIPGGDVYVSLERGTIDAAEFTGPFDEER
FT                   MGLNKVAPYYYFPSWWEGQAAVHFFMNLQKWEELPAHYKAILRAAAAVAADEVVTRYDY
FT                   GNPAALVRLISSGAQLRNFNEEIIATALAASKEVYAELNETNPEWKTLYDSIVEYRDSA
FT                   YAYWQLTELSYDAMMARLRTQL"
FT   sig_peptide     complement(176547..176624)
FT                   /locus_tag="Pden_0193"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.836 at
FT                   residue 26"
FT   gene            176899..177723
FT                   /locus_tag="Pden_0194"
FT   CDS_pept        176899..177723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_C0656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68310"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYG6"
FT                   /protein_id="ABL68310.1"
FT                   /translation="MTMERDSAPLIRIDSCALASARRVAAMLDCDPGMVADGQPLPRGW
FT                   HFILLGGDTRRSELRGDGFPGLGVPMPDFGLPRLLLAGRSVRWDGDIAIGEPVERDSRI
FT                   EDITEKQGPAGRMALVRLRHALRPLSQAQAAVIETQTYALLPAGPSAPRPAAPAGAEAA
FT                   HRRRVTPDETLLFQYSALGFNSHKIHLDRDHARIVEGLPDLVVNGGLVALLATEFLRTD
FT                   LGVTPTALRARHLSPLYCNHPMTLCADPAPSGWRIRVLDDSGVLAAELEVEA"
FT   gene            177720..178925
FT                   /locus_tag="Pden_0195"
FT   CDS_pept        177720..178925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0195"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: rpa:RPA4557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68311"
FT                   /db_xref="GOA:A1AYG7"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYG7"
FT                   /protein_id="ABL68311.1"
FT                   /translation="MSFQPLKSIRVLDLTSVVVGPAATWRLGQYGADVVKVENPAGDLM
FT                   RGLGGQSPTGQHSGAYLHLNRGKRNICLDLKSDGARQVIARLIAQADVVVANMRPKALE
FT                   KLGIDPARIQARHPDKIYCLLTGFGTDGPYGGFPAYDSVVQAAAGIPGLSLARDGVPRY
FT                   VPLLICDHVVGEIAAGAILAAVIERQATGRGRMIEIPMFETMAAFVLQEHLAQHSFDPP
FT                   VGPPGDRRLLSPHNMPVQTADGHVAVTINTDAQVRAFLQVTDRAELADDPRFATVAARA
FT                   DNVAEWFEVRGAPLTQRTTAEWLSLFRAADLAAMPCHTLETLPSDPHLAAVGLIEHEDH
FT                   PTEGRTAVIRASLRVDGDSVPTRSPAAPRGWDTRDVLADAGFSASEIETLLSEGSAHEH
FT                   HR"
FT   gene            178909..179730
FT                   /locus_tag="Pden_0196"
FT   CDS_pept        178909..179730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0196"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   psp:PSPPH_1258 3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68312"
FT                   /db_xref="GOA:A1AYG8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYG8"
FT                   /protein_id="ABL68312.1"
FT                   /translation="MNITAETVPAALKGGPRYLDGKVCVIVGVASLRGIGYATAELFAR
FT                   HGAKLVVVDLMMDDTIAADVSQAIATRNGEAPELLGLRCDIGRAADCQGVIDQAVARFG
FT                   RIDCLVNTAAIVKSDGLLAISGDDLDLILNVNLKGAFNLCQNALRVFEEQGSGTIVNIA
FT                   SVAAQRGGGLVGGAHYAASKGGVISLTRSIAREFGPKGIRANAICPSMTETGMLDGNVT
FT                   EAQFAQIVDAIPLKRAGRPEDIANACLYLASDLSAYVTGTTLDVNGGSHIH"
FT   gene            179751..181280
FT                   /locus_tag="Pden_0197"
FT   CDS_pept        179751..181280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0197"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="KEGG: pen:PSEEN2793 3-hydroxyacyl-CoA dehydrogenase
FT                   PhaC; TIGRFAM: 3-hydroxyacyl-CoA dehydrogenase PaaC; PFAM:
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68313"
FT                   /db_xref="GOA:A1AYG9"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011967"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041040"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYG9"
FT                   /protein_id="ABL68313.1"
FT                   /translation="MSGLEKSATVAVIGAGAMGAGIAQVAATAGHPVLLFDVRPEAAEA
FT                   GRAGIVKMLDRQLAKGRLTADDRDAIAARLSVAKAPGDLAPARLVIEAIVEKLEVKRDL
FT                   FARLEGIVDDAAILATNTSSLSVTAIAAGLRHPGRVAGLHFFNPAPLMRLVEVIAGLAS
FT                   DPSVLDLLHDTALDWGKAPVRATSTPGFIVNRVARPYYAEALRLVEEGAAAPQTIDAIL
FT                   REAGGFRMGPFELMDLIGHDVNFAVTRSVFDAYFGDPRYRPSLIQQELVAAGWLGRKSG
FT                   RGFYDYAEGAARPEPATVAPTPAPARVVVEGDLGPAAALVPALREAGLQVDLAPGEGCI
FT                   RVGAARLAPGDGRMATARVAGGESADLVLFDLALDYATATRIALARADQTPEAALADAV
FT                   GLFQALGKQVSVVDDTPGLVVLRMLAMLANEASEAVLTRVATPADIDRAMTLGVNYPKG
FT                   PLAWADTVGPARILSVLDAIHAACGDSRYRASQLLRRQVATGARLSGDPVV"
FT   sig_peptide     179751..179828
FT                   /locus_tag="Pden_0197"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.750 at
FT                   residue 26"
FT   gene            complement(181335..182495)
FT                   /locus_tag="Pden_0198"
FT   CDS_pept        complement(181335..182495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0198"
FT                   /product="Butyryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.1"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   mag:amb2599 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68314"
FT                   /db_xref="GOA:A1AYH0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYH0"
FT                   /protein_id="ABL68314.1"
FT                   /translation="MSLDPETLAQFLETLDRFVRERLIPNEERVADGDAIPPELVQEIR
FT                   EMGLFGMSIPEEHGGIGLTMAEEVQAALVLGQASPVFRSLVGTNNGIGSQGIIIDGTPE
FT                   QKAHYLPQLASGEMIASFALTEPDAGSDAGSLRCSARLDGDHYVLNGTKRFITNAPHAG
FT                   LFTVFARTDPDSKSAAGVTAFLVEAGTPGLHLGPRDRKMGQKGSHTCDVILEDCRVPAS
FT                   AIIGGPDRLGQGFKTAMKVLDRGRLHISAVCVGAAERLIRDSLAYAMERRQFGEPIAEK
FT                   QLVQAMLADSRAEAYAARCMIEETARRKDAGLSVSTEAACCKMYASEMVGRVADRAVQI
FT                   HGGAGYMAEYAVERFYRDVRLFRIYEGTTQIQQLVIARNMIREASG"
FT   gene            182778..183845
FT                   /pseudo
FT                   /locus_tag="Pden_0199"
FT                   /note="similar to Alcohol dehydrogenase GroES domain
FT                   protein; premature stop"
FT   gene            complement(183912..185984)
FT                   /locus_tag="Pden_0201"
FT   CDS_pept        complement(183912..185984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0201"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD-binding; KEGG:
FT                   jan:Jann_0676 3-hydroxyacyl-CoA dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68315"
FT                   /db_xref="GOA:A1AYH1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYH1"
FT                   /protein_id="ABL68315.1"
FT                   /translation="MPVHYDLAGDSAVLTFDNPPLNVLGQAMRADLARAIAQAAADRPA
FT                   RLILRGAGRNFVAGADAREFDGPPLDPQLNEVLDALAALPFPTIAAIHGAALGGGLEIA
FT                   LACRFRIAHPSATLGLPEVTLGIVPGAGGTQRLPRLVGMAAALDLLGQGRSVTAAEAES
FT                   LGLIDLIADDPMAAARGVDTQTLLRALCADDRPPPAPDEAAVAAAHARADRRAPGQVAP
FT                   HRAIELVATSAQEPIKAALTRERATFLDLRGSDQARALRHVFFAERAAMAQGKAWPAPA
FT                   PEIARAVVVGGGNMGAAIAYALLSAGLVVRVVETDAAALDRARDNIAGLVAQGRKRGAL
FT                   TDAGAAELQARLSLAVGYDDLPAADLAIEAAYEDMAVKQAIFAALQDALPDSTILATNT
FT                   SYLDIDLLAQGIRQPGRFLGLHFFAPAHVMKLLEIVRGEATSDQTLGAAFRLARKLGKV
FT                   PVLAGVCDGFIGNRILARYRHAADILLLEGALPAQVDAAMRGFGMAMGPYEAQDMSGLD
FT                   IAYANRRRQNLRDRADHRYVPIADHLVERCRRLGRKSGAGWYDYDAEGRAQPSDEVTQA
FT                   ILSASRDAGITRVALPAEGIAERLVLAMIAEATRILAEGIAAAPRDIDLVLVHGYGFPR
FT                   WRGGLMHHADRLTPARILSRIEALAKDDPLSWSVPPLLRQLADEGRDFTSLNPSA"
FT   gene            186326..186856
FT                   /locus_tag="Pden_0202"
FT   CDS_pept        186326..186856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0202"
FT                   /product="flavin reductase domain protein, FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: bte:BTH_II2298 flavin reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68316"
FT                   /db_xref="GOA:A1AYH2"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYH2"
FT                   /protein_id="ABL68316.1"
FT                   /translation="MTAHSDVASPLRDTFRASMRPVAASVSVVASGDAAGAWHGMAVTS
FT                   AVSLSMEPPSMMVAVNRSASVHPVIQGAGWFSLNLMAECHADLLEAFSRSDLRDRRFLP
FT                   EHWSAGLQGLPVLKDALSTHLCRVTAAHDFGTHTVFFGQVEDVILPEPAARTLAPLVWF
FT                   NGARAALSATAET"
FT   gene            186916..188004
FT                   /locus_tag="Pden_0203"
FT   CDS_pept        186916..188004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0203"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: jan:Jann_2939
FT                   luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68317"
FT                   /db_xref="GOA:A1AYH3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYH3"
FT                   /protein_id="ABL68317.1"
FT                   /translation="MELGLFHMPLHPAERPLVDVLAENTEKIVYADKLGFAEAWVGEHY
FT                   SATTEPITSPLIFLASLLPQTKQIRLGTGVLCLPNHHPAQLAGQVALFDHMAQGRFMMG
FT                   VGPGGLASDMELFDVLDANVRNEKFVEAIKIIKQIWSQDPPYDIQGKYWQIKITDNIIP
FT                   ELGVGYMQKPFTKPHPPISLSSMSPDSESVSRAVKLGWKPISANFAPESTIIGHWKKYV
FT                   EGCEAAGREPTGQDWSVARNVLIADSDAQAEDWLLDPKGSNYYYFDYLWKVLKVADYTA
FT                   VIKPDINMADEDVTVEAIVKASVLYGSRKTVTDKIMSLRERSGPFGTLLMAAMDGSGKN
FT                   RERERLTMRRLAEDVLPVVNAA"
FT   gene            188036..188707
FT                   /locus_tag="Pden_0204"
FT   CDS_pept        188036..188707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0204"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="PFAM: 3,4-dihydroxy-2-butanone 4-phosphate synthase;
FT                   KEGG: mta:Moth_0917 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68318"
FT                   /db_xref="GOA:A1AYH4"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYH4"
FT                   /protein_id="ABL68318.1"
FT                   /translation="MNIETVIRASEPELHSQDQQPGDRVGMAIDIIAAGGMVIVVDDDS
FT                   RENEGDLIASAETITPQMVAFMVNHSTGILCASMSGARADALHLPPMVTRNDDPQGTAY
FT                   TVSCDAAACGTGVSAADRTLSFHALAAGATDPAALRRPGHIFPLRAREGGVLTREGHTE
FT                   AAFDLVRLAGHLPVGVLCELVNRDGTMMAGPQIDRFAERHGLLKVSVAELIAWRRQRGD
FT                   L"
FT   gene            complement(188774..189028)
FT                   /locus_tag="Pden_0205"
FT   CDS_pept        complement(188774..189028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68319"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYH5"
FT                   /protein_id="ABL68319.1"
FT                   /translation="MRPRQSRLHITLTGQADRSVGADVAQGGVQIEQFVGAPDQAFVRA
FT                   ARQSRLKAPTSKTSAPRSPGNWPTSEPASRHETWRTTVP"
FT   gene            complement(189154..189945)
FT                   /locus_tag="Pden_0206"
FT   CDS_pept        complement(189154..189945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0206"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: pau:PA14_10280 putative short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68320"
FT                   /db_xref="GOA:A1AYH6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYH6"
FT                   /protein_id="ABL68320.1"
FT                   /translation="MTQSQFSLEGKIALVTGGGRGIGAGIAQSLAQAGADVVIADYTTE
FT                   LAEGGAEGVAALGRRSAALQVDVRKPDSVTAMVEAVVKQFGRLDIAVNNAGVVSLGGIE
FT                   ELTLDQWNDVIDINLRGVFLCCQAQINVMRPQQFGRIINTSSIAGKVGFPQLSHYSASK
FT                   FGVIGMTNAIAKEVAKDGITVNALCPGIVGTGMWRGETGLSGKWALPGETEEQSWERHQ
FT                   QIFLPQGVAQTPEDMGQMAVYLACAPHVTGQALAVDGGFSL"
FT   gene            complement(190129..191124)
FT                   /locus_tag="Pden_0207"
FT   CDS_pept        complement(190129..191124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0207"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rso:RS05450
FT                   putative hydrolase signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68321"
FT                   /db_xref="GOA:A1AYH7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYH7"
FT                   /protein_id="ABL68321.1"
FT                   /translation="MTPILRGLSVLALALAPIGVGAEPATSVLKRDFAFPEPVEGMPAR
FT                   LSEFPDLQINAFTTNDGVSISYWEAGSGEPVLFVPAWGSNGAELIDVIWLLSRTHHVYV
FT                   MDPRNQGLSERTAKGQRIARHAMDLNQLLDHLELDRTVLAGWSMGAAVIWAYVDLFGTD
FT                   HITRAVFVDQPVSIYTHADWTEEERLNAGGMTTSPERMIAAFAGAPTNQQVVDMKVTHR
FT                   ARMLDTPHIRNATSFAQAVIPSDPDHAALVLFDHATNDWRDVISHKLDMPVAVFSGEES
FT                   NNLPSQAWIARTVPDGRLYSYTAEQQGDHMLMLKNPVGFVSDLRAFLAGE"
FT   sig_peptide     complement(191056..191124)
FT                   /locus_tag="Pden_0207"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.884 at
FT                   residue 23"
FT   gene            complement(191172..191351)
FT                   /locus_tag="Pden_0208"
FT   CDS_pept        complement(191172..191351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0208"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   rso:RS05436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68322"
FT                   /db_xref="GOA:A1AYH8"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYH8"
FT                   /protein_id="ABL68322.1"
FT                   /translation="MPVVRVSWFEGKAAEEKQKVAQDITDSIVRNTGTDASYIYVIFED
FT                   VKTSDWAGGGKLYG"
FT   gene            191454..192362
FT                   /locus_tag="Pden_0209"
FT   CDS_pept        191454..192362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0209"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: psb:Psyr_2945 regulatory protein,
FT                   LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68323"
FT                   /db_xref="GOA:A1AYH9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYH9"
FT                   /protein_id="ABL68323.1"
FT                   /translation="MMPASHLSGVHAFVETAHHLSFTGAAESLGMTKSAVGKSVSRLEA
FT                   RLGVKLIHRSTRRLVLTQDGEAYLAAARRALEEIEAAEASLSSNHREIAGRLRIDAPAA
FT                   WGRRVLLPILTEVALAQPGLRLSLSLTDRIIDPVAEQVDLVIRFGETADTADLISRKLA
FT                   EQRAPLVAAPAYLARCGVPAQPEDLLRHCCVTGISREMPIGFRIARPGCAPQRLRVAPA
FT                   HEIGDGSAVVEAAIAGLGIAQMPLSLVADALSDGRLVEVLPEFGTVPVGIFALWPRTRH
FT                   LLARVRHVVDLLAAKGQAGAL"
FT   gene            complement(192405..193013)
FT                   /locus_tag="Pden_0210"
FT   CDS_pept        complement(192405..193013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS05437 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68324"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYI0"
FT                   /protein_id="ABL68324.1"
FT                   /translation="MQFTLQGVFLTETTYQGRPAFQVTMPASATQDPAREALSDRDFMA
FT                   WVPMDFGDGTIEVDVASVLAPDAPDYARGFIGLAFRIGADNSFESIYLRPANARVDDQV
FT                   RRNHTVQYVAYPEYPFPRLRREEPEKYETHVDIGLAEWIRMRIELQGTTARLFINDAPH
FT                   PTLVVSDMKLGGAQRGGVGLWIEAGTIGYFSNLRITPVR"
FT   gene            complement(193178..193600)
FT                   /locus_tag="Pden_0211"
FT   CDS_pept        complement(193178..193600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0211"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: rsp:RSP_1790
FT                   probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68325"
FT                   /db_xref="GOA:A1AYI1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYI1"
FT                   /protein_id="ABL68325.1"
FT                   /translation="MLGIGKLSAATGVKVPTIRYYEQIGLLQAPARSVGNQRVYDGRAL
FT                   DRLRFIRHARELGFPLEAIRELLSLSDQPGMPCAAADIIAKRQLVSVQGRIARLRLLQD
FT                   ELERMVSQCAHGTVSDCKVIEVLGDHGLCLHGDHGA"
FT   gene            193651..195927
FT                   /locus_tag="Pden_0212"
FT   CDS_pept        193651..195927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0212"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: rsp:RSP_1791 heavy
FT                   metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68326"
FT                   /db_xref="GOA:A1AYI2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYI2"
FT                   /protein_id="ABL68326.1"
FT                   /translation="MMERPLPAVPAWETRMTDSTTERREWTVSGMDCAACTVKVTRAVE
FT                   RLPGVSDVKVALMGERLSLALADGATAAEEIEKIVRRLGYGIAPREREQPRQAALAPRR
FT                   PHDDGCGGTCGHDRKAASPSGAGHGTPAGGSTPWYRTAKGRLVILTGALLSLAWAFELL
FT                   APAEWGYRAFLLACLIGVAPVAKRAFEALRLGQPFTIESLMTIAATGALFIGAAEEAAL
FT                   VVFLFAVGEVLEGVAAGKARDGIRALANLVPRTAIVEIDGQARETPADSLQIGQVVLVR
FT                   PGDRVPADGEILDGTSGIDESPVTGESVPRTRGPGEPVFAGSINAEAALRVRVTREASD
FT                   NTIARIIRLVEEAEEARAPTERFIDRFSRWYMPAIVGLAALVVVVPPLAFGAEWGTWIY
FT                   RGLALLLIGCPCALVISVPASIASSLSAGARRGMLMKGGAVIEAAARVSHVAFDKTGTL
FT                   THGKPVVTDLIPAPGIGEAALLEVAGGVEAGSSHPLAQAILSRLAQEGVTPLPARAARV
FT                   LVGQGAEAVVGGAPAWVSLPRHAAQRDGIEADALREATRLEGEGKTVVAVFRDGQPLGL
FT                   IAMRDEPRGDAAEAMRQLRDLNVGAIMLTGDNPRTAAAIAGGLGMDYRAEMMPEDKLAA
FT                   IRETGLPGSVMMIGDGINDAPALKQAGIGVAMGSGTDVALETADAAILRDRVTDVPALI
FT                   RLARATMGNIRQNVTIALGLKAVFLVTSVLGITGLWIAILADTGATVLVTLNALRLLRF
FT                   RPEQA"
FT   gene            195927..196523
FT                   /locus_tag="Pden_0213"
FT   CDS_pept        195927..196523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0213"
FT                   /product="Putative protein-S-isoprenylcysteine
FT                   methyltransferase-like protein"
FT                   /note="KEGG: tfu:Tfu_1571 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68327"
FT                   /db_xref="GOA:A1AYI3"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYI3"
FT                   /protein_id="ABL68327.1"
FT                   /translation="MTWPAATAWLILIAYLALFFGASSEAQRASGQPVWLFGHARGRDR
FT                   LAALGFRLGFVLAVLGPVAAIAMPAPVALPIGVNVAGIAMASIGMAVAFGAQMAMGASW
FT                   RIGVRAGSEGPLVTTGLFRISRNPTFLGQGILLAGTLLASFSVFTLAGFGLFAAAASAQ
FT                   IRSEERLLRDRHGAAYERWARQVPRWIGRGGKSRS"
FT   sig_peptide     195927..196007
FT                   /locus_tag="Pden_0213"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.640 at
FT                   residue 27"
FT   gene            complement(196604..197680)
FT                   /locus_tag="Pden_0214"
FT   CDS_pept        complement(196604..197680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0214"
FT                   /product="arsenical-resistance protein"
FT                   /note="TIGRFAM: arsenical-resistance protein; PFAM: Bile
FT                   acid:sodium symporter; KEGG: sal:Sala_2405
FT                   arsenical-resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68328"
FT                   /db_xref="GOA:A1AYI4"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYI4"
FT                   /protein_id="ABL68328.1"
FT                   /translation="MTSPTPPSRLSFLDRWLTLWIFAAMALGIGLGTVFPGLPGALDAL
FT                   SVGTTNIPIAIGLILMMYPPLARVRYEELPRVFTDRRVLVLSLVQNWIIGPVLMFALAV
FT                   IFLRDHPEYMTGLILIGLARCIAMVLVWNQLARGNGQYVAALVAFNSVFQILFFSTYAW
FT                   FFLTVLPPLFGLEGSVIDVSFRTITEAVLVYLGIPFAAGFLTRRILVARKGEGWYETAF
FT                   LPRIGPITLAALLFTIVATFSLKGGDVVRLPVDAFRIAVPLALYFVIQFLVSFAMGRLI
FT                   EADYPRTTAIAFTAAGNNFELAIAVAIAAFGLASPVAFAAVIGPLVEVPALILLVHVAL
FT                   RLGQRWFPHDVTVQEVEA"
FT   sig_peptide     complement(197555..197680)
FT                   /locus_tag="Pden_0214"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.665) with cleavage site probability 0.478 at
FT                   residue 42"
FT   gene            complement(197709..198137)
FT                   /locus_tag="Pden_0215"
FT   CDS_pept        complement(197709..198137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0215"
FT                   /product="arsenate reductase"
FT                   /note="TIGRFAM: arsenate reductase; PFAM: arsenate
FT                   reductase and related; KEGG: rpa:RPA3554 arsenate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68329"
FT                   /db_xref="GOA:A1AYI5"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYI5"
FT                   /protein_id="ABL68329.1"
FT                   /translation="MDIILYHNPDCGTSRNTLGLIRNAGLEPHVIEYLKCPPSRELLVR
FT                   LIARMGLTARDLLRQKGTPYADLGLDDPALSEDQLLEAMMAHPILINRPIVVSPRGVRL
FT                   CRPSEAVLDLLPPQRGAFAKEDGEAVVGDDGQPVTPAS"
FT   gene            complement(198147..198683)
FT                   /locus_tag="Pden_0216"
FT   CDS_pept        complement(198147..198683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0216"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: nwi:Nwi_3124 low molecular weight
FT                   phosphotyrosine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68330"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYI6"
FT                   /protein_id="ABL68330.1"
FT                   /translation="MPDRSRRLFNVLFLCTGNSARSIIAESVLRQDGGGRFRAFSAGSR
FT                   PRGEVHPTARGVLENFHYPTEGLRSKSWDEFAGADAPVMDFVFTVCDQAAGETCPLWPR
FT                   QPISAHWGVPDPAAATGTGLEREMAFIDTLRIMRNRISVFTALPMATLNRASLTARLHQ
FT                   IGQSQGATSARTDMA"
FT   gene            complement(198676..199038)
FT                   /locus_tag="Pden_0217"
FT   CDS_pept        complement(198676..199038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0217"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein, ArsR; KEGG: nwi:Nwi_3123
FT                   transcriptional regulatory protein, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68331"
FT                   /db_xref="GOA:A1AYI7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYI7"
FT                   /protein_id="ABL68331.1"
FT                   /translation="MEEKRALAAFAALSQETRLRIVRLLVTAGSEGLPAGAIGEAMDGA
FT                   TSSRMSFHLGHLEHAGLVTSRREGRQIIYSVTYQALSDLIAFLMRDCCQGRAEICAPVV
FT                   AALSCSCEPDKDPAHA"
FT   gene            199089..199535
FT                   /locus_tag="Pden_0218"
FT   CDS_pept        199089..199535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0218"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: gvi:glr3360
FT                   LysR family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68332"
FT                   /db_xref="GOA:A1AYI8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYI8"
FT                   /protein_id="ABL68332.1"
FT                   /translation="MATRLGPCDHRHGGSREWSGWAVLIACLVRSRLPEYAATSGAGRR
FT                   WKRLRYFLAVTGELHFGRAATRLEIAPPPLSRQIAALEEDLGVQLFDRSRSLIRLTQAG
FT                   IVLQDHARQILNRLDVAFRETRLVDNGGAGRLRIAFVGSACCRR"
FT   gene            199766..200146
FT                   /locus_tag="Pden_0219"
FT   CDS_pept        199766..200146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0219"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ttj:TTHB244 phenol hydroxylase component B"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68333"
FT                   /db_xref="GOA:A1AYI9"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYI9"
FT                   /protein_id="ABL68333.1"
FT                   /translation="MPPLGVVVAPPCLDDDPAREDPRLAPLRGQRAGQQHGAWRHALGG
FT                   SPQPDLAGIFERRSGLPVVPGAAVIFLTDVVQEIDAGNHTLFIGEVTHLERQPEAEPLL
FT                   FCGGKFARLAGIALGPPIPAFG"
FT   gene            200561..201643
FT                   /locus_tag="Pden_0220"
FT   CDS_pept        200561..201643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0220"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: jan:Jann_2939
FT                   luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68334"
FT                   /db_xref="GOA:A1AYJ0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYJ0"
FT                   /protein_id="ABL68334.1"
FT                   /translation="MVKLGTFAMPLHPPHRPVGDIIKENQDKIILADQLGFDIAYMGEH
FT                   YSCTTEQIASPLIFFASLINQTKNIKFATGVIGLPQHHPVIVANEVAMFDHMAQGRFVF
FT                   GIGPGGLASDLEVFDHEDHAVRNEMVAEHLRIVLEIWKSDPPYDIQGKYWNVQIKNAIY
FT                   PELGIGSMSKPYQLPHPPIHISSMSPDSPTVALAARKGWVPITANFTPHETVYGHWKQY
FT                   VAGCEAVGREPTGEDWTVARNIIIGESDAQAEDWMMDPQGSSQYYYDYMWKVLVAADYT
FT                   TVAKPRPDMKDEDITVEQIIRSSVIWGSKETVAEKLNELREKSGPFGTLLMAMTDGSGP
FT                   NLEREQLSMQRLAEIRHLIR"
FT   gene            201702..202565
FT                   /locus_tag="Pden_0221"
FT   CDS_pept        201702..202565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_C0656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68335"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYJ1"
FT                   /protein_id="ABL68335.1"
FT                   /translation="MSNATPSAVDMADIFTLSQARRVAAMLDIDPQQLRQGDPVPRGWH
FT                   FAMLAGQSPRHALRPDGFPGLGIPMPRTDRPRLLLGERSMAFRGNLVVGAPLRRQSAIA
FT                   SIVEKTGRNGPLSIVRVEHVLSGDADAPDGAASITESQTYYLAGPPSSPGTATATRPGR
FT                   AAPDVPAAGASKVVTPDEVLLFQYSALGFNTHRIHFDRDYATRVEGHPDLVVNGGLATL
FT                   LATEYLRNDLGKSVSTLSARHLAPLYVNRPLTIRPSELSDTGASLSLIDCDGRVAAELV
FT                   VTFDEL"
FT   gene            202555..203775
FT                   /locus_tag="Pden_0222"
FT   CDS_pept        202555..203775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0222"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: pol:Bpro_5571 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68336"
FT                   /db_xref="GOA:A1AYJ2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYJ2"
FT                   /protein_id="ABL68336.1"
FT                   /translation="MSYEPLHGTRVLDLTAVVVGPAATWRLGQYGAQIIKVESPGGDLM
FT                   RGLGGLSPTGQHAGAYLHLNRGKRNICLDLKAPGASGVMERLVAWADVIVANMRPKALA
FT                   RLGLDPETVRAGHPGKIYCLLTGYGSDGPYGGFPTYDSVVQGAVGLPGLALERDGTPGY
FT                   VPLLICDHVVGEIAAGAILAALLNRHRTGKGVTLEVPMFETMATMVLQEHLAAQSFDPP
FT                   AGPYGDQRLLSPHNRPMRTKDGFIAVTINTDPQVRAFLAATGRGHLATDPRFASVAARA
FT                   VHVAEWFEIRGAPLTDRTTDEWLKIFRTADLAAMPVHSIESLSRDPHLTAVQLMTQEDH
FT                   PTEGRTTVLRSSIRADDAPLPPRGPAAPRGWDTRAVLDELGYTGAEAAALLDRGVAVAH
FT                   SSAPDRT"
FT   gene            203895..205325
FT                   /locus_tag="Pden_0223"
FT   CDS_pept        203895..205325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0223"
FT                   /product="Succinate-semialdehyde dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.2.1.16"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: bmb:BruAb2_0802
FT                   aldehyde dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68337"
FT                   /db_xref="GOA:A1AYJ3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYJ3"
FT                   /protein_id="ABL68337.1"
FT                   /translation="MHTQAGLIIGGESRATGSEGVLEITDPATDEVLASLPKAGLAEVA
FT                   EATEAALQSFADWSAVSPYDRSKVLRRAADLMRARTEEAARCLTLEQGKPLAQARIEWA
FT                   SSADLLDWFAEEGRRAYGRIIAGRVPNADLRVLRKPVGPVAALSPWNFPAWGVMQKIAP
FT                   ALAAGCSVVAKPSEATPVTTWHIAMCLLEAGLPPRAISVIWGSSSLISDALIKSPEIRK
FT                   VSLTGSTRVGRIVAALAGEHLKKVTMELGGHAPVIVAADADMSKLIPLAAQWKFRNAGQ
FT                   VCVSPTRFLVEDAVYDDFVDGLAQAAARVKVGNGLDESTAMGPLCTRNQRNVISAMVAD
FT                   ARARGARVVAGGDAIGNTGNFHAPTVVADAHAGLMAMNDEPFGPLALVARMGSIDEALA
FT                   EANRMPVGLASFAFTSNVHTAARITRTIRAGMLGINHFALGLPETPFGGILDSGFGSEG
FT                   GIEGLEAYTSPMLVSAMV"
FT   gene            complement(205387..207240)
FT                   /locus_tag="Pden_0224"
FT   CDS_pept        complement(205387..207240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0224"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; SMART: AAA ATPase;
FT                   KEGG: aeh:Mlg_2736 GAF modulated sigma54 specific
FT                   transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68338"
FT                   /db_xref="GOA:A1AYJ4"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYJ4"
FT                   /protein_id="ABL68338.1"
FT                   /translation="MWETELRGFADPLSSEISNILRSRGEADGRLPDVVEQSWKRCLTD
FT                   YNLLPDAVPKAAVLSHSEIQMLMEQREEFMRIAEPEVERLFRRLVDSEYLVSLASPQGA
FT                   MVLFRCDYQYLSELAESGVIPGSIWAEDQQGTNGVGTCLRVGKPVTIAGTEHYGSAIQR
FT                   LTCLTAPVLGRNGAIDSVINVTTARHADARMNRMVQNIVERSARRIENGYFARMNRRNL
FT                   MLRIVDGGVGVADIAEEGRLALDENGKVTSASSVTSRILGQDAGKLAGRSVEELFEMDQ
FT                   SIFDVRPGAPITLHYHGRSLQAALCLPESRQPTRNSLVPARPATPALGMVDLAEEALRI
FT                   NPILSQSLDRAQRLLSAGLPLAITGEPGSGKTAFAKAVARCCFGEDGQIVFIDCASLQS
FT                   RDDLAALLQHRISAQRTCLLVDRIDEMDGEHQTALLAVLENDRQAGANGIGVIVISAQD
FT                   LEHLARENLMRVDLVHRLKGGQIGLPPLRSAPDLEDTILDLFRIERDALGRPEVELDED
FT                   SRLVLLHYHWPGNLRELRNTLRHAVALADGKQIGLEHLPDNIVEEIARKDLTARSQSEA
FT                   SKIEAALRYNGGNVSLTARYLGVSRATLYRKIQIQKARGEA"
FT   gene            complement(207290..207832)
FT                   /locus_tag="Pden_0225"
FT   CDS_pept        complement(207290..207832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0225"
FT                   /product="flavin reductase domain protein, FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: rsp:RSP_3957 flavoprotein oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68339"
FT                   /db_xref="GOA:A1AYJ5"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYJ5"
FT                   /protein_id="ABL68339.1"
FT                   /translation="MPSFSFPCLDGDPEFRESLRTALRGTAVNVSILTARDRAGMNHGI
FT                   AVTTAVPFSTYRPAMIVAVKHSASAYPAILDSNYFCLNQIAADEIDLLDRFSRSDRRTS
FT                   RFATGCWSVGPFCLPYLGSALTSYFCDVQGAHDHEDQTVFIGRIVGVRLGNDGTGGRDP
FT                   LMWINGRAARLAGREYV"
FT   gene            complement(208050..208970)
FT                   /locus_tag="Pden_0226"
FT   CDS_pept        complement(208050..208970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0226"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: ppu:PP_3171
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68340"
FT                   /db_xref="GOA:A1AYJ6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYJ6"
FT                   /protein_id="ABL68340.1"
FT                   /translation="MIPLSVLDLMMIGEDKTFADTLADAAMLARHVEQHGYRRYWIAEH
FT                   HDLPGIASSATTLLVQHLAGVTSRLRLGSGGIMLPNHSPLVVAEQFATLETMFPGRIDL
FT                   GIGRAAGAAGLSVRALRGLAPERDFESDIAELADYLQDNGRQPVRGIPGRHHVPVWLQG
FT                   PSMFSAELAARLGLPYAFASHFAPHLLMNAIAYYRENFRPSEGLGQAPCDRGRQCLRRR
FT                   YRGRSRLPRQFAFPLGQHAAQGPPLPAAAPAGRLSGDAVRPGKTGLAAGDGLFRCRQQD
FT                   AGRTMAVQLYQRDGRGRADHRRPYP"
FT   gene            complement(209038..209307)
FT                   /locus_tag="Pden_0227"
FT   CDS_pept        complement(209038..209307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68341"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYJ7"
FT                   /protein_id="ABL68341.1"
FT                   /translation="MQVVLSGSALSPLGWGGVATMEPVDRGELENFAVVAALDRIGYTG
FT                   SLGILGWDYCGDVYSKLDRCLAAMRALDRRLQANPGWAEIVPRP"
FT   gene            complement(209307..209846)
FT                   /locus_tag="Pden_0228"
FT   CDS_pept        complement(209307..209846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0228"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sus:Acid_5864 xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68342"
FT                   /db_xref="GOA:A1AYJ8"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYJ8"
FT                   /protein_id="ABL68342.1"
FT                   /translation="MSHPVHALDSFFYTSMGVYAFESQCEMLAELGYDGITVSAWGGQP
FT                   MTDLSLLPTVKERHGLDVAALYAVLHEGRNDAIIRRIIESVEGVELIELAVQTSLNGEA
FT                   AILRNIEALLPIAERRGLRIALYPHLRHVTQTTSEVVRLCEYFDHPLLGASFNGYHWYA
FT                   SRRAGWRNASPRSSPG"
FT   gene            complement(209861..210658)
FT                   /locus_tag="Pden_0229"
FT   CDS_pept        complement(209861..210658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0229"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sus:Acid_5864 xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68343"
FT                   /db_xref="GOA:A1AYJ9"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYJ9"
FT                   /protein_id="ABL68343.1"
FT                   /translation="MNLPLHHMDFIFQTKLGTYPLAAQCEMLAELGYQGLTVSAWSKEL
FT                   DALASVKPRWGLDVGAIYLIYGRGLEDFVTRIFETAEGCTRIELALDSGDGVTDADLRM
FT                   IERLLPICERRGIDIALYPHGRYGMQTTTEAVALCQRFDHPALGIVFNGYHWYAMQEGS
FT                   LDARLDALWPWLRQVNLAGCRMSPLGWGGLATIEPLDEGEMDNFVLLGALERRGFKGRC
FT                   GVLGWESMGGDVYGNLQRSMTAFRSMEARLAAHPGWAVMTQLT"
FT   gene            complement(210655..211734)
FT                   /locus_tag="Pden_0230"
FT   CDS_pept        complement(210655..211734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0230"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: psb:Psyr_1559
FT                   luciferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68344"
FT                   /db_xref="GOA:A1AYK0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR020020"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYK0"
FT                   /protein_id="ABL68344.1"
FT                   /translation="MTTGKGMRDRCAAYPESGIDMTTTATLGALAPELATHRGYSRVFQ
FT                   PGRLTFGFIAPLESYPDSVGPTLVGHATMAQKVDEAGFSAIWLRDVPFHDPNFGDVGQV
FT                   LDPLVYAGYLAAVTRKIAIGTAGIVLPLRDPLIVAKQAATIDQLLGGRFLLGLATGDRA
FT                   VEYPAFGIDYDNRADRFRDALAMIRATTEQAWPVHASHFYGMLDGGLDLVPKPAAPRLP
FT                   TIIIGHAGQSLDWTAQNTDGILSYIASPARIPDIIRQWRAASPANVFKPYGYGTLFDLD
FT                   RDPDMPIQPGRVLRGGRNALRELWLRQQDIGVSHVGLHFKPQRRPASEVIDELGTHLLP
FT                   LFPSHEPEVNKATAAGGRA"
FT   gene            211824..212726
FT                   /locus_tag="Pden_0231"
FT   CDS_pept        211824..212726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0231"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_1980 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68345"
FT                   /db_xref="GOA:A1AYK1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYK1"
FT                   /protein_id="ABL68345.1"
FT                   /translation="MNSFGTLAAFVHSAETRSFTEAGRRLGISSSAVGKTVARLEEELG
FT                   VRLFHRSTRAITLTAEGCRFLDRCYRIFAEFDDAKRELTQAAGKPQGKLRVGLPQIGIH
FT                   LMPHLIAFQRTFPEIELELDFSDRLVNLVEEGFDAVMRIGELNDSRLTMRRLDGYHHRL
FT                   VAAPAYLAHRGTPDRPAELMDHACLRYRYPTTGKLAPWPLNGRGGAPSIDPPQSSVTNS
FT                   IDSLLEMVQAGLGIALLPDFIVADAVAAGRLTVVLDRHGQDRRDFCILWPSSRHTAPKI
FT                   KAFVDFMVSRLGAAGALQR"
FT   gene            complement(212737..213429)
FT                   /locus_tag="Pden_0232"
FT   CDS_pept        complement(212737..213429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0232"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: pae:PA3678
FT                   probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68346"
FT                   /db_xref="GOA:A1AYK2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYK2"
FT                   /protein_id="ABL68346.1"
FT                   /translation="MQALLFSEPTGKVNRNGMAAKQESPAGRGRGKPRDAGLRERILKA
FT                   AEAEFLDEGLEGARMERIAMRAGTSKMALYQHFASKMVLFHQVRNNLLIDHLPHVDQFP
FT                   LDAEPRQVLAQIAKRYLKAITAAATIQQLHLLCQPRARDVRAATAFFDTGPQAAVRQVD
FT                   ALLQRYCDQGVFAIPAPRMAAEQFLAMVRGNEHMRALLDLPPGRDEQALDIYLASCVDL
FT                   FMRAFRAE"
FT   gene            213456..215417
FT                   /locus_tag="Pden_0233"
FT   CDS_pept        213456..215417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0233"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: gme:Gmet_2060 fusaric acid resistance protein
FT                   conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68347"
FT                   /db_xref="GOA:A1AYK3"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYK3"
FT                   /protein_id="ABL68347.1"
FT                   /translation="MARWTAFRNGPMTKLNGALRDPHIRATALRLTLAAMIAMVVATGL
FT                   GLQNPWWAAMATWMIGQPPRGLLLERSVAQFAGTLLGAAAGVAITLAGNPSLQLAWLAL
FT                   WLALCCGLTNAMRHQRAYGAALAGLTASVVVTLTTGTEIAPVSFAGARIADTLIGIGAA
FT                   LAVGFMLQPRARAQTLSARSATVLADGLRLVGMALQQHQTDLVARESAFLSTLAAISAG
FT                   AEDAAAGSLRARRGLRPLNTIFASLLDLIVVARMIRKASESRSITRQADLAALRAELER
FT                   AADALQETGKLDPLPALGMAERIAADHAELKAILGSFAAELREIAQSHQALAHPGRTVC
FT                   AARLHPQPDLTGLRRAMARGFLAIAASALVWTVTGWEAGRFLVLGASIFTVLFATLDQP
FT                   LPLVRQGLIGGAVAALAAVAWRLDVVPFAEVPWFSLLLALPLFCAASLLQASRATIFAG
FT                   LTFNMFFAVLARPVDMLPSSSQVVVASAAMLILGVAISDFFYRWVLPMDVDRRRRHIEA
FT                   SIRREIVSVSLRAGTPWAERHLSRLRHLVLEMVMRARADTEVVGNAVAALSLGHIAMRL
FT                   GQIAHQETPAADGGAITKDCLRRLANPISDPAACGREILKANQAVPAETATSAVRLAHL
FT                   MARELVDHPKVFTSSTAT"
FT   gene            215564..215908
FT                   /locus_tag="Pden_0234"
FT   CDS_pept        215564..215908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcb:XC_0382 b-ketoadipate enol-lactone
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68348"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYK4"
FT                   /protein_id="ABL68348.1"
FT                   /translation="MRRLRTDDPAGVETTLASFAATSVDGHAGCCAALAEADLRDQLHR
FT                   IAHPLLAVSGDDDPVCPPAELAAIADGVQHGRHLSLPGRHIVSPESALQFNAALEEFLK
FT                   AGPARGGGTR"
FT   gene            complement(215905..216918)
FT                   /locus_tag="Pden_0235"
FT   CDS_pept        complement(215905..216918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0235"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: rfr:Rfer_0981 oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein-like; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter, C-terminal domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68349"
FT                   /db_xref="GOA:A1AYK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYK5"
FT                   /protein_id="ABL68349.1"
FT                   /translation="MTADILRVEGLGKTFEGGGGLLGGKRAAVRAVDGIDLTMKAGETL
FT                   AVVGESGCGKSTLGRLLLRLIEPSEGRVWLDGTEITALSRRQMRQFRRNAQMVFQDPYG
FT                   SLSPRRTIAQIIAEPMDVFGTVTGKRDRREKVAELLRQVGLPTSVMDRNPRQFSGGQRQ
FT                   RICIARAISVSPRFIVADEPVSALDVSIQAQIINLMQDLQAEKGFASLFIAHDLAVVRH
FT                   IADRVAVMYLGRIVEIGPKEQIYEAPQHPYTQALLSAAPEIGRVKRRKRLILGGDVPSP
FT                   TNIPPGCSFHTRCPIAQERCRRERPALAAVAGEQRAACHFARPFPITIKATETLSS"
FT   gene            complement(216915..217913)
FT                   /locus_tag="Pden_0236"
FT   CDS_pept        complement(216915..217913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0236"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: rme:Rmet_5091 oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein-like protein; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter, C-terminal domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68350"
FT                   /db_xref="GOA:A1AYK6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYK6"
FT                   /protein_id="ABL68350.1"
FT                   /translation="MAEPLLEISDLTLEFGPISNPVRVLNHVSLSVAAGEAVGLVGESG
FT                   SGKSMTSLATMRLLPASARLTSGRIRLEGHGDLLALPSDRMPEIRGRDIAMIFQEPMSS
FT                   LNPVMTVEAQIAEAIMLHQQMSREDRRARVIELLRLVGIPDPQARMKAYPHQMSGGMRQ
FT                   RVMIAIAVACNPRLLIADEPTTALDVTIQAQVLDLLREVRQRLGTAVLMISHDLGVISE
FT                   LCDRIVVMYAGHVVETATVDDLFDNPQHPYTRGLLRAVPSLETSARRLYQIPGSVPPPG
FT                   TIKAGCPFAPRCELKRDICTREMPALTPRGRDQRAACWVTADTPMTAEAIA"
FT   gene            complement(217913..218785)
FT                   /locus_tag="Pden_0237"
FT   CDS_pept        complement(217913..218785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0237"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: psp:PSPPH_2784 dipeptide
FT                   transport system permease protein DppC AGR_L_321"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68351"
FT                   /db_xref="GOA:A1AYK7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYK7"
FT                   /protein_id="ABL68351.1"
FT                   /translation="MANSEAIPLPEAPRLRRLAGEVVAGRPAVIISLATVLVFAVIAIL
FT                   APWIAPRDPMAQSFIAINAMPSSDYLLGTDQFGRDLLSRLIYGSRNSLIFGLLSPVFAA
FT                   IAGTFLGVTAGYFGGWIDRVVTRIIDMLLAFPELLLAILVAAALGGGFWNVVAVLTIAF
FT                   TPGFARVARASTLAVKQEPYIEAAIASGVSTPVIIFRHVVPNISAPIVVLMTLWSASAI
FT                   RLEATLSFLGIGTQPPAPSWGNIIREGLGNMFATPWPILTGGLAITIVVLAISTIGDAV
FT                   RDALDPEIK"
FT   gene            complement(218785..219720)
FT                   /locus_tag="Pden_0238"
FT   CDS_pept        complement(218785..219720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0238"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ppu:PP_4455 opine ABC
FT                   transporter, periplasmic binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68352"
FT                   /db_xref="GOA:A1AYK8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYK8"
FT                   /protein_id="ABL68352.1"
FT                   /translation="MTRYILTRLLDAVPTMLLVLTLVFLAMRVLPGDPALAALGDGAQP
FT                   EAIAQFRERFGLNDPLWLQYLHFMRDMLTFDFGASLMSGERVAQLLVSNLGYTVELTIA
FT                   AVLLGIMGGIPLGVMAALNRNRAPDAGFRVFSLLGYAIPDFYLGAVLLIVFSLSLGWFP
FT                   ISGAGDGFADRMHHLVLPALTLALLKVAFLGRLTRTALLEVLGRDFVRTARAKGARENR
FT                   VIYRHALRNALLPLSTGLGLSILSTLSGSVAVELVFNRPGLGKLLITAITERDYPIVQA
FT                   GVVVFAAAVVVVNLLMELVYVIIDPRIRVQ"
FT   gene            complement(219738..221327)
FT                   /locus_tag="Pden_0239"
FT   CDS_pept        complement(219738..221327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0239"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: pol:Bpro_4344 extracellular solute-binding
FT                   protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68353"
FT                   /db_xref="GOA:A1AYK9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYK9"
FT                   /protein_id="ABL68353.1"
FT                   /translation="MLINRRRILHMSVAAAAASLAGPGLLRAQGSDRPIRIALAATSPR
FT                   AIDPIFSTLGADNWVNLQVYEHLVSPPNGRFATQDDEYRPMLAESWTKSDDARTWTFKL
FT                   RRDVAFHGGHGTLTPEDVVFTFERAMREGIATASYANVRGVAASGPDEVTFTLNGPDPF
FT                   FLGGVISIPSSLIVCKSAVEEKGENFGKEPVGTGPYAVERMSSSGVNTLRFDGYWGEPP
FT                   KTARIDFLYTSDTTSRTLSLMSGDVDMIEAVRAPGWVQQIRQQNDALIVDQTQPGSFNT
FT                   LFFNLTKAPFDNPLVRKAVATAIDSAVVAQALAPFGAQTWTLSPPDYPSGWAAEDLPED
FT                   LRYDYDPDRARELLAEAGHGNGLNFTASISQREDYRSIMLILQELMRPAGINMNLNIMD
FT                   HAAFHGANRQDANSLVLYSQSLPPVPLEYMSRYLSSAAVVKSDGTGGDNFSHYGIAMPG
FT                   VDDRIEAMRQATTVEEYSSIGREIEKKVQEDLPLMGVGNLGYAIVRNPAVDIGYQVESG
FT                   YARWRLDLAQRA"
FT   sig_peptide     complement(221241..221327)
FT                   /locus_tag="Pden_0239"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.964 at
FT                   residue 29"
FT   gene            complement(221408..222094)
FT                   /locus_tag="Pden_0240"
FT   CDS_pept        complement(221408..222094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0240"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: mes:Meso_4461 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68354"
FT                   /db_xref="GOA:A1AYL0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYL0"
FT                   /protein_id="ABL68354.1"
FT                   /translation="MTSRTKDQPRPKGRSIQRPGRLGDEVYEALYAQLMALEIPPGARI
FT                   SVDNLVRELGVSQTPIREALSRLEAQGLVVKTHLIGYSAASQIDEQRLEQLYDLRLLLE
FT                   PYAAGRAAVHMDDDDIARLVALDARMDEIHPDGKESYGEFAAADGQFHDLIAQGSGNEL
FT                   VRDALSRLYTHVHLFRLFYLASVTAEANDEHAAIVAAIVARDSAAAEEAMRRHVLESRK
FT                   RFTGRR"
FT   gene            222145..223182
FT                   /locus_tag="Pden_0241"
FT   CDS_pept        222145..223182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0241"
FT                   /product="(R)-2-hydroxyacid dehydrogenase"
FT                   /EC_number="1.1.1.272"
FT                   /note="PFAM: Malate/L-lactate dehydrogenase; KEGG:
FT                   mes:Meso_4453 malate/L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68355"
FT                   /db_xref="GOA:A1AYL1"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYL1"
FT                   /protein_id="ABL68355.1"
FT                   /translation="MASQSNIRSDRKHGMKIDVKQLERTAMAALSKLTTRDHAAQQVDL
FT                   LLEADLRGVASHGMLRLPRIIRRIRNGVADPAQTGRHAWHGSALLQVDGCHGLGPVVAN
FT                   AAIAALESRISETGVAVAAIRNSNHLGMLGYYAERAASKGLTMIALTTSEALVHPWGGR
FT                   RAMIGTNPIAIGLPTGRKGQADIFMMDAATSLVSMGEIHDHANRGMAIPEDWALDAEGR
FT                   PTTDPDAAKSGAIAPFGKAKGYALGLAFELLVTSLSRAAIGRDVTGTLDDTTTCNKGDL
FT                   FILIDGPGYDLRPYLQALRDEVPAQGFTQVTIPGERGRAARDQRLREGVDLPEQLWREI
FT                   GDLAR"
FT   gene            223208..224464
FT                   /locus_tag="Pden_0242"
FT   CDS_pept        223208..224464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0242"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   rpc:RPC_0105 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68356"
FT                   /db_xref="GOA:A1AYL2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYL2"
FT                   /protein_id="ABL68356.1"
FT                   /translation="MDFTNLGVMRAPRHLVFGAGQRGALARHAGVFGTRALIVTDTRMA
FT                   RDKDFLQMRQALEAQGIATQVFDGVAAELPLSCIEAGAKAGRAAGARMIIGIGGGSCLD
FT                   AAKIIGLLLSHGGAPQDYYGEYKVPGPIMPLILLPTTSGTGSEVTPVAVLDDPQRAMKI
FT                   GIASPHLIPEIAICDPELTLSCPPGLTAASGADAMTHAIEAFTTLRRPADSGLSLDHVF
FT                   IGKNAISDSLALEAIRLIAANLARCVSHGDDLEARSAMMLGSTLAGLAFGVAGTAAAHA
FT                   IQYPVGAMTHTAHGLGVATLMPYVMAWNRPSCETDFARIGAAMGLAASGDTSRQAEAAI
FT                   AAIAALFAQVGIPATIAQLGVPEDRLDEIARLALSAERLIKNNPRMLDAEGMDRIVRAA
FT                   HSGDLDLLTATSPRKAALQ"
FT   gene            224461..225939
FT                   /locus_tag="Pden_0243"
FT   CDS_pept        224461..225939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0243"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mes:Meso_4451
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68357"
FT                   /db_xref="GOA:A1AYL3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYL3"
FT                   /protein_id="ABL68357.1"
FT                   /translation="MSYHDTISQELGFDPQALRGDLWIDGGWRKGRGGDPIAVIDPSTG
FT                   NTITRIENASIDDAMDAVAAAEAALPGWAATPPRVKSEILRRCYDLMIQRKDMLARLIS
FT                   LENGKALPDAQGEVLYAAEFFRWFAEEAVRLNGEIYTAPSGANRIIVTHRPIGVAVMVT
FT                   PWNFPAAMATRKIAPALAAGCTCVLKPATETPLTAYALAEIYAEAGVPPGVVNVLTTSR
FT                   SGATVSAMLHDPRVRKLSFTGSTEVGRRLLHEAADTVISCSMELGGNAPFIVFDDADLD
FT                   LAIEGAMVAKMRNGGEACTAANRFLVQKGIAPAFAERLAARMEAMTLGAGYAGETLCGP
FT                   LINREALDRIAGLVSEAESHGAKTLTGGRPLDRPGFYFPPTVLTDVPPQAEITGEEIFG
FT                   PVAALATFETEDEAIARANSTEYGLISYVFTSDLARGLRVSERLDSGMVGLNRGVVSDP
FT                   AAPFGGTKQSGLGREGAHHGILEFCEVQYIAANW"
FT   gene            225977..227128
FT                   /locus_tag="Pden_0244"
FT   CDS_pept        225977..227128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0244"
FT                   /product="Mandelate racemase/muconate lactonizing enzyme,
FT                   C-terminal domain protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   enzyme, N-terminal domain protein; Mandelate
FT                   racemase/muconate lactonizing enzyme, C-terminal domain
FT                   protein; KEGG: pat:Patl_0897 mandelate racemase/muconate
FT                   lactonizing enzyme-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68358"
FT                   /db_xref="GOA:A1AYL4"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="PDB:3N4E"
FT                   /db_xref="PDB:4DWD"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYL4"
FT                   /protein_id="ABL68358.1"
FT                   /translation="MKIAKVEALSVAMGDGTGWMPTSAFVRITAEDGTVGWGEASPMLG
FT                   GIASLGVVARDIAPFLEGQEVLDHAVLLDRMMHRLVKLGPEGIATAALAACDIALWDLK
FT                   GKLLGQPIYKLLGGAWRTRLPCYSSIGGNAARSVDEVVREVARRVEAEQPAAVKIRWDG
FT                   DRTRCDVDIPGDIAKARAVRELLGPDAVIGFDANNGYSVGGAIRVGRALEDLGYSWFEE
FT                   PVQHYHVGAMGEVAQRLDITVSAGEQTYTLQALKDLILSGVRMVQPDIVKMGGITGMMQ
FT                   CAALAHAHGVEFVPHQTQPGVGHFANIHVLSTLMHMTKPVELADRWDRGRPVFRNPAEP
FT                   VDGHFALGDAPGLGIVVDEDELASRATEITVGRDQRPPAGGQY"
FT   gene            227187..228044
FT                   /locus_tag="Pden_0245"
FT   CDS_pept        227187..228044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0245"
FT                   /product="5-carboxymethyl-2-hydroxymuconate
FT                   delta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   reu:Reut_A0050 5-carboxymethyl-2-hydroxymuconate
FT                   delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68359"
FT                   /db_xref="GOA:A1AYL5"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYL5"
FT                   /protein_id="ABL68359.1"
FT                   /translation="MRLFRHGRPGRERPGLFDISGKMRDLSPVIPDFDAGTLSPQGLAR
FT                   LAGLDARGLPLLPEGTRFGACTARPGKIICVGLNYASTMIELGVPRPEAPSITIKPSSA
FT                   LAGPDDDIALPRGSTATDWEVELAAVIGTYARHVSPRRALDNVAGYCLANDLSERDHQR
FT                   HHGGESVKGRGHDGFARLGPWLVTADEIPDPQGIDLWLRIDGRRIQQGSTSDMLWSVAE
FT                   LIAHVSDYMALEPGDVIQTGTPAGIGIAQKPPRYLREGNQVSLGGSGLGMQRCRVVRQV
FT                   MPGK"
FT   gene            228259..229149
FT                   /locus_tag="Pden_0246"
FT   CDS_pept        228259..229149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0246"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: msu:MS0202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68360"
FT                   /db_xref="GOA:A1AYL6"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYL6"
FT                   /protein_id="ABL68360.1"
FT                   /translation="MMVRRAASVPGLSHVDLNYPDHVLEEPKVVQAEVNDLGLQVNGLA
FT                   MRYYTNPALKLGAFTNPDRAVRQEAIDLTKRGIDAALEMGAPLMTLWLGQDGFDYSFQG
FT                   DYPRMWEDEIGGIREVAEHAPDCMISIEYKPNEPRSYALLPDVATTLLAIAETGCGNIG
FT                   VTLDFAHVLYADEMPAYAATLIARKSRLLGVHLNDGYAKRDDGLMVGSVHPQATLELLW
FT                   QITRDGYDGVIYFDTFPDASGIDPVEECRTNIETVERFMNMVPRLNADNLLHDAIAGQN
FT                   SPLSQRAVARIMSGA"
FT   gene            229193..230239
FT                   /locus_tag="Pden_0247"
FT   CDS_pept        229193..230239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0247"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: msu:MS0201 RbsB protein;
FT                   TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68361"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYL7"
FT                   /protein_id="ABL68361.1"
FT                   /translation="MTTIKSFLLASALTAFGGIVMAQDLAPLNSDEEPDRMDWSELTER
FT                   FGDLPKPTEGTQIGGVSKALTNEYWRSLGEGYKNMTDAQGVGLAYQAAPSEGDQLGQLS
FT                   IAENMILQGYQGLLVSPQTDNNLQPAMETAASRGIAVVNVNDAVIPSATQYVGNVQRDN
FT                   GVRVAQWFIDNRPGGGKVAAIEGQPGVFAAGQRTDGFTTTITEAGNFQVVASVPANWSR
FT                   EQAYDAASTILQQHPDLIGFYANNDGMALGVVEAVKAANLQEQVSVFGTDGIPDAYASI
FT                   RAGDLTGTVDSFPVLTGEVAMEVVLRLLAGQGIPRVVATPQALITADNVADYSVEDSTA
FT                   LREKLLAE"
FT   sig_peptide     229193..229261
FT                   /locus_tag="Pden_0247"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            230457..231896
FT                   /locus_tag="Pden_0248"
FT   CDS_pept        230457..231896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0248"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: msu:MS0200 MglA protein; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68362"
FT                   /db_xref="GOA:A1AYL8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYL8"
FT                   /protein_id="ABL68362.1"
FT                   /translation="MHGLLGENGAGKSTLLNILSAVLSASEGQIIIDGEPVSLAQPADA
FT                   RAAGIAMIHQELQHIPALSVAQNMFLGRPLTQAGGLLVDRGSQEQRARQVLADLDPSID
FT                   PRAPIHTLKVAQQQIVEIARALFDDARIITMDEPTSSLTPSEFESLAALIARLAARGVS
FT                   IIYVSHKMDEVFRVCQRATILRDGRYIDTVDLSEVSEDQVISRMVGRDIMQEGHVSHAR
FT                   PEVVMRVEGLDDGRLIREASFELHRGEVLGIAGLVGSGRTELLRLIAGIDRVRQGRVVL
FT                   NGNPVDLRSPRHAIRSGIGLVPEERKKDGIVRDRSVASNIALPCMGRFTRHGLVRRKAL
FT                   RAEATPLMKKMGMRPPDVTRAIGTFSGGNQQKAIIGRWLAADVDILLFDEPTRGIDIGA
FT                   KAEIYALIEALAKSGKSIVVVSSELPEIIRLSDRVMVMREGRIAATLAGAEIAEDAIAA
FT                   NAIPKSRRPDKIPAQPIEALS"
FT   gene            231893..232855
FT                   /locus_tag="Pden_0249"
FT   CDS_pept        231893..232855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0249"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="PFAM: inner-membrane translocator; KEGG: msu:MS0199
FT                   ribose/xylose/arabinose/galactoside ABC-type transport
FT                   systems, permease components; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68363"
FT                   /db_xref="GOA:A1AYL9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYL9"
FT                   /protein_id="ABL68363.1"
FT                   /translation="MNKTLTASPSRRLPINLRDAGTLFGLVLIFAVFAALNPVFLTGPN
FT                   LINILQQSAINACIALGMTFVIISGGIDLSVGPTAAVSVIVGATLMIAGVPIPLAVVAA
FT                   IATGMACGLFNGTLVAIAGLQPFIVTLGALSLYRALALIFTGGNPIFGIPTEFRQAINS
FT                   LVLGVPVPVIIVAVIAAVLWVVLNRSPLGEYILAVGGNQEAARIAGVPVARTRITVYVL
FT                   SGGLAAVAGLILTGRLGAADPTMGNLWELDAIAAAAIGGASLMGGKGSVIGTLMGAVIL
FT                   GGLRNGLTLMNVQAFYQLLATGIIILVAMLIDRATRGKA"
FT   sig_peptide     231893..231997
FT                   /locus_tag="Pden_0249"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.997 at
FT                   residue 35"
FT   gene            232852..233715
FT                   /locus_tag="Pden_0250"
FT   CDS_pept        232852..233715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0250"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: msu:MS0198 RpiR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68364"
FT                   /db_xref="GOA:A1AYM0"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYM0"
FT                   /protein_id="ABL68364.1"
FT                   /translation="MMGHYDPRTVGAQIRMKLPFLTPLEARVVDTITGRNDLDLTTALR
FT                   QVSEDAGVSDAMVVKIAKKLGFNGFRDFREALVVYRQTDVASLHSEISPEDSSADIIRK
FT                   VFQTSIQALEETMSIIDVSAFDRAATLLHGARQRDFYGVGGSAQIARDVAHKFLRIGLR
FT                   AGVQDDPHMMLMSAALLGPEDVVVAFSHSGTTSNVIEAARLARQQGARVIAITNYATAP
FT                   LSELADIALCSTAQGSPLLGENAAARIAQLNIMDAIFVAVAQRDLERAEAQLARTRNAV
FT                   DNKRRR"
FT   gene            233732..234574
FT                   /locus_tag="Pden_0251"
FT   CDS_pept        233732..234574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0251"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: msu:MS0197 RbsK
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68365"
FT                   /db_xref="GOA:A1AYM1"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYM1"
FT                   /protein_id="ABL68365.1"
FT                   /translation="MARTSCAVVVGSLHYDIVVSAPHRPAAGETVTGTAWHPVFGGKGG
FT                   NQAVAVVRAGVACRIVSAVGDDDFGLFLRGHLEASGVDAAHVATLPGTGSGMSVAIMDA
FT                   GGDYGAVIVSGANLAIDPAVLDRDALWDGASHLVLQNEIPEALNIAAARAARARGLRVV
FT                   LNAAPARDLSADLAATIDILVVNAGEAEALSGIVVESLEDARHAASALADRFRIVVVTA
FT                   GTEGAHSEPGRRVKLVSTHGAGDCFIGTLVAELAHGGDLRYSVRQANLAAAKHVSRAE"
FT   gene            complement(234598..234849)
FT                   /locus_tag="Pden_0252"
FT   CDS_pept        complement(234598..234849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0252"
FT                   /product="transposase (class I)"
FT                   /note="KEGG: gox:GOX2677 transposase (class I)"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68366"
FT                   /db_xref="GOA:A1AYM2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYM2"
FT                   /protein_id="ABL68366.1"
FT                   /translation="MVRLLPKTATVKRFHYERPDQLRTHLTDFIAAYNLARRLKTFSGL
FT                   TPYEYICKIWISEPDRFIVNPIHQMPGLNTLCVSGVLH"
FT   gene            complement(234955..235479)
FT                   /locus_tag="Pden_0253"
FT   CDS_pept        complement(234955..235479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68367"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYM3"
FT                   /protein_id="ABL68367.1"
FT                   /translation="MASLVLAPISRTRSSLPHSEDGRQVPPAPVWCRQAQTSRTEMPSS
FT                   AINGPPVTKLERSDKRNRAPYAISADLSIRFIRCRQVVKSSSRQPLGRIHELAVRAEQV
FT                   DEGQLPRRKDGAGGHAELAMTGRTFETPTGRQVVDISHPQADRPARHLSLATAVGRTGD
FT                   RRPPRHRRKSP"
FT   gene            235511..235789
FT                   /locus_tag="Pden_0254"
FT   CDS_pept        235511..235789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68368"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYM4"
FT                   /protein_id="ABL68368.1"
FT                   /translation="MGYIMQQAMGRGTRLIASIVGCAPPQPNSTILSASYAQAPVTAGA
FT                   LFFCGQHLVNIRGLPETRRCRRARMVSDEGIWEAITVMTSRAKKSGA"
FT   gene            236307..236864
FT                   /locus_tag="Pden_0255"
FT   CDS_pept        236307..236864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68369"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYM5"
FT                   /protein_id="ABL68369.1"
FT                   /translation="MMDMIARLRAERQDLVARLGEIDKILTQYKQIERAAQQLLGDHPP
FT                   VDSRAMTAGPVEPVAPHTPATVPDRAVSAKNKTPIEEFEQAVIDVLQETAAPLNRVQLY
FT                   DALTDRGIVIGDGDREKELNALSARVYRMTQTGRLTSRRGQGYSLKADGDVDGPRYDPQ
FT                   QEDLPRHQEVREADERDDELLG"
FT   gene            236988..237242
FT                   /locus_tag="Pden_0256"
FT   CDS_pept        236988..237242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68370"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYM6"
FT                   /protein_id="ABL68370.1"
FT                   /translation="MPACHRRRPPSRVPIEQIAQRRGNWRRQDPVAFVCQDAEPGGGRR
FT                   CHLTADQQQAVIRHHAEPTVLDFDPERGRYQNHGHHHGN"
FT   gene            complement(237429..237779)
FT                   /locus_tag="Pden_0257"
FT   CDS_pept        complement(237429..237779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa39970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68371"
FT                   /db_xref="InterPro:IPR025475"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYM7"
FT                   /protein_id="ABL68371.1"
FT                   /translation="MMPQRIQLKRTKGWRLPADAVKVDRSTRWGNPWRVGEPDITDAAE
FT                   AVRRFAHAVEGFMSNGSYCRPVAHPDSHIGRIISGIGDLRGKDLACWCPLDQPCHADVL
FT                   LRLANRGDERDG"
FT   gene            complement(237776..238126)
FT                   /locus_tag="Pden_0258"
FT   CDS_pept        complement(237776..238126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68372"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYM8"
FT                   /protein_id="ABL68372.1"
FT                   /translation="MGELLPVECGACGWTGRRKPGRAVWCPKCGSLAGFQVDLQDRDSD
FT                   GLLVKAGDTISFSFGIPPRRVEGILFERDGQLIMPCEGVTPKEATLDMLRRHVGGFWKV
FT                   DRLARDQYADDA"
FT   gene            238183..238512
FT                   /locus_tag="Pden_0259"
FT   CDS_pept        238183..238512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68373"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYM9"
FT                   /protein_id="ABL68373.1"
FT                   /translation="MTPSHQPTPNTHMPSANRIQRIPASSQHDEHGTIAPGQLPTPQQF
FT                   TQRTIAAAVSPEVDAIADGDPPRCAAAVIAHVQGADHPNIRVSPDLLPNTSRLTLVPAD
FT                   DHLIS"
FT   gene            complement(238789..239064)
FT                   /locus_tag="Pden_0260"
FT   CDS_pept        complement(238789..239064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68374"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYN0"
FT                   /protein_id="ABL68374.1"
FT                   /translation="MNGCIVQVWFEPETDTPGRCAPFVIIETELPDFASFCELVDADRL
FT                   IGGGILWTRNGSPGEKVIYRRQPCAFRGSAVLRCQLPTWRFIEGDS"
FT   gene            complement(239190..239984)
FT                   /locus_tag="Pden_0261"
FT   CDS_pept        complement(239190..239984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0261"
FT                   /product="D12 class N6 adenine-specific DNA
FT                   methyltransferase"
FT                   /note="PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase; KEGG: ypm:YP_1932 putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68375"
FT                   /db_xref="GOA:A1AYN1"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYN1"
FT                   /protein_id="ABL68375.1"
FT                   /translation="MTVHRPILRWHGGKWRLAPWIIEQMPHHRIYVEPFGGAASVLLRK
FT                   PRSYAEVYNDLDDEVVNLFQVLRSDRSHDLIDLLRLTPFAESEFRTAYEPAYDPVERAR
FT                   RIIIRSFMGFGSNGHQRRTGFRSNSNRSGTTPARDWRNYPDALAMIVDRLSGVVIQNRD
FT                   AREVMAAHDSPETLHYVDPPYVMGTRDYGSDYAHEMSDADHIDLLAALGALRGRVILSG
FT                   YANSLYDEALAGWQRLERRAHADGARERTEVLWMNFEPDRLL"
FT   gene            complement(239981..240562)
FT                   /locus_tag="Pden_0262"
FT   CDS_pept        complement(239981..240562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_0232 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68376"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYN2"
FT                   /protein_id="ABL68376.1"
FT                   /translation="MTAIGICLVCGCDRPIHARCLCNAHYKRFRRHGDPLGGNTSVGDP
FT                   IKFLKFAILYCGNNCLLWPFSKNPFGYGQIAIERFPKLVHRIVCEEVHGPPVRPDDHAA
FT                   HSCGNGHLGCVNPIHIRWATAKENEADKIIHGSRSRGERHGAHKLSEAHVRQIRRWRGT
FT                   MSCRDIGKLLGVSPSTVNRIHNGGRWGWLE"
FT   gene            complement(240559..242226)
FT                   /locus_tag="Pden_0263"
FT   CDS_pept        complement(240559..242226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0263"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase; KEGG: bte:BTH_II1364 DNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68377"
FT                   /db_xref="GOA:A1AYN3"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYN3"
FT                   /protein_id="ABL68377.1"
FT                   /translation="MVNLSFLSVCSGIEAASLAWEPLGWKAIGYSEIEPFPCHVLHHRF
FT                   GAGRPIFMPAPDEAGLSAKDRKARAAAIRAVAKLPEVGRVPNFGDMTQFDRWPDAAFDV
FT                   LVGGTPCQDYSVAGLRLGMAGSRGQLTLTYVEIAARYRPRWFVWENVPGVLSSNGGRDF
FT                   ARFLGEISGQQIDVPDGGWKNAGIVSGIPEAYGLAYRVLDAQFVRTRGHPRAVPQRRRR
FT                   VFVVGYLGDWRRAAAVLFDRESLLGNPPPRRQLGQGLASSLTASTGGCSGKDGIDGRLI
FT                   AMAHGQGGAEIGIDHGPTLTCNHEAPIVAHSLRAEGFDASEDGTGRGTPIVPVPQPLSF
FT                   QPGNLARGAGADPSAEVFPTLKADHGRGLSDQFPHVAHPIAFDCLAGGETGLSIGDVPG
FT                   ALHGGGKSGGRAAICFSAKDYGADAQDDVTPTLRAMGHADSHANAGGQLAVAIQERAVC
FT                   ENPNAGPDGKGFREDGASYTLEARTTPQAVALPWAVRRLVPEECERLQGMPDEHTMIPW
FT                   RGRNGAPDGPRYRSLGNSFAVNAVEWIGERISMVEMLK"
FT   gene            242420..242716
FT                   /locus_tag="Pden_0264"
FT   CDS_pept        242420..242716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc00822 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68378"
FT                   /db_xref="GOA:A1AYN4"
FT                   /db_xref="InterPro:IPR018669"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYN4"
FT                   /protein_id="ABL68378.1"
FT                   /translation="MQIIAKATLRAFWEREPRAETPLVNWYAAVSRANFSGPADVKAMF
FT                   GTTVDFVGDNRVIFDIGGNKYRLIVHFAYPYRRGLIKFVGTHKEYDKINPETI"
FT   gene            242716..243093
FT                   /locus_tag="Pden_0265"
FT   CDS_pept        242716..243093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0265"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: sit:TM1040_0815 transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68379"
FT                   /db_xref="GOA:A1AYN5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039060"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYN5"
FT                   /protein_id="ABL68379.1"
FT                   /translation="MDVRPIRTEADYQWALAEIAPYFDNQPEPGTPEADRFDVLADLIE
FT                   AYEDRHHPIPEADPVDLLKAHMEATGRTQADLGRLLGSTPRASEVVNRKRALTVAMIHK
FT                   ISTEWGLPADCLVRPYHLNAA"
FT   gene            243083..243817
FT                   /locus_tag="Pden_0266"
FT   CDS_pept        243083..243817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68380"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYN6"
FT                   /protein_id="ABL68380.1"
FT                   /translation="MPRDVLGQRLERGKRGLVEGGILAAFPVSQATIERDLRRQAGEWE
FT                   GAGPAAARQQDRAAILGQPRHWLGQKRRSGHVPHPASIRAISARPVARLCGPPSTTSAA
FT                   ACADRDALVPSHTASPLTPVAQPLKIIGRIAMANIRMVHLPSGFLIALEIGLPSVTTPI
FT                   AAPEAEGGDHRHDQPAERRQCAAEPRPQQPGQHATHSPRRNQPCHWQGMPVLWIEGDRV
FT                   GYSSSRSQSHEGPGRPDPFTGK"
FT   gene            complement(243957..244910)
FT                   /locus_tag="Pden_0267"
FT   CDS_pept        complement(243957..244910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0267"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   eli:ELI_07940 putative bacteriophage-acquired protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68381"
FT                   /db_xref="GOA:A1AYN7"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR024408"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYN7"
FT                   /protein_id="ABL68381.1"
FT                   /translation="MSKPWKGAAQRATAQDFVTAAEELGCEVAALEAVWQIEASGKPFR
FT                   SDGTLERRFEPHKLRKPEGNYKTSAALSFAAREAKFDAAYARNAEDAMRASSWGGPQIM
FT                   GFNANAAGYPTAGAMVEAMAASESEQIRAFVRLIKAWGLASALRSHDWRAFAARYNGNA
FT                   NVAEYSARIETAYQKLSGRASPVVLRSGDKGVAVRRLQYALGIDVDGSFGPDTDKAVRD
FT                   FQKRHGLTVDGVVGQRTWKALEGYSGIQPVKQPAAQDRIAQASEIVALASTAAGAMATV
FT                   GGALPESSVNLLIIAAAVIGIGALALHAFRKLRGVA"
FT   gene            complement(244980..245237)
FT                   /locus_tag="Pden_0268"
FT   CDS_pept        complement(244980..245237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68382"
FT                   /db_xref="GOA:A1AYN8"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYN8"
FT                   /protein_id="ABL68382.1"
FT                   /translation="MPDWSAIQQVWPLLIAVAGVWAKLEVTMMRNREQSARNEAEITKL
FT                   EAQLEAQKLVTQKQGLTLARMEESLVSIGRTLERIDRKIP"
FT   gene            complement(245264..245617)
FT                   /locus_tag="Pden_0269"
FT   CDS_pept        complement(245264..245617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sil:SPO2726 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68383"
FT                   /db_xref="InterPro:IPR021251"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYN9"
FT                   /protein_id="ABL68383.1"
FT                   /translation="MANSANLALPYLAASQAQKHVTHNEALRLLDGIVQLSAADRAVNT
FT                   PPGSPSPGTRYIVGGAPTGEWAGWDDSIALWADGSWFRMIPKPGWTCWVEDEGMFYVFD
FT                   GSGWVTLASTLGL"
FT   gene            complement(245625..249644)
FT                   /locus_tag="Pden_0270"
FT   CDS_pept        complement(245625..249644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0270"
FT                   /product="gene transfer agent (GTA) like protein"
FT                   /note="KEGG: nwi:Nwi_0792 gene transfer agent (GTA) like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68384"
FT                   /db_xref="InterPro:IPR025195"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYP0"
FT                   /protein_id="ABL68384.1"
FT                   /translation="MATLILGAAGTALGGAMAGTVFTAFGTAVTGAMIGGAIGSMAGSM
FT                   VDAWIIQSMMPGQKFEGQRLDAQRITSSTEGTVIPRVFGAARIGGNVIWATDFREEVTT
FT                   TRQGGKGGGGGVETTEYTYYASFAIAICEGQIGGIGRVWADGELLDMTNVTMRVYRGGE
FT                   GQQPDPLISSLMGADRTPAYRGTAYVVFEDMLLTDFGNRIPQLTFEVFRPLAHADSIEG
FT                   LARAVTLFPAAGEFGYSTQVVRTVAGVLVPINSSESGEFVNSNAAEGRTDFRVSLDRLD
FT                   DIAPNVMSVSLSVPWFGNDLRCGNCLLKPGIEHEQRNTTPISWSVNGITRGLFGSGAHL
FT                   VSRDGQNRPNFGGTPADVSVVQAIKALKNRGKRVTFYPSILMDIPAGNSLPNPYSHNAA
FT                   SVGQPAFPWRGRITCSPAPGFAGTVDKTTDATAQIAAFFGSAAAGDFSVSDESVSWTGG
FT                   EDWGYRRMILHYAYLCAAAGGVDTFLIGSELRGLTQLRNNATTGYNVVARLRTLAADVR
FT                   SILGPGTKISYAADWSEYFGHHPSDGTGDVFFHLDPLWADSNVDFVGIDNYMPLSDWRD
FT                   GWDHLDAQAGAGSIYDLGYLRGNVEGGEGYDWFYASDAARNNQARTPITDAAAGKPWVF
FT                   RYKDIRAWWSNQHRNRPGGVEQGGATAWVPQSKPIRFTGLGCPAVDRGSNQPAVSFDPK
FT                   SSESALPHFSRGWRDDSNQRAYIEAMLGYWADSTNNPQSSVYAGRMVESDECAVWAWDT
FT                   RPYPHFPALTDVWVDGENWRLGHWMTGRLGSVSLRALVRALCKEAGLADSQFDVTGLHD
FT                   AVEGYCITSIESPKSSIAMLARHFGFDACETGGLIRFVSRGRAPAGSVTTADLVRRGEG
FT                   GGEVIEMVRGQETEIPQALKWQVARNDEEYDGVMVEARRATVDSTRIAAESFSIVVPPE
FT                   EADRRCQRALQEAWVSRERATFSLPPSRLALDPTDVLTLEHDGRGYEYRLMQIGDAEAR
FT                   TIDSVRQDREAYDLPPAVTRRAHLSRPLPYDAPTTIFLDLPLLQSSQQAHRPLLAATAA
FT                   RWPGQMAVYRSEDENEGFTLLTTFNRRARIGSLAFPLHSGPVDRFDHGNELWIDLAWGT
FT                   LVSVSEQQLFSGANAFAIETAPGVWEIVQAANAELVSPGRYRLTKLLRGVRGTEWAMTS
FT                   VVASGATVVMLDEAVIELPISAEDVGVPWYWRVGPASKTISDASYRQAQFTPRAIGLEP
FT                   FAGVHAVQPYRRGRAVGDLTIEWIRRSRALAADIWGNGEVPLGEESPAYEVDILDGAAV
FT                   KRTLSSTTTSVVYTGAQQTADWGAPLAPGDSLRVDIYQVAPVAGRGIAYSETLFF"
FT   sig_peptide     complement(249573..249644)
FT                   /locus_tag="Pden_0270"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.406 at
FT                   residue 24"
FT   gene            complement(249649..250086)
FT                   /locus_tag="Pden_0271"
FT   CDS_pept        complement(249649..250086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0271"
FT                   /product="putative phage cell wall peptidase, NlpC/P60
FT                   family"
FT                   /note="TIGRFAM: putative phage cell wall peptidase,
FT                   NlpC/P60 family; PFAM: NLP/P60 protein; KEGG: sil:SPO2729
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68385"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR011929"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYP1"
FT                   /protein_id="ABL68385.1"
FT                   /translation="MSADPAIVIAAARAWLGTPYHDQASTIGAGCDCLGLARGVWRQIV
FT                   GHEPTEIPPYGRGWGEIGQREVLAEGARQWMIQIDPLEAGPGSVVLFRMRENGIAKHVG
FT                   ILTGPDSFIHSYERLGVIEQPLTTAWQRRIAFAFLYPNPES"
FT   gene            complement(250083..250967)
FT                   /locus_tag="Pden_0272"
FT   CDS_pept        complement(250083..250967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0272"
FT                   /product="phage conserved hypothetical protein BR0599"
FT                   /note="KEGG: rpb:RPB_3460 phage conserved hypothetical
FT                   protein BR0599"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68386"
FT                   /db_xref="InterPro:IPR011928"
FT                   /db_xref="InterPro:IPR018964"
FT                   /db_xref="InterPro:IPR019228"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYP2"
FT                   /protein_id="ABL68386.1"
FT                   /translation="MKTLPAGMQAHLDEGTTTLCWCWKITRNDGVVLGFTDHDNPLNFS
FT                   GVEFEPESGFAASEIRAGSELNVDSQDAEGVLSSGRITEADIIDGRYDNAAVEVWRVNW
FT                   SAPAQRVLMRRGAIGEVRRGQVAFNAEMRSLAHMLDQASGRTYQYACDAALGDARCKVA
FT                   LSAPEFNGAGAVTSVLRDRGFNASGLGAFAGGWFDHGVLTWTSGPNAGRQAEVTLHGKS
FT                   GSAVSLSLLEAPVYAIATGHAFTIVAGCDKQHATCFQKFSNIVNFRGFPDIPGQDTVLR
FT                   YARKSGLNDGQPL"
FT   gene            complement(250964..251590)
FT                   /locus_tag="Pden_0273"
FT   CDS_pept        complement(250964..251590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmr:Mmar10_0930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68387"
FT                   /db_xref="InterPro:IPR011740"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYP3"
FT                   /protein_id="ABL68387.1"
FT                   /translation="MAFHEIRFPDNISRGARGGPRRMTQVVELSSGDEERNASWANSRR
FT                   VYDVSYGIRNADQLAEVVSFFEARNGRLYGFRFKDWSDYKSCSPMQVSHPADMALGVGD
FT                   GTRTEFQLRKFYISGSQSWTRIITKPVADTVRVAVNGVEQLSGWTVDTTTGVVTFANPP
FT                   AAGQQVRAGFQFDVPVRFDTDQLDLILDIERLGSIPSIPLIEVRR"
FT   gene            complement(251590..252849)
FT                   /locus_tag="Pden_0274"
FT   CDS_pept        complement(251590..252849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dvu:DVU1490 tail tape measure protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68388"
FT                   /db_xref="InterPro:IPR006431"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYP4"
FT                   /protein_id="ABL68388.1"
FT                   /translation="MAAGVKWVGNMLINGIKAAVSGIRAAVDAIPLLFEQGFEKAKAVA
FT                   LKALGGIMDGIGTMINGIATAWDTLFGTNLAGSNAAWGIGAQLEDMAGVAEAKAMTAGA
FT                   KARRGLEAGLGDIRDIMSEDPMGDFFDRVREQAIKNAIDRQKDDKKKKGGGKSKREEKD
FT                   EADELIKSLERELAVLKETDPIKKKMLEYSKQLKDATAEQKAKVLELVTALDQEKTGWN
FT                   AIGRSLAEYAEEAKRIGDDIGDALVGAFDGAAAAVGEFVKTGKADFSDLITSMLGDLAK
FT                   LAAQRYITGPLAGLVSGFFDPLGAALKGAGLNPVSVMHTGGKGGGALRYVSAANFANAP
FT                   RLHNGTPLGLRSDEYAAILQRGERVLNRRQTRDWEDRHFGGGSAPIINFNVRDAQSIRQ
FT                   SRTQLAADASRMLSMAGRGR"
FT   gene            complement(252834..253898)
FT                   /locus_tag="Pden_0275"
FT   CDS_pept        complement(252834..253898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68389"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYP5"
FT                   /protein_id="ABL68389.1"
FT                   /translation="MGDAINAAYTLPEDRLSLPATNGAPLDDDLTPGTQTFTDEIRENY
FT                   AAPPPGVVNAAARATGLIVFDPPSQESTNYVYTDVPWFTHRGSTFRALPVDISATVFNS
FT                   LVGPCLFEPVATNSWGMLVWRYIGDKPIHSFLQGQMAMRVRTSGTTNDAFHKLILNLRT
FT                   WDAPHMEAGGQSNGRRFLSTFIGSYQQPVKMTDYEGMNDECLPLTQAVWTAHNAEPDRF
FT                   VGYDNGYFDEGSGEVLLTTEGGSPVGAEVRTTKWIDVSDIDASERCLAVWVAGKSRRSR
FT                   MQWKDSNGDVHFYPVMSRDQHCRRVFRLPHGAQEVRFHYSGPGDDVSSIAVKRMRSTPL
FT                   PLGSIGRGIRWPPG"
FT   gene            254344..254865
FT                   /locus_tag="Pden_0276"
FT   CDS_pept        254344..254865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0276"
FT                   /product="conserved hypothetical sugar-binding protein"
FT                   /note="KEGG: bmb:BruAb2_0879 hypothetical sugar-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68390"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYP6"
FT                   /protein_id="ABL68390.1"
FT                   /translation="MAEVLLDYGHRRIAALNSYRRFRYAAARDAGYRAAMEGRHVPVDP
FT                   DLVLETAMTEEDGLKLGARLLSLPEPPTAIICGSIFLAKGVYRAAAEAGRTIGKDLSVV
FT                   AHDDQLRGISAADFAPALTATQQSVEMAGRRLAEILIDRLEGRLAPEPVCEVSRPDLIL
FT                   RGSVGQGKLV"
FT   gene            complement(254938..255678)
FT                   /locus_tag="Pden_0277"
FT   CDS_pept        complement(254938..255678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0277"
FT                   /product="ChaC family protein"
FT                   /note="PFAM: ChaC family protein; KEGG: mlo:mll2256 cation
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68391"
FT                   /db_xref="GOA:A1AYP7"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYP7"
FT                   /protein_id="ABL68391.1"
FT                   /translation="MELSPPAGNLMSNCRPIVLSDDHVARVASAEEGLLHDPRWRMLED
FT                   ADLDLLADRLTRGRPRPIPVFAYGSLIWNPGFAVGGRRRATAIGWHRRFSISLDHFRGT
FT                   PERPGLMLALASGGSCEGLVLDIAEGTEAQSLRAILRRELVAHELSANACWIEVETDRG
FT                   REDALTFYADPVGTQLAELTVQEQAQRLARAAGAAGSGAEYLLRTARGLAEIGIHDDYI
FT                   WTLQQLVAEEIDAGTAEPEERPSE"
FT   gene            256203..257528
FT                   /locus_tag="Pden_0278"
FT   CDS_pept        256203..257528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0278"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: rxy:Rxyl_2255 general
FT                   substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68392"
FT                   /db_xref="GOA:A1AYP8"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYP8"
FT                   /protein_id="ABL68392.1"
FT                   /translation="MAISILPGGPAMRDAFGRLPIDEAPLKPIHIVAAAAVLGGAVLDG
FT                   YVLGIVGPALSIARQEMQLSAISQGLIASSALIGVFIGGLFFGNLADRFGRRPVFGWNL
FT                   AAFIVLSVLQIFVQDVWQLVAIRLALGLAIGVEYAVGSSVLAEFSRRKGRGVLLGCFSI
FT                   GWQVGFTVAFVVGSFYDGDNWRMLLASSVIPALITFVLRMTLPETPMWLKAQGRDAEAR
FT                   AIVDKHFGSEYAIPDVDPNPHHASPRELFTAEIWRQTLYSGLFWFCQVGPFFGIFTFLA
FT                   PVLESLGLRDATAVDMSLNAIQIAGAVVGVFLLHWMSRRGFVIWTFVIVLLTFLALGLF
FT                   PQAPTWVVVALFATYMFVAPAANNIQFVYPPEIFDTHIRATGIGFSAAFSRISAAGVTY
FT                   LLSWLLQKFGFSATLVMMAGFPLLGLVLSIFWAPETKGKHLR"
FT   gene            257705..259090
FT                   /locus_tag="Pden_0279"
FT   CDS_pept        257705..259090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0279"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II; KEGG: ret:RHE_PF00188
FT                   putative transcriptional regulator protein, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68393"
FT                   /db_xref="GOA:A1AYP9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYP9"
FT                   /protein_id="ABL68393.1"
FT                   /translation="MTIWTPDPSGLHRPAYLSLAEQYARAIRDGMLPAGTRLPPQRRLA
FT                   DDLGLSVQTVSRAYEELIRRGLVVGEVGRGSFVLPPGSENTPPYLAERLGELIDLSILK
FT                   PVTERMHVETFREGLHWVAENLPVPAALSFRPSSVLPQHRQIAADWLRRGGIDAQPENI
FT                   TITDGATSAITTAVMSAVPAGDTLAAAALTHHLLMPLCKYLGLHLEGLPVDEDGIVPEA
FT                   LDHLARKGSLRALYMQPAAINPMAIMSSAERRAELAAIARRHDLLVIENDMLNVMIPDR
FT                   PPPMAALAPERVLHINGFTKTTLPGLRVAWLLSPARLASATANRHLVTNWMATPAMVEL
FT                   LSHWIGDGTVDRLILWQREALGARHRIAREVLGAAPFRAHPQSLHIWLELPPGRDEEEF
FT                   VAQARQRGVAVASGRAFRLSERGRRDAVRIALGSTGADELRRGLTLVAETLGGSAEPLL
FT                   PLI"
FT   gene            259188..259973
FT                   /locus_tag="Pden_0280"
FT   CDS_pept        259188..259973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0280"
FT                   /product="hydroxyectoine ABC transporter ATP-binding
FT                   protein / ectoine ABC transporter ATP-binding protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sme:SMb20427 putative amino acid ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68394"
FT                   /db_xref="GOA:A1AYQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014343"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYQ0"
FT                   /protein_id="ABL68394.1"
FT                   /translation="MDQPIIRIQNLRKSFGTLTVIDGLNFDVMKGEKLALIGPSGSGKT
FT                   TILRILMTLEDISGGRIEVCGEPLYHMQRSGAEVPADEAHLHKMRRHIGMVFQHFNLFP
FT                   HKSVLQNITLAPMLTKGEARAVAEKRARELLDMVGLSDKADYMPSQLSGGQKQRVAIAR
FT                   ALALQPQIMLFDEVTSALDPELVEEVLEVMKRLAAETDMTMLLVTHEMGFAHDFADRVL
FT                   FFDKGRIVEQGPPAQIFTAPQEDRTKSFLRKIIAAGQRV"
FT   gene            259973..260818
FT                   /locus_tag="Pden_0281"
FT   CDS_pept        259973..260818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0281"
FT                   /product="hydroxyectoine-binding protein / ectoine-binding
FT                   protein"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: mlo:mlr7133 amino acid ABC transporter protein,
FT                   solute-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68395"
FT                   /db_xref="GOA:A1AYQ1"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR014337"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYQ1"
FT                   /protein_id="ABL68395.1"
FT                   /translation="MPTRQERMMKKCLIAAALLAVPLPALADKLEDLQKQGYVRIAIGN
FT                   EPPYTAVASDGKVSGAAPDVARAVFEKLGIKDLEASIAEYGAMIPSLQAGRVDAITAGL
FT                   FMKPERCNAVAYSEPILCDAEALLVPKGNPKGFNSYADIANDASARLGAPGGGTEEKLA
FT                   LDAGVPRDRLVVVPDPQSGLKMVQDGRIDAYSLPVLSLNDLLAKSGDANLEVFAPVEGA
FT                   PVYCDGAAFNKKDTALRDAFDVELAKLKESGEFAAIVEPYGFSAAAAMSTTRDALCAAQ
FT                   "
FT   sig_peptide     259973..260056
FT                   /locus_tag="Pden_0281"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            260877..261533
FT                   /locus_tag="Pden_0282"
FT   CDS_pept        260877..261533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0282"
FT                   /product="hydroxyectoine ABC transporter membrane protein /
FT                   ectoine ABC transporter membrane protein"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; amino acid ABC transporter, permease
FT                   protein, 3-TM region, His/Glu/Gln/Arg/opine; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; KEGG: sme:SMb20429 putative amino acid ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68396"
FT                   /db_xref="GOA:A1AYQ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR014342"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYQ2"
FT                   /protein_id="ABL68396.1"
FT                   /translation="MGDWAGYLTLILMGAWVTVKLTLMGSALALVVAFVAGLGRISRHA
FT                   AVRWLATAYIEFFRGTSIFVQLFWIYFVLPMTGAELTPMQAGVMALGLNVGAYGAEVVR
FT                   GAILAVPRDQHEACVAVNLTRFQRMRHIILPQALPLMLPTFGNNAIELLKATSVVSLIS
FT                   LSDMTFQAQVVRSQTGSTLMPFVTILLLYFAMSSALSFGMRRLERRVTRGLDGVR"
FT   gene            261535..262194
FT                   /locus_tag="Pden_0283"
FT   CDS_pept        261535..262194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0283"
FT                   /product="hydroxyectoine ABC transporter membrane protein /
FT                   ectoine ABC transporter membrane protein"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; amino acid ABC transporter, permease
FT                   protein, 3-TM region, His/Glu/Gln/Arg/opine; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; KEGG: sme:SMb20430 putative amino acid ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68397"
FT                   /db_xref="GOA:A1AYQ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR014341"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYQ3"
FT                   /protein_id="ABL68397.1"
FT                   /translation="MEWDWDFAWSIMPTLLAGFRITLIATVLGAMVAAVLGLVFAILRR
FT                   SPNRLVARTTGFVVEFIRGTPLLVQLYFIFYVLPDLGIRLPALTAGVIGMGLHYATYAA
FT                   EVYRGGIEAVPRGQWEAAKATNLTTRQTWLHVVLPQAVPPMIPAMANYLLAMFKETPLL
FT                   SAITVLELMNQAKSVANSSYRYVEPMTLVGVMFLVVSLISVIGLRWLERRYGRISR"
FT   gene            262191..262934
FT                   /locus_tag="Pden_0284"
FT   CDS_pept        262191..262934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0284"
FT                   /product="Asp/Glu racemase"
FT                   /note="PFAM: Asp/Glu racemase; KEGG: sme:SMb20431
FT                   hypothetical arylmalonate decarboxylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68398"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYQ4"
FT                   /protein_id="ABL68398.1"
FT                   /translation="MTVLSVPVALDERPLPRRVGLVTLATDHTTEVDFSALPAHGVGVY
FT                   ATRIPFANPVTPETLAAMARDVTAAAALILPDEELDAVVYSCTSASVVIGDQAVRDAIR
FT                   LGKPSAEPITPISAGFAALRALEAGRITLLTPYTPRTTQPMAECFEAGGFVLQGVSCLN
FT                   LTDDREMARISHATIVEAARAALAPGSQALFVACTAVRAAAIIDRIEDALGVPVVSANS
FT                   ATLWAAARACGISGPVAPGQLMRLA"
FT   gene            262931..263887
FT                   /locus_tag="Pden_0285"
FT   CDS_pept        262931..263887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0285"
FT                   /product="Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit; KEGG: ret:RHE_PF00182 probable threonine
FT                   dehydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68399"
FT                   /db_xref="GOA:A1AYQ5"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR014333"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYQ5"
FT                   /protein_id="ABL68399.1"
FT                   /translation="MSVTLDDIRAAAGRIRGHVVETPLVRDEVLSARLGQPVWLKCEYR
FT                   QATGAFKLRGATNAILSLAPDALARGVVTASTGNHGRALAHAARALGVPATVCLSRLVP
FT                   GNKVQAIRDLGATVRITGASQDEAMVEVARAVAQEGMTEIPPFDHEAVVAGQGTLGPEI
FT                   APLTPDAVLVPLSGGGLAAGVAVSIKALSPATRVIGLTMENGAAMAASLAAGHPVEVAE
FT                   SPSLADSLGGGIGLQNRVTFAICRDLLDDAILLTEAEIAEGIRHLGRAGHVVEGAASVG
FT                   TAAMLAGKFVPQGPTVTILSGANIDPALHARIMAEAA"
FT   gene            263884..264861
FT                   /locus_tag="Pden_0286"
FT   CDS_pept        263884..264861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0286"
FT                   /product="Ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin;
FT                   Shikimate/quinate 5-dehydrogenase; KEGG: sme:SMb20433
FT                   putative cyclodeaminase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68400"
FT                   /db_xref="GOA:A1AYQ6"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR014334"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYQ6"
FT                   /protein_id="ABL68400.1"
FT                   /translation="MRPPVTILTETDLRALVPLDAKAVACIRDAFVALATKPVAMPPIL
FT                   RLDIPEHRGEVDVKTAYVPGLTHFAIKISPGFFGNPALGLPSTNGMMVVLSSRTGLVEA
FT                   LLLDNGYLTDVRTAAAGAVAADALARPDAATAAILGAGMQARMQLQALALVRRLTGVRV
FT                   WARDPAKAQAFAAEMTAILRIPVTAGASVAEAARDADLVVTTTPSESPILSAADIAPGT
FT                   HVTAMGSDAGHKNEIAPDLIAAAHYVADRLSQTRTLGELHHSPLVGRDFPELGQILAGQ
FT                   RPGRTDPAQITLADLTGTGIQDTAIATLALARAGKAGAGRTFTL"
FT   gene            264873..266054
FT                   /locus_tag="Pden_0287"
FT   CDS_pept        264873..266054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0287"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: sme:SMb20434 putative
FT                   hydrolasepeptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68401"
FT                   /db_xref="GOA:A1AYQ7"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR014335"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYQ7"
FT                   /protein_id="ABL68401.1"
FT                   /translation="MTDVALKFTREEYAQRLAKTRRAMEEKGVDLLIVTDPSNMNWLTG
FT                   YDGWSFYVHQCVVVPPEGEPIWYGRGQDANGAKLTAYLKPENIVGYPDHYVQNPAMHPM
FT                   DHLSGILRDKGWGAKRIGVEMDNYWFTAAAFASLVANLPDARLTDCTALVNWQRAVKSP
FT                   QEIAYMRNAARIVEAMHARILDKVQVGMRKCDLVAEIYDAGTRGVDGIGGDYPAIVPLL
FT                   PSGRDASAPHLTWDDKPMKAGEGTFFEIAGCYHRYHVPLSRTVFLGKPTQAFLDAEKAT
FT                   LEGMEAGLAAAKPGNTCEDIAKGFFDVLAKYGIVKDNRTGYGIGVSYPPDWGERTMSLR
FT                   PGDRTVLQPGMTFHFMTGLWLEDMGLEITESILITETGVECLADVPRQLFVKD"
FT   gene            266068..267069
FT                   /locus_tag="Pden_0288"
FT   CDS_pept        266068..267069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0288"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: sme:SMb20435
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68402"
FT                   /db_xref="GOA:A1AYQ8"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR014336"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYQ8"
FT                   /protein_id="ABL68402.1"
FT                   /translation="MQPAPSPIAATVDFAAPGVGHGFLRLPHSRDDAAWGSIMTPITVV
FT                   NNGEGPTALLTGANHGDEYEGPIALFDLAATVRAEDVTGRLIIVPAMNYPAFAAATRTS
FT                   PIDRGNLNRSFPGRPDGTVTQKIADYFQRVLLPMADVVLDFHSGGKTLDFLPYCAAHIL
FT                   PDKRQQAAAFDLVRAFGAPWSVRMLEIDAVGMYDTAAEEMGKVFVTTELGGGGTASART
FT                   AGIAKRGLRNLLVAAGVMRGEVAAQPTRWLDMPDADCFTFAEDGGLIEFLADLGDAVEK
FT                   GQPVARIFPVTRTGLAPVTVPAGRAGLMMARHFPGIVKPGDCVAVIGVEVDE"
FT   gene            267066..268517
FT                   /locus_tag="Pden_0289"
FT   CDS_pept        267066..268517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0289"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: sil:SPO1137
FT                   succinate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68403"
FT                   /db_xref="GOA:A1AYQ9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYQ9"
FT                   /protein_id="ABL68403.1"
FT                   /translation="MITDKTLMREDAFVNGVWLGGERFAVTDPATGTAIAQVARLDAAQ
FT                   ARAAVDAAQAAFAGWAALLPQERAAVLMRWHRLIVDAREDLARIMTAEQGKPLSESRGE
FT                   IDYAASFVEFYAEEAKRPNIESVTSHLSTAEMELWREPLGVAALVTPWNFPCAMITRKA
FT                   AAALAAGCTVVVHPSAETPLSATALAELADRAGFPPGVFNVVTGDAPEIVGEWCADPRV
FT                   RALSFTGSTQVGKLLYRQSADTVKRLVLELGGHAPFIAFADCDLDLAVDEAIKAKFATS
FT                   GQDCLGANRFLIERPIYEEFCRRFTAAAAALALGPGVEDRDLGPLMNEGAVRKQEEHVA
FT                   DALARGARLLTGGARDPQGPLFYRPTVLADVPGEALVFREETFGPVAAIAPFETEEEAV
FT                   GIANATEYGLVAYVHSRDPRRIYRLSRALSFGMVAVNRTKVTGAPIPFGGMKQSGLGRE
FT                   GSRHGLEAFTEIKYVCRDWAETRRA"
FT   gene            268517..269887
FT                   /locus_tag="Pden_0290"
FT   CDS_pept        268517..269887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0290"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   sit:TM1040_2691 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68404"
FT                   /db_xref="GOA:A1AYR0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYR0"
FT                   /protein_id="ABL68404.1"
FT                   /translation="MLTNDELSKWDRESLFHPSTNLGQFARGEGPQRIVSGAEGVYVTD
FT                   RDGNRLLDGFAGLYCVNVGYGRPEIAEAIATQARELAYYHAYAGHGSEASITLAKMVMD
FT                   RAPRHMARVYFGLGGSDANETNVKLVWYYNNIRGLPQKKKIISRWRGYHGSGLMTGSLT
FT                   GLELFHKKFDLPLAQVIHTEAPYYYRRKDAGMSEEQFSAHCADELEKLIAAEGADTIAA
FT                   FIGEPVLGTGGIVPPPKGYWEAIQKVLARHDILLIADEVVTGFGRLGSMFGSDHYGMTP
FT                   DIITCAKGLTSAYAPLSGSIVGQKVWEVLMQGTDEYGVLGHGWTYSAHPIGAAAGIANL
FT                   RLIDELGLVGNAGRVGRYLNDRMRAAVGDHPNVGEIRGEGMLCAVELVRDRDTRGFFDA
FT                   AEGIGGKVVGAMLKRGVIARAMPQGDIVGLAPPLCLTEAEADVIVDVTAVALRETLG"
FT   gene            269891..271033
FT                   /locus_tag="Pden_0291"
FT   CDS_pept        269891..271033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0291"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   csa:Csal_2340 alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68405"
FT                   /db_xref="GOA:A1AYR1"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYR1"
FT                   /protein_id="ABL68405.1"
FT                   /translation="MTAIPETMCAMVLTGHGGTERLEWREDWPVPRPGPGEVLVRITAC
FT                   AKNNTDRKVREGRYSTADDGAVTSFAMAGNTLSFPRIQGADVVGHVVAVGQGVPTDRIG
FT                   ERGLLDFNIYPDARDDLNLAPDYFGHGADGGFAEYGCFPSEQFHAIANPALGDAELATL
FT                   GMCSWQTGYRMLTSAGVGAGEHVLVTGASGGVGTALLQLCRVIGAIPHAVASAGKAEAL
FT                   HALGAETVIDRNAVGDWPSAIDRATGGATIDAVMDLVGGEMTVPLIQAMCRDMRRRTTP
FT                   PRLSIAGASAGNVTALPWTLIYLNQVRIFGVSHGTRAEARQLIGWIGENRLKPVLAGIM
FT                   PLSRLREAERLFVERGRDFIGKLVIVPDRVVAEQGLETMA"
FT   gene            complement(271049..272245)
FT                   /locus_tag="Pden_0292"
FT   CDS_pept        complement(271049..272245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0292"
FT                   /product="protein of unknown function DUF1006"
FT                   /note="PFAM: protein of unknown function DUF1006; KEGG:
FT                   jan:Jann_2912 protein of unknown function DUF1006"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68406"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYR2"
FT                   /protein_id="ABL68406.1"
FT                   /translation="MARPLLTNRDARRLFLDRHLLLRPGAGPGKGADLENVLSGLGFVQ
FT                   VDSVNTLARAHDLILWSRRGQYRPQGLESLIARHRAGFEHWTHDAAVIPMRFYPMWRLK
FT                   FARDEAHMQRRWPKWRREGWDAEFDSVLRHIADHGPASSSDLGGDEPKGSGGWWDWHPS
FT                   KTALEYLWRSGRLAICHRSGFRKVYDLAERVIPAEHLNARLDDAEIIDWAMTAALERLG
FT                   FATSGELAGFFAIASRDEAKLWCSEALAAGRIVEIDVEMADGSVRRSFSAPALLDLVPA
FT                   LPDPSSRIRLLSPFDPALRDRARAERLFGFRYRIEIFVPAERRQYGYYVFPVMQGDRLV
FT                   GRVDTKREDGALAVRAFWPEPGVRMGQGRVTALAAEFQRIAPLAGVDEIRHAPDWLRA"
FT   gene            complement(272403..272990)
FT                   /locus_tag="Pden_0293"
FT   CDS_pept        complement(272403..272990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68407"
FT                   /db_xref="GOA:A1AYR3"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYR3"
FT                   /protein_id="ABL68407.1"
FT                   /translation="MGSILHEPPSDDHAESIGIPGHPRPMRRGCSWHRPGGPLHARCLR
FT                   DGDEGQAGPDRTTPPRHGWRAEARPLRDALRFPPAPFRRRPPFHQKSRTMLKKLTPDSV
FT                   SRSDRDQDRGFPLGIVVLASLAAVAATALAWLMGWGLPWLVATYCLTGSVALLGLAWHK
FT                   ASRPDSEERYENADAAETGHAPRRAAVSGRPR"
FT   gene            complement(273336..275105)
FT                   /locus_tag="Pden_0294"
FT   CDS_pept        complement(273336..275105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0294"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   sil:SPO1617 type I secretion target repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68408"
FT                   /db_xref="GOA:A1AYR4"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYR4"
FT                   /protein_id="ABL68408.1"
FT                   /translation="MTDPTNNQPLNTAAMAFSSSAQPDGIVDGTDGDDYMVPGYVDHQG
FT                   DVVDGADGVNDWINAGAGNDTVNGGAGNDTIEGGEGDDLLRGNAGHDIIRGDAGNDTIN
FT                   GDAGNDTIEGGEGDDLLRGDAGDDVLRGGEGNDTFNGGIGNDTIEGEEGDDLLRGDDGD
FT                   DLLLGGVGSDTLNGGLGNDTLDGGDDDDLLRGDDGNDLLLGGAGNDTLNGGNGDDTLEG
FT                   GEGDDLLRGDAGHDLLQGGDGNDTLEGGQGNDVLEGGDGDDSLIGGPGADTMTGGAGND
FT                   RFVVSGGGDLITDFDAVTGIGDGQSDNNDFVDLNAFYNGTTLAAWNAANPHQTYASPES
FT                   WMQADQADGVLDAVGGLRIQDGTGNSVLGSQLTTENTGVLCFLRGTLIKTADGEVPVEQ
FT                   LEPGTKVMTLDHGCKALRWIGKRVLSAEELAAQPKLRPIRIRAEALGERLPERDLIVSP
FT                   QHRVLLRSVVARRMVGEAEVLLAARHLIGLDGIEVVEDMQEVEYWHFMFDRHEVVFSNG
FT                   APTESLFTGPEAMKALGPEARHEILTLFPQLAQPEPQQPAAARLLMRGRQGRHLVQRLV
FT                   ANGKQPFNWGKVG"
FT   gene            275682..276158
FT                   /locus_tag="Pden_0295"
FT   CDS_pept        275682..276158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0295"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: rsp:RSP_3055 transcriptional regulator, MarR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68409"
FT                   /db_xref="GOA:A1AYR5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYR5"
FT                   /protein_id="ABL68409.1"
FT                   /translation="MTTHQAQTAQPQFGDADPRIAYNRVFFAILRIHRTLMPQIEKALR
FT                   EIGVPDPIWYEILLATEEAGEDGVQMQVLQRRLFVPQYALSRHVARIEKAGLIRRAAAG
FT                   GAGRGQILYIAEAGRGLHARIWQIYVERIQSALAPALTTDEAYDLVRTLNRLYR"
FT   gene            complement(276190..278148)
FT                   /locus_tag="Pden_0296"
FT   CDS_pept        complement(276190..278148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0296"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug; KEGG: rsp:RSP_3056 TonB dependent-iron
FT                   siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68410"
FT                   /db_xref="GOA:A1AYR6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYR6"
FT                   /protein_id="ABL68410.1"
FT                   /translation="MAAPFTPRLILVAGAAAALALPALAQETVVLLDPITLRALDADGS
FT                   AADRGASQYVAAAELERARMGDLKDLFTGIASVSVGGAIPVAQKIFINGVDMLNLSVTV
FT                   DGVEQNNRAFHHVSANAIDPGLLKFVRVDAGVAAADAGPHAVAGAVVMETVDAADILED
FT                   GRSFGGNVRLSYGDNGRTFGRAATLAGQMGGFEWLGYLKSATGDDYQAGGGQTIRGSAA
FT                   DLQSVLLKLAHETPGGHRIELSGQRLRDDTLRPYRANIGHIEGGAPLPELRRYDTTRSS
FT                   WSLSYENTQAGGLWDPRFVIGRSESRVHVDQPTVMPPYVSKGDSDTFSAKLENRFHLSD
FT                   ANSVTAGIDWYDRSSTYSDPFGGLDENARNIGLYAQARLEPVERLDLSFGLRWDRQDFT
FT                   GTSGWKDTNSGFSGNASLAYGLTDALVLRAGASTVFGGIAIEDNYIFNGAWDYDTLRPA
FT                   RARNYTLGFDYEAGDLRLDGELFLTQVDNARGGTYRGIENFDFESRGYNLGLGYGWNGG
FT                   YLRASISDSRVSVNGNPASSYEALDFGAPLGRVFSIEAQHTPQGSAFTYGGSIEAAAKY
FT                   DRIEGDSDRTIPGYAVLNLFAEYAPEQVEALVLRAEVANLFDKDYADRATYGGDYATVT
FT                   PLREPGRTFSLVATKRF"
FT   sig_peptide     complement(278071..278148)
FT                   /locus_tag="Pden_0296"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(278251..279009)
FT                   /locus_tag="Pden_0297"
FT   CDS_pept        complement(278251..279009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0297"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: atc:AGR_C_4492 ferrichrome ABC transporter
FT                   (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68411"
FT                   /db_xref="GOA:A1AYR7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYR7"
FT                   /protein_id="ABL68411.1"
FT                   /translation="MIEVSSLCKSYGAAPVLHDVSLSLPRGGVTSLIGPNGAGKSTLLS
FT                   LIARLIVPDSGSVTVDGLDVTRTPGPVLARRLAILRQENHLVARLTVRELVGFGRFPHS
FT                   GGRLTAEDRAAIDRALDYLELAPLADRFIDQLSGGQRQRAFVAMVLAQDTDYLLLDEPL
FT                   NNLDMKHAQAMMRLLASAAHDLGKTVIVVLHDINFASCHSDRIVAMRQGRIFAAGTPAE
FT                   IVTPDLLGELYEMQIAVREIDGQRIALFYG"
FT   gene            complement(279006..279965)
FT                   /locus_tag="Pden_0298"
FT   CDS_pept        complement(279006..279965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0298"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   atc:AGR_C_4491 ferrichrome ABC transporter (permease)
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68412"
FT                   /db_xref="GOA:A1AYR8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYR8"
FT                   /protein_id="ABL68412.1"
FT                   /translation="MPHERRARLALLVLALLALSAILAFMTLGARGNWGFVLPFRGKKL
FT                   LGLLLVGHAVACSTVLFQTVTANRILTPAIMGFDSLFVLCSTVLMALFGSTMVAGLDPR
FT                   LVFAGNVLLMVGASMALYLWLFGGEERSLHRLLLIGVVFGIFLRMLAEFVQRMLDPNEF
FT                   MVLSDMLFASFGTIPATLLGIASAMVAGVTLWLMPRLSRLDVIALGRPVAVNLGIRWRA
FT                   EVLAVLAAVSVLVAVSAALVGPVLFFGLIAASLAHLAVGQSAHRYLLPAASLIGVTMLV
FT                   GGQTVLERVFAFNTALGIIVEFAGGITFIALLIGKGRR"
FT   sig_peptide     complement(279867..279965)
FT                   /locus_tag="Pden_0298"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.547 at
FT                   residue 33"
FT   gene            complement(279955..280911)
FT                   /locus_tag="Pden_0299"
FT   CDS_pept        complement(279955..280911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0299"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   atc:AGR_C_4489 ferrichrome ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68413"
FT                   /db_xref="GOA:A1AYR9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYR9"
FT                   /protein_id="ABL68413.1"
FT                   /translation="MTRLAAAVLVTAGLALASLFVGVSNVSLRGILAGQELDWLVLVES
FT                   RLPRMLALLLSGASMAIAGLLTQIVIRNRFVEPANTGTMESAGLGLLVMTLVAPGAPVI
FT                   AKMAAGAGFAMAGTALFLAILRRVPLRDPMLVPLVGILLSGVIYAGTAFVAYRFDLIQT
FT                   VLAWTQGDLSGVLRGRYELLWLGATLAAVAWLAADRFTVAGLGRDIASSLGLAHGRVVA
FT                   LGLTIVSLVTAVVVVTVGMIPFLGLIVPNIVSLALGDNMRRAVPWVAVSGAALVLACDI
FT                   LGRVIRAPYEVPLGTVLGVLGSAVFLVLILRSRDRAA"
FT   sig_peptide     complement(280858..280911)
FT                   /locus_tag="Pden_0299"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.485 at
FT                   residue 18"
FT   gene            complement(280913..281818)
FT                   /locus_tag="Pden_0300"
FT   CDS_pept        complement(280913..281818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0300"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   atc:AGR_C_4488 unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68414"
FT                   /db_xref="GOA:A1AYS0"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYS0"
FT                   /protein_id="ABL68414.1"
FT                   /translation="MFVKLIAWAATALTLAGPALAEPMTIAHSQGETVLPAPPSKVLVL
FT                   DINALDIAHAMGAEPAGVLGSNLPDYLQEYAADRPKMGTIFEPDYESIAASGADLMIVG
FT                   TRTAPAYAEMSRILPTVDLSLGDDLFASVRENVETVGRIFGKPAKAAEMVAALDAKIAH
FT                   LKDIAPGAGTALILVTNGGKLGAYGPKSRVGWVHTQLGFATVAPDIDDRFHGGDVISFE
FT                   YILERDPDWIFVIDRDAGVGEAGAGARAALDNPLMARTQAVRNGHVVHLDPHAAYIAFG
FT                   GYTALNRLLDQLTEALAATS"
FT   sig_peptide     complement(281753..281818)
FT                   /locus_tag="Pden_0300"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            282034..283434
FT                   /locus_tag="Pden_0301"
FT   CDS_pept        282034..283434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0301"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent enzymes; L-seryl-tRNA
FT                   selenium transferase; KEGG: pen:PSEEN0568 selenocysteine
FT                   synthase (with SelD)"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68415"
FT                   /db_xref="GOA:A1AYS1"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AYS1"
FT                   /protein_id="ABL68415.1"
FT                   /translation="MDPRSTLPSIDRLLRQAEARELIAHHGRDNVVGMLRRLLQDRRMA
FT                   AGRGDRAAGERAAGEGVLDECAERLAAQARPSLRPVLNLTGTVNHTNLGRALLSRRAAE
FT                   AAFRAMISATNLEYDLERGTRGDRDSHVEALICRLTGAEAATVVNNNAAAVMLMLNTLA
FT                   LGREVVVSRGELVEIGGAFRVPDVMARAGCRLHEVGTTNRTHLRDFANAVNEDTAAFMK
FT                   VHASNYAIEGFTAEVPQADLAALARRHGIPLLIDLGSGSLLDLDAFGLPPEPTARQAIR
FT                   DGADAVTFSGDKLLGGPQCGIIAGSRALVDRMRANPLKRALRVDKIILAALAETLQSHG
FT                   DPERARAEIPTLRLLTRPQDEIRALAERLCPPVHAALSGLAEVRVVDCLSQIGSGAQPV
FT                   DLLPSAGLGFAETGAVPVSRIAQAFRDLPLPVIGRVHKGEFLLDLRCLEDETPFLAQLD
FT                   RLALAGPA"
FT   gene            complement(283449..284342)
FT                   /locus_tag="Pden_0302"
FT   CDS_pept        complement(283449..284342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0302"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: sme:SMa1782 putative LysR-family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68416"
FT                   /db_xref="GOA:A1AYS2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYS2"
FT                   /protein_id="ABL68416.1"
FT                   /translation="MTVSLDQLEAFVAAAEHGSFSAAGRALRKAQSAISTQVSNLEDDL
FT                   GVLLFSRKGRNPVLTPAGERLLAEAKVVLDRREHLIGVAASFEAHVEHRLVVAIDELYP
FT                   EQPLGTLFADFAANFPHVELELLFPMMEDVSRLVLDGKADIGVMWRQEILPTEIAFHTL
FT                   GWVPLKLVCGKDHPLANTVVDWEELKRHRQLMVAVRSEGPEKQRLRTAAEVWWVESHWV
FT                   ILQMVRQGIGWALVPDHIIEDSPVRDDLVTPPLQFDGADWPVALELVWHKQRPSGPAAR
FT                   WLRQRFAAMRISGLPG"
FT   gene            284436..284876
FT                   /locus_tag="Pden_0303"
FT   CDS_pept        284436..284876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0303"
FT                   /product="transmembrane pair domain protein"
FT                   /note="PFAM: transmembrane pair domain protein; KEGG:
FT                   sme:SMa1780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68417"
FT                   /db_xref="GOA:A1AYS3"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYS3"
FT                   /protein_id="ABL68417.1"
FT                   /translation="MTMRSFPDRVRHALMFEIIGLAIITPAAAWLYDKPMLDMGVVGVG
FT                   AATLATVWTFVFNLGFDHAMRRWVGHVHKAVHHRLLHTVLFEFGLLVMLLPPMAWYLGM
FT                   TLWQTLLLDLFIVAFYLVYNFVFNVIYDRVFPLPEMPRGQPA"
FT   gene            complement(284873..285757)
FT                   /locus_tag="Pden_0304"
FT   CDS_pept        complement(284873..285757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0304"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: mlo:mll4929 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68418"
FT                   /db_xref="GOA:A1AYS4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYS4"
FT                   /protein_id="ABL68418.1"
FT                   /translation="MSIPPLAALRAFEAVARHLSFTRAAEELGMTQAAVSYQIRLLEER
FT                   LATPLFLRKPRGIVLTETGALFARPTIDAFDMLREAYADPSADSVSTLSISTVPTFAGA
FT                   WLSPRLGKFQMNHPNLAVRLETSDNLVDFGREDITVAIRAGEGGWPGVEEHCLMPIEYT
FT                   PMLSPELAKKHELREPADLLNLPLLDRVDPNWAVWMREAGVDFWESPPRPGLTLSTDLH
FT                   EARAALEGYGVALLTPRFFRFELATGSLIQPFPLVAQNGRSFWLVYPKGRRNRPAIRKF
FT                   RAFLLDEIARDPG"
FT   gene            285838..286125
FT                   /locus_tag="Pden_0305"
FT   CDS_pept        285838..286125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68419"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYS5"
FT                   /protein_id="ABL68419.1"
FT                   /translation="MITERRAKMSDNSVCERQRPFLPGLARLLFGVLRRDKPSLSPCAD
FT                   RMAALDHPATRKALADLPSHLLRDIGVADMRSEAGTAPLQEGDALRRHLW"
FT   gene            complement(286535..288052)
FT                   /locus_tag="Pden_0306"
FT   CDS_pept        complement(286535..288052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0306"
FT                   /product="protein of unknown function DUF112,
FT                   transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112,
FT                   transmembrane; KEGG: sme:SMb20726 conserved hypothetical
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68420"
FT                   /db_xref="GOA:A1AYS6"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYS6"
FT                   /protein_id="ABL68420.1"
FT                   /translation="MSAFEFLMQGLGTAADPMMLLYALIGVTLGTAVGVLPGIGPALTV
FT                   ALLLPVTYRLDPAGSLIMFAGIYYGGMYGGSTTSILLNTPGESASIITALEGNKMARKG
FT                   RGGPALATAAIGSFIAGLIATLLLAFLAPSIVKLALVFGPREYFALMVLAFVTVSAAFG
FT                   DSALRGLTSLFLGLALACVGIDQLTGQARLSFGVPELLDGIEVTTMAVAMFAVGEALFI
FT                   AGQRVQVDDEVTAVKGSIWMNRRDWARSWKPWLRGTFIGFPIGAMPAGGAEIGTFLSYA
FT                   TEKKLTKHPEEFGNGAIEGVAGPEAANNASAAGTLVPLLTLGLPTSATAAIMLAGFQQF
FT                   GLQPGPLLFATNPTLVWGLIASLLIANAMLLVLNLPMIGLWVKLLTVPKPWLYAGILLF
FT                   ATLGTIGANPSAFELGMLLAFGVLGYVMRLFGYPIAPIVVGLILGPMAEQQLRRALAIS
FT                   QGDWTTLVQSPIAATLLGIAALALIVPLILRARGKGEVLSQLAGDED"
FT   gene            complement(288056..288550)
FT                   /locus_tag="Pden_0307"
FT   CDS_pept        complement(288056..288550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0307"
FT                   /product="putative tricarboxylic transport membrane
FT                   protein"
FT                   /note="KEGG: atc:AGR_C_4484 putative tricarboxylic
FT                   transport membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68421"
FT                   /db_xref="GOA:A1AYS7"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYS7"
FT                   /protein_id="ABL68421.1"
FT                   /translation="MSVSRYEPPRRRDTAALIIAAGLVVIGGVMLWDSARLADLGGYSG
FT                   VGPASVPRVVGFALMGLAVWTAVEALRGDFPQRAPQNALPVLWIVAGLAAQLMLLHVAG
FT                   FSIATGILFAFTARAFGKRNLATTIPIGIVVSFVVWAIFSQLLMLHLPAGPLEHLIFPR
FT                   G"
FT   gene            complement(288547..289488)
FT                   /locus_tag="Pden_0308"
FT   CDS_pept        complement(288547..289488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0308"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   sme:SMb20724 putative tricarboxylic transport membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68422"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYS8"
FT                   /protein_id="ABL68422.1"
FT                   /translation="MKQFVLASLFAAATALPAMADYTIIAPANPGGGWDQTARTMQAVM
FT                   QEEGISKSVQVQNVPGAGGTIGLAQFASQNKGNPDALIVGGYVMVGAILTNNSPVSLKD
FT                   VTPIARLTGEYEAIVVPAASPIQDVAGLIEALKADPGAVSWAGGSAGGTDHIAVGLIAK
FT                   AAGVDPTKINYIAYSGGGEALAAILGNQVTAGISSLGEFEAQIQAGTLRLLAVTAPERL
FT                   EGVDAPTLQEAGLDVVLENWRMVAAAPGLSDEQKAKVTADIEKMAKSENWQKQLSDKGW
FT                   MDTYLAGPEFEAQLEQDVTSTEAILKDIGLVK"
FT   sig_peptide     complement(289426..289488)
FT                   /locus_tag="Pden_0308"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(289661..290758)
FT                   /locus_tag="Pden_0309"
FT   CDS_pept        complement(289661..290758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0309"
FT                   /product="periplasmic iron-binding protein"
FT                   /note="KEGG: atc:AGR_C_4480 periplasmic iron-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68423"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYS9"
FT                   /protein_id="ABL68423.1"
FT                   /translation="MAKSPIMRLIARLMPAIATALALWPGPASAQVTLFPAPAGDGREL
FT                   SVYSSLDDDLAAPLVAAFQNLHPGVTVRYENLLTTELHDRIVAETQAGGGTADFAFSSA
FT                   MDLQVKLANDGFARPVETPHTRGWPGWANWRDTAYALTFEPAVFAYHKPSFAGREPPAT
FT                   RADLMQWMAEHPDEAQGRIGTYDVSRSGVGYLFLARDQELYPGIWSVVQAMGRAGVQQF
FT                   PTSAELLERIADGRLRLGYNLLGSYASDWARRHPDVGVILPRDFTVVVSRVALVPAAAR
FT                   QPGLGADFLAFLMSPEGQGLLSRTLRLSAVSLEVAGQPGPAGGMQDLAGLRLKPVPVSP
FT                   GLLAYLDQATRAKLLARWNKALAGE"
FT   sig_peptide     complement(290666..290758)
FT                   /locus_tag="Pden_0309"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT   gene            290820..291491
FT                   /locus_tag="Pden_0310"
FT   CDS_pept        290820..291491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0310"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: sme:SMb20722 putative
FT                   two-component response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68424"
FT                   /db_xref="GOA:A1AYT0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYT0"
FT                   /protein_id="ABL68424.1"
FT                   /translation="MRILLVEDNLSLAEGLTALLRQSGYAVDVVHDGASAEALAAAESF
FT                   DLVILDLNLPQMDGLEVLRAMRARRNPAAVMILTARGAPEERVRGLDLGADDYLIKPFD
FT                   IGEFEARIRSLLRRQAGLRNSTVSFGDLVLDQTARSFLLAGQPLDLPARERGLLELLIM
FT                   RAGKVVARESIVQSLTSLEDDLSANAIEQYVSRLRKRLAPAGLTVRTARGIGYFLDRAE
FT                   P"
FT   gene            291488..292918
FT                   /locus_tag="Pden_0311"
FT   CDS_pept        291488..292918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0311"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   Two-component sensor kinase N-terminal domain protein;
FT                   KEGG: ret:RHE_CH03588 probable two-component sensor
FT                   histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68425"
FT                   /db_xref="GOA:A1AYT1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYT1"
FT                   /protein_id="ABL68425.1"
FT                   /translation="MIRRPFSLRRRLLAWLLLATLVLGTAALIDTWREAVRMANALADR
FT                   VLAGSALVIAERASLDEDGRIAIEIPYGALEMLSSAAQDRVFYRVDGPPGHIVTGYGDL
FT                   PMAPARPGGGPAYADDVFRGEPVRVASLARAASTGIDEVPFVVTVAETTNARRELTRAI
FT                   LMRSALRLVLMIAGAALIVWIAVTLSLRPLYRLGEEIAARNPDDLSPIETPVPSEVRGL
FT                   VGTVNGFMRRLGAALDGMRNFTGNAGHQLRTPLAVVRTQLALAARAASLPEAQAAAAKG
FT                   DAAVAHAERILAQLLLLARVDTAEGAALAAPLELAALARDLTAEHIPAAAEAGIDLGFE
FT                   GGGPVTVRAEPLLLGEAVSNLISNALLHAGRAAVVTVRVGREGGDAVLEVEDNGPGIPP
FT                   AARAAAVSRFARGQTSGPGMGLGLPVALEIASLFGGRLVLDERAGGRGLLARITLPALA
FT                   TTRSAQENAGIDTEPLQS"
FT   sig_peptide     291488..291571
FT                   /locus_tag="Pden_0311"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.561 at
FT                   residue 28"
FT   gene            293052..294146
FT                   /locus_tag="Pden_0312"
FT   CDS_pept        293052..294146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0312"
FT                   /product="protein of unknown function DUF475"
FT                   /note="PFAM: protein of unknown function DUF475; KEGG:
FT                   rsp:RSP_0459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68426"
FT                   /db_xref="GOA:A1AYT2"
FT                   /db_xref="InterPro:IPR007427"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYT2"
FT                   /protein_id="ABL68426.1"
FT                   /translation="MQQGNNPSAGGSTNGTHRPTLHYFKWSFIVTALGLALGAVLGWQT
FT                   TGTVGGTLTIFFICAVLAVLEISLSFDNAIVNANKLKEMTPKWQRRFLTWGILIAVFGM
FT                   RIVFPLLIVVIAANIGPWQAMVLAASQPDEYSRIMHDAHLPIAAFGGTFLMMVGLSFFF
FT                   DHEKDVHWVRWLEHRMQRYATVRGIEVAVVLVTVLIFSRFLEGADSQVFFHSAIWGLLT
FT                   FLLVEVLGGLLDSSQEAMQAGAKGGIGAFLYLEVLDASFSFDGVIGAFALTHNLFVIAI
FT                   GLGIGAMYVRSMTIMLVERGTLAEYRFLEHGAFYAIIALSVIMFVQPLVHIPEVITGLG
FT                   GATLIGISFWSSIRWNRKNHAVEA"
FT   gene            294237..295178
FT                   /locus_tag="Pden_0313"
FT   CDS_pept        294237..295178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0313"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sil:SPO0845 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68427"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYT3"
FT                   /protein_id="ABL68427.1"
FT                   /translation="MRYLLALLVVVAVAALFYWRHAQKAGAAHDDGADVQALYQAGRPL
FT                   PQGPLRVYHLGHSLVGRDMPAMLAQLAGQGHDYALQLGWGTALREHHQGREAINGFDQE
FT                   NATPHHREAHEALASGAYDAFVMTEMVRLKDAIQYKESRTYAGKWAAEAAAGNPAGQIF
FT                   LYESWHALDDQPDWLSRLPDDLETMWKPGLLWPAARAAGRPVWLIPGGQVMARLVAEAE
FT                   AKGGIAELTSREGLFARSPDGTLDTIHPNDLGVYLVALTHYAVLYGQSPVGLPHELMRA
FT                   DGSPADAPSPELARRMQEVVWEVVSTNPLTGL"
FT   sig_peptide     294237..294311
FT                   /locus_tag="Pden_0313"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.502 at
FT                   residue 25"
FT   gene            295262..295834
FT                   /locus_tag="Pden_0314"
FT   CDS_pept        295262..295834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0314"
FT                   /product="AmiS/UreI transporter"
FT                   /note="PFAM: AmiS/UreI transporter; KEGG: bpa:BPP1188
FT                   putative transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68428"
FT                   /db_xref="GOA:A1AYT4"
FT                   /db_xref="InterPro:IPR003211"
FT                   /db_xref="InterPro:IPR038523"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYT4"
FT                   /protein_id="ABL68428.1"
FT                   /translation="MADRIPGNCPKRGRACAGGPMLTGFVLFYVGAVLFLNGLWLMGRI
FT                   ADREIVVINIVTALVSGAAVLHDAFGTGASAASIRNGALSLLFCTTYLWVAYNRLSGAD
FT                   GRGLGWFSLFVAVTTVPVFLRALAAAGSATELWLAANWAVWGVLWFMYFLLLALGRPIQ
FT                   RQTAWVTLLAGIFTGWLPGFLLLDGLI"
FT   gene            complement(295835..297919)
FT                   /locus_tag="Pden_0315"
FT   CDS_pept        complement(295835..297919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0315"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein;
FT                   dihydrodipicolinate reductase; NAD-dependent
FT                   epimerase/dehydratase; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; homoserine dehydrogenase,
FT                   NAD-binding; dTDP-4-dehydrorhamnose reductase; NmrA family
FT                   protein; Male sterility C-terminal domain; KEGG:
FT                   sil:SPO0852 oxidoreductase, Gfo/Idh/MocA family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68429"
FT                   /db_xref="GOA:A1AYT5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYT5"
FT                   /protein_id="ABL68429.1"
FT                   /translation="MTSDLRIAILGAGYIASWHADAIKAAPGARLVAVCDPARDAAEAL
FT                   AASHGVAAFTDLDQMIAAGVCDVVHILTPPNLHRDLAVQCLNAGLHVLVEKPVALSVAE
FT                   IDEMEAAATAAGRQLGACHNFLGLPGYERLKRAVQAGELGLVSSAQINWSLPLVPLRSG
FT                   PYGLWMLRETQNLLLELGPHPFSFAVDLFGPLEVEHVSLGQWITLPGGEQRPQSWRILA
FT                   RAGKVDVTIALSLVETFDDRSLSLRGSSGMARLDYAADALVLTRDNTADLVLNPLVKEL
FT                   SRSGAHLREGVRNALRQAASLNQKSPYGLSFRATIAAFYDGIRAGRPDPRFAPSSARAV
FT                   MQGIGDALACLPALPPVPARPIGTPQPRVMVIGGTGFIGRNLTRRLVERGHDVRVLSRG
FT                   RNGPFPDIADHVETLGISLHDEEGLAAAMQGMDCVFNLAKSTDKSWQAALDNDVATTER
FT                   IGRAAIRSGVGRLVHTGTIASYDMSDPARTITEATDFGAMDSRNIYARSKAEGERRLIA
FT                   MQAQGLRLAIARPGIVLGDGGPLQHWGIGRWHGAGAVRLWGNGRNILPFVLADDVSDGL
FT                   IAMMERDEAIGESFNLIGEPMFSGRDYFDAIHRRTGARLKVSGSNLTALWAVDAVKQGL
FT                   KRHALRRKGAAPASLADWKSRGHLSPFDNGKPKRLLGWAPEADRDAFWRRAIDEAHLFW
FT                   "
FT   gene            complement(297929..298891)
FT                   /locus_tag="Pden_0316"
FT   CDS_pept        complement(297929..298891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0316"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   sil:SPO0853 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68430"
FT                   /db_xref="GOA:A1AYT6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYT6"
FT                   /protein_id="ABL68430.1"
FT                   /translation="MTRPTLGAVAIGRNEGERLKACLRSLVPLCERVVYVDSGSRDDSV
FT                   AFARSLGVDVVELDTSVPFTAARARNAGAEALLAGGDLDLVQFVDGDCRVEPGWLEAGT
FT                   AAMQADPELGLVTGWRSEIHPTATVYNQMCEVDWHRPAGPIVACGGDMMVRAAAFRRIG
FT                   GFDPTVIAAEDDEFCLRLGKAGWKLVRLPVQMTWHDADMTRFGQWWQRTIRNGHGFAQV
FT                   GRMHPPHFRREKLRVWAYGLVLPLVFLLGLFTSLWLSLAALGLYALSFWKTLKGLRGQP
FT                   MAARQAALLTLAKIPNLLGMLTYFRRRHRGVAMHIIEYK"
FT   gene            complement(298982..300166)
FT                   /locus_tag="Pden_0317"
FT   CDS_pept        complement(298982..300166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0317"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; HPP family
FT                   protein+B94; KEGG: rsp:RSP_0830 CBS-domain-containing
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68431"
FT                   /db_xref="GOA:A1AYT7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYT7"
FT                   /protein_id="ABL68431.1"
FT                   /translation="MTRPAGAVLHQIAQALGPAIAPGSPREALRAGIGALAGLGVSGLF
FT                   LLSPTTDLRLGLYMIAPFGATSVLVFAVPNSPLAQPWSAVVGNCVAAAVGVLACMLTPS
FT                   STLCVALAVGVTITAMILLRAVHPPAGAVAMTAALNPEAIRELGFHFVLAPVLTGTLAL
FT                   VGLAMIYARLTGRRYPFRQFDEPGPHGTADHPAMERLGLSREELTEILQRYRQSLNLGV
FT                   EDLARLIGAAELQAATHRTGPLTAADVMSRDLVTVAPHTRLVRVADIFRKHGFTSLPVV
FT                   DGEGRFCGVIFQLHLIRRARDDAFRHDRRFSAAMSDLLTPSRGMPTRAREIMQTDPPHV
FT                   APDTPIGALLPMLASGECDAVPVLDGQRIVGIVTQTDLISALARQSLRQDLPAH"
FT   gene            complement(300271..300927)
FT                   /locus_tag="Pden_0318"
FT   CDS_pept        complement(300271..300927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0318"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: psb:Psyr_0495 regulatory protein,
FT                   GntR:bacterial regulatory protein, GntR"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68432"
FT                   /db_xref="GOA:A1AYT8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYT8"
FT                   /protein_id="ABL68432.1"
FT                   /translation="MAEAREPAPSLAEEIAARLRDQVTGGALVPGQRLSEARVAAELDI
FT                   SRNTLREVFRLLTREGILRHEPNRGVFVAVPSMASILDIYRVRRLIEVPALAQAWPGHA
FT                   AVARMRSAVARATELQRIPDWRGVGSANMEFHAAIVALTDSPRLIQFFTQIIAELRLAF
FT                   GLLDSPELLHRPYIPRNAEILGRLEAGDPAGASRMLEDYLNQSERAVLEAFARLG"
FT   gene            301221..302456
FT                   /locus_tag="Pden_0319"
FT   CDS_pept        301221..302456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: atc:AGR_L_1874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68433"
FT                   /db_xref="GOA:A1AYT9"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYT9"
FT                   /protein_id="ABL68433.1"
FT                   /translation="MAESVTSPSAASAAARGGFMAAIFLMATSAIGPGFITQTATFTAK
FT                   LGAAFAFAILASIVIDFVVQLNIWRITALTKRNASDTANAAIPGAGYLLAILVLVGGLA
FT                   FNIGNIAGAGLGLNAMFGLEPKIGGALSAALAIGIFLSRRAGLLLDRSLIGLGLLMIAM
FT                   TVIVALVSNPPVGDAVRQMVLPEIVDFATITTIVGGTVGGYITYSGAHRLLDKGLVGEQ
FT                   NLAAVTRASLTGIAVTGVMRFILFLAILGVVASGVTLDLSGQAANPAAQAFAVVLGEWG
FT                   MRIFGLIFWAAAITSVIGAAYTSVSFLVAFRTMGDRDRNIATVIFIAISLAVYLSLGTA
FT                   PAAILVFVGGFNGLILPIGLTIFTYVGFARADLMGGHVYNRPLLIASAVVCALTWYMGF
FT                   NSIGPIFAFLSA"
FT   sig_peptide     301221..301304
FT                   /locus_tag="Pden_0319"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.640) with cleavage site probability 0.271 at
FT                   residue 28"
FT   gene            302525..303298
FT                   /locus_tag="Pden_0320"
FT   CDS_pept        302525..303298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0320"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: pst:PSPTO_5378
FT                   LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68434"
FT                   /db_xref="GOA:A1AYU0"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYU0"
FT                   /protein_id="ABL68434.1"
FT                   /translation="MTRNIDLNSDLGEGYGAWKMGDDATMLGIVSSANVACGFHAGDPL
FT                   TILVTVREAAARGVAVGAHVSYPDRVGFGRRPMDVTHAELAADVIYQIGALQGICASAG
FT                   TRVSYVKPHGALYNTIATDPRQGAAVIEGIKAVDPGLAMMGLAGTQILRQAAEAGLPTI
FT                   AEAFADRAYRPDGQLVSRREPGAVLHDPEAVAARMLRLATDGEVEAADGSVLHLHADSI
FT                   CVHGDSPGAVAMAARIREVLLAGGVSIAPAAGGAA"
FT   gene            303295..304086
FT                   /locus_tag="Pden_0321"
FT   CDS_pept        303295..304086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0321"
FT                   /product="protein of unknown function DUF1445"
FT                   /note="PFAM: protein of unknown function DUF1445; KEGG:
FT                   atc:AGR_L_1868 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68435"
FT                   /db_xref="GOA:A1AYU1"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AYU1"
FT                   /protein_id="ABL68435.1"
FT                   /translation="MTLLPDPAEARAARLACRQGAPRPTAGMAPGFTQCNMISLPKDWA
FT                   WDFLLYAQRNPKPCPVLDVTDPGSHRTALAPKADLRTDIPLYRIWRDGVLAEETPDATA
FT                   AWAEHPDLVTFLIGCSFTFETPLQQAGIEVRHIAQGCNVPMFLTDRDCRPAGRLHGKMV
FT                   VSMRPIPAGRVAEAAMISGRTPAVHGAPVHIGAPEALGIADLSRPDFGDPVQIRPGEVP
FT                   VFWACGVTPQAALMASKPPFAITHAPGYMFITDVPDTHWQV"
FT   gene            304074..305642
FT                   /locus_tag="Pden_0322"
FT   CDS_pept        304074..305642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0322"
FT                   /product="Allophanate hydrolase subunit 2"
FT                   /note="PFAM: Allophanate hydrolase subunit 2; Allophanate
FT                   hydrolase subunit 1; KEGG: atc:AGR_L_1866 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68436"
FT                   /db_xref="GOA:A1AYU2"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYU2"
FT                   /protein_id="ABL68436.1"
FT                   /translation="MAGVTMRFLPIGPRTLLAELDDLDQTLALFDALLADPVPGVAEIV
FT                   PAARTLMIRTAPGVAADARLAGAILARQPAPGTQPNARASETVELPVTYDGEDLADVAA
FT                   HMGLTEAEVIAAHQETIWQVAFCGFAPGFAYMTCDDPRFDLPRRPAPRTRIPAGSVALA
FT                   GRFCGVYPQETPGGWQLIGRTEVPMWDLSRDPPALLRPGVRCRFVARRAEVHASATIPQ
FT                   PQPEQGLRLLSTAFPIVFQDEGRPGQGGQGVSASGALDMGAARRANRAVGNPSDTPVLE
FT                   ITLGPVRLRADQPMTLALTGASQASIAGHAVPHGAAFAVDAGDEITIAPPGAGMRSYLA
FT                   LRGGFRVAPVLGSAATDTLAHVGPEPVVAGTVLAVANHSAVAAAAAEAEPALPKPGDLV
FT                   ELPVTLGPRADWFTPDMVRHFLTQEWLVTPQSSRVGIRLQGDAVTREDAVELPSEGTET
FT                   GAIQIPHSGQPVLFLADHPLTGGYPVIATLRPEALDLAGQIPPGARIRFTASADFAPIT
FT                   PERPA"
FT   gene            305639..307405
FT                   /locus_tag="Pden_0323"
FT   CDS_pept        305639..307405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0323"
FT                   /product="biotin carboxyl carrier protein / biotin
FT                   carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; phosphoribosylglycinamide synthetase;
FT                   ATP-dependent carboxylate-amine ligase domain protein,
FT                   ATP-grasp; Carbamoyl-phosphate synthase L chain,
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   atc:AGR_L_1864 biotin carboxylase protein A2"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68437"
FT                   /db_xref="GOA:A1AYU3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYU3"
FT                   /protein_id="ABL68437.1"
FT                   /translation="MTIFATGPTRPIRRLLIANRGEIAVRVIRACRDEGIESVAVYADA
FT                   DRDAIFVRMADQAQALGGDKPAETYLDAGKIIAIARAAGADAIHPGYGFLSERAEFAQA
FT                   VQDAGLIWIGPDPKVIEALGDKIEARRIAEAVGAPLVAGTPGPVESPAEALAFARQHGL
FT                   PIAIKAAFGGGGRGMKVAWRLEEVEELFESATREALTAFGRGECFIEQFLDRPRHVEAQ
FT                   VLADKHGTVKVIGTRDCSLQRRNQKLVEEAPAPFLTDEQRARIHDSARAICAHAGYSGA
FT                   GTVEYLLSANGTISFLEVNTRLQVEHPVTEETTGIDLVRGMIRVAQGARLADETVPEPR
FT                   GHAIEFRINAEDPARGFLPTPGPVEVFDAPSGPGIRMDSGVAQGSVVPGSFDSLMAKLI
FT                   VTGATRQEALQRAERALREFRIEGVASVLPFARAVLAQPDFRAEDGDFRVHTRWIETDF
FT                   AEALAEAVAPHARVAPAAQAPLLRLAIEIDGKRHELGLPANLLSALPAGGASAVQPAPE
FT                   ADEAVLTAPVPGTLTLWQAEDEAEVEQGQVVAVIEAMKMETRIEAHRAGKLTRIAAQGE
FT                   VLGFGAALARID"
FT   gene            307485..308516
FT                   /locus_tag="Pden_0324"
FT   CDS_pept        307485..308516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0324"
FT                   /product="putative ammonia monooxygenase"
FT                   /note="PFAM: putative ammonia monooxygenase; KEGG:
FT                   jan:Jann_2088 putative ammonia monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68438"
FT                   /db_xref="GOA:A1AYU4"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYU4"
FT                   /protein_id="ABL68438.1"
FT                   /translation="MSLLNRRILTSALAALGGAAFLLLHLPLPMLLGPMLACLIAALAG
FT                   APLAGAGQFGIFMRTILGVAVGASITPGVLAELPDVAASLLFVPGFIGVIALVGYPLFR
FT                   RVFGFDHATAWYGAMPGGLQDMLVFGEEAGGDIRALSLIHATRVLVIVTVAPLIMTAWW
FT                   GVDLSQPPGTPMRATGAAEIALMVAAGLIGWKGAERLGIFGASILGPMVLTAALSLSGL
FT                   ITQRPPAEMIQAAQFFIGIAVGVKYAGITLRELRLHVTAGIVYALLLAWISLIFIEVIV
FT                   HLRLAPGLDAFLAFLPGGQAEMVVIALIAGADLAYVVSHHLLRMIIVIVLGPVVGKVLG
FT                   RRS"
FT   sig_peptide     307485..307559
FT                   /locus_tag="Pden_0324"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.455 at
FT                   residue 25"
FT   gene            308566..309129
FT                   /locus_tag="Pden_0325"
FT   CDS_pept        308566..309129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0325"
FT                   /product="protein of unknown function DUF886"
FT                   /note="PFAM: protein of unknown function DUF886; KEGG:
FT                   mlo:mlr8324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68439"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYU5"
FT                   /protein_id="ABL68439.1"
FT                   /translation="MSHRILKAADHRRMPWKNGRGETVEIAVHPQGAGLADFGWRVSMA
FT                   GVSEDGDFSIFPQIDRTLAVLTGEGIELDVQGQARRRLTPESGPLAFPADVPTSARLLG
FT                   GPITDLNVMTRRGAFTHRLSRLTEAAVGAPGWRLVLATAPVVLDLAGATVALDQLDALF
FT                   CEGPDAALPVGPAADAWLIEIDRA"
FT   gene            complement(309179..310213)
FT                   /locus_tag="Pden_0326"
FT   CDS_pept        complement(309179..310213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0326"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mlo:mll2315
FT                   alkanal monooxygenase (bacterial liciferase alpha chain)
FT                   like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68440"
FT                   /db_xref="GOA:A1AYU6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYU6"
FT                   /protein_id="ABL68440.1"
FT                   /translation="MKKIGVKKIGFLSFGHWSDEPASQARSAQDTLLQSIELAVAAEEL
FT                   GADGAYFRVHHYARQLASPFPLLAAVGARTQRIEIGTAVIDMRYENPLYMAEDAGAADL
FT                   ISQGRLQLGISRGSPEQVIEGWRYFGYTPAEEESDADMARRHAEVFLNVIEGHGFARPN
FT                   PRPMFPNPPGLLRIEPHSPGLRERIWWGAASNDTARWAAQLGMHLQSSTLKTDENGKPF
FT                   HVQQAEQIRAYREAWAAAGHEREPRVSVSRSIFPLMDDRDRMYFGRGGKEADQIGFIEE
FT                   TRSIFGRGYTAEPDRLIEELREDEAIAEADTLLLTVPNQLGVDYNAHVIEAVLSHVAPA
FT                   LGWR"
FT   gene            complement(310210..311184)
FT                   /locus_tag="Pden_0327"
FT   CDS_pept        complement(310210..311184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0327"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pau:PA14_48770 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68441"
FT                   /db_xref="GOA:A1AYU7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYU7"
FT                   /protein_id="ABL68441.1"
FT                   /translation="MRYDLNDLETFLTVMELGTVTAAAARLNLSKSVVSKRITDLEATL
FT                   GAALFRRNAGRITPTEAALRLAERLRPALAELIAAAESTAWDMDGLAPLRGSLSVAAPM
FT                   SFGVLHLGPIIARFAAQNPELEISVDYDDRSRDLAREGFDIGIRIGKMRDKALMQRKLC
FT                   EDASIACASPAYLDRKGRPQTLADLREHEVIGYSHLPNSQLWQFQDRDRFVSPFVQGRL
FT                   SMNNGEAIRDMTIEGLGLAMLPGFVVAPALADGRLERVLPGFGTRPLPIVAVWPPVQPM
FT                   PAKLRRFIDHLAVELSSPAWQAGWVSARRDPISQEPTTPKVAP"
FT   gene            311304..312248
FT                   /locus_tag="Pden_0328"
FT   CDS_pept        311304..312248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0328"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sme:SMc01961 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68442"
FT                   /db_xref="GOA:A1AYU8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYU8"
FT                   /protein_id="ABL68442.1"
FT                   /translation="MELTGIHHLTAITADAPGNKRFYTDTLGLRLVKKTVNQDDTSAYH
FT                   LFYADGLARPGTDLTFFDWPAAPERRGTHSISRTGLRVAGDSLDYWAGRLADRGLTLGR
FT                   VAEIDTRASLDFEDPEGQRFRLTEDAQDAVTAPWEKSPVPAQHQIHGLGPITISVPDLA
FT                   PTEIVLTHVMGMRKVRDYASPDGHGTVHVYEMGQGGPSAELHVAVQPDLAVARQGAGGV
FT                   HHVAFRVPDKPAIHDWARRLNEMRVPSSGEVERYYFRSLYFREPGGNLFEIASDEPGFA
FT                   VDEPLESLGETLSLPPFLEGQRAQIEARLKPLD"
FT   gene            312401..312802
FT                   /locus_tag="Pden_0329"
FT   CDS_pept        312401..312802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr6753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68443"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYU9"
FT                   /protein_id="ABL68443.1"
FT                   /translation="MSQSEKGTPASELIDARIRELGNWRGETLARLRALIHEADPEVVE
FT                   EWKWRGVPVWSHDGILCTGETYSQVVKMTFAKGAALEDPSGLFNASLEGNTRRAIDLRE
FT                   GERIKAEALKALIRAAVALNRARKKGRSK"
FT   gene            complement(312834..313427)
FT                   /locus_tag="Pden_0330"
FT   CDS_pept        complement(312834..313427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0330"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   mlo:mll2599 probable reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68444"
FT                   /db_xref="GOA:A1AYV0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYV0"
FT                   /protein_id="ABL68444.1"
FT                   /translation="MTRKPHIAIIIGSTRAARFADKPAAWLLENAQKRDDMSFELVDLR
FT                   DYDLPLFDEVASNLWVPSQDPRAIKWQQKLAEFDGYVFVTSEYNHSISGSLKNALDQAY
FT                   KEWNHKPAAAMGYGGVGAARAIEHLRGIAVELQMVPLRNAVHLGGGDFFKVSPLGANGE
FT                   MAEVEANLLPSLNAMLDELLWWAEATMAQRAKTA"
FT   gene            complement(313684..315213)
FT                   /locus_tag="Pden_0331"
FT   CDS_pept        complement(313684..315213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0331"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sme:SMc01956 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68445"
FT                   /db_xref="GOA:A1AYV1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYV1"
FT                   /protein_id="ABL68445.1"
FT                   /translation="MPTGIHHVTGITRRVQANVDFYAGFLGLRLVKRTGGFEDAEQLHL
FT                   FYGDALGSPGSLVTFLVWEDGAPGRVGHGQVAEIALAVPPESIGDWLTRAMTARVPVEG
FT                   PLRERGETVLRLKDPDGVTVKLVGVDLPATAPLPDPIAPTRLRGATILTEQPQATRDFL
FT                   ARFGYRPGAAEGAVQRMESDTDTVDIRDATGFFPGIPGTGILDHVAFRAPDADAVRRMR
FT                   LELKDTDATTVHDRKYFLSLYVREPAGTLLEYATDAPGFTLDEAPEHLGETLFVPPHDA
FT                   ARADDLRVILPQFALPGEERSPMRELHFIHRFHRPESPDGSTIVLLHGTGGNESDLMPL
FT                   AHRMAPNATLLGVRGRSTEEGINRWFRRHDAVTYDQDDIRAETEAFAGFIDEAARAYAL
FT                   DPGALTYLGYSNGANLLGAAMQLHPGLIGRAVLLRAVQVLEEPPALDAQALAGSRVLML
FT                   TGARDPFARMAPALERALRDGGAALEARVIEAGHELQPEDLTLAAGWLAHD"
FT   gene            complement(315226..315843)
FT                   /locus_tag="Pden_0332"
FT   CDS_pept        complement(315226..315843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0332"
FT                   /product="Glutathione S-transferase, N-terminal domain"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   Glutathione S-transferase, C-terminal domain; KEGG:
FT                   bpa:BPP2935 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68446"
FT                   /db_xref="GOA:A1AYV2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYV2"
FT                   /protein_id="ABL68446.1"
FT                   /translation="MPTLFYHAGACSLAPHIVLEWTQAPYEAVAVEFGSAELLAVNPAG
FT                   AVPVLREDDGWILTQAGAILHHLARKHPEADLGGGDDLRAQAELDRWSSFFTGDLHPAF
FT                   FPLFTPQRYTTSRDKADREAVQEAGRKLVRKRLALLDAHLDGRDWILGRRSVIDAYAFP
FT                   MLRWAAKLLPEGTQGWANVQALHDRIAADPAVQTVLAREEGA"
FT   gene            complement(315957..316754)
FT                   /locus_tag="Pden_0333"
FT   CDS_pept        complement(315957..316754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0333"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: rsp:RSP_0831 tryptophan synthase subunit
FT                   alpha; TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase, alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68447"
FT                   /db_xref="GOA:A1AYV3"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AYV3"
FT                   /protein_id="ABL68447.1"
FT                   /translation="MSRIDDTFARLSETGGKAFVAYMMGCDPDFDTSLQIMRGLPGAGV
FT                   DIIELGMPFTDPMADGATIQAAGQRALAAGGSVSRVLDMVRAFRRDDDATPIVLMGYYN
FT                   PIYARQGGVDRFITEAVEAGVDGLIVVDLPPEEDAELCLPAREAGLNFIRLATPTTDDR
FT                   RLPAVVRNTSGFVYYVSVTGITGGPAANAAEVAPEVARIRAAAKLPVVVGFGISTPEAA
FT                   QAVAGVADGCVVGSAIVKLIGEGRPVPEILSFVADLAQGAHSA"
FT   gene            316884..317981
FT                   /locus_tag="Pden_0334"
FT   CDS_pept        316884..317981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0334"
FT                   /product="GTP-binding protein YchF"
FT                   /note="TIGRFAM: GTP-binding protein YchF; PFAM: GTP-binding
FT                   protein, HSR1-related; Protein of unknown function DUF933;
FT                   KEGG: rsp:RSP_0832 putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68448"
FT                   /db_xref="GOA:A1AYV4"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYV4"
FT                   /protein_id="ABL68448.1"
FT                   /translation="MGFRMGIVGLPNVGKSTLFNALTKTAAAQAANFPFCTIEPNVGEV
FT                   AVPDPRLDKLAGIAGSKQIIPTRITFVDIAGLVKGASKGEGLGNQFLANIREVDAIAHV
FT                   LRCFEDGDVTHVEGRVDPIADAETIETELMIADLESIERRLANIQRKLKGGDKEAVAQE
FT                   KLLKAAQAALESGKPARTVQVADEDRKAWDMLQLLTAKPVLFVCNVEEDKAATGNSQSE
FT                   RVAQMAAEQGAGHVVISAKIEEEISQLPAEEADMFLEEMGLHEAGLDRLIREGYKLLGL
FT                   ETYFTVGPKEARAWTIHKGTLAPAAAGVIHGDFERGFIRAETIAYDDYVTYKGEAGARE
FT                   AGKFRVEGKSYEVQDGDVLHFLFNA"
FT   gene            complement(318371..319441)
FT                   /locus_tag="Pden_0335"
FT   CDS_pept        complement(318371..319441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0335"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   gox:GOX2318 prophage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68449"
FT                   /db_xref="GOA:A1AYV5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYV5"
FT                   /protein_id="ABL68449.1"
FT                   /translation="MPLKLIKRGEIWYIRGTVAGQRVYESTRIGDKRQAEILRARREAE
FT                   IIERRAYGKAVTYTFAEAALAYMESGGEGKYLARIIKHFGPRWRLVDTDNDAVSRAAAA
FT                   LYPDAGPATINRQLITPISAVYRLAAEDGKVPDRRFRRRKEPRTRLRWLTPEEVEALLA
FT                   ACDRRLLPIVAFLLGTGCRTGEALGLTVQHLHLDTCEAYVGVTKNGDGKMVQYPGRTRR
FT                   IMVASGLPEAGAVFRTPKGKPYRLTNSSGSRLGGQIKGAFDKARDAAGLGEDVTPHTLR
FT                   HTFATWHYAVNRDLILLMERGGWRKPDMAIGYTKLAPADLPRRLFEHGWDFRANYVHDA
FT                   ALPDDFGKKIKIMREA"
FT   gene            complement(319640..319954)
FT                   /locus_tag="Pden_0336"
FT   CDS_pept        complement(319640..319954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68450"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYV6"
FT                   /protein_id="ABL68450.1"
FT                   /translation="MKMNNSEGRLGEFERHLTGGFEHGKLMFLENSDPSIGTELVMFFM
FT                   DVEYDPVRVTFDPEGMASIHSDGHNWHMLSADQLMMLSDMCEEAVRMWEKWDEEHQDDG
FT                   "
FT   gene            complement(319992..320720)
FT                   /locus_tag="Pden_0337"
FT   CDS_pept        complement(319992..320720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_3624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68451"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYV7"
FT                   /protein_id="ABL68451.1"
FT                   /translation="MTAALRVGVLCETSGTMRRAFAALGHDATSVDRLPAEDGSNHHIV
FT                   GDVRDYLDYGWDLLIVCHPPCTRLCNSGVRWLSDPPKNPPDDATPAEKVAWPILPREAR
FT                   LAIMWRLLDEGAELFAACWQAPVARVAVENPVMHKHGRARMPADLPKPQIVQPWWFDEP
FT                   AFKATGFYLRGLPPLTATKRLIPPSAATEPERHKAWSAIHRASPGPDRWKIRSRTFDGI
FT                   ARACAEQWGGYALDQIRRMA"
FT   gene            complement(320717..321160)
FT                   /locus_tag="Pden_0338"
FT   CDS_pept        complement(320717..321160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68452"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYV8"
FT                   /protein_id="ABL68452.1"
FT                   /translation="MQVNRYLEDKAMDRIDHALGRPVNPLAQTYRDHFAASVGSRAAEE
FT                   MAASPHWRAGGSDGKLQWFFVTRAGQEALRDHLRKIGDQHRLYVVIWDGMEMPCVATSP
FT                   SKARYSKWLDVTDGFCEVSFKDFCRAARVRLAVGGGGAAEGWA"
FT   gene            complement(321356..322261)
FT                   /locus_tag="Pden_0339"
FT   CDS_pept        complement(321356..322261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0339"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_3428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68453"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYV9"
FT                   /protein_id="ABL68453.1"
FT                   /translation="MTSDIVSVEIGRSTWQGPAEEAPQRAEPITQGDLVSALEQIEILT
FT                   ATGSGLDPDTTMHIHLLAGIGRATHDPYAWYSRADLCASGQQVRALMDAAQTILDRGYV
FT                   SQSIAEEKPDHDALRDALAALTPAPQPEGPPDDLAVDRFAAAMKAKLAKKRTEGRGGWD
FT                   RKDECSAELLSRLLREHVEKGDPVDVGNLAMMLHQRGERIVPGGEAKSIAPQPEGEAVP
FT                   KCVACEDSPKPPNVPCAVCGAHPAQPGETVAAVERAFADIRELNMLDRDENGHRWANSD
FT                   LIDQTVTSGLIALRALKGGA"
FT   gene            complement(322258..322677)
FT                   /locus_tag="Pden_0340"
FT   CDS_pept        complement(322258..322677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68454"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW0"
FT                   /protein_id="ABL68454.1"
FT                   /translation="MKTIEQLTASETAWYSSNDTEVWHGGPYATREEAEDGAKAEEHEW
FT                   IMRATKWPVRVSEFFSQGCFFEAAEESLYDQCDEDGSPILDFTPAINLDLQSRVRAAID
FT                   EWQVAHQLSPMPWRFSGSDEPEIAAWAKAAEGGDA"
FT   gene            complement(322674..325319)
FT                   /locus_tag="Pden_0341"
FT   CDS_pept        complement(322674..325319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0341"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   mes:Meso_1199 helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68455"
FT                   /db_xref="GOA:A1AYW1"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW1"
FT                   /protein_id="ABL68455.1"
FT                   /translation="MGQHPSYDEFLRAKAAIAPRFGGMQVDEATLNPALKPHTRRMVSW
FT                   GLQGGRRAWFASFGLHKTATQLETMRVLTETTGQPTLITAPLGVRREFMREAQERFRGS
FT                   FAVDLKFIRDSDQVDGPGIYLTNYESVRDGKVQPDPFIGVSLDEAAILRGFGGTKTFRE
FT                   FMALFAGDDRRDQSNRIKTAGVPYRFVATATPSPNDYIELLSYAGFLDVMDIGQAKTRF
FT                   FKRNSEKADQLTLMQHKEREFWLWVASWALFVTKPSDLDPSFSDEGYDLPPLDVRWHEL
FT                   PVDHLAGAAVEKSGQKRMFKDVARDLKVAAREKRTSIGGRIEKLMEIRAEDPAAHRIIW
FT                   HDLEAERAALEKTVPGIATVYGSQDLDQREELIGDFADGRVQELGAKPVMLGSGTNLQR
FT                   HCAWHVFLGIGHKFNDFIQAIHRLLRFGQPADSVRLDLIYTEAEREIRRSLERKWRQHN
FT                   EMVQKMIDIIKEFGLSEVAMQQALVRALGVERVEASGPDYRCVHNDCVAETRSMPDASV
FT                   QLIVTSIPFSTQYEYSPNYADFGHTDDDPHFWQQMGFLIPELLRVLEPGRICAIHVKDR
FT                   IIPGGINGFGFQTLSTLHMDCVREFQRHGWAYLGMKTITTDVVRENNQTYRLGWSEQCK
FT                   DGSRMGCGVPEYLLIFRRPPSDTSNGYADRPVKKAKKEWDPEAKDWRNEGGYSRARWQI
FT                   DAHGYMRSNGDRTLLPEELEGLDADQVYKVWKAYNLQQVYDFEHHVRIGEALEKKGRLP
FT                   PTFMLLPPHSAHPDVWTDVARMMTINAEQARKGNEMHLCPLQYDIVDRAIAQFTERGEW
FT                   VYDPFGGLMTVPFRAVKLGRKGIGVELNKGYWLDGCKYVEAASREAGMPSLFDLLDADQ
FT                   PENQKLRRTA"
FT   gene            complement(325323..326441)
FT                   /locus_tag="Pden_0342"
FT   CDS_pept        complement(325323..326441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0342"
FT                   /product="DNA polymerase III beta subunit family protein"
FT                   /note="KEGG: jan:Jann_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68456"
FT                   /db_xref="GOA:A1AYW2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW2"
FT                   /protein_id="ABL68456.1"
FT                   /translation="MTLMEPIKPAATAGITCTVADLRRAVNAAAFVVERRNTIPVLGCL
FT                   RIEPLNDKLRIESTNLDSWLMVDCPATCIEGKPFVIDARLLLALLTGAERDDSVSITLD
FT                   GNVVTLRIGPAVARVQLLCPASDWPTAPSTKGMSWVSIPEAALARMIGRVRWAISTEET
FT                   RYYLNGIYMHGREGRLAVTATDGHRLALYHSDIEYKLPDLIFPRYSVAALCNLMTDGGN
FT                   QLLRIGGSADPVRMQISGDGWSLTVKCIDGAYPDYTRVIPDRGTMRGYAVINRALLRRF
FT                   PNTRRMHLLRDALKFDLDKRVANLNSVGLGIDVEIPIEADGDFAIGFNEGYVREVARIF
FT                   DTVRIEASTARDAALILTEDPDLTVVIMPMRM"
FT   gene            complement(326577..326789)
FT                   /locus_tag="Pden_0343"
FT   CDS_pept        complement(326577..326789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68457"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW3"
FT                   /protein_id="ABL68457.1"
FT                   /translation="MQDAAAAKTMFVEGRDGLILDRHTGRELARVAVDKMTITEAQRIS
FT                   RAILAGLEAEYALDPRPDGPPLPKP"
FT   gene            327011..327613
FT                   /locus_tag="Pden_0344"
FT   CDS_pept        327011..327613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68458"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW4"
FT                   /protein_id="ABL68458.1"
FT                   /translation="MAGRWRWRCITPCALATTMQARRRRLSGAASANSALAMMVRASET
FT                   ARGVTMREGSCIRRSIQGLRMRLKLTGQKSYVNIKQDSNPIISDFRPGATHWPVLRIGR
FT                   NSSPFVLANARSWLNDRVASDKGGAMLSKSETLRCLLRLDDSAVVSLRFAVEVAKRAAS
FT                   ERSAGASAASILPQNSDAVLAPEDDFPPVALGEIARK"
FT   sig_peptide     327011..327139
FT                   /locus_tag="Pden_0344"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.815) with cleavage site probability 0.793 at
FT                   residue 43"
FT   gene            328067..328573
FT                   /locus_tag="Pden_0345"
FT   CDS_pept        328067..328573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68459"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW5"
FT                   /protein_id="ABL68459.1"
FT                   /translation="MLSLTADCSPGWITAASVCLGPWTAFAPTCPLIRSAAISVSFLLN
FT                   PPPRRHNPKSILMSLICKIPDRPRSGLPSRQMSFTPPVGGRGRSVAARRRAHVHAQRDT
FT                   DGFLRRWSMLMIVSFSTAEACGQHFGVTKQTGCNWREGTHRPCGDAVDFAMQTLPRYAE
FT                   IMWGQ"
FT   gene            328573..329100
FT                   /locus_tag="Pden_0346"
FT   CDS_pept        328573..329100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68460"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW6"
FT                   /protein_id="ABL68460.1"
FT                   /translation="MDEPDLKPLMGARLARTSEVIERGNAMTAQDTDNWAADEAAERDP
FT                   SDDLGRLFPREGVQHPISESAAWALCAPFVGLVRCNWRVKRVDTDLFEQAIKTWWECLR
FT                   KARLPEERLTCERMINALGLANGMDNRARASELAAENVERFMAHRKEMARVRSERKEAA
FT                   CVDAWRDFRSVP"
FT   gene            complement(329084..329443)
FT                   /locus_tag="Pden_0347"
FT   CDS_pept        complement(329084..329443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68461"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW7"
FT                   /protein_id="ABL68461.1"
FT                   /translation="MLPRPGQPESPCWSWFFGLRIPRPVGNALPIHAEGTAMTETARLN
FT                   ARVEALESIVISMLQLAEDRDSDLHKHIIQRLNKAIRETDEADGIPEEDTDAEKPVALT
FT                   SKCIKAIRDQFKARS"
FT   gene            329665..329997
FT                   /locus_tag="Pden_0348"
FT   CDS_pept        329665..329997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68462"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW8"
FT                   /protein_id="ABL68462.1"
FT                   /translation="MHAHPRDLKSNTAARLMSIAAIRARLSMLAVAYAARIGAVNMNDV
FT                   LATASAVVAVFGEDHDLSREMRGFVDSLPELRRHVPDLASAGDRLIRAVERTTWPDADG
FT                   RADIHG"
FT   gene            329990..330304
FT                   /locus_tag="Pden_0349"
FT   CDS_pept        329990..330304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68463"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW9"
FT                   /protein_id="ABL68463.1"
FT                   /translation="MADQPRLSLADHAMIHALGVLSRPPITDRAGLDLVVGVMRDLMPG
FT                   VTRENPQLMGLIQTADQFATCRVAVPGCYGGLHDRAWKVMNDWDRRRLAEAWDRARGAK
FT                   "
FT   gene            330301..330513
FT                   /locus_tag="Pden_0350"
FT   CDS_pept        330301..330513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68464"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYX0"
FT                   /protein_id="ABL68464.1"
FT                   /translation="MRTHRDRHGNAYRAGAREGVGDFLADLLALTPPSTHDDLKKLARN
FT                   VLARPKYRRVSQKTAMNGGPNVAKQ"
FT   gene            complement(330675..331004)
FT                   /locus_tag="Pden_0351"
FT   CDS_pept        complement(330675..331004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68465"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYX1"
FT                   /protein_id="ABL68465.1"
FT                   /translation="MANKLSDEEIAEMADDIDNLYGLHHGHRRATGALEIALLAVLDTL
FT                   EDKFPGMREIVVADMREAAEKQRSFMRMQQETNPACDISDDDIEEELDTLEDLIFKLER
FT                   RMITE"
FT   gene            331125..332267
FT                   /locus_tag="Pden_0352"
FT   CDS_pept        331125..332267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0352"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sit:TM1040_1631 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68466"
FT                   /db_xref="GOA:A1AYX2"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYX2"
FT                   /protein_id="ABL68466.1"
FT                   /translation="MTQDDHRLDEAKAMPIADVVARLELSGLVRTGGELVGPCPQCGGR
FT                   DRFGVNLKDGVFTCRKECGPHARGDQIALVQHVLGLDFRGALEWLCGPAQGLSDAERAE
FT                   RRRKAEANRRKQADIARRARENSIRAARDIWFAAGPAEGTLVRDYLTLRGIDPAHYPDL
FT                   PQVLRFDPEARYTIPVEGKTQEWQTVHVGPAMVAAVVDAGNRVSAVHRTWLDLDQPKGK
FT                   LVLPDPRKPGETLPAKKVLGSKKGAVIRFLTPQDCDTMIMAEGVETTLSALIAEAMPRR
FT                   CAYWCGVDLGNMAGRMQRGPGLKYAGLPDMDDSEAWLPPVWVKTLIFVQDGDSDPKLTR
FT                   AKLLAGLRRAKRKNPGLIAKIVHAGEGRDLNDILMGQRDE"
FT   gene            332260..334101
FT                   /locus_tag="Pden_0353"
FT   CDS_pept        332260..334101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0353"
FT                   /product="phage/plasmid primase, P4 family"
FT                   /note="TIGRFAM: phage/plasmid primase, P4 family; PFAM:
FT                   Poxvirus D5 protein; KEGG: bld:BLi03629 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68467"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYX3"
FT                   /protein_id="ABL68467.1"
FT                   /translation="MSDDDALGQVRAVMSNAEEVDLPEGMEPDGHDDGYPDDYAPPPPP
FT                   PDEGGGEGEPEDPVSRASREPLNDLGNARRFVIHFGDDILFVSQVGWFVWDGSRWRKDD
FT                   EISRDVSPLIRAQAHKVSTLILQEIDWLQPNDRDRKLIEEDRDLKVRRREIENAPGYAA
FT                   DESLMKELASIEARLRALDAALKSYRNLTTRRLTWAKDAGNSTRIAHMIAEARVMLARA
FT                   VDDMDQGALDVNTLSGVLRFTRIPNDPEAGMTGMSSVELIPHDRAQLLTKIMPVIYDPD
FT                   AKCPRFDSFLEQIQPNIEMRRFLQRWFGLSMTGLAVQKLAFFHGGGANGKSVLVDLMAR
FT                   MFGDYSASARIESLTGKNKKSGSDSQPDLMPLIAARFVRTSEPEDGERLQEGLVKALTG
FT                   GEPMMIRALYSDFIIFRPIFKLTISGNHLPEIRGGDDGIWRRVMLVNFPVQIPEKKRIP
FT                   KEELDEILWQERSGILNWLIQGLIDFLDGGLQEPDDVTSATEGYRAESDPIGTFLGDAT
FT                   VVTGFEGDFMTARELIEAFNFWIEERGETRWGNRTVSNKLKAKSGTWRHPETNKTFAPG
FT                   KSGVTGYRGIRLDDTFLSRKRSAEASSSQSSWGGSPR"
FT   gene            complement(334153..334449)
FT                   /locus_tag="Pden_0354"
FT   CDS_pept        complement(334153..334449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68468"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYX4"
FT                   /protein_id="ABL68468.1"
FT                   /translation="MLRSFVFKGLTLFFGPDGLEGLENLTFTHEAFPPYPAVSRACVHV
FT                   DFSGPSGPSGPKIGIKPLILRKRHPLTPEGFQAHHRRPSGPSGPTTMRWHKDA"
FT   gene            334560..335318
FT                   /locus_tag="Pden_0355"
FT   CDS_pept        334560..335318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_3778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68469"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYX5"
FT                   /protein_id="ABL68469.1"
FT                   /translation="MMNKAERIAAGRLLVQAAQEAREAWRAEEAARLAAIRDASAIPDQ
FT                   CGPDTIAAPARGPFVVEPQFTMVPNGVDKHGLDKWAAAATGYGHRASVRAADVFDRMIA
FT                   SALRRKRSCPLTHGQIAMGRHYAMLVELAAADGTKVSRLDASRAGGDSMGWMDRHLDIA
FT                   QELTILRNRIGFSAAMTVRRIRPSKRGETQRGPIMDRVLVDMVCIKGCTLDEVLVSHGW
FT                   AVKGAHRKAVTEALSAALDRMIGYRDKKTS"
FT   gene            335488..335838
FT                   /locus_tag="Pden_0356"
FT   CDS_pept        335488..335838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0356"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   rsp:RSP_2072 putative phage-related holin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68470"
FT                   /db_xref="GOA:A1AYX6"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYX6"
FT                   /protein_id="ABL68470.1"
FT                   /translation="MSRLGRMPSRFAGADQAGQRLSRAFQHRDQQREAIAPWRRWYKTA
FT                   RWQRLRESVLIRDQFTCRKCGTIETDTSMLVGDHIVPHRGDPELFWSQANVQCLCKTCH
FT                   DRDKQAEERNHV"
FT   gene            335888..336148
FT                   /locus_tag="Pden_0357"
FT   CDS_pept        335888..336148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68471"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYX7"
FT                   /protein_id="ABL68471.1"
FT                   /translation="MDALPAGGSILVVMTWDRARIYREGIVIRRGAEIEARTVVVSMGA
FT                   KDIISRLTGALLPIIITADVRAYCPRPLLLRIEDLAARPLN"
FT   gene            336322..336825
FT                   /locus_tag="Pden_0358"
FT   CDS_pept        336322..336825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0358"
FT                   /product="Resolvase helix-turn-helix domain protein"
FT                   /note="PFAM: Resolvase helix-turn-helix domain protein;
FT                   KEGG: sit:TM1040_1626 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68472"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYX8"
FT                   /protein_id="ABL68472.1"
FT                   /translation="MSGEVFDLFGNPVRPGRGQKGRPPFEVTDKDRNKVKLLLAMGWSN
FT                   QRVANAIGVSLATLKRYFRAELTVRDQMRDRLEARRLELAMDLANAGNTAGMRELDRLI
FT                   MKNDQKLAAAKMTQADEAEREEERPTSRYVGKGEISRKRANALAAGETQSEWGSLLKPG
FT                   SYEN"
FT   gene            336815..338536
FT                   /locus_tag="Pden_0359"
FT   CDS_pept        336815..338536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0359"
FT                   /product="phage Terminase"
FT                   /note="PFAM: phage Terminase; KEGG: rsp:RSP_2070 putative
FT                   phage-related terminase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68473"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYX9"
FT                   /protein_id="ABL68473.1"
FT                   /translation="MRTDDLPTPEVWDTSLPDWKERIVNRRPLIPDLPLFDAVAEKALA
FT                   IFKRLRLPDVIGNPTFAEAGDDWIFDFVRAVFGSYDPVRKVRMIREFLLLVPKGNAKTT
FT                   YAAAIILVAAIMNERPHAELMLIAPSQKIAKRAFSQAAGMIRLDESLSAMFDPKAYSNE
FT                   IVKLDEVVPSKIQIVSADPSVVTGAMATFTLIDETHEFSKMSKAADVFAEIKGSLGKRP
FT                   DGFLLQITTQSKAPPTGVWKSELTIARKVRDGEMRRSMLPVLYELPPEMAKDDGWRDRR
FT                   TWGMVNPNLNRSVTEDYIAGEIEKAEIDGPHQMALIASQHLNVEIGQGLNADRWAGALY
FT                   WAKNAVTGLTFERMLDECDVMVAAGDVGGADDLFGFSAIGRHRKSRNWLVWCWAWCLRP
FT                   VLELRKSIAPKLEELAQLGQLGITDTAAEQVEAAVEICCRIRDAGLFPKQAGIGLDPHG
FT                   VAALVDALEEERFELGKHIVPVGQGYKLSGAIKGVERRLFDGRMKHGGQELMTWCVGNA
FT                   KAEQRGNNVYVTKEAAGVAKIDPLIALFTGAILMDGNPEPAGNLDDFLSDPVLVAR"
FT   gene            338536..339873
FT                   /locus_tag="Pden_0360"
FT   CDS_pept        338536..339873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0360"
FT                   /product="phage portal protein, HK97 family"
FT                   /note="TIGRFAM: phage portal protein, HK97 family; PFAM:
FT                   phage portal protein; KEGG: rsp:RSP_2069 putative phage
FT                   portal protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68474"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYY0"
FT                   /protein_id="ABL68474.1"
FT                   /translation="MGVFTRALAAPFKLYHSVADEVAKDRRLRLSDGSGWSQLFGRSSY
FT                   AGKTVTMTSAMQLSAVWACIRVTAQAISALPLGVYERRGDDDRVRVDDDPVADVLTGSP
FT                   NADQTPLEFWEGMVAWLVTSGNAYAEKGLIGSRLTSLEPLQAGGLNCRPVRLPDGRLVY
FT                   RVTDRGKTEDLPRDKVLHLKGFGQSISDRDTGLSPIAVGANTMGAAMAAQEASSSVFAN
FT                   GMMPSGFILFDQQLTKDQRAQARKNLIEPLQGSGKTGAIGILEGGTQFLQTQMNPEDVQ
FT                   MLDTRRFDIEEICRWWGVPPIVIGHAGQGQTMWGSGVEQILISWLVLGINPICSRIEAR
FT                   VAKQLLRPHSSPRRYAEFNREALLQMDSTAKANFISRMVQSAIMTPGEGRAKLNLPRKD
FT                   GTDRLLAQTSLAPLETLGQDKPTGQLRQALLNLLGITEKDKGDEHS"
FT   gene            339860..340702
FT                   /locus_tag="Pden_0361"
FT   CDS_pept        339860..340702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0361"
FT                   /product="peptidase S14, ClpP"
FT                   /note="PFAM: peptidase S14, ClpP; KEGG: rsp:RSP_2068
FT                   putative ClpP-like protease"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68475"
FT                   /db_xref="GOA:A1AYY1"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYY1"
FT                   /protein_id="ABL68475.1"
FT                   /translation="MSIRDLPAATVGAKPGVRSDIGAKVIERWNPDVRAAAEEDAEASI
FT                   SVLDVIGQDWWGEGVTAKRVAAALRQIGKRDVVVNINSPGGDFFEGLAIYNTLREHPAK
FT                   VTVKILGLAASAASVIAMAGDEVLIGRAGFLMIHNTWVVAAGDRHALREVADWLEPFDS
FT                   ASVDIYAARTGLDGKKLGQMLDRETWIGGQSAVDQGFADSLLAADEVSASARQEGEARV
FT                   RAEKKFDLLAARAGLSRGAAREILAELKGGKPGAAPSGTQDAAVIEEVRNLLKSMKSI"
FT   gene            340714..342063
FT                   /locus_tag="Pden_0362"
FT   CDS_pept        340714..342063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0362"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /note="TIGRFAM: phage major capsid protein, HK97 family;
FT                   KEGG: rsp:RSP_2067 putative prophage LambdaSo, major capsid
FT                   protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68476"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYY2"
FT                   /protein_id="ABL68476.1"
FT                   /translation="MNKALMPQASLAALMAARPQAVIGAVRSEANPGNVEQLMREVRQE
FT                   LDRIGGDVKRTAEDALRQSRDTGELTRELKNSADQLLTQQKILTDAQQKLTDRLEQLET
FT                   RNTDLEQQLSQRGRGNRDQVQSFGERAARHDDMRAFAQAGCKGTVRIALDVEQAITSVR
FT                   PGGGGLIWSDRETEIVGLPRRQMTIRNLLSQGRTGSNAIEYARQTTRTNNARPVTEGAQ
FT                   KPESDYVWAQESALVRTIAHFVHVSRQAMEDAQQLQTEIDTELRYGLMLAEEGQLLKGD
FT                   GVGQNLEGLVTAATAFVPAFAVAGETMIDTLRLALLQASLAEYPADGIVLHPTNWAQIE
FT                   LTKDGEFRYIFANVMQLAGPQLWGHPVVQTQSMDLDEFLTGAFKAAATIYDRMDPEVIA
FT                   SSEDRDNFIKNMITVRAEERLALAIKRPAALITGEFNSTVVSSGAPVSSA"
FT   sig_peptide     340714..340779
FT                   /locus_tag="Pden_0362"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.939) with cleavage site probability 0.667 at
FT                   residue 22"
FT   gene            342121..342429
FT                   /locus_tag="Pden_0363"
FT   CDS_pept        342121..342429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68477"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYY3"
FT                   /protein_id="ABL68477.1"
FT                   /translation="MKIQALRGMVGSYGALRRGQVADIDDHIAEKLVKAGRAVPVETDA
FT                   ADPIPASEPGPVSGADAKDTRQAGGRAGKAKPASSSPADPAPETSGQVSPPSEGNPA"
FT   gene            342471..342965
FT                   /locus_tag="Pden_0364"
FT   CDS_pept        342471..342965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68478"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYY4"
FT                   /protein_id="ABL68478.1"
FT                   /translation="MLYACDLAWWRRYSGAAGFAGLKLGADPAVDRKPWGVRSIRVQQT
FT                   VDRILTDRPGVIGWGGNSGFHALNLAVQFGVRRIVLVGYDMQVEAGLHWHGAHEGMNNP
FT                   SQQSTARWRRIIDAAAPDLALLGVEVINASAVSALTAYPKIPLMEALHADHDLAVNRSA
FT                   D"
FT   gene            342934..343482
FT                   /locus_tag="Pden_0365"
FT   CDS_pept        342934..343482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0365"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sit:TM1040_1619 phage conserved hypothetical
FT                   protein, phiE125 gp8"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68479"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYY5"
FT                   /protein_id="ABL68479.1"
FT                   /translation="MISRSTDLPIDLAAAKKVLRVDFDDDDDMIRDLIDGETRRYEDFA
FT                   RRIVAQTVFRFRSPGWFTRIPIDLDPIRSIAGVFYLDQAMQEVALASAAYRFVPCSQGG
FT                   YLGIYSDWPRPDLADVAFPVWFDVVAGADLPADSPAVAPLDPADRMNILHMVKQIYDHD
FT                   DPLTEEQLRRRFSGRRLLW"
FT   gene            343476..343835
FT                   /locus_tag="Pden_0366"
FT   CDS_pept        343476..343835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0366"
FT                   /product="phage head-tail adaptor, putative"
FT                   /note="TIGRFAM: phage head-tail adaptor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68480"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYY6"
FT                   /protein_id="ABL68480.1"
FT                   /translation="MVKAAAQTARLVKRAAFGEPAEVSDDIGLGDADGQVVHGYPIAFR
FT                   TRANLLPLRGGESVMHARLAAKNPAILTVRNSALTRRVTSDWKVLIDGRVFDCKEDPRE
FT                   SQDRRYLEILVEASP"
FT   gene            343922..344218
FT                   /locus_tag="Pden_0367"
FT   CDS_pept        343922..344218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68481"
FT                   /db_xref="InterPro:IPR021508"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYY7"
FT                   /protein_id="ABL68481.1"
FT                   /translation="MKSTPYPYATLGPSYWVDDISECILARDVTLQIDLWDSQVNKGRL
FT                   EDLTDDVATALRGWSDTDALTMHPMRVTLARVMDDPDGVSVHGVVQVEALVEG"
FT   gene            complement(344215..344742)
FT                   /locus_tag="Pden_0368"
FT   CDS_pept        complement(344215..344742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68482"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYY8"
FT                   /protein_id="ABL68482.1"
FT                   /translation="MLGEGRADEVADVFADLLGPLLHRLTGCLYSDIRNSLEFCHDPGV
FT                   KLGHGSPIYEDYMRHFTAVLLATLAAPPLATASELECLVIRTHIEKMQDASFAAIYSTE
FT                   AGAQDVKDAVNKILIDPRMPADLADEGRKHIFGDAFDRWETTYKEARYSAQYPEDPAFE
FT                   ALMREKCGRNWR"
FT   gene            344752..345042
FT                   /locus_tag="Pden_0369"
FT   CDS_pept        344752..345042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68483"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYY9"
FT                   /protein_id="ABL68483.1"
FT                   /translation="MLRSIGWTWGELPPGTFMIDEIRSGRNRGDQYATLRIKIYAGAGD
FT                   GFYFRFHEFGTKDGLPARPTFYPAWKAKRSGFRKKIRDRVRAAIRGVWRNG"
FT   gene            345234..345695
FT                   /locus_tag="Pden_0370"
FT   CDS_pept        345234..345695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68484"
FT                   /db_xref="InterPro:IPR011855"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYZ0"
FT                   /protein_id="ABL68484.1"
FT                   /translation="MALPDLQFRGDIVVMVAWDEENPATYTNWCGATGINLSITNNISE
FT                   TTVYDCDNWTLPAQIILGYGAQSVTATVNANLTKAGRDKLIRAVKDQRELPIRLHMIGA
FT                   APNEIEYIDGIGLLPNLDIAGIGSTDDNAVITYTLNVSFKAGIEFTDAT"
FT   gene            345695..346084
FT                   /locus_tag="Pden_0371"
FT   CDS_pept        345695..346084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68485"
FT                   /db_xref="InterPro:IPR021791"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYZ1"
FT                   /protein_id="ABL68485.1"
FT                   /translation="MQPIVVRWPGGEHAFRLGLGELRTIQQKTDCGPEFLLIRINAGQW
FT                   HVDDLREVIRNGLIGGGMPHVDALRAVDKAFNAAPAITFKVPAQEILSAFLFGPPDDVV
FT                   GESLPVGPTPAKETTENGGSAPITD"
FT   gene            346245..349151
FT                   /locus_tag="Pden_0372"
FT   CDS_pept        346245..349151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0372"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_3791 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68486"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYZ2"
FT                   /protein_id="ABL68486.1"
FT                   /translation="MANEPDLLISAGFSDAQLVKEADKVVEFYRKKGQEAQKAFQDSQG
FT                   RVTNTQAARAHARELDRLAKSYDPVYRAAKRYEEELKRLDKALDVGAISQKRYADLVGQ
FT                   AARQMNLATGAIEQSSRKAAGGGNMLQQVGWQVGDFAVQVGAGTSAAQAFAQQAPQLLG
FT                   AMGAWGALAGAGVAVAVPLGAALLKVAMDTETLAEKLDSLNDTTKAYTDAAEAAVEPIS
FT                   VLRQKYGELADEVQRANGTMAMLASIRAQSDLFGAARSLGRELGINLNPMDVPLQADGA
FT                   INRDREYMAIQQRERAMERLRQRTGATADQADRLRMALNRTDSSNSLEAVVQDAANLLR
FT                   IIAELSGNEGADTMFLGGWAQQVDAVMKSAQKQIEATNKAQNDLLNSYDENTQKLKKLA
FT                   DDRRLAEEMLAVALKDGKADQIEAYGRVIKAIDKEVQAVKQSIAEMDGTFEASVKRMQE
FT                   LAGGLGGTINDAIKQWTGLNLREWGQAGAAANKGILDLIAQRESRGDYNATLDDGRWTG
FT                   GSRNLVNMTLKEIRALQEAMKTPENRALYGNGAGSSALGRYQIVGTTLDDLMKRLKLTG
FT                   DELFTPELQDRLATELLRQIKPGDVEGIRKVWAGLENVPAPLIQQAWGQQSIPRVDAEI
FT                   QKDLDKEIKDRERLAEQARRYGEQLAQNLLTEKESARLAAEQADQISAIKAQGLAPEDE
FT                   SRAIAAVTADIESQRVVLTLLADAKRRNVDLDAMLADGSMTYKQAIEALGEAKKADIIA
FT                   TNERAIAEGRLAETQQLMADAQQQTKQGLLDSIVAGESFADVLANVARMFAKAALEAAL
FT                   FNEGSWASGGGGKGLLGGLVNAIFKGWSVGGYTGPGGKHEPAGIVHKGEVVWSQDDVRR
FT                   AGGVGVVEALRRSSRLPGLADGGAAGMPMMQLSQIPFGLAAQRGPAVNATFAPNISIAP
FT                   GVTQAELAMTMAAAQREYEQKFLPMLQKHMPSYNERYT"
FT   gene            349151..349831
FT                   /locus_tag="Pden_0373"
FT   CDS_pept        349151..349831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68487"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYZ3"
FT                   /protein_id="ABL68487.1"
FT                   /translation="MPEVIAWPCSLIRPQDVSYFIQRTSRDAGANLAGIAQILTPGTGA
FT                   WRVDITIPRDFDGTRVKQLEALVSEMRGRENVANLCICDPYKYGSRVSPVQTPFSDGTW
FT                   FSDGTGFTDPAAGTQPLLTSAAVAAGDNELYVDLTNPVRPSLRIGDMFSVNGFLYRVVR
FT                   RNAAGWVKFEPSARRAIASGVALVTDPPRFYGRFIDDMQGQRTREMLKWGQSITISFIE
FT                   AFDR"
FT   gene            349828..350394
FT                   /locus_tag="Pden_0374"
FT   CDS_pept        349828..350394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68488"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYZ4"
FT                   /protein_id="ABL68488.1"
FT                   /translation="MSPELAAFLDSDPEVVPLVRLFHLNFGSVQYYLNETEVPLTFAGQ
FT                   LWQPSMGWIGADPLRLSANPFDANPAYYTVWNVGNKEGEDLAYEALNNPASWSDKLVRQ
FT                   LWAVRGFPDDAIVMHVGRIVDVKPRENVGLAEIRIRAETIAATRNYTPLGEYTDRDQQR
FT                   RHPGDLGCQHAASLVGKKIKGWLIG"
FT   gene            350379..350750
FT                   /locus_tag="Pden_0375"
FT   CDS_pept        350379..350750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_1234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68489"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYZ5"
FT                   /protein_id="ABL68489.1"
FT                   /translation="MADRLGAFVEATASRPWDWATDNCTFWVADWALMRWGADFAARYR
FT                   DRCRSEADAAALTAGGLVALVEPEIALPRKDAPAEGDIGVIEFRGRQVSAIWSGSHWLI
FT                   RTPRGVAMVRARAIAIWGD"
FT   gene            350750..352792
FT                   /locus_tag="Pden_0376"
FT   CDS_pept        350750..352792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0376"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nar:Saro_2739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68490"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYZ6"
FT                   /protein_id="ABL68490.1"
FT                   /translation="MPQVGPWLVATWKAGGIGAALLKTAAAVAINMAVAKLTAPGGPRP
FT                   QEITTELRSSNAKRIRHLGRVRASGAVMFWEWAYAGGERRLFKLLAVAQGGMNNVLQWY
FT                   LDGEPVEVDANGYVTTAPWNKGNIRLRWRKGIQGDQWDGGNYADLRAAFPSQWTEAHRL
FT                   RGVGTILATFDAVGGEDIAEVYSGGEPEVSALIEGASGYWAVDGSAINGRNPAVHLSDI
FT                   VANPVYGALAPSDIDLASLGVARSDCNADVPTDGGTRSRYQSGISYALSDPIKDTAQKL
FT                   LDAMGGRAWITPEGKLAVEAGVWRPPTVTIEERHIVEMEYGAGTERINRVTTLVPTYVA
FT                   PQVRWQEANADPVEDADAIARWGEGEPKGVDLLPVQHHGQAGHLCKQMLARMNPDRRMT
FT                   VKLRAFGLRLIGERLVALNIPRLGLVSVPFWIDGLEFDGTNVMVDLIEAEPASFDWTAE
FT                   EEGEPPAVLTDIDRGTATRDAAITSVTLITDDGPPYIRIEGTLSAQRGDQLMAQFRRTG
FT                   SALAWTDMISEATSGNGFSFRTMPLGDLSEYDFRVFFGRYSNGSSGRELQMLSVPVVVT
FT                   GVDVVANGNPPDEPVVISASGSAGDNLIVTFTVDLGANYHRTGLYRAASGAPFGSATLV
FT                   KWSFDQSSQVTMTAAIPPSGARFWLRSENESQVGSDPVEVGDYPA"
FT   gene            352856..354613
FT                   /locus_tag="Pden_0377"
FT   CDS_pept        352856..354613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68491"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYZ7"
FT                   /protein_id="ABL68491.1"
FT                   /translation="MSFQSDANEAYPNGTPVDKADVRALWGRVDGVVANGGKVFPARGD
FT                   AEAAGQSALVPALSRIFVTEGSYLHLRGPSSQALDPLFPSYPYWGIQFIVPNTTAAWNR
FT                   ANHTGTQPISTVDGLPEALDGKADQEVVNGLIADAEDQAEKLTFATAEGSPFDSHLTDS
FT                   RGDLLAGWAADRAALAGMDFLRNDGLDRPVVVGSDNFVLWYPPDAEPAQNPALTPYFGS
FT                   RLFGIAGERLPIYAAGLIANRADVEQVRLVLAGAAGEVGYGDRRVDVDAAGLGASAALQ
FT                   LRNRADAGGPFVELPLTVHAAPKAPGSGDAPVILSVGDSITHRSGTALAAVYLDEWGYT
FT                   PDFIGTLMSETGGDAPPVAGEGKPGHCLQDLTYDVTNRVQPLAPGDESLYNAMSTADKR
FT                   LRNTMLRAATGGDDPADVRNGYVLDFGFYITRHGLATPTVLWQGYGTNDIRDIPAGDIE
FT                   DRIHDMDSLVYRRWHAAYPSAPVVRWMPGTAWDADRNLVWTASYIPTIRGMLRAAAEAT
FT                   GPVLLVPTWAMHTPEAGYDLVPSPAIPDPVTGHIVRTIGDTIHPTGASRRELFRAVAAA
FT                   LACASTGNF"
FT   gene            354623..355363
FT                   /locus_tag="Pden_0378"
FT   CDS_pept        354623..355363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68492"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYZ8"
FT                   /protein_id="ABL68492.1"
FT                   /translation="MSLVIRTATPARSRARKYLPPVMRGLDYLFLGDGDDPGQNWAIDR
FT                   PDGEVHGTPVRGPDGISWRFKGLANFIETQSWEVDSETHLIVCRTFDTLADNATRPQFF
FT                   GTFTGPPAKQDTTTTTFGSRLYVSAAGAVRYVAGRGNTVDDDVQGDAAVVVPDHQQYQL
FT                   IVCQTDPINRITNATTGTTASNPSELPRFPARRRYRLGSGYLTQEGEGDVLLWAKFNSA
FT                   ATADEIAAMVADMRRYCADLGVTV"
FT   gene            355399..355695
FT                   /locus_tag="Pden_0379"
FT   CDS_pept        355399..355695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68493"
FT                   /db_xref="GOA:A1AYZ9"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYZ9"
FT                   /protein_id="ABL68493.1"
FT                   /translation="MTDPGPFRSADFWIAVGVALIVKIKTSASLGPVKVITSMIVAAGA
FT                   AWVASDYAAETFGVPLPIAAAVVTLTAEGAMRWLLIAVNDPKQAIDLWRYWRR"
FT   gene            complement(355711..355959)
FT                   /locus_tag="Pden_0380"
FT   CDS_pept        complement(355711..355959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68494"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ00"
FT                   /protein_id="ABL68494.1"
FT                   /translation="MGLQPAAAGRKTRVMKATHDDKTFTLTGEIWSATYPLDELPKWLR
FT                   WYRSRKARFPKAGDAYDPTIAALEGLAAELGVEVSED"
FT   gene            356004..356636
FT                   /locus_tag="Pden_0381"
FT   CDS_pept        356004..356636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0381"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syw:SYNW0477 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68495"
FT                   /db_xref="GOA:A1AZ01"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ01"
FT                   /protein_id="ABL68495.1"
FT                   /translation="MTAVMNAVRARQARCAALGFWPGPIDGIDGPRTRAAHAAAIEAQR
FT                   AKGLPFQHPTGIARIHWHWTAGGYTPNTVDLRSYHALIDGEGRIRWPVDPTTTRSHTLN
FT                   ANGGAIGLSICAMAGAQERPFAWGKAPITPAQVSALARETARLCRTYDIPVSRWSTLSH
FT                   AEIQPTLGVAQKNKWDITVLPGMSAPADPITVGDRLRDLVARELSTF"
FT   gene            356648..357043
FT                   /locus_tag="Pden_0382"
FT   CDS_pept        356648..357043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68496"
FT                   /db_xref="GOA:A1AZ02"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ02"
FT                   /protein_id="ABL68496.1"
FT                   /translation="MQTIINAAAPHLLELIGLAITAIIGWGVRQASKRWGIEIQASHRE
FT                   ALHWALYTAAQLAIKHELTGKAAVDLVLEYARRSVPDAIGNLKPSAEVLTDLARAKLEQ
FT                   VAAEKAKDAATGAVDQLTEALRRAGAA"
FT   gene            complement(357161..357364)
FT                   /locus_tag="Pden_0383"
FT   CDS_pept        complement(357161..357364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68497"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ03"
FT                   /protein_id="ABL68497.1"
FT                   /translation="MTPEAFARWLAEMKAAGLAKSDRDAAALLGVSANSIVSMKRSGVT
FT                   GATAERTALACQALLDGLKPYQ"
FT   gene            complement(357761..357928)
FT                   /locus_tag="Pden_0384"
FT   CDS_pept        complement(357761..357928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68498"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ04"
FT                   /protein_id="ABL68498.1"
FT                   /translation="MEKIIATKVENIAPAITENTIAKFNAAMAEMCPMTDEERAEVEAT
FT                   WEAIFSALDD"
FT   gene            complement(358047..359285)
FT                   /locus_tag="Pden_0385"
FT   CDS_pept        complement(358047..359285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0385"
FT                   /product="Recombinase"
FT                   /note="PFAM: Resolvase, N-terminal domain; Recombinase;
FT                   KEGG: nwi:Nwi_1951 resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68499"
FT                   /db_xref="GOA:A1AZ05"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ05"
FT                   /protein_id="ABL68499.1"
FT                   /translation="MRCAIYTRKSADERAGAEFGSLENQRSFCASYIASQGGQGWDELP
FT                   NRYDDEGYSGGSLKRPSLDRLRADIQLRKLDTVVVYKIDRLSRSLRDFCNLVAEFEACG
FT                   VTFVSVTQSFDTGTAMGRLTLNVLLSFAQFERELTGERLKDWFAGARERGLWVQQRPFG
FT                   YAKPPGTNQLVPHETEAPVVRWIFRRYIALKSAERVADDLYARGITNTRGKPWTGNMVR
FT                   HTITHPIYRGKMVHRRQAMPGSHEPIVSDSLWRRANAVLADARNHRMGGRGAKPLALLA
FT                   GLLFDRTGSAITHTFLTSKGRLYRYYIAQQERRHGYGEDSDPYMRFRAADLEAAVLEVV
FT                   QRMTGYDLGAVRAQYERIERLRTYIERIDVDLEGMTVVFRAGGSVRAEAAGRLGPRRHT
FT                   RREKRGRPQQGGK"
FT   gene            359492..360115
FT                   /locus_tag="Pden_0386"
FT   CDS_pept        359492..360115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0386"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159; KEGG:
FT                   sit:TM1040_1580 protein of unknown function DUF159"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68500"
FT                   /db_xref="GOA:A1AZ06"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ06"
FT                   /protein_id="ABL68500.1"
FT                   /translation="MCGRFVDPNLRGTSFEISQTRLHPFPRRYNIKPTQDVLVITTDAP
FT                   EGEMARWWLVPSWHKGDLRDWKATTFNARIEDAASKPTFRGPWRYGRCLIPAGGYYEWT
FT                   GEKGHKQPHFISSAGNDDTLWFAGLVSRWNDMLTCTIVTRPANASVADIHTRMPVILNA
FT                   DERDAWLAGSDDPEIGAGAQLRHHPVARFGTASDGPELIDPTAA"
FT   gene            360185..360424
FT                   /locus_tag="Pden_0387"
FT   CDS_pept        360185..360424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68501"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ07"
FT                   /protein_id="ABL68501.1"
FT                   /translation="MMIIGNVLAVEPEDSMEAHVRRYLAFRFAGHAIVDLRGQDEIWTA
FT                   RLHSAEAGDAVVTIKADLIEDDLYLAFDILDMAA"
FT   gene            360445..360705
FT                   /locus_tag="Pden_0388"
FT   CDS_pept        360445..360705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68502"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ08"
FT                   /protein_id="ABL68502.1"
FT                   /translation="MKLRVIRDWNRRWRFRPVRDTGGYVIENTYDLLRNGVVVGRVQRE
FT                   WGGEWSWDIYTEPKERGWAGTMTEALHDARNALGLRHIAAP"
FT   gene            361057..361146
FT                   /locus_tag="Pden_R0008"
FT                   /note="tRNA-Ser1"
FT   tRNA            361057..361146
FT                   /locus_tag="Pden_R0008"
FT                   /product="tRNA-Ser"
FT   gene            361152..361484
FT                   /locus_tag="Pden_0389"
FT   CDS_pept        361152..361484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68503"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ09"
FT                   /protein_id="ABL68503.1"
FT                   /translation="MHQSLTGFLRSLESWSRTSCDAPWRHFCAATDSDANDARGLITQS
FT                   GRDYSAAPRTRAMWPGRWYAPWATTVTKASESTTCSGSSKVVPFCREQMWRVMSQMKVP
FT                   CPLSGR"
FT   gene            361651..362016
FT                   /locus_tag="Pden_0390"
FT   CDS_pept        361651..362016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0390"
FT                   /product="protein of unknown function DUF983"
FT                   /note="PFAM: protein of unknown function DUF983; KEGG:
FT                   ccr:CC1021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68504"
FT                   /db_xref="GOA:A1AZ10"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ10"
FT                   /protein_id="ABL68504.1"
FT                   /translation="MAEERDERAAAVRGLTGRCPHCGKGRLFKGYLAIVQECEACGEPL
FT                   GLYRAADGPAFFTMTIMLLLLIPMIGFTWAIYRPDPVTLLIVVGVAMTLLTLVILRLVK
FT                   GAFVGYLWAKHEQDRGA"
FT   gene            complement(362346..362717)
FT                   /locus_tag="Pden_0391"
FT   CDS_pept        complement(362346..362717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68505"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ11"
FT                   /protein_id="ABL68505.1"
FT                   /translation="MTDPQAPETANPSHAARLWLALLLALLVVMLPGPQVTATASQSKQ
FT                   LTTPTLALTAIHGRDLIARKDAVQIRPLTATALPPPEPLPPPPRAAASVAYAHQPQIGV
FT                   CACTLAPCARAPPSFRMTA"
FT   gene            362922..363236
FT                   /locus_tag="Pden_0392"
FT   CDS_pept        362922..363236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0392"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: jan:Jann_0243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68506"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ12"
FT                   /protein_id="ABL68506.1"
FT                   /translation="MVNGEGDWLFYGHANTAGTGFDLWWLLDLRAFRAGLIRHAPNGYP
FT                   ISSGDRMNMDGTCFKRFDIRSFPKELPLVLAISGPRSAGPSHHAGALPFQEPSPVPATE
FT                   "
FT   gene            363233..363715
FT                   /locus_tag="Pden_0393"
FT   CDS_pept        363233..363715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bms:BR0799 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68507"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ13"
FT                   /protein_id="ABL68507.1"
FT                   /translation="MTGKHCSPVIACPALLDFLAYARSLEGRWIMQNKAILIVGPLLFA
FT                   ACTASDNYSEIIARSTPPGAALKAEIVAGAKELIYDPASIRDAEISNVATLPDGLQGVC
FT                   VRADSKDVSGRYLGLHSIGIPIRDGKIAGGSLDHPLCDRADIQWQPFPELERLPGA"
FT   gene            364225..364824
FT                   /locus_tag="Pden_0394"
FT   CDS_pept        364225..364824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rde:RD1_A0063 succinoglycan biosynthesis
FT                   protein ExoI"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68508"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ14"
FT                   /protein_id="ABL68508.1"
FT                   /translation="MRPSWMPPAARCAARAKPAATVASAGTNYAAKASAVPAIVDRRAT
FT                   PSAAILTAVRSDYRDFDAPIGTGIATIATIAGIAAVRALVVGAVLVMPAVTWAATDGSP
FT                   LIACRAVVVDGDLLIWQSESQLAWEYRADRWARAATEAPEGCPIKGNISKKGERIYHAP
FT                   WSPAYAETRIDESKGERWFCDEAEAIAASWRAARWR"
FT   gene            complement(364942..365017)
FT                   /locus_tag="Pden_R0009"
FT                   /note="tRNA-Lys1"
FT   tRNA            complement(364942..365017)
FT                   /locus_tag="Pden_R0009"
FT                   /product="tRNA-Lys"
FT   gene            365115..365942
FT                   /locus_tag="Pden_0395"
FT   CDS_pept        365115..365942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0395"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: sil:SPO0278
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68509"
FT                   /db_xref="GOA:A1AZ15"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ15"
FT                   /protein_id="ABL68509.1"
FT                   /translation="MEHQQNLGQSIPLPFMKMHGLGNDFVVIDSRRTGALPDAATVAAI
FT                   ADRHRGVGFDQLAVILPGENADARLVFFNADGSLSAACGNATRCVARFLMDETGARALR
FT                   LATDHAVLAAEDAGDRLTRVNMGAPVLDWAGIPLAEDVDTLHLPVPGDPVATGMGNPHM
FT                   TFFVPDAAAVDLERFGPAHEHHPLYPQRTNIELVQVVSPDEIILRIWERGTGITLASGS
FT                   CSCAAVVAAARRGLTGRRVRVNVPGGVLEIDWREDGVWMTGPTAHVFDGVWRG"
FT   gene            365939..367201
FT                   /locus_tag="Pden_0396"
FT   CDS_pept        365939..367201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0396"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /note="KEGG: rsp:RSP_0935 MiaB-like radical SAM protein;
FT                   TIGRFAM: RNA modification enzyme, MiaB family; MiaB-like
FT                   tRNA modifying enzyme; PFAM: Radical SAM domain protein;
FT                   Protein of unknown function UPF0004-like; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68510"
FT                   /db_xref="GOA:A1AZ16"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ16"
FT                   /protein_id="ABL68510.1"
FT                   /translation="MKDLKPPVFATLGCRLNAYETEAMREMAEAAGLQGAVIVNTCAVT
FT                   AEAVRKARQEIRRLARENPGAPVIVTGCAAQTEPETFAAMAEVSRVIGNHEKMQPATWA
FT                   AMQAPDLIGETEKVQVDDIMSVKETAGHLIDGFGRHRAYVQVQNGCDHRCTFCIIPYGR
FT                   GNSRSVPAGVVVDQIKRLRDRGFNEVVLTGVDLTSWGADLPGQPRLGDLVMRILRLVPD
FT                   LPRLRISSIDSIEADENLMLAIATEPRLMPHLHLSLQAGDDMILKRMKRRHLRDDAIRF
FT                   CEEARRLRPGIAFGADIIAGFPTETEAMFENSLKLVEDCGLTFLHVFPYSARKGTPAAR
FT                   MPRVPGPAIKERAARLRAAGDAALARHLQAQLGEARMVLTEGPRLGRTEHFTEVAFDRD
FT                   MPEGTLMALRIAGHDGQRLTV"
FT   gene            367359..368318
FT                   /locus_tag="Pden_0397"
FT   CDS_pept        367359..368318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0397"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   rsp:RSP_1137 histone deacetylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68511"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ17"
FT                   /protein_id="ABL68511.1"
FT                   /translation="MACRVGKLHIILGWMTLLYTHPSGLSHVTPPSHPEQVARLDAVLA
FT                   VLDGADLERREAPEAADQDILRAHPPEYLSLLRRKAPGEGWSMLDSDTYLSPGSLNAAR
FT                   HAVGGVCAAVDAVLAGEAPSAFVAMRPPGHHAERMKAMGFCIFSSVAIGALRALEHHGL
FT                   DRVAVLDFDVHHGNGTQDVLWDERRALFASTHQVPLYPGTGAPSERGAHGQVVNLPLAP
FT                   GSGGGEARAVWQAICARVEAWRPQLVLVSAGFDAHAEDPLASLMWDDGDFTAITRMICD
FT                   TAAACSAPVVSALEGGYDLAALGRSARAHVDVLRETAA"
FT   gene            368315..368557
FT                   /locus_tag="Pden_0398"
FT   CDS_pept        368315..368557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0398"
FT                   /product="Exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="TIGRFAM: exodeoxyribonuclease VII, small subunit;
FT                   PFAM: Exonuclease VII, small subunit; KEGG: jan:Jann_0090
FT                   exodeoxyribonuclease VII, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68512"
FT                   /db_xref="GOA:A1AZ18"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ18"
FT                   /protein_id="ABL68512.1"
FT                   /translation="MTGTEIENMSFEEAMKELEATVGRLEHGEATLEESIKLYERGAAL
FT                   RAHCDKRLREAEERVEKITLAANGQPTGTVPAEGL"
FT   gene            368557..369420
FT                   /locus_tag="Pden_0399"
FT   CDS_pept        368557..369420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0399"
FT                   /product="farnesyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: rsp:RSP_1135
FT                   geranylgeranyl pyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68513"
FT                   /db_xref="GOA:A1AZ19"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ19"
FT                   /protein_id="ABL68513.1"
FT                   /translation="MLDRLDEVKTQVQAALDGAMAGLPEGELTDAMRYACIGGKRIRAF
FT                   LVMESARLFGLRDRESLPVAAAVEALHAYSLVHDDLPSMDDDDLRRGLPTVHVRWSEAT
FT                   AILAGDALQSLAFGLLTDAQIGAPEIRLALVSGFSEAVGGRGMVWGQALDIAAETAVEP
FT                   LDLMAIKRLQQAKTGALIQFSATAGAVMAGQDTGPLAEYARNLGLAFQIHDDVLDVTGN
FT                   EADTGKRTGKDGAANKATFVSLLGLEGARDKARTLVRNAETALEPYGEGAGNLRQLARF
FT                   VIERDA"
FT   gene            369446..371368
FT                   /locus_tag="Pden_0400"
FT   CDS_pept        369446..371368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0400"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="TIGRFAM: deoxyxylulose-5-phosphate synthase; PFAM:
FT                   Transketolase, central region; Transketolase domain
FT                   protein; KEGG: sil:SPO0247 1-deoxy-D-xylulose-5-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68514"
FT                   /db_xref="GOA:A1AZ20"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ20"
FT                   /protein_id="ABL68514.1"
FT                   /translation="MTHETSDRPSTPILDRVHLPSDLKDLTDRELRQLADELRAETVSA
FT                   VSVTGGHLGAGLGVVELTVALHAVFDAPRDKIIWDVGHQCYPHKILTGRRDRIRTLRME
FT                   GGLSGFTKRSESPYDPFGAGHSSTSISAALGFAMARELGGDPGDAIAVIGDGAMSAGMA
FT                   FEALNNAGDLGKRLFVVLNDNEMSIAPPTGALSRYLTRLYAEGPFQDLKAVAKGAVGFL
FT                   PPTLQEGARRAKEMLKGMTVGGTLFEELGFSYIGPVDGHDLDQLLPLLRTVKARATGPV
FT                   LLHVVTRKGKGYGPAERAADKGHATAKFDVETGAQAKAKSNAPSYTSVFARALVDQASR
FT                   DARIVAVTAAMPDGTGLNLMAERFPRRCFDVGIAEQHAVTFSAGLAAGGMKPFCALYST
FT                   FLQRGYDQVVHDVAIQRLPVRFAIDRAGLVGADGATHAGAYDVAFLANLPGMVVMAAAD
FT                   EAELVHMVATAAAHDEGPIAFRYPRGEGTGVEMPERGEVLVIGKGRVMAEGKGVAILSF
FT                   GTRLSEVMRARESLAARGVSPTVVDARFAKPLDRDLILRLARTHEALITIEEGAVGGFG
FT                   SLVAQLLADEGVFDGGLRFRQMVLPDTFIDHASPEAMYREARMSAPDIEAKVLEVLGVA
FT                   LAKRA"
FT   gene            371378..371998
FT                   /locus_tag="Pden_0401"
FT   CDS_pept        371378..371998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0401"
FT                   /product="SH3, type 3 domain protein"
FT                   /note="PFAM: SH3, type 3 domain protein; KEGG: sil:SPO0041
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68515"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ21"
FT                   /protein_id="ABL68515.1"
FT                   /translation="MLRILLTGLVLAAPLAVQAQDYLPNLFDVTVVETWDKLNVREAPD
FT                   GQAKIIGRLASTAKGVELLDRDASGKWGLVNVGETTGWVALRFLKPQATVWKPAELPLA
FT                   LRCSGTEPFWSVKTVQKGLIFSEPDAPERQLSLRKVMDRGIEGEPTRGIIAGDDKGRLT
FT                   AFMRPEQCSDGMSDRGHALAVSVILDGQEQPSRMLTGCCSIAP"
FT   sig_peptide     371378..371437
FT                   /locus_tag="Pden_0401"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(371995..372858)
FT                   /locus_tag="Pden_0402"
FT   CDS_pept        complement(371995..372858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0402"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: jan:Jann_0273
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68516"
FT                   /db_xref="GOA:A1AZ22"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ22"
FT                   /protein_id="ABL68516.1"
FT                   /translation="MMRMLVFGHGYSAGFLTPLLLAEGWQVTGTTRGATDRVAQAGAEP
FT                   LRWPGQEDAVRKAIAQADAILISVGPEQGADPVLAAFGTEIAAARPRWLGYLSTTGVYG
FT                   DRDGGWVDEDTPCTPSTRRGRERVAAELGWQAFAAEHGLPLHIFRLAGIYGPGRGPFAK
FT                   VRAGTARRIVKPGQIFSRIHAEDIAQVLLASIKAPHPGAIYNVCDDDPAPPEAVIGHAA
FT                   ELLGLPMPPAEDYASAEMTPMARSFYAENKRVSNHRIKRELGVTLRYPDYRAGLAALAR
FT                   AEGIPA"
FT   gene            complement(372855..373841)
FT                   /locus_tag="Pden_0403"
FT   CDS_pept        complement(372855..373841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0403"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: sil:SPO2518
FT                   bacterial luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68517"
FT                   /db_xref="GOA:A1AZ23"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ23"
FT                   /protein_id="ABL68517.1"
FT                   /translation="MEFSVLDLAVVAEGSDARQAIANSVALAQAAEGWGYSRFWLAEHH
FT                   NMPGIASAATAVLIGHVADHTRAIRVGAGGVMLPNHAPLAIAEQFGTLATIHGPRIDLG
FT                   LGRAPGGDGAVMHALRRSMQRNEDFPNDVVELLRYLGPPRPGAPVAAHPGEGTNVPVWI
FT                   LGSSLYGASLAAALGLPYAFASHFAPGDLEEARRLYRERFQPTEFGEKPRFMLAVNVIA
FT                   AETDAEAQRLRSSQQISFARLRLGMPGLLPPPVDDVLDAIPVRILPTVNAALAISAVGS
FT                   PQTVAAELDRLIARHQPDELILVGNIYDQVARHRSFAIAAEILRGRT"
FT   gene            373937..375421
FT                   /locus_tag="Pden_0404"
FT   CDS_pept        373937..375421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0404"
FT                   /product="AMP nucleosidase"
FT                   /EC_number="3.2.2.4"
FT                   /note="KEGG: rsp:RSP_1387 AMP nucleosidase; TIGRFAM: AMP
FT                   nucleosidase; PFAM: purine and other phosphorylases, family
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68518"
FT                   /db_xref="GOA:A1AZ24"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011271"
FT                   /db_xref="InterPro:IPR018953"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR037109"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ24"
FT                   /protein_id="ABL68518.1"
FT                   /translation="MLTDSRRLPIETPEPAERVYFDDPAAAVARLIELYDRASHFLLDR
FT                   FLATLQGGRPAARYRAFYPELRMTVPIHSKTDSRLSFGHVALPGTYSTSITRPDLFRGY
FT                   LTEQIGLLMRNHGVPVAIGESGTPMPVHFAVATQSDLNVPQEGVLDYSLRDVFDVPDLN
FT                   TMNDDIVNGIAGPNPDGSHALAPFTAQRVDYSLARLAHYTATLPEHFQNFVMFTNYQFY
FT                   VDEFEAFARRALADPNSGYTGFVAPGNQILERPEDIIATGAKMPQMPAYHLKRPDGDGI
FT                   TLVNIGVGPSNAKTATDHIAVLRPHAWLMVGHCAGLRNSQSLGDFVLAHAYLREDHVLD
FT                   DDLPVWVPIPALAEVQVALQEAVAEVTQLDGYELKRIMRTGTVATIDNRNWELRDQSGP
FT                   VQRLSQSRAIALDMESATIAANGFRFRVPYGTLLCVSDKPLHGELKLPGMATDFYRTQV
FT                   ANHLLIGIRAMEKLRETPLERIHSRKLRSFNETAFL"
FT   gene            375573..375872
FT                   /locus_tag="Pden_0405"
FT   CDS_pept        375573..375872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0405"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: rsp:RSP_1388 DNA-binding protein HU, form N"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68519"
FT                   /db_xref="GOA:A1AZ25"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ25"
FT                   /protein_id="ABL68519.1"
FT                   /translation="MAQAASKPMTKTQLVATLADEMGSDKKTAAAALDALSAVVSRTVA
FT                   EGGALTLPGIGKVACRTRPERQVRNPQTQEMMTKPADKVVKVTIAKALKDSVNA"
FT   gene            376017..376937
FT                   /locus_tag="Pden_0406"
FT   CDS_pept        376017..376937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0406"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: rsp:RSP_1390 putative transporter, DMT
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68520"
FT                   /db_xref="GOA:A1AZ26"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ26"
FT                   /protein_id="ABL68520.1"
FT                   /translation="MDFRAILMGFGFAVLWASAFTSTRMIVLAAPPLTALVIRFGLSAL
FT                   VAIPLARAMGQSWRLNRTEWRTVILFGLCQNALYLGFSWVAMQYVEASVSAIIASMMPL
FT                   VVAFLGWLLYGERLRPIAVAGLVAGVAGVTLIMGVRLQHGLDVPGVILCLIGMVALTFA
FT                   TLAARGAGGSRNMMMLVGLQMAVGAALLLIPAVLMEWGRPVEWSAGLVWAFAYTVIAPG
FT                   IGATWLWFRLVNRIGAVRAATFHFLSPIFGVGIAAALLGERFGVSDVIGALIVAAGILM
FT                   VQLAKLPAAAPQPSIPAARAIEGRD"
FT   sig_peptide     376017..376106
FT                   /locus_tag="Pden_0406"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.948 at
FT                   residue 30"
FT   gene            complement(376892..377485)
FT                   /locus_tag="Pden_0407"
FT   CDS_pept        complement(376892..377485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0407"
FT                   /product="glutathione S-transferase"
FT                   /note="KEGG: hne:HNE_1223 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68521"
FT                   /db_xref="GOA:A1AZ27"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ27"
FT                   /protein_id="ABL68521.1"
FT                   /translation="MLTLYHAPKSRSSSILVLLDELGILDKIEIRRVTIPRQDGSGGRD
FT                   PANPHPEGKVPYLVNGADHVRERGAIMLYLTDMFPEAGLGPLPGDPGRGQYLSWLSWYQ
FT                   GVLEPVAILNFFKIEHPALEATFRDYDTVIQRLDEVLGKQSWLLGNRLSAADLLIASPF
FT                   LFFGEGMPRTAAIDEWARRIQSRPSMARAAGIDG"
FT   gene            377546..378247
FT                   /locus_tag="Pden_0408"
FT   CDS_pept        377546..378247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0408"
FT                   /product="Helix-turn-helix, type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix, type 11 domain protein;
FT                   KEGG: hne:HNE_1222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68522"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ28"
FT                   /protein_id="ABL68522.1"
FT                   /translation="MSRTDRLMRLMDALRRLPAPVTAARLAEETGVSRRQLYRDIATLR
FT                   AGGALIDGEAGLGYALTEDPALPPQSFSRLEIEALLLAISGLRTLGDPELTRAGEDALA
FT                   RIIATLPESQGRHAMHTTMRLFRAPAQRPSPQVDMALLRAALWEERSLVIDYLDLHDAA
FT                   TTREIWPLGLSYSDNHMMLLAHCKLREDFRTFHVPRIRAMRPGGTSFRPRRVALVREYI
FT                   SRPCATRPQSG"
FT   gene            complement(378225..379646)
FT                   /locus_tag="Pden_0409"
FT   CDS_pept        complement(378225..379646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0409"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V; KEGG:
FT                   ret:RHE_PE00221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68523"
FT                   /db_xref="GOA:A1AZ29"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ29"
FT                   /protein_id="ABL68523.1"
FT                   /translation="MKMRNPMPPFDNYLARLGDDPMQVIHDGVIGRDAVIDGPFGPRRM
FT                   IYADYIASGRALRPIEEWVMENVLPWYANSHTEASHCGGTMTRMRRAAREAIGLCTHAG
FT                   AEHAVIFTGSGATQGINRLVHLMAAGPGTTVLLGPYEHHSNILPWRESGAEMVTIPETA
FT                   TGGPDLAALRAALARAEGPVIGSFSAASNVTGTLTDVAAVTRILKAAGAKVIWDHAGGA
FT                   PYLPIDMRLGMDAVVISPHKFIGGPGASGITVLRRDAVVADRPTLPGGGTVRFVSPKSH
FT                   DYAQSLEAREEGGTPNVIGDIRAALVFLTKAAVGQDAIDARNAEWLALGMARLRHHPRI
FT                   ELLGNLDAPRLPFFSFRIRDGQGGYIHQQLATRMLSDLYGVQARGGCACAGPYVHHLLG
FT                   LEAEDSARLRAAILAGDEIEKPGFVRLNLCWAAPRTEIEAILDAVCDLADQAADHLAHY
FT                   RCDRATAIFTPIAAE"
FT   gene            379720..380193
FT                   /locus_tag="Pden_0410"
FT   CDS_pept        379720..380193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0410"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   ret:RHE_PE00222 probable transcriptional regulator protein,
FT                   AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68524"
FT                   /db_xref="GOA:A1AZ30"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ30"
FT                   /protein_id="ABL68524.1"
FT                   /translation="MNDKIFSIDEIDNRLLSLLQRDASLSQRELAERVGLSQNACWRRL
FT                   QRLTEAGVLQGSRAVIDAAALGLGLTVFVMIRTRHHDDAWARRFRARIESLPQITEFHR
FT                   IGGEWDYMAKAVVGGMAGYDALYKRLIADMDLERVTGVFSMETIFEGRPLAPA"
FT   gene            380224..381213
FT                   /locus_tag="Pden_0411"
FT   CDS_pept        380224..381213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0411"
FT                   /product="putative exonuclease protein involved in mRNA
FT                   processing"
FT                   /note="KEGG: ret:RHE_CH01163 putative exonuclease protein
FT                   involved in mRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68525"
FT                   /db_xref="GOA:A1AZ31"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ31"
FT                   /protein_id="ABL68525.1"
FT                   /translation="MRADSILFPTEAGLFCPEGGFHIDPLKPVERALITHGHSDHARFG
FT                   HGAVMATAETLEIMRLRMGDGFAGATQVADGEMRIGGVTVGFHPAGHVLGSSQIAVEAG
FT                   GRRIVVSGDYARQPNPTCAPFQPVPCDVFVTEATFGLPVFRFPDPTTQVVKLLSSMAEF
FT                   PDRPHLIGAYALGKAQHVIALMREAGYDAPIAIHGALKVLCDFYAARGVELGELVPATA
FT                   EDVAAQLVIAPPSAFASPWVQRFRDPVIGFASGWMAVRARARQRGVELPLVISDHVDWP
FT                   ALTGTLAELAPSEVWVTHGAEDGVIRWCELAQIPARPLRLVGYEDEAE"
FT   gene            381210..382754
FT                   /locus_tag="Pden_0412"
FT   CDS_pept        381210..382754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0412"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="PFAM: ATP dependent DNA ligase domain protein; ATP
FT                   dependent DNA ligase; KEGG: ccr:CC3610 DNA ligase,
FT                   ATP-dependent, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68526"
FT                   /db_xref="GOA:A1AZ32"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR026333"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ32"
FT                   /protein_id="ABL68526.1"
FT                   /translation="MKAFAALLERLAFTPARNAKLQLLQHYLERTPDPDRGWALAALTG
FT                   DLELRRVTPSLLRGLAAERVDGELLALSYDFVGDLAETIALLWPEGAEDDPSLSQAVAL
FT                   LQGTGKAALPGAIAGMLDRLGPSERLAFLKLATGNLRIGVSARMARTALAGMGVPSVPE
FT                   IEEIWHGLAPPYAPLFGWLGGGARPESAALAPFRPVMLSTPTDLDELRALDPGDYLAEW
FT                   KWDGIRVQAVSEGGMRRLYSRTGEDISHAFPDVIEAMDFDGTADGELIVRREGEVAPFG
FT                   DLQKRLNRKTVGKGLLASHPAGLRLYDLLLWDGRDLRAEPLGARRTVLEAVDFGPRIDI
FT                   SPLLDFATWEDLAALRAEPPAAVIEGVMIKRRDSAYVAGRPRGPWFKWKRDPMVVDAVL
FT                   IYAQRGHGKRSGFHSDFTFGLWDGGELVPVGKAYFGFTDAELRELDRFVRQNTVERYGP
FT                   VRALAPKLVVEVAFEGLNRSTRHRSGVAMRFPRISRIRWDKPAAEADRLETLEAML"
FT   gene            382751..385186
FT                   /locus_tag="Pden_0413"
FT   CDS_pept        382751..385186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0413"
FT                   /product="DEAD/H associated domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; DEAD/H associated domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: rsp:RSP_0658
FT                   probable ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68527"
FT                   /db_xref="GOA:A1AZ33"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ33"
FT                   /protein_id="ABL68527.1"
FT                   /translation="MILPPEFQDWFVRQGWQPHPHQLALLAAEGDSLLIAPTGGGKTLA
FT                   GFLPSLVDLARVGRSQDGYLENGKGARTGLHTLYVSPLKALTADIGRNLARPVAELGLE
FT                   IRVEDRTGDTGQGQRRRQRVDPPEILLTTPESLALMLSYPEAPAIFGGLRRVVLDELHA
FT                   LAESKRGDQLMLGLARLRRLAPGLRVTGLSATVEDPQALAGFMAGAALVTVVEADPGPD
FT                   PDIAMLPTAKPAPWSGGGGHYAIPEVLEAVKGARTTIIFINTRAQAELFFQALWAENDE
FT                   NLPIGLHHGSLAREQRARVEAAMAAGELRAVVATGSLDLGIDWGAVDLVIQVGAPKNVK
FT                   RLVQRIGRANHRYNAPSRARIVPANRFEQIECVAALEAVRERDLDGDRRGPGPLDVLCQ
FT                   HIGLTACAAPFDADALFAEVVTAGPYRGLSRADFDACLDFAATGGYALRAYDRWQRLVL
FT                   RAGLWQLRDPRAAKLLRMNVGTIVEAEMMKVRLRGRGGAPLGEVEEAFAASLTHGDSFL
FT                   IGGRVVRMDAMREMVIEVTPDPTRQPKIAVYSGVKLAMSTQLSHRVLALIGDPARHGAL
FT                   PAQTREWLDLQAQVSALPEPGLLLSESFPHAGLWHFALYGFAGRNALQTLGLLLTREME
FT                   DEGLGPLGFLSTDYALLVWSLDAVRDPAPLLDRARLRAGLGDWLGENAVMKRTFRNVAT
FT                   VAGLTQRNMPGQRKTGRQATFSSDILYDTLRKYDPGHLMLRITAEEAGRGLVDFGRIEE
FT                   MLDRSPRREHRMLERVSPMAAPLLLEVGRVPIRGEGRERLAQIEAEALMAEAGLEGIA"
FT   gene            385183..385839
FT                   /locus_tag="Pden_0414"
FT   CDS_pept        385183..385839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0414"
FT                   /product="putative metallo-phosphoesterase"
FT                   /note="KEGG: rsp:RSP_0659 putative metallo-phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68528"
FT                   /db_xref="GOA:A1AZ34"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ34"
FT                   /protein_id="ABL68528.1"
FT                   /translation="MNGYGFDFHGLRFEARASGALWWPEGAALIVADLHLGKSERMARR
FT                   GGPLLPPYEGLATLERLAGEIAALDPQAVVSLGDGFDDMAATEALDPQVAGALRRLARG
FT                   RDWIWIGGNHDPGAPAGLPGRAADSLPLGRVTLRHEAAEGPDVSGHFHPVVRLAGERRR
FT                   AFLLGRDHLLLPAFGAYTGGLSHDDPALAALVPQGLAIACGARAIALPLGRRRRS"
FT   gene            complement(385901..386668)
FT                   /locus_tag="Pden_0415"
FT   CDS_pept        complement(385901..386668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0415"
FT                   /product="outer membrane protein"
FT                   /note="KEGG: mlo:mll1390 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68529"
FT                   /db_xref="GOA:A1AZ35"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ35"
FT                   /protein_id="ABL68529.1"
FT                   /translation="MCAVLVKASLTAGAVASLALGTALAANAGGYTPPVVDTDVTAPVV
FT                   ESAPVGDWAGAYAGLTLGYAFGGDDRVGFTEVDTGTYLGDAGKLELGGANAGLHVGYRW
FT                   QRDRWVFGPELGFEAGNIKDTITFDNQLGGSTDVSSKIRNVLALRLKTGYALRPDLLLY
FT                   GIAGIARADVEYKVAGTDGSGGSMSESRDFKSNGYIVGLGVERKLSDRMSVTGEYEYAN
FT                   FGKTTRTFQVDGGVSTQATPDYHNVKLGLNFKF"
FT   sig_peptide     complement(386582..386668)
FT                   /locus_tag="Pden_0415"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.572 at
FT                   residue 29"
FT   gene            complement(386880..389318)
FT                   /locus_tag="Pden_0416"
FT   CDS_pept        complement(386880..389318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0416"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: rsp:RSP_1346 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68530"
FT                   /db_xref="GOA:A1AZ36"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ36"
FT                   /protein_id="ABL68530.1"
FT                   /translation="MTEPAPQTSDYGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLHHM
FT                   VTEVVDNGIDEALAGHADFVRVKIHADGSVSVRDNGRGIPVDMHPTEGVSAAEVIMTQL
FT                   HAGGKFDQNSYKVSGGLHGVGVSVVNALSDWLELRIWRGGKEHYARFENGDTVEHLRVV
FT                   GDAEPGEKGTEVRFLASSKEDRPDGTFLNREYSYKVLENRLRELAFLNSGVRIILEDER
FT                   PAEPLRTELYYEGGVREFVKFIDRSKTPVMPEPIFITGERNGIGIEVAMWWNDSYHETV
FT                   LPFTNNIPQRDGGTHLAGFRGALTRVINNYAQSSGAARKEKVDFTGDDAREGLTCVLSV
FT                   KVPDPKFSSQTKDKLVSSEVRPAVEGLIGEKLAEWFEENPAEAKSILGKIIEAALAREA
FT                   ARKARELTRRKTAMDVASLPGKLADCQEKDPALSELFIVEGDSAGGSAKQGRSRQNQAV
FT                   LPLRGKILNVERARFDRMLSSDQIGTLITALGTGIGRDEFNLDKLRYHKIVIMTDADVD
FT                   GAHIRTLLLTFFFRQMPELIEAGHLYIAQPPLYKVSRGRSEVYLKDEAALEDYLIEQGV
FT                   DGASLRLGNGETLTGADLARVVEEARVVRRILRAYPTHYPPHITEQAAIAGALVQGRVD
FT                   ADAQGVANAVAQRLDMIAEEYERGWTGRPTQDAGIRLTRLLRGVEESRTLDGPMLRSAE
FT                   SRRLGAMTDALRDVYGQTAQLIRKDRGIPIHGPMSLLQAIFLEGEKGLSLQRYKGLGEM
FT                   NPEQLWETTLDPAARTMLQVRVEDLGEADDIFTKLMGDVVEPRRDFIQQNALSVENLDI
FT                   "
FT   gene            complement(389505..389840)
FT                   /locus_tag="Pden_0417"
FT   CDS_pept        complement(389505..389840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0417"
FT                   /product="protein of unknown function DUF1491"
FT                   /note="PFAM: protein of unknown function DUF1491; KEGG:
FT                   rsp:RSP_1677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68531"
FT                   /db_xref="InterPro:IPR009964"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ37"
FT                   /protein_id="ABL68531.1"
FT                   /translation="MPEARLAAGIWVAAYLRRLGLADIPAYVTRHGDDTAGSVMVKCAT
FT                   LDGRASLWVREWDFETDRRLWLQLNEAGEREIDAEIARNAARDPDLWVIEIESRDGRTL
FT                   LDEPGLA"
FT   gene            complement(389833..390744)
FT                   /locus_tag="Pden_0418"
FT   CDS_pept        complement(389833..390744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0418"
FT                   /product="GTP-binding protein Era"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Era; PFAM: GTP-binding protein, HSR1-related; KH,
FT                   type 2 domain protein; Miro domain protein; KEGG:
FT                   rsp:RSP_1676 GTP-binding protein Era"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68532"
FT                   /db_xref="GOA:A1AZ38"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ38"
FT                   /protein_id="ABL68532.1"
FT                   /translation="MTQTRAGFVALIGEPNAGKSTLLNRMVGAKVSIVTHKVQTTRARI
FT                   RGIAMRGASQIVFVDTPGIFRPRRRLDRSMVKAAWGGAADADVILLLIEAHRGLTDGTQ
FT                   AIIDNLRDHAGTTPVVLVINKIDRVKSETLLALSQQVNAAFDFTRTFMISAEKGHGCDD
FT                   LLEWLAGQVPEGPWLYPEDQVADLPMRMIAAEITREKLTLRLHEEIPYQLTVETERWEE
FT                   KKDGSARVDQIVYVARPGHKGIVLGKGGETIKAVGQAARAELAEFMGRPVHLFLQVKVR
FT                   ENWLDEAERYNEMGLDFRDGDA"
FT   gene            complement(390741..391466)
FT                   /locus_tag="Pden_0419"
FT   CDS_pept        complement(390741..391466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0419"
FT                   /product="RNAse III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: ribonuclease III; double-stranded RNA binding
FT                   domain protein; KEGG: rsp:RSP_1675 ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68533"
FT                   /db_xref="GOA:A1AZ39"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ39"
FT                   /protein_id="ABL68533.1"
FT                   /translation="MPRRPAPWQDRHMKISADLRAFSERLGHEFSRPELLRRALTHGSI
FT                   ASTTRPDNQRLEFLGDRVLGLTIAEALFSADRAATEGQLAPRYNALVKGETCAAIAREI
FT                   GLGEVLKLGRSEMMSGGRRKEALLADAMEAVIAAVYLDAGFETARGVVLGLWSDRLANV
FT                   ETDARDAKTALQEWAQAQGMSPPRYVQIARTGPDHAPEFQITVRLDDGREASASGKGTK
FT                   RSIEQAAATAMLEQIERTP"
FT   gene            complement(391475..392266)
FT                   /locus_tag="Pden_0420"
FT   CDS_pept        complement(391475..392266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0420"
FT                   /product="signal peptidase I, Serine peptidase, MEROPS
FT                   family S26A"
FT                   /EC_number="3.4.21.89"
FT                   /note="KEGG: rsp:RSP_1674 type 1 signal peptidase; TIGRFAM:
FT                   signal peptidase I; PFAM: peptidase S24, S26A and S26B"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68534"
FT                   /db_xref="GOA:A1AZ40"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ40"
FT                   /protein_id="ABL68534.1"
FT                   /translation="MAKSEARKDGGIWETVKTIFWALVIAGVFRTLFFQPFWIPSGSMK
FT                   DTLLIGDFLFVNKMAYGYSRVSCPFALCPISGRILGSEPERGDVVVFRHPTRGDDFIKR
FT                   VIGLPGDRIQMKGGVLWINGQEVPQQPAGTFTEPYAPQGPQQSLPKCRNEPVPEGGICE
FT                   KDRHTETLPNGVAHDVLNIIDNGPGDNTAEFTVPEGNYFFLGDNRDNSGDSRWPAAVGG
FT                   VGMVPAEYLIGRADRIMFSSAGKSLLYFWTWRPDRFLKAVD"
FT   gene            complement(392326..392745)
FT                   /locus_tag="Pden_0421"
FT   CDS_pept        complement(392326..392745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0421"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /note="TIGRFAM: holo-acyl-carrier-protein synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase; KEGG: rde:RD1_1364
FT                   holo-(acyl-carrier-protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68535"
FT                   /db_xref="GOA:A1AZ41"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZ41"
FT                   /protein_id="ABL68535.1"
FT                   /translation="MILGIGSDLCNIDRIAGVLERHGDRFRRRVFTETELALAGRRRHE
FT                   AATLAKRWAAKEACSKALGTGLAMGISWKDMAVRNLRGGQPTMELTGWAAERLAAMTPP
FT                   GHRAHVHVTLTDDHPWAQAFVVIEALPDDAQAGTA"
FT   gene            complement(392794..393528)
FT                   /locus_tag="Pden_0422"
FT   CDS_pept        complement(392794..393528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0422"
FT                   /product="pyridoxine 5'-phosphate synthase"
FT                   /EC_number="2.6.99.2"
FT                   /note="TIGRFAM: pyridoxal phosphate biosynthetic protein
FT                   PdxJ; PFAM: Pyridoxal phosphate biosynthetic protein PdxJ;
FT                   KEGG: rde:RD1_1362 pyridoxal phosphate biosynthetic protein
FT                   PdxJ"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68536"
FT                   /db_xref="GOA:A1AZ42"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ42"
FT                   /protein_id="ABL68536.1"
FT                   /translation="MLRLGVNIDHVATIRNARGTPWPDPVRAAKLAEEAGADGITAHLR
FT                   EDRRHISDGDIDRLMESLHLPLNLEMAATAEMQAIALRHRPHAVCIVPEKREERTTEGG
FT                   LDVAGNEAFLADFIAPLREAGCRVSLFIGHEQDQIEAAARIGAAVVELHTGAYCDFDTE
FT                   GRLAERDLELEALRRGAAQAHLLGLEVHAGHGLTFDTVGPIAAISELRELNIGHFLIAE
FT                   SVFLGLGPAIREMRRNMDAARA"
FT   gene            complement(393559..394380)
FT                   /locus_tag="Pden_0423"
FT   CDS_pept        complement(393559..394380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0423"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="KEGG: rsp:RSP_1779 putative
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase, C terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68537"
FT                   /db_xref="GOA:A1AZ43"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZ43"
FT                   /protein_id="ABL68537.1"
FT                   /translation="MPLHRREAAPAKLNLTLHVTGRRVDGYHLLDSLVVFLDLGDVVTI
FT                   APGPLSLSLTGPFAPGLAAEPDNLCLRAARLAGREARITLEKNLPVASGIGGGSADAAA
FT                   VLRALDASPRRPEALGADVPVCLASRPVRMRGVGEILAPLPALPELNVLLVNPGRGLST
FT                   PAVFKALARHDNPPMPEPLPDFPDAQALIGFLHECRNDLEAPAIALMPGIADCLAALRS
FT                   AGAQLARMSGSGATCFGLFASAAEAQAARARIAGTNPGWWVAASGLAPAKH"
FT   gene            complement(394384..396312)
FT                   /locus_tag="Pden_0424"
FT   CDS_pept        complement(394384..396312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0424"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: rde:RD1_3403 TPR
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68538"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ44"
FT                   /protein_id="ABL68538.1"
FT                   /translation="MIAAGHAAPAAALPIGAAAARVAGAIAETWAQAVTTRLIPLALIA
FT                   LLPLLQGPAMAAPSLAQAQDPAAGNSERPAHRPVDAAPDLRGLSGPYLAARMAAIQNDY
FT                   SVAARYYLQALAHDDSDPFLQDSALVALISAGEMERAAALSGTMSDQGRATELARLVQR
FT                   AEMARAGRWDALIEAIDSAPSPGGNATPGGGILVDGMMRAWALLGAGKAGESLTAFKKL
FT                   AELRGAAPMVNYHLALAKARVGDFEGAELLLADPATGAHILGVIARAQVLSQLERNRDA
FT                   IAMLEATPGFAEEPYLVALRDRMKRGETLPFDSARGPADGMAQVFLTFGSVLATSDEPD
FT                   PLALIHARLAEYLAPDLGEARLLSAQLLQGFGQFDLAEHEFEALRELGDMRPVAELSRI
FT                   DALARAERLNDAEKAALALTAAHPELAQGWIALGDMLRQQDKFGQAVPAYDKALSLIGD
FT                   KIPEARWFPLYARGIALERSGQFSKAEADFRAALKIRPDSAQVLNYLGYSLVDRSEKLD
FT                   EALALIQRAVELRPDDGYILDSLAWAYFRLDRYPEAVAPMERAVAAMPGDPLVNDHMGD
FT                   IYWMVGRKREAEIQWHRALSLKPETEAEVHRIRAKLERGLDAVLEEEKANGGKLPEVRA
FT                   PEPARAD"
FT   sig_peptide     complement(396235..396312)
FT                   /locus_tag="Pden_0424"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.889) with cleavage site probability 0.321 at
FT                   residue 26"
FT   gene            complement(396309..397955)
FT                   /locus_tag="Pden_0425"
FT   CDS_pept        complement(396309..397955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0425"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   electron transfer flavoprotein-ubiquinone oxidoreductase;
FT                   KEGG: sil:SPO0316 electrotransfer ubiquinone oxidoreductase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68539"
FT                   /db_xref="GOA:A1AZ45"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ45"
FT                   /protein_id="ABL68539.1"
FT                   /translation="MSEIERESMDYDVVIVGGGPAGLSAAIRLKQVNPELSVVLLEKGS
FT                   EIGAHILSGAVLDTSGLDRLIPDWKDRGAPVTTEVTQDNFYILGPHGQVRVPNWPMPPL
FT                   MNNHGKYIVSMGNVCRWLAEQAEALEVEIFPGMACSQLVYEGDRVVGVVAGEMGLNADG
FT                   SPGPAYEPGMELRGKYVLIAEGVRGSLAKELIGKYDLSAGHEPQKFGLGMKEIWEIDPA
FT                   KARPGTVTHTMGWPLGKNAGGGSFIYHLEGNQVLVGFVVHLNYANPYLYPYMEFQRFKH
FT                   HPLVADLLEGGKRVAYGARAISEGGWQSIPKLTVPGAALLGCSAGLVNVPRIKGNHNAM
FT                   LSGIAAAEAAAKAIAAGREGDELTDYEADLRSGPIARDLKPVRNVKPLWSKLGLWSSLV
FT                   LGGFDMWVANLTGWNPLGTWKHGKTDAQATGKAADFQPIDYPRPDGKLSFDRLTNVAFS
FT                   FTNHEESQPCHLKLKDPAVPIAVNLPLYAEPATRYCPAGVYEVLEGEGGPRFQINFQNC
FT                   VHCKTCDIKDPSQNINWTTPQGGDGPNYPNM"
FT   gene            398232..398702
FT                   /locus_tag="Pden_0426"
FT   CDS_pept        398232..398702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0426"
FT                   /product="transcription elongation factor GreA"
FT                   /note="TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: rsp:RSP_1776 transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68540"
FT                   /db_xref="GOA:A1AZ46"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZ46"
FT                   /protein_id="ABL68540.1"
FT                   /translation="MEKIPMTRAGYDQLDEELRELRSVQRPAVIRAIAEAREHGDLSEN
FT                   AEYHAAREKQSFVEGRIKELEMILSRAEVIDPTRLNGSIKFGATVTLVDEDSEEERTYQ
FT                   IVGEAEADLERGLLNIRSPLARALIGKDEGDSIEVVTPGGGKSYEIISIRYV"
FT   gene            398720..399667
FT                   /locus_tag="Pden_0427"
FT   CDS_pept        398720..399667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sil:SPO0311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68541"
FT                   /db_xref="GOA:A1AZ47"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ47"
FT                   /protein_id="ABL68541.1"
FT                   /translation="MDSLDPLRRLAVEQARNRALMIGAAVGLAWLVLVGLFAFFGPEAE
FT                   GQGAVGWPLWLVGVFLPLALVWLAVWAARSLLILRLEAEELRAMLARMQGEGAAAEPMA
FT                   EPRPVAPAPAPAVRRSTVPPAPRPAADARQATLELDSLPETELTATELFHALNFPDGPE
FT                   DREAIRCLRLALADPGMARLIRAAQDVVTLLAGQGVYMDELAMPQTDPALWRRFAEGAR
FT                   GETVAALAVIRDEDALASAGAMLRSDEVFRDVAHHFLRHFDRLMSRKAQDSDAELLAVL
FT                   AETRSGRAFTLLAQVTGMLGRTGTEAEDEAAEAR"
FT   gene            complement(399664..400251)
FT                   /locus_tag="Pden_0428"
FT   CDS_pept        complement(399664..400251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0428"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rsp:RSP_0736 MobC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68542"
FT                   /db_xref="GOA:A1AZ48"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ48"
FT                   /protein_id="ABL68542.1"
FT                   /translation="MPGPQTPPRIQRGIPPRLHDAAAALYWRHFGAQILPWPATARQGV
FT                   ALVRAAMRPEQALVALAPSGRLVGMAGLRDAGGGFLAPHAKGFVAVWGPARGRLRHLAT
FT                   GLYRPGAETADLVLDGIAVQPQWRRQGIARALIGAAAAHARRLGHPALRAEVEAGNHGG
FT                   MAAWQAMGFQPLARQRLGWPWSAPAHVLRLAL"
FT   gene            400357..401133
FT                   /locus_tag="Pden_0429"
FT   CDS_pept        400357..401133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0429"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: rsp:RSP_0739
FT                   branched chain amino acid efflux pump, large (AzlC)
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68543"
FT                   /db_xref="GOA:A1AZ49"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ49"
FT                   /protein_id="ABL68543.1"
FT                   /translation="MTAQADLAADSCLTPEQSRALRRKPAQCVRHGFVQALPFILVLLP
FT                   FGMLFGVVATDAGLDLPQILGFTVLVLAGASQFTAVQLMTDHAPALVIIVSAIAVNLRM
FT                   AMYSASLVPWLGRARPRDRAWIAYVLVDQSYALAIQHYEKHPRLNLEQRIGYFLGAVLA
FT                   TCPIWLLATLLGVWLGQAIPEDWALDFAMPITFLALIAPMLRSPAHLAAALVAVVGSLV
FT                   FAFLPSGLGLFVAAPLAMLTGAGVEVLMERRNGARL"
FT   gene            401130..401462
FT                   /locus_tag="Pden_0430"
FT   CDS_pept        401130..401462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0430"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; KEGG:
FT                   rde:RD1_3412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68544"
FT                   /db_xref="GOA:A1AZ50"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ50"
FT                   /protein_id="ABL68544.1"
FT                   /translation="MTGYSDATIWLIILTVALGTYGLRWSFLGVFGSRPMPLWAQRLLR
FT                   YTAVGVLPAIVAPLVVWPAATHGQPDPARMIAAAVAVAVGVATRNVLAAILSGMATLYA
FT                   ALYLIT"
FT   gene            complement(401447..402094)
FT                   /locus_tag="Pden_0431"
FT   CDS_pept        complement(401447..402094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68545"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ51"
FT                   /protein_id="ABL68545.1"
FT                   /translation="MQRRAFLALALPAALAACGADNKWASDEAIRRARYVSDEPPSITL
FT                   FSVIGIPRGEGGHSALMINGSQRVIYDPAGSWEHPAIPERHDVLYGITPNFRNFYIDYH
FT                   ARSTYWVAEDTVRVPLSVADAAIRSVERQGASNKSFCAVNTGKALSRVPGFEGAPTGFS
FT                   VLKLREWFLTLPGVTSRRHMDGDPANNHDVLLRQKSGSITGYGRDGQLHVMR"
FT   sig_peptide     complement(402035..402094)
FT                   /locus_tag="Pden_0431"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.897 at
FT                   residue 20"
FT   gene            complement(402118..402318)
FT                   /locus_tag="Pden_0432"
FT   CDS_pept        complement(402118..402318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0432"
FT                   /product="aa3 type cytochrome c oxidase subunit IV"
FT                   /note="PFAM: aa3 type cytochrome c oxidase subunit IV;
FT                   KEGG: rsp:RSP_6128 Aa3-type cytochrome c oxidase subunit
FT                   IV"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68546"
FT                   /db_xref="GOA:A1AZ52"
FT                   /db_xref="InterPro:IPR012422"
FT                   /db_xref="InterPro:IPR036596"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ52"
FT                   /protein_id="ABL68546.1"
FT                   /translation="MGYPCARRIASFTDRIMASHHEITDHKHGEMDIRHQQATFAGFIK
FT                   GATWVSILSIAVLVFLALANS"
FT   gene            complement(402332..403354)
FT                   /locus_tag="Pden_0433"
FT   CDS_pept        complement(402332..403354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0433"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rsp:RSP_0741 putative metallo-beta-lactamase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68547"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ53"
FT                   /protein_id="ABL68547.1"
FT                   /translation="MIRSEAHNPPAEGEAHEIAPGVFWFQLPLPFKPDTVNAYAFRDAD
FT                   GWTVVDTGLDTRRTRAIWQGILQGPLAGAPVVRLIATHHHIDHIGLAGWFQAQGAELWT
FT                   SRASWLMARMGILDVQERPTPQAVAFWRQAGMPPELLDERSHERPFNSADVCAPLPPGY
FT                   RRLSEGQQVTFGERRWVVRMGHGHAPEHVTLWSLDDDLVIGGDQMLATISPNLGVYPTE
FT                   PEADTVGDWLESCDRLAEYARPEQLVLPGHKLPYRGLPTRLRQLATNQRAALDRMLEGL
FT                   RQEPLSTVGCFPLLYRRQIAKPEFGLALAEAVGHVNHLRATGQVWPVGKTETGAVLWGA
FT                   "
FT   gene            complement(403351..405042)
FT                   /locus_tag="Pden_0434"
FT   CDS_pept        complement(403351..405042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0434"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   rsp:RSP_0742 probable acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68548"
FT                   /db_xref="GOA:A1AZ54"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ54"
FT                   /protein_id="ABL68548.1"
FT                   /translation="MAYQAPVDQIAFILNRIVSFPELSGTARFAEATAETMTAVLAEAG
FT                   KLATEVIAPANRAGDLTPARLENGKLRSSPGYAQAFRALAEGGWIGIAADPEHGGMGLP
FT                   QALNMAVNEMIASGCLALQLNPLLTQGQIEALEHHGSDELKALYLPKLISGEWSGTMNL
FT                   TEPQAGSDVGALTTKAERAEDGSYRVTGQKIFITWGDSDVTENVCHLVLARLPDGAAGT
FT                   RGISLFMVPKFIPDEAGRPGIANDLRVVSLEHKLGIHGSPTCVMSFEGAKGWLVGEEHK
FT                   GMAAMFTMMNAARLGVGVQGVAQAEAALQQAVAYAAERVQMGPIIRHPDVRRMLAESRA
FT                   EVFAARAICLGCAVALDMARATGSEEWAARAAFLTPIAKAHGTDVGIRVADTAVQVHGG
FT                   MGYIEETGAAQYLRDVRITAIYEGTNGIQAMDLVGRKLADGGAAAMALLDEVLDGAKAA
FT                   QSAEPELANQLWQAAETLREATQELLEQDMPDRFAGAVPYLAAFARVLGAHYHLRAATG
FT                   GGSKALARLYITRILPQFAADLVAARAGLADLEALDDAVLLGQMAG"
FT   gene            405159..406109
FT                   /locus_tag="Pden_0435"
FT   CDS_pept        405159..406109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0435"
FT                   /product="translation factor SUA5"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5 domain protein; SUA5/yciO/yrdC, N-terminal domain;
FT                   KEGG: rsp:RSP_0743 putative translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68549"
FT                   /db_xref="GOA:A1AZ55"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ55"
FT                   /protein_id="ABL68549.1"
FT                   /translation="MQTLILGHDPRGVRTAAELLAQGEPVAIPTETVYGLAGDARNPRA
FT                   VARIYEAKGRPSFNPLIVHVPDLAAAGRIADFDDAALALARAFWPGALTLVLPLRPDAG
FT                   IASLVTAGLDTVAIRVPAHPAAQEVLRVFGGPLAAPSANPSGRISPTTAAHAADPETGL
FT                   GGRIAAVLDAGACPVGVESTIVGWVDGQPALLRPGGVAAEAIEAVLGRPLARPEADPDA
FT                   PTAPGQLTSHYAPRASLRLNADAARPGEVLIGFGPVAGEMTLSETGDLTEAAARLFDLL
FT                   HRADAEERPIAVAPVPERGLGAAINDRLRRAAAPR"
FT   gene            complement(406113..406685)
FT                   /locus_tag="Pden_0436"
FT   CDS_pept        complement(406113..406685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0436"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   sil:SPO0296 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68550"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZ56"
FT                   /protein_id="ABL68550.1"
FT                   /translation="MDQSSNLTGKMLIAMPGMRDPRFEQSVILICAHSEDGAMGLVVNR
FT                   PLPEIGFSDLLAQLGIQAGANALDIPVRFGGPVEPGRGFVLHRAPREIELDENRMRITD
FT                   DLAMSTTRDILEDFARGLGPQPAMLALGYAGWGPGQLDSEIRENGWLTSDRGDEIIFGA
FT                   EDAGKWRAALKSLGIDPLMLSPDAGHA"
FT   gene            406794..407576
FT                   /locus_tag="Pden_0437"
FT   CDS_pept        406794..407576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rde:RD1_3420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68551"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ57"
FT                   /protein_id="ABL68551.1"
FT                   /translation="MKTLALLFITAAPALAQDLPPGLLSAELLPGWTTSQGHRMTALHL
FT                   RLEPGWKTYWRSPGDAGVPPRFDWGGSQNLGEVRLMWPRPEVIESGGERTLGYHDELVL
FT                   PIEIAPASHAAPVEPRAVVDFGICQDICVPVRVELQAGPPGPMPDPVIEAAIARQPETS
FT                   DRQPECRIARIKDGMQVTATLPAADSARGDEVAMELADDEIWVSAPETHAVGNRLTAQA
FT                   EFVAASGQPFPLDPGSLRVTLIGPDDAVEFQGCRVAGD"
FT   sig_peptide     406794..406844
FT                   /locus_tag="Pden_0437"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 17"
FT   gene            complement(407573..408388)
FT                   /locus_tag="Pden_0438"
FT   CDS_pept        complement(407573..408388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0438"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   rsp:RSP_1001 putative DNA polymerase bacteriophage-type"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68552"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ58"
FT                   /protein_id="ABL68552.1"
FT                   /translation="MTADPTYRGFALDAETALALLQWQAELGADEPCLDAPLDRYAMPD
FT                   RAEPSPAPATAAPQAANPRSPVRDEAEDLVARAEAMATAATTLAELAAAQEAFDGIELK
FT                   KGARNFCFCDGNPAARIMIIGEAPGEEEDRQGRPFVGRAGQLLDQMFGAIGLSREAVDA
FT                   ERALYITNVLTWRPPGNRRPEPAEIAMMLPFLTRHVELAQPQLLVLMGNTPCIAALNQQ
FT                   GILKLRGKWTTAFGLPALPMAHPAYLLRTPLAKREAWADLLSLSARLEG"
FT   gene            complement(408494..408895)
FT                   /locus_tag="Pden_0439"
FT   CDS_pept        complement(408494..408895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68553"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ59"
FT                   /protein_id="ABL68553.1"
FT                   /translation="MKALAALAGALVLGTGAALADGGITVKLPDVSNLSDTEAKSLIAE
FT                   LANVNVITSNCPDYEITDGEWTLITGTGDLLAAKLGLDASAYDRSYYGPAFKLLDDPGA
FT                   CDRVGPTAKPLIQRLVGMGGGTTPLTQSQ"
FT   sig_peptide     complement(408833..408895)
FT                   /locus_tag="Pden_0439"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            409050..410171
FT                   /locus_tag="Pden_0440"
FT   CDS_pept        409050..410171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0440"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="KEGG: rsp:RSP_0859 hypothetical protein; TIGRFAM:
FT                   3-isopropylmalate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68554"
FT                   /db_xref="GOA:A1AZ60"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ60"
FT                   /protein_id="ABL68554.1"
FT                   /translation="MTTYSLLILPGDGIGPEVMAEVRKVIGWFEKSRGLSFDVSEDLVG
FT                   GAAYDKYGKPLADETMAKAQAVDAVLLGAVGGPKYDNLDFSVKPERGLLRLRKEMDLFA
FT                   NLRPAQCFDALADFSSLKREVVAGLDILIVRELTSGVYFGEPRGIHADDNNPDNEGGRV
FT                   GVNTQRYTSGEIRRVARSAFELARKRSNRVCSMEKANVMESGILWREEVQWVHDNEYPD
FT                   VELSHMYADNGAMQLVRNPRQFDVIVTDNLFGDILSDAAAMLTGSLGMLPSASLGAPMA
FT                   NGRPKALYEPVHGSAPDIAGQGKANPIACILSFAMCLRYSFGLGAEADLLEKAVERVLA
FT                   DGVRTGDLMGAEGGKPVSTAEMGDHIVAALSAL"
FT   gene            410232..411185
FT                   /locus_tag="Pden_0441"
FT   CDS_pept        410232..411185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0441"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: rsp:RSP_0858 putative transporter,
FT                   RhaT family, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68555"
FT                   /db_xref="GOA:A1AZ61"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ61"
FT                   /protein_id="ABL68555.1"
FT                   /translation="MTAGNVKGALLALLSMGLYSTHDVIIKLLGATYPALQILFFSALL
FT                   SFPPLAVLLLRDPTHGTLLPRNPFWVGLRSLCIVASGVGGFYAFSVLPLAQVYSILFAA
FT                   PLIVTVLSVPLLGEKVGLHRWLAVCAGLGGVLIVLRPGVTPLGLGHLAALMGATATALS
FT                   AIAVRRLGRSERTVILLLWPMIGNFLLTGASLGFAYRPMELGDLALTGVIAALGLAAGF
FT                   LLILAYQAGEAANVAPMQYSQMLWAVGYGWFLFGERPDGPTVLGAGLIMASGLYILMRE
FT                   RLGASRLRPATRARFGGEAVTAPRWSLLQRLLRERR"
FT   gene            411262..411338
FT                   /locus_tag="Pden_R0010"
FT                   /note="tRNA-Pro1"
FT   tRNA            411262..411338
FT                   /locus_tag="Pden_R0010"
FT                   /product="tRNA-Pro"
FT   gene            411827..412228
FT                   /locus_tag="Pden_0442"
FT   CDS_pept        411827..412228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68556"
FT                   /db_xref="GOA:A1AZ62"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ62"
FT                   /protein_id="ABL68556.1"
FT                   /translation="MKAVGYVACLLGGAVLCYLLLSLGVVDAVDGLPGTMQEPAIAMPT
FT                   YLGFMSAMMTAVTAVLAAVAIGIGVVTFFTFGGIKAEARKIASERVNELVNEKLSDDAI
FT                   KARIDEIAFGQGPRGELDEDFDPDDTGNR"
FT   sig_peptide     411827..411913
FT                   /locus_tag="Pden_0442"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.885) with cleavage site probability 0.854 at
FT                   residue 29"
FT   gene            412240..412752
FT                   /locus_tag="Pden_0443"
FT   CDS_pept        412240..412752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0443"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; KEGG:
FT                   gbe:GbCGDNIH1_1521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68557"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ63"
FT                   /protein_id="ABL68557.1"
FT                   /translation="MTSREYNRIEGPAKKILERYLAEYPVKLGQLAKELGVSIKVSSMS
FT                   TGVSGQIMKEDGNYTIRVNRHEARERQRFTIAHELSHFFLHKAVIDSSPDGIKDNVLYR
FT                   SGEPERIEYEANRLAADIVMPMALVEQVLRDEFGGVVTEATIESLAARFQVSKAAMEIR
FT                   LSTFAEA"
FT   gene            412764..413840
FT                   /locus_tag="Pden_0444"
FT   CDS_pept        412764..413840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gbe:GbCGDNIH1_1520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68558"
FT                   /db_xref="InterPro:IPR025683"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ64"
FT                   /protein_id="ABL68558.1"
FT                   /translation="MVLENKSYVPTLAIRASEMNGLEFLPGATKDRMTPCILLAPWANS
FT                   LTLDRAIDRVERAFPNRNYFLDIDRDYQFTNLESGPQQELARLMESDNAFANWVEFVGR
FT                   HENAWPCIQSRGQSEADLRRQIEAIQELGRPYCMRIVRDRFPSNIQEIVAAFAAGGAAD
FT                   FAIILEGGWTRDPLTLSVWFEGVIAESLQEIDAAVPVVLSCTSIPKMFSAFSGITPVPF
FT                   SNRQLIDQISRRSNRTRVIYGDWGSTRPREESGFASRPLDRIDYPTDGAWYIVRNKDEE
FT                   WDFKAAAEELIENSDIWDGNLNIWGEEMIYQTTINEEIGIDTPQKNVAARVNIHLHRQA
FT                   FYGAGDIGGMNLDEDWED"
FT   gene            414070..414585
FT                   /locus_tag="Pden_0445"
FT   CDS_pept        414070..414585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0445"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sil:SPOA0122 ISSpo9, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68559"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ65"
FT                   /protein_id="ABL68559.1"
FT                   /translation="MSRPTPPTYKTRNWPAYNEALKRRGSLTIWFDTDTTWDAVPTGRR
FT                   GRQQTYSDAAIQTCLSMKALFGMALRGAAAVIPPRKNAKPWKPNTPGVRARNEALRASK
FT                   YLGRALWRNWSGYHRRSRVESKMHCVKLLGQRLMARDFDRQVAEIQIRIAVLNDYTALG
FT                   IPVTEAVG"
FT   gene            415141..416178
FT                   /locus_tag="Pden_0446"
FT   CDS_pept        415141..416178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0446"
FT                   /product="zinc finger, CHC2-family protein"
FT                   /note="PFAM: zinc finger, CHC2-family protein; KEGG:
FT                   bpa:BPP0490 putative DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68560"
FT                   /db_xref="GOA:A1AZ66"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ66"
FT                   /protein_id="ABL68560.1"
FT                   /translation="MSRKRYDLERIKAIPIATVAADLGFALSPRGTGRCRLPGHPDQRP
FT                   SFSLRSISNGFSCFGCQRSGSVIDLVMAMDNLDFLAACRWLDDNYLNSISAQPRSRRRP
FT                   STIQQTLPVPVQSSSHGMAPEVYGWILDQSPLSASGRAYLQRRAFSAETIAHFRVGQIG
FT                   DRTSLFRRALSAFGMPRLEEAGLVMQGRYGPLLCLPSNYLLFPFLQDGTVTYLQARRAD
FT                   DGKEYRWFCPAKLLPPPYNLDALAKPGSTITICEGITDVLSAHELGMLPIGLLGAMRNL
FT                   GTDIIDRLIGRNVAIFADADRSGRSLAKRLSDRLAARGITVVTKQLPPEVNDLNDYLRS
FT                   RRGIA"
FT   gene            416175..419363
FT                   /locus_tag="Pden_0447"
FT   CDS_pept        416175..419363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0447"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpa:BPP0491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68561"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ67"
FT                   /protein_id="ABL68561.1"
FT                   /translation="MTWFNLLLMPENLLWAWRKARRCYRMADGLFDQAEIAAFELNLEA
FT                   ELTAIRHDFETGNWRNRPIRLVPQPKKPDKEGKPRLRQYFEISVRDQVAWIALVNVLGP
FT                   ELDQRMPAWSYGNRLYRAAWYEEETAEGQNSKLNIGPYRHSAGYLYRHFKHSWPLFRRH
FT                   ISLTARKMVGKSIEEDDLDAGERLALEQGDELAYFHPTFWNRPASGDNTLYAASLDLSK
FT                   FYPSVQVSAIQRGFDTLVEGFSDEPRLSALLSAMLRFEVDDGGLDQALKAKVDPIAPVG
FT                   SFDGIPTGLFVGGFLANVAMLPIDREVEKLLLQHRNIAHFRFVDDHEFLAYDFDRLLEW
FT                   MTEYAHLLARHGIGVEIEREKYSPAELKWLLHPDETVEPKKLSELRSVAIAAASVDGRK
FT                   PTQLMTRTLAQVSMLAATDFDLLTDAGRSQRLEQLEWLLLANIPDNEIRGDTRMAFAAA
FT                   RIANLTPALFRPNEELLLEHRRLKALTRGKAPADLEPAMVKPFLDRIAELEKTEQENWA
FT                   ALVKRHFGLLFEAFATHPDKVRLFTRLLDYCRVTGHNGFDRMRRWMDDHTDDDHKFLQS
FT                   YLGAMALHVLARHVLTASVALSQPDLLHRERGAARAFLENLVRADLEAFVPRASEAVRL
FT                   QQFQWNARRAFEAALMLGATEIAMTDATLSNEMLVRAIGPEKAAAPGFVVLFEMTGVPL
FT                   GVWFHWLFTTTGAHPMQPPVYWATAAKSYEPSRPEDWNGLRRYPRLLPPAAWKRLAEDP
FT                   FLLKSDDEGWLLDAARTQPDRFAGLPNIAPVIADVRARVGNSRATLSLVEWTEKTAVMD
FT                   SSDPRRSEWTALEIVRQILEPIFEPEGPDIDYLDRLHPEDVGIPFEWLPADWRALPEAT
FT                   DAGDKITWEAWQSLTRRSRVAHSPGMRDYRYHEVLVSVDDRAWPRRLRALGQILWGILR
FT                   QSFVLPAAWNIRGQERSLIEIVAHDIERLTISSFTISILRACLLPRSRETSMLTQFPML
FT                   FGNAKGQSADDTEFDQLIDSPDALLAQIKQAQDVLQKSQMTVLEHKPRQLIPVRLRQMG
FT                   AFIDGMPSEEELGL"
FT   gene            419360..420268
FT                   /locus_tag="Pden_0448"
FT   CDS_pept        419360..420268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpa:BPP0493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68562"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ68"
FT                   /protein_id="ABL68562.1"
FT                   /translation="MTTPPSPTLTPFLKVGIIQTSLDPAAAWAAVPKMSPCEEERAITE
FT                   IRGFFAAFHQEQPPPDIIVLPELSVPTGYEATLRRMAGKMQSIVIAGLDYRVGGKPGEV
FT                   HNEALLIVPKRWRNRKMGAKATTRRIGKTYAAPEEDKKLKSISCEFKRDPSVWLFDGDE
FT                   IGAFGVMVCYDFLDLERIAMYRGKVQHLFILALNKDATSFRHVAEAVARMVFCNVIICN
FT                   CGHFGGSLAVSPYRLSERRTIYQHAGPGLATAQIIELPVERLGLHQKGGDPLKDGIKEF
FT                   KSLPPGYQFSVALLEKLARLV"
FT   gene            420268..421179
FT                   /locus_tag="Pden_0449"
FT   CDS_pept        420268..421179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0449"
FT                   /product="Exonuclease, RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease, RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: ret:RHE_PE00402 probable
FT                   polymerase epsilon subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68563"
FT                   /db_xref="GOA:A1AZ69"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ69"
FT                   /protein_id="ABL68563.1"
FT                   /translation="MKFPHLFNSRASSTDLGEYLAHRLSQIPGYRVLRELSFAGQVDEL
FT                   APRSTEMRIVAIIDTETTGLDPTTDRLVEIAIERLSVDARGRIIEMEHPRSWREDPGRS
FT                   MPPRLTLLTGLTDADLAGCAFDDESIVAQLGEADVIIAHNAAFDRPFVDVRFPALQHQA
FT                   WGCSLTQLDWLTLGFDGRALGHLLFQAGWYFKGHRAEQDVHALATLLGSVAGDGRTIMS
FT                   HLLERCDRPNFRIAAIGAPFNAKDLLKSRGYRWDPTHRYWWREIDADVLDGEKDWLDHA
FT                   VYGATGGHPTVSRITASERFAR"
FT   gene            complement(421270..421986)
FT                   /locus_tag="Pden_0450"
FT   CDS_pept        complement(421270..421986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb2_0399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68564"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ70"
FT                   /protein_id="ABL68564.1"
FT                   /translation="MTTRLLPDIDLARIAPQRDDMKRKSLEQMKGGFSTFSYKPVRACF
FT                   SDIFNIQPDLDLGSADPTPWTVIESELRKRSKSDEEFNYNRRVALGLHDFATSGRVFGR
FT                   RQEFFPLSMGMGQKVTFWLPMILAIDEQASALFIEPRRTRGLTAEGRRFALSMMHERIR
FT                   AADEDFADVRLTIVQFSDPSDDRRAVRLHTDEGVELYSREDLEQMVASTYEMWRDVLEE
FT                   RENKARGKATGTGPLI"
FT   gene            complement(421964..422515)
FT                   /locus_tag="Pden_0451"
FT   CDS_pept        complement(421964..422515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb2_0400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68565"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ71"
FT                   /protein_id="ABL68565.1"
FT                   /translation="MSGPYDPRAIANLMLDEADRRGWKITNLALQKLLYFAHGIHLTKT
FT                   KRPLVSGYFEAWQYGPVHPAVYRAFKPSGSAPIINRAAAKDPLTGKTRDLPKPTDLEVI
FT                   DLVSDVMRSYGHLPPGRLVDLSHAKDSPWSVVVDKARTDVAFGMRIPDDVIIARFRHHK
FT                   VSVGTSPRAGEPPSDDAPFA"
FT   gene            complement(422858..423403)
FT                   /pseudo
FT                   /locus_tag="Pden_0452"
FT   gene            complement(423504..423761)
FT                   /locus_tag="Pden_0453"
FT   CDS_pept        complement(423504..423761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68566"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ72"
FT                   /protein_id="ABL68566.1"
FT                   /translation="MRRTIRMDGGDVFTEPSDEQLAAHDAENLQSMLTYLRDNPTDDAE
FT                   CVLEVKVSMSALAKMQLRSIQEKISLQAVLRESLRRDGLS"
FT   gene            complement(423758..424588)
FT                   /locus_tag="Pden_0454"
FT   CDS_pept        complement(423758..424588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68567"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ73"
FT                   /protein_id="ABL68567.1"
FT                   /translation="MLPPHRIPAIALLTFLAAAAAGAQSLPQQPGYDAFQHAVVVEPRP
FT                   YEFEILGVKPGMPIDEAVRLIEEHLGKELSPLDGTLQISSPDGRTFRTELRLGYETPGI
FT                   TFFLHNQDDQPFDSLKLDVSTPASGSVVTVVRREVRLSASDGPDGASLLAQLEDLYGEP
FT                   SETKVSPGTNSWLWATDMDYSDIAFVGGGPEPRYACVRGLPDNGRYSYEAPFLTGGPNN
FT                   CGATFGVSHRTSATTVTLNFRLTDYKLVDQDRAAANSQVDEKLTATAAPSDMKL"
FT   sig_peptide     complement(424517..424588)
FT                   /locus_tag="Pden_0454"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.850 at
FT                   residue 24"
FT   gene            424675..424929
FT                   /locus_tag="Pden_0455"
FT   CDS_pept        424675..424929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0455"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   rde:RD1_0810 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68568"
FT                   /db_xref="GOA:A1AZ74"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ74"
FT                   /protein_id="ABL68568.1"
FT                   /translation="MPDADDALLEAFAKILRKQRTAAGLSQEELAHRAGVSMRYVSLLE
FT                   SRRHQPSLATIHGLCQGLGLSMVELIGAVEAEFSERGQH"
FT   gene            complement(425445..425816)
FT                   /locus_tag="Pden_0456"
FT   CDS_pept        complement(425445..425816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68569"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ75"
FT                   /protein_id="ABL68569.1"
FT                   /translation="MRARFGMLGSPGALDSVNLSRALKVGAFGAFRFLALHGALLFVAI
FT                   RPDIFGGGIKLFGYRTLDSLRPSKPLRHKAYRGRSFTQFASDVAEAGSGQPQACPDHLV
FT                   AKFIVHPCTYTVSVSDQHI"
FT   gene            425929..426456
FT                   /locus_tag="Pden_0457"
FT   CDS_pept        425929..426456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpb:RPB_2539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68570"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ76"
FT                   /protein_id="ABL68570.1"
FT                   /translation="MNPFFRFPVLAPASRTIPARSKASARVQVVDVRSFLPQPVISRLE
FT                   SGLEAHCWDQLIADPEIREVQAQPPVIQYRDARGRPAVHHFDFRAHLADGSALAVAVRP
FT                   LARVRKYRFEDTLRLIASQLPRSFATRILLFTDADIPRPEVVPHAPTTRLIERARELGA
FT                   PMIPAFTHMILA"
FT   gene            426466..428598
FT                   /locus_tag="Pden_0458"
FT   CDS_pept        426466..428598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0458"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   bmb:BruAb1_0746 transposase, hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68571"
FT                   /db_xref="GOA:A1AZ77"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ77"
FT                   /protein_id="ABL68571.1"
FT                   /translation="MKHFNINLLDLVILDGVEYRLASHEPEGIVLIGTAPPHPARSISH
FT                   GELEELLRSPRFRYIPQGAARTAAERNLDGLPEYFRDLPEGKQETALWRLLFVEELLRC
FT                   IKAGLARRNEASVNIILPAVIAAVESHMRKRFRKRFKRAGRMETSRTPPCAKTLLTWTR
FT                   AYERSGFSIMALVPQTHRCGGRGQMLPGELAAFDALIAEYASPLRQTIDQIHERATNFY
FT                   ADFNRDRAERGLPELRPPSRSTVYRAIKRMDPYETYLQRWGVDAANKKFAIIEYGVQVL
FT                   RPMERVEIDEWDVDLMAWVSNAGLLDRLTTQQIAALEVIRLVICVAIDCATRCVVGLTL
FT                   SRSTSAEAAIRTMETVTIDKTAIAVGLSCRHGWHQGGRPETVAADMGSAFVSDDFKITC
FT                   AGLLARLVNPPGGVAKLRSRIERLFGTFATHFVSRFRGRTFSNPEQRGDYDAEAEASLT
FT                   DQDLLAALVTYIVDVYHQRPHAGLQGETPADCWDRLVAKYGLPAPVDAMDRRAIFGIEL
FT                   ERSISGRGVRVFGADFACEQLRDARKHSHQHKARLRFDPLDLGWVAVEVGGIWYPAHDL
FT                   SGALSGVSFYQWSAFARTVMDHNRERAAISAEIFHDGLRRLDLLSIEAANAAQLGRMTF
FT                   TAEEIDRAEQTLGLGLHLLPAASVGQAQAGSDWLQGGFEVGGSEADDAEVPPAPEDPPA
FT                   DDTPPSRKGWRFEDDE"
FT   gene            428588..429586
FT                   /locus_tag="Pden_0459"
FT   CDS_pept        428588..429586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0459"
FT                   /product="transposition protein, putative"
FT                   /note="KEGG: rde:RD1_0796 transposition protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68572"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ78"
FT                   /protein_id="ABL68572.1"
FT                   /translation="MTNEHHTAPDQVARIAVSLRKHFVAHPGYETVRRLFREIMDKRQA
FT                   ELDLGQSAEGRGIAVIGESGSGKTTAIQRILRRIDAADAESGEFRWISIRVPTPATQKD
FT                   LARAILHALAFQIQSNTTASRMWELVNFHLHLRKCWLIHLDEGQELGGRGSEVEKAGVI
FT                   NALKSLMQIPDWPTNLVVSGTPELHDLLTQDPQLSRRFFITRFLPVTEFDACDDVAELV
FT                   ARYAGLADLPLAPDLADVEFVPRLLHAGREQFGIVVELIIGAITRALADGHLALGIRDF
FT                   ARFYTERTGDVAGRNPFLVPDFRSLNTGRSPLEPDPPTGSKGRSRKPRGRR"
FT   gene            429588..431069
FT                   /locus_tag="Pden_0460"
FT   CDS_pept        429588..431069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0460"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_2090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68573"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ79"
FT                   /protein_id="ABL68573.1"
FT                   /translation="MIFPAPHARETIASYGYRIARLSGLSSLAALVHLFDLDLRALLMG
FT                   DRHSVENLARYTGCDPQALVRGALDASNPRRLQLGADPSNKVQCAPDRYRFCPACLGGL
FT                   ADGDLRSACLGRTDWLIDANHVCAEHGLRLMTVLPRKAARMQQDLSPLIPKLVAARAAP
FT                   WQPGRPTALEHYITERLDGVHSRRWIDDVQLDVAIHTAEVFGAMAMRGPQGDWKGISAD
FT                   ERREHGDLGAEVLIEGPAAIKDFLRTHIGHGRRGNDYHNAFGRAFNEFYFRKDQPAYRP
FT                   ICAVLAAYVGETFRFTGQEKVFGIRTRGVEPKTLRSLCNRHGIGLKITVQVLKAQYGLR
FT                   VGIGASSEVDPDLIADLAPKLKDLLNAQDAARHLGVSVDVVRGLIGDGLLVPDYRFNDR
FT                   MVGFSAATLESFLDDWCSAGKSPSGGQAIRTPIQTVARANRVKVSRLLIAARAVGGALY
FT                   RDRRKRGLTGVTVSHSCMAALVEQAKTDASKVGLG"
FT   gene            431234..432751
FT                   /locus_tag="Pden_0461"
FT   CDS_pept        431234..432751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0461"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   sme:SMc03282 putative transposase number 1 for insertion
FT                   sequence ISRM27"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68574"
FT                   /db_xref="GOA:A1AZ80"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ80"
FT                   /protein_id="ABL68574.1"
FT                   /translation="MPGRHVTDHQTRLFMKLRQDHPIETAAAKAGLSRSTGYRIVNDPR
FT                   LPSQKKGARGRRRPDPLEHIFEAEVVPMLQSAPGLRPVAIYEEMLRRHPELQPGIRRTL
FT                   ERRIRAWRALHGEDREVMFRQVHEPGRLGLSDFTDMGALGVTITGQLLDHLLYHFRLPW
FT                   SGFEHAHVILGGESFVALAEGLQNALWSAGGAPACHRTDSLSAAFRNLDADARTDLTTR
FT                   YEALCTQYRMVPTRNNKGVAHENGAIESAHGHLKAAVRDALLMRGSADFDHLDHYRAFI
FT                   DEIVGRRNAARGKGIAAERAHLQVLPTRRTTDFEEVIVTVTGTGGFTLRKVFYTVPSRL
FT                   IGHRLRVRLFDDRLEVFTGGTHLLTLPRGRAQANGKHDQVVNYHHVIHSLRKKPMALAG
FT                   LVYRDKLFPRPEYRRAWEALNEALPARQACRITVELLALAHDRGCEAELAAEIGRVLQD
FT                   GGLPDLSILRARFSPDPEQLPVITVTSPRLSSYEALIRAPELAEARA"
FT   gene            432748..433326
FT                   /locus_tag="Pden_0462"
FT   CDS_pept        432748..433326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0462"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; KEGG:
FT                   sme:SMc03281 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68575"
FT                   /db_xref="GOA:A1AZ81"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ81"
FT                   /protein_id="ABL68575.1"
FT                   /translation="MKPASHTVDGARLGIMLNELRLPTIKTLWPRFAEQADREGWPAAR
FT                   FLAAIAEHELAERAHRRIARHLAEAHLPPGKTLDSFAFEAVPMISKAQVSAMAAGDSWL
FT                   AKGANVLMFGPPGGGKSHLAAAIGLALIENGWRVLFTRTTDLVQKLQVARRELQLEAAI
FT                   AKLDKFDLLILDDLAYAHPVCRAAAASSR"
FT   gene            433296..434282
FT                   /locus_tag="Pden_0463"
FT   CDS_pept        433296..434282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0463"
FT                   /product="Recombinase"
FT                   /note="PFAM: Recombinase; KEGG: rsp:RSP_3812 recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68576"
FT                   /db_xref="GOA:A1AZ82"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ82"
FT                   /protein_id="ABL68576.1"
FT                   /translation="MSRGSRELSVKVFAGQCRLVELGFRQGGAPGYGLRRVLIDEHGNP
FT                   KGELSRGEQKSLQTDRVILVPGPEDEQDVVRRMYRMFVEDGRSEREIADALNADGLRTD
FT                   LDRPWTRATVHQVLTNEKYIGNNVFNKISFKLKQRRVVNPREMWIRAEGAYPAIVDEAL
FT                   FLRAREIVDARSRHLSDQDLLDALRALLASKGFLSGLVIDEHEDTPSSSAFRSRFGSLL
FT                   RAYEMVGYQPDRDYRYIKINRKLREAHPQIVAGVIAGIENAGGSAVQDPRTEILTVNGE
FT                   FTVSVVLSRCFETAAGSLRWRIRLDTLHGELMRWMPPPDGILCAMMV"
FT   gene            434326..435324
FT                   /locus_tag="Pden_0464"
FT   CDS_pept        434326..435324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0464"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: nha:Nham_3955
FT                   transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68577"
FT                   /db_xref="GOA:A1AZ83"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ83"
FT                   /protein_id="ABL68577.1"
FT                   /translation="MLAIDLAKGSFQVCAVAADGAVLYNRVMSRTRLAALLAEQPACVV
FT                   AMEACATSHHWGRMAQSHGHEVRLVPAVYVKPFVKRQKNDRADAEAIAEAALRPTMRFV
FT                   AVKSADTQGRAVAFRTHQCLVRQRTQLINALRGHLAEFGLVAPKGPASLKVLENALADP
FT                   ASDVPGPVREMGAIYVEQIARLTEVIGRLAEELEAASRTDTQLRRLCTIPRIGPVTAGA
FT                   VAAFAPDLDTFDSGRNFAAWLGLVPRQRSTGGKTRLGSVSKMGQTDIRRLLIVGAMSVI
FT                   RWVVRKGGSANRWLAALVMRKPKMVAAVALANKMARMIWALTTKEQDYRMA"
FT   gene            complement(435638..435778)
FT                   /pseudo
FT                   /locus_tag="Pden_0465"
FT   gene            436286..437371
FT                   /locus_tag="Pden_0466"
FT   CDS_pept        436286..437371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0466"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: psb:Psyr_4615
FT                   spermidine/putrescine ABC transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68578"
FT                   /db_xref="GOA:A1AZ84"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ84"
FT                   /protein_id="ABL68578.1"
FT                   /translation="MSRQPFISFNSVSKSYDHDRWVVEDLCLDVREGEFLTLLGPSGSG
FT                   KSTTLMMLAGFEQPTTGDILRRGRSLHSIAPHKRNIGIVFQDYALFPHMKIGDNIGYPL
FT                   RMRGLRGADVARKVEKALDMVDMSNLSSRYPHQLSGGQRQRVALARALVFDPDLVLLDE
FT                   PLGALDNQLRIRMQAEIKRLHAATGVTFVAVTHDQNEALSMSDRIAIFNNGRVQQIDET
FT                   RKIYDQPATAFVAQFIGDSNILPAQLVDHGAGQVRVTVADMGTLLATKQTLTPEGANMA
FT                   VAIRQERIVVSPVAANCDNRFSGQVSELAFLGDQIRVQIHIGDHRINVRRPISEFVEIP
FT                   TEGDWFEVGWSPTDCWVLPET"
FT   gene            437384..438448
FT                   /locus_tag="Pden_0467"
FT   CDS_pept        437384..438448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0467"
FT                   /product="putative spermidine/putrescine-binding protein"
FT                   /note="KEGG: bmb:BruAb2_0855 hypothetical
FT                   spermidine/putrescine ABC transporter, periplasmic
FT                   spermidine/putrescine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68579"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ85"
FT                   /protein_id="ABL68579.1"
FT                   /translation="MGTAMEKHEFYAAMVLASITATICGPYQSLADQITIASWGGNVTD
FT                   ANRAAYWEPFTTESGIAVVDDVFNGEIAKLRVQVETGSIQWDIAEVEDAEAIVGCDEGL
FT                   YEFLVIDTLPIDDMLPGTVTDCGIASLSAASVLTYNGTKFEEGPKTWTDFFNLNAFPGK
FT                   RGLRKSPTYTLEFALLADGVPREEIYEVLATPEGQDRAFAMLDRIKDEIVWYSSGTQQI
FT                   QGFISGEYDIGVGFNARVADANREQRVDLRMSWNAGYIVGHNFWVVLAGSSRIEEVRKF
FT                   LEFVTRPDRQAAFMEYIDYGSSNRESYKLLPEDRKTYLPGAGDHAEYQISYDAQFWSNH
FT                   LDQLTERFNRWIGE"
FT   gene            438445..439695
FT                   /locus_tag="Pden_0468"
FT   CDS_pept        438445..439695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0468"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ppu:PP_0413 polyamine ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68580"
FT                   /db_xref="GOA:A1AZ86"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ86"
FT                   /protein_id="ABL68580.1"
FT                   /translation="MIEAAAKYAHSATWWQRTKLFGDRSNRAAWLLLLPSMVLVALAFL
FT                   MPLGGFLWRAVDNSALSRKLPATIEAVQMWDHRTEPTETLAAAMMSDLATQAEQRGGMA
FT                   AVARELNDLLPSFRNVIMRTGRALTQPPQTVSAMEWLGAVDQQWREPDVWIAVKSNDGY
FT                   LTDRYLLTTLGLERSIDKGLTRASVDKRIYADVLVRTLWMSFVVTAATLLLAYPLAYAL
FT                   AHAPSRWRGLVLCAIMLPFLTSLLVRTLAWVIILQKHGVLNQLLIGTGIAERPLSLLYT
FT                   RGAVYLGMIHILLPFMVLPIRNSMQRIPPSHMKAALSLGATPLRAFLNVYLPATLPGIG
FT                   AGVLIVGVLTLGFYITPEFLGGSKDQMVSYFVSFFTNRSVNWGMASAMGIWLLVLAVAL
FT                   VGTLRWLTQHFNPERQG"
FT   gene            439692..440477
FT                   /locus_tag="Pden_0469"
FT   CDS_pept        439692..440477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0469"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pst:PSPTO_0565 polyamine
FT                   ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68581"
FT                   /db_xref="GOA:A1AZ87"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ87"
FT                   /protein_id="ABL68581.1"
FT                   /translation="MRVSGLSSIVLAALCILLIGFLLAPLAIILVLSFTADTYFVFPPS
FT                   GWSLKWYAEVMASAEWRRSFVNSMLIATATALLATVFGTMAALGLWKLRSPLKGVIYAT
FT                   LLAPSMVPIVITAVALFAAFSRVGLVNTYSGIIIGHTLLALPFVILSVGAALQSYNPNL
FT                   GRAAASLGGSPLRVFLGVMMPVIAPGLITGALLAFSTSFDEVVLALFLASPGQRTVPRQ
FT                   IYAGIGESITPAVAAAAALVILMATILMLLIVYRSRTRT"
FT   sig_peptide     439692..439799
FT                   /locus_tag="Pden_0469"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.688 at
FT                   residue 36"
FT   gene            440577..441365
FT                   /locus_tag="Pden_0470"
FT   CDS_pept        440577..441365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0470"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: pau:PA14_72890 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68582"
FT                   /db_xref="GOA:A1AZ88"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ88"
FT                   /protein_id="ABL68582.1"
FT                   /translation="MQQNLSPTPRKRRPGGGRKQVAAPSLPVLASGDEETLAQKVYDAL
FT                   QAGLMAGSIEPGMPLTVRSLSQVMGVSATPVREALKLLEADGVLEARNKSAFYARELGS
FT                   EEMRQVLDMRLALEGLAVRRAALAVGPDDLDRISRLNDHYATALRAAGDNGPLILERNH
FT                   QFHFAIYALCGSPILLQTIETMWLRIGPTLHLYIDAGGMDGDFPRYHEDMIDALRERDA
FT                   DAAEAALRDDLIAAARKILRLQASETTGNRQPYILENVDL"
FT   gene            441610..442539
FT                   /locus_tag="Pden_0471"
FT   CDS_pept        441610..442539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0471"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   bur:Bcep18194_C7701 protein of unknown function DUF849"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68583"
FT                   /db_xref="GOA:A1AZ89"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ89"
FT                   /protein_id="ABL68583.1"
FT                   /translation="MPKKVIITCAVTGGLHTPTMSPYLPITPDEIAEAAIGAAKAGAAI
FT                   IHLHARDPESGRPKQDPDLFLQFLPRIKQATGAVLNITTGGGLGMTLEERLRPAHRAKP
FT                   EVCSLNMGTMNFCAFELAGKYDSWKHDWEKPYLESTRDLIYANTYAMLETIMVEVGQAH
FT                   GTRFEFECFDLSHLEAVRYFAAKGLIKPPFLIQGIFGVMGGMGATIENLIHFHGVAQRL
FT                   FGSDMEFSAFAVGRRQMHFLTVAAILGGSVRVGLEDSVYIGRGELATSNAQQVQKIRRI
FT                   VEELGLEVASPDEARARLSLKGGDRVDF"
FT   gene            442556..444619
FT                   /locus_tag="Pden_0472"
FT   CDS_pept        442556..444619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0472"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG:
FT                   reu:Reut_C6223 5-oxoprolinase (ATP-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68584"
FT                   /db_xref="GOA:A1AZ90"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ90"
FT                   /protein_id="ABL68584.1"
FT                   /translation="MRLASDTGGTFTDLVVEEDDGRITMYKSPTVPDDPVLGVLRALEL
FT                   AAEDRGLSLQELMARADTFIHGTTHAINAIITGNVARTALLVTKGHRDILVFREGGRVE
FT                   PFNQSIPFPRPYIPRDLTYEIPERILSTGAIHRDLDEAAVIGVLQSLKEQQVEAVAVCL
FT                   LWATINPAHELRVGELIAEHLPGVPYTLAHDVNPTLREFRRASSAAIDASLKPLMGHYL
FT                   SGLTDRIRGEGFTGDIMLLTSSGGMVDAAEVARSPIKVINSGPSMAPISGHYYARAEAQ
FT                   ADDVIVADTGGTTYDISLVRKGVVPITRELWIGRPLLGHLVGYPSVEVKSVGAGGGSIA
FT                   HVDQGGLLRVGPQSAGAKPGPVCYRQGGTKPTVTDASVALGHIDPDFFLGGRIKLDRPA
FT                   AIEAIRKQVAEPLGMSVDEASWQIIALATEGMVQAIADITVAQGIDPANAVLIGGGGAA
FT                   GLNSTFIARRLGCKSLVIPETGAALSAAGAMMSPLISEYATSIFVSSDRFDREALAAAI
FT                   ERLRAKCEDFASRSPAASGAPRISFVAEARYEGQVWDIDVKFDPQKILGPDGSEIFRAG
FT                   FDDMHEQIFAVRDPGSAVEIIGIRATLRADIRRDVEFRLHSPGALSGDHRPREIYFHGY
FT                   GRLQTPVLRLEAIAPGRPGQGPAIIESAFTTIVVDPDARFHRSGTGSIVIHP"
FT   gene            444631..446397
FT                   /locus_tag="Pden_0473"
FT   CDS_pept        444631..446397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0473"
FT                   /product="Hydantoinase B/oxoprolinase"
FT                   /note="PFAM: Hydantoinase B/oxoprolinase; KEGG:
FT                   reu:Reut_C6222 hydantoinase B/oxoprolinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68585"
FT                   /db_xref="GOA:A1AZ91"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ91"
FT                   /protein_id="ABL68585.1"
FT                   /translation="MTTTALNGAELAILNNRVEGIVRKMANTLLRTGRSGVLNRAKDFS
FT                   CCIITADCHLLAAAESLPIHVLSGPDIMARTMAEFHPNLRRGDAFFHNSPYHGCSHAAD
FT                   LSILVPVIDADGRHRFTIFAKAHQADIGNSEPTTYMATARDIYNEGALLFPAVQVQRDY
FT                   RDIADIIRMCELRIRVPEQWRGDYLATIGAVRIGERELLALGEEIGWDRLDQFAAQWFD
FT                   YSENMMDAAIRELPAGRVMGRSTHDPFPGLPPEGVTVTAHVHARPDEGRITVDLSENID
FT                   CQPSGLNLSEACSRTAAMIGVFNSLDHRVPKNAGAFRRIEVILRRNCIAGITEHPYSCS
FT                   AATTNISDRVGNAVQLAMAEFGDGFGMAEVGAVIAPSAGVVSGVDARSGNAFVNQIFLA
FT                   FSAGAASPISDAWWTMIDVGNGGMCGLDGVELDEIYQPLLVESRRFVTDTEGAGRFTGA
FT                   PSTEVVFGPVQGGITIAYGSDGQVNPPQGVRGGGPGGGSDQFIRRKDGTVEPLPPVAQV
FT                   ELREGEMIIAISTGGGGYGPPADRDAAAVARDVREGYVSTDRARTVYGVVLDGQGQVDL
FT                   AATETRRAEMMA"
FT   gene            446394..447158
FT                   /locus_tag="Pden_0474"
FT   CDS_pept        446394..447158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0474"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   reu:Reut_C6225 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68586"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ92"
FT                   /protein_id="ABL68586.1"
FT                   /translation="MSGQSVIVTAGASGIGLAIARSFLEAGARVAICDLNAEAFAQVKA
FT                   EHPDIQTLQADIAREDQAIASVAEVVRLHGRVDVLVNNAGIAGACAPIADISAADWIRS
FT                   FDVNVHGVFFMLRAVLPDMTARGTGAIINISTGSVFTLPAGRADYVASKWALEGLTRAA
FT                   AKELGPLGIRVNAIRPGFVDSARMRSILGQKAKAEDTTMEALEQRFLDYISMRTKVQPE
FT                   DIARMAVFLASESARFVTGQLVSVDGNIEWEN"
FT   gene            447146..447538
FT                   /locus_tag="Pden_0475"
FT   CDS_pept        447146..447538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68587"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ93"
FT                   /protein_id="ABL68587.1"
FT                   /translation="MGKLTGSEGKANRMAVDVALDPNRMTDAGPDPGRGQPDGAMPRHD
FT                   DQAAALRRRYPGRCPHTFGRSQADVAAGKVFVAGISPLQSSGGEPEIGRPGQVARRPRA
FT                   ALRGIHTGTVTRPKGRGEIVEARSGA"
FT   gene            447538..447990
FT                   /locus_tag="Pden_0476"
FT   CDS_pept        447538..447990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0476"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   bja:blr1345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68588"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ94"
FT                   /protein_id="ABL68588.1"
FT                   /translation="MDDSKPRQIETGRRVVYPWYCDVMGHLATQHYMAFLDDAFLHFMA
FT                   ELAPLPQPERLGWADVRHEIDYLAELRAGNLVVLRSSLLAIGRKSIRHQTEIRRQGCGT
FT                   VCARVISTTVRFDLDARRAIDVEPGIAARAQALDLLPRAASKPSCP"
FT   gene            448044..448658
FT                   /locus_tag="Pden_0477"
FT   CDS_pept        448044..448658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0477"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2,
FT                   conserved barrel domain protein; KEGG: bur:Bcep18194_B1227
FT                   transcriptional regulator, XRE family with cupin sensor
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68589"
FT                   /db_xref="GOA:A1AZ95"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ95"
FT                   /protein_id="ABL68589.1"
FT                   /translation="MARKIEGTRIQSGLPERLRALRERKGWSLNRAAEEVGVPPSTLSR
FT                   IENRKMSPTLDLLLKIVRTFDMHPNDVFSGRPDQQEKQEISVSRASDPALIELPNLFYK
FT                   HLHPDMECFNFRAILITLFARSVEEYGGLTAHSGQEFVYLLSGKLQVHLEGHPLVTLAP
FT                   GDSIMFTSSIPHAYVSAGDSQAKLLIASSSEEDVLQVKFQK"
FT   gene            448844..450010
FT                   /locus_tag="Pden_0478"
FT   CDS_pept        448844..450010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0478"
FT                   /product="protein of unknown function DUF1100, hydrolase
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF1100, hydrolase
FT                   family protein; KEGG: ppu:PP_3195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68590"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ96"
FT                   /protein_id="ABL68590.1"
FT                   /translation="MYQYFPNNYSWSLAVSCSIAMGAQISELDEALAPLVPLVEAGHTA
FT                   AANEAWYQNWTRLGHKLNDLAKADEAAGNGFTASAKYMRAANYYLFAERIASWSDPRRM
FT                   HVYNLGIAAFRKGLELSGDRWERVEIPFEDGVLSGWLRLADTDARQPALVFYNGFDSIK
FT                   EMHYLIYAGMSARRGIATLFVDQEGTGEAVRFHNIPKRPETEVSAGKFYDFLAAHPAID
FT                   ADRIGIVGLSMGGYCAPRAASQDHRFKCVASLGAFFELDAGWEALLRGTSGSGLSDGLP
FT                   ESGIHAMHVTGKPTIDEAIAVLKARTLEPVIGQVKCPLLVVHGENDRQVALAHAEKTVA
FT                   GAVNSADAKLRVFSVAEGSTEHCGVDVMEMQGHYVYDWAARILGGRVA"
FT   gene            450007..450780
FT                   /locus_tag="Pden_0479"
FT   CDS_pept        450007..450780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0479"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   reu:Reut_C6224 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68591"
FT                   /db_xref="GOA:A1AZ97"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ97"
FT                   /protein_id="ABL68591.1"
FT                   /translation="MNRFKDKIAVVTGGSSGIGATVAMRLAAEGARVHVVASSSIDKAR
FT                   VVADRIVAADGQAAPHVADVQSEWMMRALADNVVKADGRIDIWVNAAGVFLPSPVGDTP
FT                   PEVLNGMIDINLKGSWNAIQAVVPHMKAAGGGKILNFSSVAGLTAIKGFALYCASKAAT
FT                   AMLTRVLGAELAPFNINVNAIAPGNTETPMNDAMRNDPAQSAVLAAMKAMTPSNQTFSK
FT                   PDEIASTALFLVSDEARPMYGSILLADEGLSAAIG"
FT   sig_peptide     450007..450090
FT                   /locus_tag="Pden_0479"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.909 at
FT                   residue 28"
FT   gene            450916..452154
FT                   /locus_tag="Pden_0480"
FT   CDS_pept        450916..452154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0480"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rha:RHA1_ro04907 transporter, MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68592"
FT                   /db_xref="GOA:A1AZ98"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ98"
FT                   /protein_id="ABL68592.1"
FT                   /translation="MQTVTTSSMDELKTGWKYLVAAMVGCGLGVSSLPIYTAGVFFPAL
FT                   IAEYGWSRSQLSFAVLLFTLSIGVASPIVGRAIDRFGPVRCAAVSIISAVVLYLVLARF
FT                   VNSLAGFYAVHVLIALLGAAAAPVAYTKVIAGHFSRMKGLAMGITLMGPSVVATVAPAI
FT                   VATSIDDTNWRAGYIALAVMMAIVLPFLLLLRGQGDGVQAAQAAPEDDNGAFTEAERRN
FT                   IFRLLITGLALFSLGIGSLIVHLSPMLIDAGLEPVTAAGIVGFLGISGMAGRLIGGWLA
FT                   DRIFAAYILVGVSLSAALGCLALAMVGASVAIPATIAIGFSLGVEADLMGYLVSRYFRR
FT                   SDYSKVYGWQYAAFIGAVGISPLIMARIFDSLGNYQLGLFLNVVLLTMAAAVFRVLPRY
FT                   DKPAAVRSFASAG"
FT   gene            complement(452349..452849)
FT                   /locus_tag="Pden_0481"
FT   CDS_pept        complement(452349..452849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0481"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gbe:GbCGDNIH1_1799 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68593"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ99"
FT                   /protein_id="ABL68593.1"
FT                   /translation="MQPKPMRARLDSADALDRALSHCPASRVSERYVRVLGQNRSTQRR
FT                   LSRDRDDERQLTDDIVALARRYGSYTFNRISDSGAFSLSCTSAEPASVIGLSLSAPAPK
FT                   VRSALSFAVSLWCVSSQLAEVNAFGERIASRDPDRQAAKVQIRVAPMNRLNALGIAEIE
FT                   RVA"
FT   gene            453006..453269
FT                   /locus_tag="Pden_0482"
FT   CDS_pept        453006..453269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0482"
FT                   /product="SpoVT/AbrB domain protein"
FT                   /note="PFAM: SpoVT/AbrB domain protein; KEGG: sme:SMc03949
FT                   nitrogen regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68594"
FT                   /db_xref="GOA:A1AZA0"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZA0"
FT                   /protein_id="ABL68594.1"
FT                   /translation="MPHPQPSSGPREAKLFRNNKSQAVRIPADFEMPGDRVNIYRDGNR
FT                   LIIEPLRRKNLLEVLAGLDPLGPEDQFPDVDETLLPAKEIDL"
FT   gene            453266..453667
FT                   /locus_tag="Pden_0483"
FT   CDS_pept        453266..453667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0483"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; SMART: Nucleotide
FT                   binding protein, PINc; KEGG: sme:SMa0981 probable NtrR2
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68595"
FT                   /db_xref="GOA:A1AZA1"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZA1"
FT                   /protein_id="ABL68595.1"
FT                   /translation="MTLYMLDTNIVSDLLRHPDGSAAKRIAEVGPDAICVSIITAAELR
FT                   YGCARKGSAKLLAHVEAILENVQVLALDVPADAEYGGIRAELEAAGKPIGPNDLLIAAH
FT                   AYAAGAILVTDNTGEFSRVRGLRVENWIR"
FT   gene            454495..454833
FT                   /locus_tag="Pden_0484"
FT   CDS_pept        454495..454833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0484"
FT                   /product="RelE-like cytotoxic translational repressor of
FT                   toxin-antitoxin stability system"
FT                   /note="KEGG: eba:ebB86 RelE-like cytotoxic translational
FT                   repressor of toxin-antitoxin stability system"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68596"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZA2"
FT                   /protein_id="ABL68596.1"
FT                   /translation="MQTVVETPIFTRQTEKLFDEDEKRELIDFLAENPMAGDEIPGTGG
FT                   VRKLRFAASGRGKRGGARVIYYYLDESMPLYALLAYAKNARSDMTPDEKRTVAALATAL
FT                   KAAWKERK"
FT   gene            454815..455108
FT                   /locus_tag="Pden_0485"
FT   CDS_pept        454815..455108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0485"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: noc:Noc_2738 transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68597"
FT                   /db_xref="GOA:A1AZA3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZA3"
FT                   /protein_id="ABL68597.1"
FT                   /translation="MEGKEMSTFGEDLIQAMGEALAHAKGEGTAILHEPVDPREVRMRA
FT                   KLTQAQMAPLMGMSLSGYRKWEQGQRRVSGPAATLLRVIEKEPGAVQRALAG"
FT   gene            455218..455601
FT                   /locus_tag="Pden_0486"
FT   CDS_pept        455218..455601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc01416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68598"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZA4"
FT                   /protein_id="ABL68598.1"
FT                   /translation="MSTLNIHLDTGANLRTGFTEAGELAVIVNTREAIPALYFRSYEDL
FT                   HRVLTPSRLRVVMALAGQGVMSIDELARRVGRDAPAVHQDVITLADAGVIDHTEKGAEF
FT                   PHRGIHLDFWVDLSDGNMQRHEQ"
FT   gene            complement(455768..456088)
FT                   /locus_tag="Pden_0487"
FT   CDS_pept        complement(455768..456088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68599"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZA5"
FT                   /protein_id="ABL68599.1"
FT                   /translation="MPQTARALSSGCARNPRVICARQHGMKHRPPCLRSTITKMGIDHG
FT                   HAATLRHHESKLREIHVSPGRAGSIVAKKGGTIVAIWKCYEISESLALFSIRILNESSG
FT                   FG"
FT   gene            complement(456189..460739)
FT                   /locus_tag="Pden_0488"
FT   CDS_pept        complement(456189..460739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0488"
FT                   /product="glutamate synthase (NADPH) large subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="PFAM: glutamine amidotransferase, class-II;
FT                   glutamate synthase, alpha subunit domain protein;
FT                   ferredoxin-dependent glutamate synthase; glutamate
FT                   synthase; KEGG: rsp:RSP_1146 glutamine-pyruvate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68600"
FT                   /db_xref="GOA:A1AZA6"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZA6"
FT                   /protein_id="ABL68600.1"
FT                   /translation="MKDSDMTGWEQQEQARRDWMAEHSLYRAEDEHSSCGVGLVVSIDG
FT                   KISRKVVESGINALKAIWHRGAVDADGKTGDGAGIHVQIPVPFFYDQVRRTGHEPDHDK
FT                   LIAVGQVFLPRTDFAAQERCRTIVESEVLRMGHYIYGWRHVPVNTAVLGEKANATRPEI
FT                   EQILIRCDKDIDDEQFERELYIIRRRIEKAAVAAQIAGMYICTLSCRSIIYKGMMLAEQ
FT                   VAEFYPDLKDERFESAFAIYHQRYSTNTFPQWWLAQPFRMLAHNGEINTLKGNSNWMRS
FT                   HEIRMASRTFGEMAEDIKPIIPGGSSDSAALDAVFEVLVRSGRNAPMTKTILVPEAWSK
FT                   ATTDMPRAWADMYAYCNSIMEPWDGPAALAMTDGRWVCGGLDRNGLRPLRYVVTGDNLL
FT                   IAGSEAGMVPINETAVREKGALGPGQMIAVDMAEGKLYHDREIKDHLAASQPFGDWVEK
FT                   VVQPSELMAKLPETALHDGEELRRRQIAVGYTVELVEQMLVPMAEDAKEALASMGDDTP
FT                   PAVLSRQFRPLSHYFRQNFSQVTNPPIDSLRESRVMSLRTRFGNLKNVLEESSTHAEIT
FT                   MLESPFLANGEFEELTRMFEGQATQIDCTFPVDGGSDALGDALARIRAEAEDAVRSGNG
FT                   HIILTDEGISASRIGVPMILATSAVHSWLTRKGLRTFCSLNVRASECVDPHDFAVLIGC
FT                   GATTVNPYLAQDTLAERIERGLLDGNLIDIMTRYREAIDAGLLKIMAKMGISVLSSYRG
FT                   GLNFEAVGLSRAMVAEYFPGMQSRISGIGLHGLQAKLEEAHAKGFGAALVDLLPVGGFF
FT                   KARRSGEKHAWEANTMRLLQLACEKASYDIWKQFTATMRANPPIHIRDLLDIKPLGKPV
FT                   PIEEVESITSIRKRFVTPGMSLGALSPEAHMTLNIAMNRIGAKSDSGEGGEDPAHSHPL
FT                   PNGDNPCAKIKQVASGRFGVTAEYLNACEELEIKVAQGAKPGEGGQLPGMKVTDLIARL
FT                   RHSTKGVTLISPPPHHDIYSIEDLAQLIYDLKQINPRAKITVKLVASSGVGTIAAGVAK
FT                   AKADVILISGHNGGTGASPATSIKFAGLPWEMGLTEAHQVLAMNRLRDRVTLRTDGGLR
FT                   TGRDIVMAAMMGAEEYGIGTAALIAMGCIMVRQCQSNTCPVGVCTQDEKLRAMFNGSAD
FT                   KVVNLITFYATEVREILASIGARSLDEVIGRADLLTQVSRGDKSLDDLDLNPLLITVDG
FT                   SEKIVYDRSKPRNAVPDTLDAEIIRDAGRFFSDGEKMQLSYAVRNTQRTVGTRTSSMIV
FT                   QTFGMRNTLQPDHLTVRLTGSAGQSLGAFAAPGLKIEVSGDANDYVGKGLSGGTIVVRP
FT                   PMGSPLNAAENTIIGNTVLYGASDGYLFAAGRAGERFAVRNSGAKVVIEGCGSNGCEYM
FT                   TGGVAVILGRIGANFGAGMTGGMAYLYDPEGLARDYINDETLVLCPVTQAHWEEQLRDL
FT                   IERHHRETRSRRAEEILQNWEDEKANFLQVCPKEMLPHLKHPIAPVEDLAAVPAE"
FT   gene            complement(460736..461500)
FT                   /locus_tag="Pden_0489"
FT   CDS_pept        complement(460736..461500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0489"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68601"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZA7"
FT                   /protein_id="ABL68601.1"
FT                   /translation="MASRPSINPMGRGMALAAGTAAMLTLPVLPAQAANFTPPAGCKLE
FT                   VTVQNRGCSVSQHYRCSADTAGDQWVTYFTPEGPTFQSRIDRETRWMESTDLRTGLTDV
FT                   LEDQAQDHASFSTLLDSGQDDFDFWTRSNSGERLHHVGHDELTGETVQVDGVTLEVTRF
FT                   ELTTYSESGQVLIQRRGQQFISRAQGRFYGGVETSEDWTGAVQQTNDSPVTFSFPGHPG
FT                   FGSTTPEYDCDLQMVGGQGAGALWQLVKEART"
FT   sig_peptide     complement(461399..461500)
FT                   /locus_tag="Pden_0489"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 34"
FT   gene            complement(461513..463006)
FT                   /locus_tag="Pden_0490"
FT   CDS_pept        complement(461513..463006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0490"
FT                   /product="glutamate synthase (NADPH) small subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="TIGRFAM: glutamate synthase, small subunit; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: sit:TM1040_2822 glutamate synthase,
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68602"
FT                   /db_xref="GOA:A1AZA8"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZA8"
FT                   /protein_id="ABL68602.1"
FT                   /translation="MATQKMLKFVTIGREMPEKRDAASRSEDFHEIYREFAEAKAKEQA
FT                   SRCSQCGVPYCQSHCPLHNNIPDWLRLTAEGRTQEAYLRSQETNTFPEICGRICPQDRL
FT                   CEGNCVIEQSGHGTVTIGAIEKYITDTAWEEGWITPVAPTQERPESIGIIGAGPGGLAA
FT                   ADRLRRMGFQVTVYDRHDRAGGLLIYGIPGFKLEKQVVERRTQQLVEGGVDFVLNVSVG
FT                   EDISFDAIRGKHDAVLIATGVYKTRDLDIDNAAAKGVVRALDYLTASNRVDLGDEIPDY
FT                   EDGELNARGKRVVVIGGGDTAMDCVRTAIRQGAQSVKCLYRRDRANMPGSQREVQNAEE
FT                   EGVEFVWLSAPGAFTGHVTGEAMVAQERDVDDTGEIPTISAVRVQKMRLGAPDVSGRQS
FT                   PELIEGADYDEPAELVIKALGFEPEELPRLWGVDGLEVTRWGTIKADYQTHQTSLPGVY
FT                   AVGDIVRGASLVVWAIRDGREAADSIAGYLSGAARVAAE"
FT   gene            complement(463157..463960)
FT                   /locus_tag="Pden_0491"
FT   CDS_pept        complement(463157..463960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0491"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="KEGG: rsp:RSP_1150 undecaprenyl pyrophosphate
FT                   phosphatase; TIGRFAM: putative undecaprenol kinase; PFAM:
FT                   Bacitracin resistance protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68603"
FT                   /db_xref="GOA:A1AZA9"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZA9"
FT                   /protein_id="ABL68603.1"
FT                   /translation="MDHNTIVAAALGLLEGLTEFIPVSSTGHVLLAGHFLGFDSPGRAF
FT                   EVLIQLGAIMAILGVYAGRLWRIFSSAPQDPRARRFILAVLLAFLPAVVIGVLAHRIIK
FT                   EVLFETPTLIAVMLIVGGVVLLFVDRMANRPRHFSAEDFPLPMALKIGFIQCLAMIPGV
FT                   SRSGATIVGALLLGADKRSAAEFSFFLSMPTMLGAFVYDLYKNRDILDAAATGNIVIGF
FT                   VCAFLAAVVVVRGLLNYVSTYGYGLFAWWRIAVGVAVLLALQAGW"
FT   gene            complement(463960..464952)
FT                   /locus_tag="Pden_0492"
FT   CDS_pept        complement(463960..464952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0492"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein; Male
FT                   sterility C-terminal domain; KEGG: sit:TM1040_2820 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68604"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZB0"
FT                   /protein_id="ABL68604.1"
FT                   /translation="MSAAKLVTIYGGSGFLGRQIARTMAAQGWRIRVAVRRPNEAGVVR
FT                   TYGAPGQVEPVPCNVRDDLSVTACMADADAVINCVGIMVREGKNTFDAIHEEAAGRIAR
FT                   IAAETGVKRFVHVSAIGADPDSASRYAASKGRGEAAVLAHRPDAMILRPSVIFGPDDHF
FT                   YNRIASMTRLGPILFVPGANTLMQPVYVEDVARAAAMGAEGTAQPGIYELGGPDMLTMR
FT                   EVAQQVLVAIDRRRAIVGLPHWLARVTGSALDLVQAATGGLLTNRILTRDQARLLRLPN
FT                   RVSGEVKTFADLDIEPTAAPAVIADYLWRFRSSGQYEAITASAKNLRNS"
FT   gene            complement(464983..466581)
FT                   /locus_tag="Pden_0493"
FT   CDS_pept        complement(464983..466581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0493"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: ter:Tery_1077
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68605"
FT                   /db_xref="GOA:A1AZB1"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZB1"
FT                   /protein_id="ABL68605.1"
FT                   /translation="MDDLKTREWDAIVIGTGIGGGTAGRRLAEAGLSVLYVEKGPDLGD
FT                   APLSALDLDTRDPEERMSHGAWPRLLEAQLDGAWCEFDGMIGAGVGGTSAFYAATLERP
FT                   ERHDLDTSDELPHPTGGWPVGYDEMRPWFELAEDYFHINGEVDPLAPAGAKLLPPVQPL
FT                   PASDAALMTALRRSGMNPYRTHMAARFLPGCENCFGRRCPRRCKMDGRSAGVLPALDTG
FT                   RAALVDRCTVTRIEADGQRILGLACRREGQEFTLRARTYVLAAGGLGSPSLLLRSASET
FT                   WPEGLGNRNGLIGRNLMFHLSEIIAIWAGQGRHENGASRSISMRDLYFMDGQRFGTVQS
FT                   MGLTAGYGEILHALNGRFDQSALRRIRPLRHGLRFPAMIAARMLGHAKLFVGVLEDLPY
FT                   AHNRVLPDPDDPDRMRCRYDISDELRRRRAAFRKALRAAFRPHRAMFMGAAPQLNFAHP
FT                   CGTLRFGTDPATSVLDRDCRMHGIDNLFVADSSFMPTSNGVNPSLTIAANALRVADAIV
FT                   AGRQPRLAAGRSLGY"
FT   gene            466890..466974
FT                   /locus_tag="Pden_R0011"
FT                   /note="tRNA-Leu1"
FT   tRNA            466890..466974
FT                   /locus_tag="Pden_R0011"
FT                   /product="tRNA-Leu"
FT   gene            467184..467624
FT                   /locus_tag="Pden_0494"
FT   CDS_pept        467184..467624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0494"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rsp:RSP_1208 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68606"
FT                   /db_xref="GOA:A1AZB2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZB2"
FT                   /protein_id="ABL68606.1"
FT                   /translation="MIPRFGLPPGRRAYRLRPGAYALLIRDGAALLTFQQAPEPEFQLP
FT                   GGGIDPGESPLAALHREVREETGWSIGNPRRFGSYRRFCYLPDYGFWAEKLCTVWLARP
FT                   VTRRGAPAEPGHEAHWVPLPQVARLLPDPGSRAFVRAALRRL"
FT   gene            complement(467633..468904)
FT                   /locus_tag="Pden_0495"
FT   CDS_pept        complement(467633..468904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0495"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; Stage II
FT                   sporulation E family protein; SMART: protein phosphatase 2C
FT                   domain protein; KEGG: rde:RD1_0413 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68607"
FT                   /db_xref="GOA:A1AZB3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZB3"
FT                   /protein_id="ABL68607.1"
FT                   /translation="MMIIDAQALSSVPHGWRLVLLVDDSRAQRRTLAVQLIRAGYHVVE
FT                   AASGDEAMRICLERRPDIVISDWMMPGQSGLEFCRRFREMQSDRYGYFILLTSRNDKKD
FT                   IAEGLRAGADEFLTKPVSGAELLARLSASERILRMEESLRSANARLNSTLTRLRETQAA
FT                   IDRDLREAQRLQQGLVRERHGRYGDFDLSLLMRPAGHIGGDLVGFFPINARRVGLFALD
FT                   VAGHGVASALLCARLAALLSGAADQNIALRITELGLCDARPPAEILHHLNTLMIEELRT
FT                   ESYFTMVYADLDFLTGALRLVQAGHPHPVLQRADGRIESIGRGGLPVGVFSHAAYEEVQ
FT                   LVLDPGDRLFISSDGLSESENARGEPLGEDGLHAILRTNATLRGDSLLESICWSAAHYA
FT                   GGQRNDDISAVLIERRQEAGQTWG"
FT   gene            469024..469374
FT                   /locus_tag="Pden_0496"
FT   CDS_pept        469024..469374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0496"
FT                   /product="Hpt protein"
FT                   /note="PFAM: Hpt domain protein; KEGG: sit:TM1040_2886 Hpt
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68608"
FT                   /db_xref="GOA:A1AZB4"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZB4"
FT                   /protein_id="ABL68608.1"
FT                   /translation="MLDWSRINELRGEVGDDEFQLILELFLDEVEGVIMRLSRRDALRL
FT                   ETDLHFLKGCASNLGFADFGDLCDACERKAAGGRPAEVDIESLLASYAASKRALMGRLD
FT                   AALHPGRGGRRA"
FT   gene            complement(469382..470620)
FT                   /locus_tag="Pden_0497"
FT   CDS_pept        complement(469382..470620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0497"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /note="TIGRFAM: threonine dehydratase; PFAM: Threonine
FT                   dehydratase domain protein;
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   KEGG: sil:SPO0020 threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68609"
FT                   /db_xref="GOA:A1AZB5"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR011820"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZB5"
FT                   /protein_id="ABL68609.1"
FT                   /translation="MENFAASVRQAGVALRDLFEPTPLQKNDHLSAKYGAEIWLKREDL
FT                   TPVRSYKLRGAFNAMRKIGAGSQGHFVCASAGNHAQGMAYACRHFGTRGTIFMPVTTPK
FT                   QKIDKTRIFGNGVIEIVLTGDYFDQTLAAAQDFARAQGATFLSPFDDADIIEGQATVGL
FT                   ELLDQIGAAPDLVVLPVGGGGLAAGVTRLLAELAPGTRAEFAEPEGGGSLREALLAGAP
FT                   VTLPVVDNFVDGAAVARIGDLPFRTLAGFDADRVHTAPEDRICATMLEMLNIEGIVLEP
FT                   AGALAVDVLRDIPDLAGKRVVCICSGGNFDFERLPEVKERAQRFSGLKRYFILRMPQRP
FT                   GALRDFLQLLGPQDDIARFEYLKKSARNFGSVLIGIETTAPENLDRLRERLETAGIGYR
FT                   DITHDPALAEFLI"
FT   gene            complement(470699..471541)
FT                   /locus_tag="Pden_0498"
FT   CDS_pept        complement(470699..471541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68610"
FT                   /db_xref="GOA:A1AZB6"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZB6"
FT                   /protein_id="ABL68610.1"
FT                   /translation="MTDKSGAQPGRMQSFSGKPRGFRRRVRCRAALCRRGLRRSRDAFM
FT                   DQTGALLRRVFRDCWWLSAIVAMTVFLPPLLMKPLPAWHDPVALAILTLAFGIAVLGWT
FT                   IAIMGSLQRWPGLRLGLTLAIPLSMVMLARMNARSILAHSFGVSPDAFPMTLDVLTAVE
FT                   SLWLTFAGVGLLLLLLLFGLLILQMLAGAGGAALRSAALVLPLSVMAAMPLASFLAIMP
FT                   DLPRLARALDGQATYLCDFPTMLSKPVAVTFLSDTQVLAWMPDTAQPIVLPCEMRPGH"
FT   gene            471591..472817
FT                   /locus_tag="Pden_0499"
FT   CDS_pept        471591..472817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0499"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="PFAM: argininosuccinate synthase; KEGG: rsp:RSP_1212
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68611"
FT                   /db_xref="GOA:A1AZB7"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZB7"
FT                   /protein_id="ABL68611.1"
FT                   /translation="MSDAPKKVVLAYSGGLDTSIILKWLQTEYGCEVITFTADLGQGEE
FT                   LEPARQKAELLGIKPENIHIVDVREEFVRDFVFPMFRANAVYEGLYLLGTSIARPLISK
FT                   HLVEIAHQHGADAVAHGATGKGNDQVRFELSAYALDPSIKVIAPWREWDLTSRTKLIEF
FT                   AEQNQIPIAKDKRGEAPFSVDANLLHTSSEGKALENPADEAPDYVYQRTVSPEDAPDQP
FT                   EYIEVSFERGDAVAINGEALSPATILTALNEYGRKHGIGRLDFVENRFVGMKSRGIYET
FT                   PGGTILLEAHRGIEQITLDSGAGHLKDSIMPRYAELIYNGFWYSPEREMLQALIDKSQE
FT                   HVTGTVRLKLYKGGVHTVGRWSEHSLYSEKHVTFEDDAGAYDQKDAAGFIRLNALRLKL
FT                   VANRNARFK"
FT   gene            472955..473434
FT                   /locus_tag="Pden_0500"
FT   CDS_pept        472955..473434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0500"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /note="PFAM: 3-demethylubiquinone-9 3-methyltransferase;
FT                   KEGG: nwi:Nwi_0688 3-demethylubiquinone-9
FT                   3-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68612"
FT                   /db_xref="GOA:A1AZB8"
FT                   /db_xref="InterPro:IPR009725"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZB8"
FT                   /protein_id="ABL68612.1"
FT                   /translation="MTMAKNTICLWYDKDAEAAARFYAETFPDSAVTAVRHAPSDFPSG
FT                   KAGDVLLVEFTVAGIPCLGLNGGPTFRHNEAFSFQIATDDQEETDRYWNAIVGNGGQES
FT                   ACGWCKDKWGVSWQITPRVLTDALAAGGDEAKRAFDAMMEMTRIDVAAIEAARRG"
FT   gene            473477..474028
FT                   /locus_tag="Pden_0501"
FT   CDS_pept        473477..474028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0501"
FT                   /product="molybdopterin adenylyltransferase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; KEGG: bmb:BruAb2_0726 MogA,
FT                   molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68613"
FT                   /db_xref="GOA:A1AZB9"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZB9"
FT                   /protein_id="ABL68613.1"
FT                   /translation="MTQNPAADRPAHVAIVTVSDRAASGEYEDKGGPGAEDWLHATITS
FT                   PMDITRRIIPDGREIVADCLRDLADEQGADLILITGGTGPAPRDQTPEAMADVIEKELP
FT                   GFGEEMRRASLREVPTAILSRQTAGIRGATLMITIPGKPSAIATCLDAVFAAVPYCLDL
FT                   IGAAYIETDPARIKAFRPKK"
FT   gene            complement(474003..474617)
FT                   /locus_tag="Pden_0502"
FT   CDS_pept        complement(474003..474617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0502"
FT                   /product="fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /note="KEGG: rsp:RSP_0986 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68614"
FT                   /db_xref="GOA:A1AZC0"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZC0"
FT                   /protein_id="ABL68614.1"
FT                   /translation="MEEILDRIAGLGPGRRVLAVLGAPGSGKSTLAAQLAAGLDDAVLV
FT                   PMDGFHLDNRLLEADGRRGCKGAPETFDAAGFVALVQRLKAGGEVIHPIFDRALDLAIA
FT                   GAGRVEAETRLVVVEGNYLLLDRDPWRELAGLWDLSVMLDVPMEELRRRLTARWQGLGR
FT                   SPAEVMAHLENDLGNAELVLRESLPADLVVRPGPISSAETP"
FT   gene            complement(474658..475452)
FT                   /locus_tag="Pden_0503"
FT   CDS_pept        complement(474658..475452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0503"
FT                   /product="ribose ABC transporter ATP-binding protein /
FT                   fructose ABC transporter ATP-binding protein / mannose ABC
FT                   transporter ATP-binding protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sme:SMc02169 putative ATP-binding ABC transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68615"
FT                   /db_xref="GOA:A1AZC1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZC1"
FT                   /protein_id="ABL68615.1"
FT                   /translation="MTANISGEPLLKARGLVKRYGKVTALDHCDFDLLPGEILAVIGDN
FT                   GAGKSSLIKALSGAVQPDEGEIALEGKPVRFANPLDARGYGIECVYQTLAMSPALSIAD
FT                   NMFMGRELRKPGIMGQWFRKLDRPAMEKFAREKLTELGLMTIQNINQAVETLSGGQRQG
FT                   VAVARAAAFGSKVVILDEPTAALGVKESRRVLELIRDVRSRGIPIILISHNMPHVFEVA
FT                   DRIHIHRLGRRLCVIRPDDYSMSDAVAFMTGAKLPEEAATAA"
FT   gene            complement(475449..476522)
FT                   /locus_tag="Pden_0504"
FT   CDS_pept        complement(475449..476522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0504"
FT                   /product="fructose ABC transporter membrane protein /
FT                   mannose ABC transporter membrane protein / ribose ABC
FT                   transporter membrane protein"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rsp:RSP_0989 ABC sugar transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68616"
FT                   /db_xref="GOA:A1AZC2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZC2"
FT                   /protein_id="ABL68616.1"
FT                   /translation="MSSDAKTAASYEEGLQGASDKVAEFQEQKTALKRLQHWLHMTPSA
FT                   VPMIVLVAAIVVFGLLSPNFFKAVTLSTILQQIAIVGILGCAQSLVVLTAGIDLSVGAI
FT                   AVFSSVLMGQFTFRYGIPAPLAIALGLAAGTAMGFANGWLVARIKLPPFIVTLGTWQII
FT                   LAANYIYSANETIRSSAIAAEAPALQFWGYSIQPGGVKILYAVFLMVALVALLAYVLRH
FT                   TAWGRHVYAVGDDPEAAELAGVRTKRVLIQVYVLAGLFCAIAGWVMIGRFGSVSPSAST
FT                   GQLGNIQSITAVVIGGISLFGGRGSIVGMFFGALIVGVFEMGLKMVGTDPQWTFFLIGL
FT                   LIILAVAVDQWIRKASA"
FT   gene            complement(476615..477634)
FT                   /locus_tag="Pden_0505"
FT   CDS_pept        complement(476615..477634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0505"
FT                   /product="mannose-binding protein / fructose-binding
FT                   protein / ribose-binding protein"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: rsp:RSP_0990 ABC sugar
FT                   transporter, periplasmic sugar binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68617"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZC3"
FT                   /protein_id="ABL68617.1"
FT                   /translation="MTKTKLLRAALAGSALTLIAGMAQADSACLITKTDTNPFFVKMKE
FT                   GAQAKAAELGIELKSYAGRIDGDHESQVSAVEACIADGAKGILITASDTKAIVDSVKAA
FT                   RDAGLLVIALDTPLDPIDAADATFATDNFKAGELIGQWAKATMGDAAAEARIALLDLAI
FT                   SQPSVDVLRDQGFLQGFGVELGDPEKWGDETDPRIVGHEVTSGNEEGGLKAMETLLAKD
FT                   PDINLVYTINEPAAAGAYEALKAVGREGDVLIVSVDGGCPGVENVKDGVIGATSQQYPL
FT                   DMASRGIEAIAAFAKDGTRPEPTEGKDFVDTGVQLVTDKPAEGVESIDSAKGTELCWG"
FT   sig_peptide     complement(477557..477634)
FT                   /locus_tag="Pden_0505"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.988 at
FT                   residue 26"
FT   gene            477754..478944
FT                   /locus_tag="Pden_0506"
FT   CDS_pept        477754..478944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0506"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; regulatory protein, MarR;
FT                   KEGG: rsp:RSP_0991 putative transcriptional regulator, ROK
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68618"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZC4"
FT                   /protein_id="ABL68618.1"
FT                   /translation="MPNTNPAATPQGVRSQNERQILWLIRRNGPMPRAALAQATGLSAQ
FT                   AVTNITRELIAAGLLDAGGERRRGKVGQPLLPLALAPEGALFLGLKVGRRVAELVLVDF
FT                   AGRIRQIRLLPHAYPHPDAIRDFAIAGVAEILAGLTDAQHARLAGMGIASPFYLWDWAE
FT                   EMQPWRGRDLRTELAEALDLPVWLENDGSCACGAEMMFGTDELPQDFLYFYIAHFAGGG
FT                   VVLEGRLRLGPSRNAGAMGSYPVPGGRQVLDVASISVLEAALGGDLPLDDADWQVPPAI
FT                   AREWLDESARVLSHAALGAVAVLDLPLVVIDGAMPAALRAALVQGTAASLAAMRHHGVT
FT                   LPEVRAGTLGRRARTLGAAALPLGAGFLPGGSFSAPRPGRDGHETRDARPRSRDDR"
FT   gene            478963..479877
FT                   /locus_tag="Pden_0507"
FT   CDS_pept        478963..479877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0507"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: sme:SMa0116 putative
FT                   DnaJ/CbpA-type protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68619"
FT                   /db_xref="GOA:A1AZC5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZC5"
FT                   /protein_id="ABL68619.1"
FT                   /translation="MADDPYKALGLGKNASQDDIKKAYRRIAKTDHPDLNPDPAAHERF
FT                   KAASSAYDLLKDPEQRARFDRGEIDAQGQEQPQRHYYREYAESGDNPYRQHHGFDDLSD
FT                   VFSDLFGGRGGGGGGRRGGARSFDMRGSDQRFTLEIDFMTAARGGSTRITMPDGSVLEV
FT                   KIPEGAHDGQVIRLRGKGGPGMGNGEPGDALLTLIVAEDPDWHRDGNDVETTLPITIDE
FT                   AVLGGKVEAQTIDGPVMLTVPRGASSGRKLRLKGRGIKGADGRRGDQHVVLKIVMPPQI
FT                   DSELARFMEDWRQNHAYDPRRGK"
FT   gene            479874..480221
FT                   /locus_tag="Pden_0508"
FT   CDS_pept        479874..480221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rru:Rru_A2016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68620"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZC6"
FT                   /protein_id="ABL68620.1"
FT                   /translation="MTQPHYTLTQTLESVGGLTSEQLERYISAGVVVPVQSEQGPLFRE
FT                   IDLARLNLVVDLAEGYHLDEEALALVLSLVDQLHGLRGDMRAILDAVAREPVETRVRLK
FT                   AAIREVRVVTR"
FT   gene            complement(480218..480385)
FT                   /locus_tag="Pden_0509"
FT   CDS_pept        complement(480218..480385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0509"
FT                   /product="protein of unknown function DUF1289"
FT                   /note="PFAM: protein of unknown function DUF1289; KEGG:
FT                   jan:Jann_2180 protein of unknown function DUF1289"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68621"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZC7"
FT                   /protein_id="ABL68621.1"
FT                   /translation="MKPSTPCIDICKIDPASRLCTGCLRSIDEIAGWGRMTEAERLAIM
FT                   AELPARRPAD"
FT   gene            complement(480382..480858)
FT                   /locus_tag="Pden_0510"
FT   CDS_pept        complement(480382..480858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0510"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase, RNase H domain protein fold; KEGG: rsp:RSP_2684
FT                   putative endonuclease involved in recombination"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68622"
FT                   /db_xref="GOA:A1AZC8"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZC8"
FT                   /protein_id="ABL68622.1"
FT                   /translation="MICENVETFAEALPRTGAVAGLDLGTKTIGVAVSDGLRGVASPLT
FT                   VIRRTKFTADAQALLKIVQDRALVGLVLGLPRNMDGSEGPRAQSTRAFARNLERLTPLP
FT                   ITFWDERLSTVAAERALLEGDTSRKRRAEVIDQVAAGYILQGALDRLRFLGRTE"
FT   gene            complement(480855..482102)
FT                   /locus_tag="Pden_0511"
FT   CDS_pept        complement(480855..482102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0511"
FT                   /product="putative cytochrome c-type biogenesis protein,
FT                   CycH"
FT                   /note="KEGG: rsp:RSP_2685 putative cytochrome c-type
FT                   biogenesis protein, CycH"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68623"
FT                   /db_xref="GOA:A1AZC9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017560"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZC9"
FT                   /protein_id="ABL68623.1"
FT                   /translation="MFWIICAALAGVVAVAIAAPLLRRQDEGAEPAAAYDLRIYRDQLR
FT                   EVERDLERGVIDAADAERLRVEIGRKVLAADRALERTGSTRRSAGGWAALVGLALLLGG
FT                   AFLTYQRLGQPDRPDAPIAQRIAQAQALYDSRPSQAEAEAQTPRPARPEPDADYILLIE
FT                   RLREAVQKNPNDPRGLELLAEHEERLGNLVAAKDAQRRLVALRGDEASAEDLSRLAGLT
FT                   IEAAGGIITRDGEEAVARALARDARNPQARFMAGLLHLQNGRPDQAFPVWARLLAEGPE
FT                   DAPWIAPIRGSIQDLAWFAGHPDYTPPEPAASGTPGMPSLPAMPGPDADAMAAAEDMTA
FT                   EERQQMVEGMVKGLETRLATQGGTPEEWARLISSLPVIGQKDHAADILGEARKLFAGDP
FT                   TGLEVIEAAARQAGLK"
FT   sig_peptide     complement(482046..482102)
FT                   /locus_tag="Pden_0511"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.980 at
FT                   residue 19"
FT   gene            482305..483576
FT                   /locus_tag="Pden_0512"
FT   CDS_pept        482305..483576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0512"
FT                   /product="sarcosine oxidase, beta subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, beta subunit family;
FT                   PFAM: FAD dependent oxidoreductase; KEGG: rsp:RSP_2686
FT                   putative sarcosine oxidase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68624"
FT                   /db_xref="GOA:A1AZD0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006278"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZD0"
FT                   /protein_id="ABL68624.1"
FT                   /translation="MPASASSSTGRYSVFAIAREAMRLHTGWKRAWASPEPKKKYQVVI
FT                   VGAGGHGLATAYYLGRNFGITDVAVIEKGWLGGGNTGRNTTIIRSNYLQDPSAAIYDKA
FT                   LKLYENLSQDLNYNIMFSPRGLLMLAQTEHEVRGYKRTVYANQLQGVATEWVSPKRIKD
FT                   MLPIINIEGPRYPVLGGLYQERGGTARHDAVAWGYARACSAMGMHIIQNCEVTGIETQG
FT                   GQVVAVNTGKGRIECDKLALIAAGHSSVLAEMAGFRLPIESLALQALVSEPIKPCCDIV
FT                   IMANTVHGYLSQSDKGEMVIGGGTDGFNNYTQRGSWHHVEETVRALIETFPMLSRLKML
FT                   RQWGGIVDMTGDRSPILSTTPVGNIFVNCGWGTGGFKAIPGSGWAMAELVAKGQPGPLA
FT                   ADFGLSRFAEGRFIDESVAAGVAH"
FT   gene            483734..483985
FT                   /locus_tag="Pden_0513"
FT   CDS_pept        483734..483985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0513"
FT                   /product="conserved hypoothetical protein"
FT                   /note="KEGG: rsp:RSP_1403 conserved hypoothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68625"
FT                   /db_xref="GOA:A1AZD1"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZD1"
FT                   /protein_id="ABL68625.1"
FT                   /translation="MAEQNKSNLWLIVGVVVVVLVVIYWFVSSGTEPTATEPPAAPAVS
FT                   SEPAPVDDGAVSVEPPVDAAPADPAAPAPAEPAAPSTN"
FT   gene            484296..484676
FT                   /locus_tag="Pden_0514"
FT   CDS_pept        484296..484676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0514"
FT                   /product="Sarcosine oxidase, delta subunit,
FT                   heterotetrameric"
FT                   /note="PFAM: Sarcosine oxidase, delta subunit,
FT                   heterotetrameric; KEGG: rsp:RSP_2688 putative sarcosine
FT                   oxidase delta subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68626"
FT                   /db_xref="GOA:A1AZD2"
FT                   /db_xref="InterPro:IPR006279"
FT                   /db_xref="InterPro:IPR038561"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZD2"
FT                   /protein_id="ABL68626.1"
FT                   /translation="MLTLTCPYCGIAAEETELQPGGEAHLKRFGPGSTDAEFEAYLFAR
FT                   KNPKGVHFERWRHAYGCGKWFMAARDTATLQVFGTYSAQTPHPTPEIVAAIQAHRPDWQ
FT                   PDWLAEPTTQTPADTSAESLNA"
FT   gene            484673..487606
FT                   /locus_tag="Pden_0515"
FT   CDS_pept        484673..487606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0515"
FT                   /product="sarcosine oxidase, alpha subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, alpha subunit family;
FT                   PFAM: FAD dependent oxidoreductase; glycine cleavage T
FT                   protein (aminomethyl transferase); Glycine cleavage
FT                   T-protein, C-terminal barrel; KEGG: rsp:RSP_2689 putative
FT                   sarcosine oxidase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68627"
FT                   /db_xref="GOA:A1AZD3"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006277"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041117"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZD3"
FT                   /protein_id="ABL68627.1"
FT                   /translation="MTETGPFRLPRGGRLIDRAYQLPFRFDGRQMRGVAGDTLASALLA
FT                   NGQLMMGRSFKYHRPRGPIASGAEEPNALLGLGQGGRFEPNQRATTTPLVGGMVTASQN
FT                   AWPSLNADIGAINNWLYRFFPAGFYYKTFMHPRPFWKHVFEPIIRRSAGLGKAPTEADP
FT                   DKYEQAYAHVDVVVVGGGIAGLTAARDAARDGKSVWLVEQTPHFGGRTPTDHADGQARV
FT                   DALLAELQGMANVTLRRSTQATGLYDHGYLLVRESLADHDPNAGIPRQRLWRIRAGHVV
FT                   VATGALERPLSFAGNDVPGVILASAVRDYINDYGVAPGRRIVVVTNNDDAYRTALVALD
FT                   AGLDVAAVIDARSTAEGALPAAVRARGVRVLTGSAIAGVKGGHGVEAVKLCAHSGSGQV
FT                   TETIDADCVAMSGGWSPVVHLWSHCGGKLNWSDAQSMFAPDPNRPPTGADGKAMASCVG
FT                   AAAGDLLVPELTGAQAESATMPVWVMPAHAPRKMKFKMWLDFQNDVKVSDVELAAQEGY
FT                   HSVEHTKRYTTLGMATDQGKVSNINGLAVLSNALNQPIPATGTTTFRPPYTPLTLGTIA
FT                   GEARGEIFQPLRKTPMHGWHEAQGAFFEPVGHWRRPYCYPKGSESHGDAVAREIRAVRA
FT                   SVGTLDASTLGKIIVKGPDAGRYLDMMYTGMMSSLPIGKCRYGLICSENGFLIDDGVAA
FT                   RLSEDTWLVHTTTGGAERMHGHFEDWLQCEWWDWKVWTANVTEQWAQVAVVGPKARVLL
FT                   ERLGGKIDLSPEALPFMGWIEGEIAGIPARVYRISFSGELSFEVAVPANRGLELWEKLH
FT                   EAGRDLNVTPYGTEAMHVMRAEKGFIMIGDETDGTVIPQDLGMSWAISKKKADYIGKRA
FT                   QERSFMTDPGRWKLVGLESLDGRVLPDGVYAVDQGANANGQRKVQGRVTSTYMSPTLDR
FT                   PIAMGLVRQGPERMGEVLEFPVAGQESYKARIVDPVFYDKEGSRANG"
FT   gene            487599..488117
FT                   /locus_tag="Pden_0516"
FT   CDS_pept        487599..488117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0516"
FT                   /product="Sarcosine oxidase, gamma subunit"
FT                   /note="PFAM: Sarcosine oxidase, gamma subunit; KEGG:
FT                   rsp:RSP_2690 putative sarcosine oxidase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68628"
FT                   /db_xref="InterPro:IPR007375"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZD4"
FT                   /protein_id="ABL68628.1"
FT                   /translation="MAEALARISQVQDWGMIQIRADLSRAGDAIAEAAGVALPGQGRIT
FT                   TDGSRTLGWMSPDELLLVLPRAETAEALAALQDALATEHALVLDVSDMRAVFRIQGAKA
FT                   LDVLMKLCPADLAAMPQDGLRRTRAAQVACGIWRETDGYVLIGFRSVTDYLRGILTGAA
FT                   VPGTQLDPR"
FT   gene            488190..488645
FT                   /locus_tag="Pden_0517"
FT   CDS_pept        488190..488645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rde:RD1_1770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68629"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZD5"
FT                   /protein_id="ABL68629.1"
FT                   /translation="MRSALLLPALLLAGLVMPVPAVRAQDWGQEPPVVMMCQMVDESGT
FT                   GWVPEFIMLTRQTAGPRQGRIEVFDPILQRLVGQPIEARITADDRTSRSYGWALAGVRN
FT                   ASGQRTDRLDYRLTVQKADGSARVTATALGYDNVMTGTGVCGSPGGG"
FT   sig_peptide     488190..488264
FT                   /locus_tag="Pden_0517"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            488754..489353
FT                   /locus_tag="Pden_0518"
FT   CDS_pept        488754..489353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0518"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: manganese and iron superoxide dismutase; KEGG:
FT                   rsp:RSP_2693 superoxide dismutase, Fe-Mn family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68630"
FT                   /db_xref="GOA:A1AZD6"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZD6"
FT                   /protein_id="ABL68630.1"
FT                   /translation="MAFTLPDLPYAHDALAAGGMSKETLEYHHDKHHKAYVDKLNELVA
FT                   GTEWEGKSLEDIVKGTYQSGAVAQNGIFNNASQHWNHAQFWEMMGPNPGAIPGELEKAL
FT                   TEAFGSVDEFKKKFAEAGVGQFGSGWAWLVKDKDGSLKVTKTENGVNPLCFGQTALLGC
FT                   DVWEHSYYIDFRNARPKYLENFLNNLVNWENVASRL"
FT   gene            489405..489929
FT                   /locus_tag="Pden_0519"
FT   CDS_pept        489405..489929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0519"
FT                   /product="protein of unknown function DUF461"
FT                   /note="PFAM: protein of unknown function DUF461; KEGG:
FT                   rde:RD1_1682 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68631"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZD7"
FT                   /protein_id="ABL68631.1"
FT                   /translation="MVRTPRGGMGMRPASSGARLGPMREDEEMKPLLPALCLGLIPLAA
FT                   PAQDAALAVHDGYARAANPRSGAAFMVIENRGAAACTLSSVASDAAERAELHTHRDEGG
FT                   VMRMVKADPIQIPAGARHELVRGGDHVMLMGLKHPLADGDQLALTLDFGSCGEVQAHLP
FT                   VDNKRMPGHAH"
FT   gene            complement(489926..490564)
FT                   /locus_tag="Pden_0520"
FT   CDS_pept        complement(489926..490564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0520"
FT                   /product="lipolytic enzyme, G-D-S-L family"
FT                   /note="PFAM: lipolytic enzyme, G-D-S-L family; KEGG:
FT                   rsp:RSP_3601 lipolytic enzyme, G-D-S-L family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68632"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZD8"
FT                   /protein_id="ABL68632.1"
FT                   /translation="MMLRTLVLILALAAVPAAATPLRILAFGDSLTEGYGLPRKDGLVP
FT                   QLQDWLRARGHDVLVLNGGLSGDTTAGGRVRIGYSLARHKPDAVIVELGGNDLLMGFAP
FT                   QMVEGNLDSILGQAGRGGRPLLLVGIASPDHDDPLRRDWAGIWPRMATQHDALLMENLY
FT                   QPLFDLPGDGYKAMLQPDGLHASAKGVGLIVQSLGPKVEALIEKAEARR"
FT   sig_peptide     complement(490505..490564)
FT                   /locus_tag="Pden_0520"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.941 at
FT                   residue 20"
FT   gene            complement(490561..492984)
FT                   /locus_tag="Pden_0521"
FT   CDS_pept        complement(490561..492984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0521"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: sil:SPO0794 copper-translocating
FT                   P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68633"
FT                   /db_xref="GOA:A1AZD9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZD9"
FT                   /protein_id="ABL68633.1"
FT                   /translation="MKHHQNDAELTVTGMSCASCVGRVEKALAAVPGVEEPRVNLATGR
FT                   AHFRLTAPEALPRAVEALAGAGYPAAPLETRLSIEGMSCASCVGRVEKALAALPGVTSA
FT                   QVNLTTASATIHHSPGVAPQALADTVTAKGYPAELQAEAGHHMHDHGGDAASMKRNFLV
FT                   ALVLTLPVFVAEMGGHAFPAFHHWLHMALGQQTLWVLEFLLTTAVLAGPGRVFFRVGFP
FT                   ALMRRAPEMNSLVALGASAAWLYSTVATFAPGVLPADSVHVYFEAAAVIVTLILLGRWL
FT                   EARAKGRAGNAIRRLIELAPDSAHVQRDGRIVEIPVAELHPGDIVHLRPGERVAVDGVL
FT                   TEGSGAIDESMLTGEPVPVAKQPGDTVTGGTVNGNAALAYRVTATGGNTVLARIIRMVE
FT                   DAQATKLPVQALVDRITAVFVPVVIGLALLTFVLWMIFAGSLGQALVAAISVLIIACPC
FT                   AMGLAVPVSIMVGTGRGAELGVLFRRGDALQRLAEARIVALDKTGTLTQGAPALTAIEA
FT                   EDIEPLDALRLAAAAEARSEHPLAAAIVGAARDKGLDLPPAEAVQAAVGRGLSARVEGR
FT                   ALLIGNAAALTEAGITPSPALIAAAEGWAANGATPVHLAVDGRHAAAMALADPIRPEAA
FT                   ETIAELHTLGLQTAMISGDVRATAEAVGRKLGIDTVTAGVLPEGKLAAIREMGGGTVFV
FT                   GDGINDAPALAAAETGIAIGTGTDVAIESAEVVLVGGDPMGVARAIRLSRSVMRNIRQN
FT                   LFWAFGYNVALIPVAMGALVPFGGPQMSPMLGAGAMALSSVFVVSNALRLRRAA"
FT   gene            493412..493990
FT                   /locus_tag="Pden_0522"
FT   CDS_pept        493412..493990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0522"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mes:Meso_4112 ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68634"
FT                   /db_xref="GOA:A1AZE0"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZE0"
FT                   /protein_id="ABL68634.1"
FT                   /translation="MNRRQMLMAALPLVAVPSLALAQAQPAALTTQAEPKRDPYAPTEV
FT                   SIRNDFEVGSIVVVSKDFFLYHVVAPGRAVRYGVAVGKAELVWKGRATVGRKTEWPSWT
FT                   PTPAMIKRNPGQYARWADGMPGGPTNPLGARALYLYDAKGNDTSIRIHGTTEPNSIGRA
FT                   VSNGCIRMRNEAVMDLFEQVPIGTPVYVY"
FT   sig_peptide     493412..493480
FT                   /locus_tag="Pden_0522"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.925 at
FT                   residue 23"
FT   gene            493991..495088
FT                   /locus_tag="Pden_0523"
FT   CDS_pept        493991..495088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0523"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: rsp:RSP_3604
FT                   rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68635"
FT                   /db_xref="GOA:A1AZE1"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZE1"
FT                   /protein_id="ABL68635.1"
FT                   /translation="MDIRLKSLSDPALSGFDTIIDTRSPLEFAEDHLPGAINLPVLSDE
FT                   ERVQVGTIYKQVSPFDARKLGGAMVAANAARHIAGPLAGFGGGWRPLVYCWRGGQRSGA
FT                   FATILQQIGWRVGRIEGGYKAWRALVVERVTAAVAAPVVVLDGNTGSAKTEILHRLAAR
FT                   GHQVIDLEGFANHRGSLFGAMPGGQPSQKLFECRLAMALEALDPGRPLLVEAESSRIGD
FT                   LNLPRGIWQAIVAAPRLRLAVPVEARAAYTARAYADTCADPQAVARIVNLLRPLHPADR
FT                   IEAWLRMIAAADWSGLAEGLMRDHYDPRYERHRARHDDGRGPVVALDGLDDLDAAAARV
FT                   EAALAGLTLPRPAPAASPVASGGSI"
FT   gene            complement(495107..495910)
FT                   /locus_tag="Pden_0524"
FT   CDS_pept        complement(495107..495910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0524"
FT                   /product="purine nucleotide phosphorylase"
FT                   /note="TIGRFAM: inosine guanosine and xanthosine
FT                   phosphorylase family; purine nucleotide phosphorylase;
FT                   PFAM: purine phosphorylase, family 2; KEGG: rsp:RSP_2207
FT                   purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68636"
FT                   /db_xref="GOA:A1AZE2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011269"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZE2"
FT                   /protein_id="ABL68636.1"
FT                   /translation="MSRNAELARLIRDRAGDEPPEYGLILGSGLGHLAAAVEGVAIPYS
FT                   DLPGFPHAGVSGHVPQLVVGRLDGRRVAVLGGRAHYYESGRADVMRLPLEVLKALGCDR
FT                   LILTNAAGSLRADMPPGSLMLLSDHIAFAGTNPLIGEASEARFVPMTDAHDPAIRAGLK
FT                   AAAKAEGIALPEGVYCWFSGPSFETPAEIRAARVLGADAVGMSTVPEVILARFLGLRCA
FT                   AVSVITNMGAGLSDESISHEHTKAMAPLGAAKLERILRRFLGQGA"
FT   gene            complement(495894..496859)
FT                   /locus_tag="Pden_0525"
FT   CDS_pept        complement(495894..496859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0525"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rsp:RSP_2208 ABC sugar transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68637"
FT                   /db_xref="GOA:A1AZE3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZE3"
FT                   /protein_id="ABL68637.1"
FT                   /translation="MDFATVIQILDSAVRLMTPLLLACLAGLYSERAGVFDIGLEGKML
FT                   MAAFTSASVAYATGNAWLGLLAGIGGAVAMAGLHGLASISFRGNQLISGVAINFLASGL
FT                   TVLLGQKIFGLGGRTPSLSGAARFGEITLPFADTLRPVPVIGPIYAELISGHTILVYVA
FT                   FAMVPLTWWVLYRTRFGLRLRAVGENPASVDTAGVSVTRLRYGAVMICGVLCGIAGAYL
FT                   ATGISAGFVKEMTAGRGFIALAALIFAKWRPWSALFATFLFGLMEAVANRFPNLDLGII
FT                   TVPSMFMNALPYILTVIILAGFVGRAIPPRAGGEPYVKER"
FT   gene            complement(496859..498037)
FT                   /locus_tag="Pden_0526"
FT   CDS_pept        complement(496859..498037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0526"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rsp:RSP_2209 ABC sugar transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68638"
FT                   /db_xref="GOA:A1AZE4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZE4"
FT                   /protein_id="ABL68638.1"
FT                   /translation="MPAAVRDEPSHASGGSIWKTEKTEKGGLMERMPKWADVILTPLIS
FT                   LALAFGISALVILAIGESPVEALKVMVQGALGSSYGWGFTLYYTTNFVFTGLAVMVAYH
FT                   AGLFNIGGEGQAALGGLGVALVVLALPWPHWALALPAAAMGAALFGALWALVPAWLQAR
FT                   RGSHIVITTIMFNFIAAALLNYVLVNLLRPVGSMDPASARFPAAVHLPKLSDMALGLGI
FT                   EWGRNTPANVTFFVAVAACVLVWLLIWHTRLGYEIRAFGKSEPAALYAGISPVRITVLA
FT                   MLISGALAGLMAINNVMGEAERLMLNAVEGAGFIGIAVALMGRNHPLGVLLAALLFGFL
FT                   YQGGGELALWTSIPRELIVVIQALVILFTGALDNMVRMPLERLFTALRRKGA"
FT   gene            complement(498015..499640)
FT                   /locus_tag="Pden_0527"
FT   CDS_pept        complement(498015..499640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0527"
FT                   /product="nucleoside ABC transporter ATP-binding protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sil:SPO0378 sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68639"
FT                   /db_xref="GOA:A1AZE5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZE5"
FT                   /protein_id="ABL68639.1"
FT                   /translation="MPAAGALHGAPAIELRGISKAFGPVQANKDIDLVVPRGTIHGIIG
FT                   ENGAGKSTLMSILYGFYRPDAGEILIGGKPIAIADSQAAIRAGIGMVFQHFKLVQNFTV
FT                   LENVILGAEDGGLLRPSLSRARGALKRLASEYGLQVDPDALVEELSVGHQQRVEILKAL
FT                   YRQADILILDEPTGVLTPAEADHLFRILRGLRDEGKTIILITHKLREIMEITDNVSVMR
FT                   RGEMVASVKTAETGPAQLAELMVGRKVLLRVEKPPARPGAPVLEVRGLRMVDADGVERL
FT                   RGIDLEIRAGEILGIAGVAGNGQTQLLEVLGGFPEAGAKLQGEIRLNGKPLPLGGAGAD
FT                   GRARRQAGVGHVPEDRQAEGLIMDFTAWENVAFGYHHAPEFQNGMLMDNAAIRADAMGK
FT                   IQHFDIRPPNPDLAARNFSGGNQQKIVVAREVERNPDLLLIGQPTRGVDIGAIEFIHKR
FT                   IVALRDAGKAVLLVSVELDEIMALSDRIAVMFDGRIMGERLADEATTGDLGCLMAGVDP
FT                   ALTPPEAAIPPAAAPGTDAGGGAG"
FT   gene            complement(499640..500626)
FT                   /locus_tag="Pden_0528"
FT   CDS_pept        complement(499640..500626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0528"
FT                   /product="nucleoside-binding protein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG: rsp:RSP_2211
FT                   ABC transporter, periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68640"
FT                   /db_xref="GOA:A1AZE6"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZE6"
FT                   /protein_id="ABL68640.1"
FT                   /translation="MSLMKSLLAGACLTLLPVAALADPALIFDLGGKFDKSFNEAAYNG
FT                   AERWKAETGGTYKELEMQSEAQREQALRRLAQSGANPIVMTGFAFGEVLNKIAPDYPDT
FT                   KFVIIDMVVEQPNVQSVVFTEEQGSYLAGVAAAKASKSGTVGFIGGMDIPLIHKFECGY
FT                   AQGFKAANPDGKLIINYTGTTPAAWNDPVKGGELLKAQVSQGADVVYAAAGGTGIGVLQ
FT                   AAADAGVLSIGVDSNQNHLHPGMVLTSMVKGVDNSVYEAFKAGTEVEPGVRVMDLASGG
FT                   VSLAMDDNNKPLISDEIAAAIDTAAKAIDAGEIKVHDYMTDNTCPVQ"
FT   sig_peptide     complement(500558..500626)
FT                   /locus_tag="Pden_0528"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(500718..501119)
FT                   /locus_tag="Pden_0529"
FT   CDS_pept        complement(500718..501119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0529"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: rsp:RSP_2212 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68641"
FT                   /db_xref="GOA:A1AZE7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZE7"
FT                   /protein_id="ABL68641.1"
FT                   /translation="MTPDDLAALHDRCFATHPRPWSAAEFEALLAGPPNFLLTRPQGFL
FT                   LGRVIADEAELLTLAVAPEARRQGLASALLAEFAATSRARGAREAFLEVASDNAAAMAL
FT                   YARADWEIIGKRRNYYAPGVDAVLMRRTL"
FT   gene            complement(501116..501709)
FT                   /locus_tag="Pden_0530"
FT   CDS_pept        complement(501116..501709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0530"
FT                   /product="peptidase M22, glycoprotease"
FT                   /note="PFAM: peptidase M22, glycoprotease; KEGG:
FT                   rsp:RSP_2213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68642"
FT                   /db_xref="GOA:A1AZE8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZE8"
FT                   /protein_id="ABL68642.1"
FT                   /translation="MADALSLGFDTSAAHCAAALLQGDRVLFHRHEEMARGQAERLFPL
FT                   LDEVLAAAGIGWRDLSVIGCGIGPGNFTGIRISVAAARGLSLSLGIPAIGVSVTEAAAH
FT                   GLPRPCRVAVPSRTGEVIWQDFGTGQATGPQQCASHDLPPGPAPLPPAMPLAEAIARFA
FT                   AARRDQPDLPRPAPIYLRPADAAPARDRGPLILS"
FT   gene            complement(501702..502256)
FT                   /locus_tag="Pden_0531"
FT   CDS_pept        complement(501702..502256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0531"
FT                   /product="nitrogen-fixing NifU domain protein"
FT                   /note="PFAM: nitrogen-fixing NifU domain protein; KEGG:
FT                   sit:TM1040_3091 nitrogen-fixing NifU-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68643"
FT                   /db_xref="GOA:A1AZE9"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZE9"
FT                   /protein_id="ABL68643.1"
FT                   /translation="MFIQTETTPNPATLKFLPGETVLGSGTADFPAPDTAAASPLARRI
FT                   FAVPGVTGVFLGSDFVTVTKAEDAVWDHLKPSVLGAIMEHYQSGAPAIEGATASGHNDQ
FT                   DGPDAEIVNQIKELLDTRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLK
FT                   MGIENLLRHYIPEVTEVRPVG"
FT   gene            complement(502470..502925)
FT                   /locus_tag="Pden_0532"
FT   CDS_pept        complement(502470..502925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0532"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: sit:TM1040_3730
FT                   UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68644"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZF0"
FT                   /protein_id="ABL68644.1"
FT                   /translation="MRKFLVVLDDSRECLNAIRYAALRAAKTGGGVQVLAVIPANAIQH
FT                   GMGVADVMRAEAYERIEAHYEVFAKWMRDRPGIEPELVVREGEPGAELLAQIHDDPEIG
FT                   VVVLAASTESAGPGPLVTRLTREVASLPCPVTIVPGDISRERLEQIT"
FT   gene            503082..503831
FT                   /locus_tag="Pden_0533"
FT   CDS_pept        503082..503831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0533"
FT                   /product="sugar transferase"
FT                   /note="PFAM: sugar transferase; KEGG: rsp:RSP_1189 sugar
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68645"
FT                   /db_xref="GOA:A1AZF1"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZF1"
FT                   /protein_id="ABL68645.1"
FT                   /translation="MTIHQDWEKADIARFATLPQPEMSWFKGEVHATRVATMPLSKRLF
FT                   DIVLALVLLVPLSIVMAVFALILLIVQGRPIFYAAPRMVAPGRTFTHLKFRTMLRQEGD
FT                   FGVTGAHKAWRITPLGHFMRRTRIDELPQLFNILKGDMSFVGPRPTIREYVERYPTVYG
FT                   QVLKSRPGVTGLATLIYHRHEDRILRRCKSAEATEAAYAGRCLPTKLKIDLIYQRNRTL
FT                   ALDLWIIWRTVLTVLYKDERPRRRGRK"
FT   gene            complement(504029..504814)
FT                   /locus_tag="Pden_0534"
FT   CDS_pept        complement(504029..504814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0534"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /note="KEGG: rsp:RSP_0571 tRNA pseudouridine synthase;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68646"
FT                   /db_xref="GOA:A1AZF2"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZF2"
FT                   /protein_id="ABL68646.1"
FT                   /translation="MPRFALLIEYDGSPFAGWQAQAERPSVQSTIEAALGRLDPGFAAG
FT                   ARIAAAGRTDAGVHATGQVAHADLARDWDPFRLSEALNWHLKPAPVAILAAARVADDFH
FT                   ARFSAHERRYLFRLVARRAPLTHDRGRAWQVPHRLDLAAMRAGAAHLLGRHDFTTFRST
FT                   MCQANSPVKTLDELTIDEAEIPQGREYRFFLRARSFLHNQVRSIVGTLERVGAGAWPPG
FT                   RVAEALAACDRAACGPVCPPQGLYLTGVGYETPPFSDSR"
FT   gene            complement(504818..505792)
FT                   /locus_tag="Pden_0535"
FT   CDS_pept        complement(504818..505792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sil:SPO2985 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68647"
FT                   /db_xref="GOA:A1AZF3"
FT                   /db_xref="InterPro:IPR018770"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZF3"
FT                   /protein_id="ABL68647.1"
FT                   /translation="MAKRFGGRFSPQPRLDGTDPRPPARPAPGEIRHPLESRTRWVTIM
FT                   AIPFLISAFWQDPAGLALHLIAFGSIASGMWMTREGLQAEAAYDARRIARRPAIPRKLF
FT                   GGILTGLGLAIGSYVPGAEAGAGVIGVAGAMLHWLAFGSDPMRDKGMEGIDGVRQDRAQ
FT                   RIVAEGEAHLKAMQDAILRTGDRRLEARVGMFAAAARELFAHVEDNPDNIAALRRYLSV
FT                   YLQGARDATVKFADLYAQTRDPRARQDYETLLNDLEGEFAARRAKLLEGGRSDLDIEIS
FT                   VLRDRLAREGVRPQPTPSEPAELQRPMTLDDLLIPRESEKPRR"
FT   gene            complement(506103..506176)
FT                   /locus_tag="Pden_R0012"
FT                   /note="tRNA-Gly3"
FT   tRNA            complement(506103..506176)
FT                   /locus_tag="Pden_R0012"
FT                   /product="tRNA-Gly"
FT   gene            506263..507711
FT                   /locus_tag="Pden_0536"
FT   CDS_pept        506263..507711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0536"
FT                   /product="cation transporter"
FT                   /note="PFAM: cation transporter; KEGG: rsp:RSP_1854
FT                   potassium uptake transporter, transmembrane component,
FT                   TrkH"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68648"
FT                   /db_xref="GOA:A1AZF4"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZF4"
FT                   /protein_id="ABL68648.1"
FT                   /translation="MIDIRPVANIVGKVVVTLGAAMALPMLVDWWHGDPHWLIFLECGI
FT                   LTTLAGGLVALSTRQVDKSLTIQQVFLLTAMLWLVVPVAGALPFMLGAPHVGFTDAYFE
FT                   AMSGVTTTGTTAFPDLDNLPKGTNLWRAFLNWAGGLGIIVVAMIFLPAMKVGGMQFFRS
FT                   EGFDTLGKILPRAFDIAREMTGVYIAMTASCMVVYILLGMKGFDALVLALSTCSTGGFS
FT                   NYDASFAPFIGPAEYAAAFFMILASIPFIRMVQLIRGSAEPIWRDIQVRAYLRWTFYAI
FT                   AVVVLYRLLWLEAKNPLDVIRETTFNVVSTFSGTGFASTDVTQWGHFPFVILIVVGLIG
FT                   GCTGSTSCSVKVFRYLVLFQAVKAQLRRMQSPHRVFPLLYGGRPLEEDVVDSVMAFFTL
FT                   FILSFGLLIVGLALTGLHPRTALTAAWTAIANVGVVWGPELTPEGAVTDFPTASKWLMI
FT                   WGMYLGRLELISVLVLFLPRFWRS"
FT   gene            complement(507708..508946)
FT                   /locus_tag="Pden_0537"
FT   CDS_pept        complement(507708..508946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0537"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   rsp:RSP_1855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68649"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZF5"
FT                   /protein_id="ABL68649.1"
FT                   /translation="MPREEAVPRLEQLKQERKVPGDSFLSAAEGRELTRIGAAAGTTIP
FT                   AAAETPAGNASTFPQGAAQEQAEPAAGDLAGEDAPAEPETAAEPAPAQFVLRLESTTDR
FT                   ARAEEMLAKWRETLPEAGLWTLPNGRLAIGFGPMDEATGTAWLKAFKDAGAVPKDAFLA
FT                   PGEDMGEIAIIGKVPDLGAPPAPDAASVPMPPLEDIQRALRWAGHYDGGIDGKDGPKTR
FT                   AAIAEEIVRLRASPDTATAMAELIRRREAWRAEMGLAELRDAHTGLALPAPMEKLQFDR
FT                   AERALSIYGPKDGSGAALILFSQPGGQQEMLDLAGLVTALGWVPAPERKVERGSVVLDG
FT                   RNQTHIGHAEGRVVDGRVQGFVLIWPISDPEGQHRLAAEISDNLARFAPGAGEAQPEAP
FT                   AIAPALAPTVAQD"
FT   gene            509237..510187
FT                   /locus_tag="Pden_0538"
FT   CDS_pept        509237..510187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0538"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="PFAM: glycyl-tRNA synthetase, alpha subunit; KEGG:
FT                   rsp:RSP_1856 glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68650"
FT                   /db_xref="GOA:A1AZF6"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZF6"
FT                   /protein_id="ABL68650.1"
FT                   /translation="MTSPKDNQTAKPVCFQDVILRLQSYWAAQGCAVLQPYDMEVGAGT
FT                   FHPATTLRSLGARPWAAAYVQPSRRPTDGRYGENPNRLQHYYQYQVIIKPSPPNLQELY
FT                   LGSLAAIGLDPMIHDVRFVEDDWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCR
FT                   PVSGELTYGLERLAMYVLGVEHVMDMPFNPPGSPIPLSYGDVFRQAEREYSRWNFEQAD
FT                   TGMLLQHFKDAEAECDRILTAAETDSAGRRIPMAHPAYDQAIKASHLFNLLDARGVISV
FT                   TERQAYIGRVRALAKRCADLFVTTEAATLQAEDAA"
FT   gene            510184..510666
FT                   /locus_tag="Pden_0539"
FT   CDS_pept        510184..510666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0539"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="KEGG: sit:TM1040_2311 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68651"
FT                   /db_xref="GOA:A1AZF7"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZF7"
FT                   /protein_id="ABL68651.1"
FT                   /translation="MSSGKIVASMLVLVAVMAGLAVWYLQVYGFYDQVDEISGAQDIVV
FT                   TDAQGATHPVAVADFKAIDATSSPIRYRACFTLDPAELADAAPYAGATPLNGPGWFKCY
FT                   SARALTADLESGAARAVLGQAEIRPDVDRVIVVYPDGRAFAWHQFNDKTPERGVMD"
FT   sig_peptide     510184..510249
FT                   /locus_tag="Pden_0539"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.863 at
FT                   residue 22"
FT   gene            510666..512723
FT                   /locus_tag="Pden_0540"
FT   CDS_pept        510666..512723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0540"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: rsp:RSP_1858 glycyl-tRNA synthetase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68652"
FT                   /db_xref="GOA:A1AZF8"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZF8"
FT                   /protein_id="ABL68652.1"
FT                   /translation="MPDLLIELFSEEIPARMQARARGDLKKLVTDGLVEAGLTYKSAGA
FT                   FSTPRRLALAIEGLTAQSPTTREERKGPRTDAPEAALEGFLRSTGLTREQLEARDDKKG
FT                   QVWFAVVTKPGRPAAEIVAEVLERAIRDFPWPKSMRWGSGSLRWVRPLHSIICLLSDES
FT                   GASVVPLEIEGIGAGNTTRGHRFMAPDEIAVSGFEDYAAKLRRARVMLDAAEREAAIRQ
FT                   EAANLAFARGWEIVPDEGLLSEVAGLVEWPVPLMGAIEDRFLALPPEVLQTSMKEHQKF
FT                   FSARNPKTGRIEGFVTVANIETPDHGETILKGNQRVLAARLSDAAFFWENDLREAKAGM
FT                   ADWAEGLRSVTFQSKLGSQADRIARIAALALEIAPLVGADADQAEQAARIAKLDLRSAM
FT                   VGEFPELQGIMGRYYALEAGLPEPVADAARDHYSPLGPSDAVPSAPVSVAVALADKLDT
FT                   LTGFWAIDEKPTGSKDPFALRRAALGVIRLLLVNGVRANLGQTFAKARPDADAADLLAF
FT                   FHDRLKVHLRDQGVRHDIIDAVLSMPGNDDLVLLVNRATALSDVLKTEDGTNLLQGLKR
FT                   AGNILAQAEEMDGVEYSFGADPKFAETDEERTLFAALDKAEPAIREAVRLEDFQAATQG
FT                   IASLRAPIDAFFEAVQINSDNQILRRNRLNLLSRIRDAGRLIADFGRIEG"
FT   gene            512830..515391
FT                   /locus_tag="Pden_0541"
FT   CDS_pept        512830..515391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0541"
FT                   /product="pyruvate phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="PFAM: PEP-utilizing enzyme; PEP-utilising enzyme,
FT                   mobile region; KEGG: rsp:RSP_1859 pyruvate phosphate
FT                   dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68653"
FT                   /db_xref="GOA:A1AZF9"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZF9"
FT                   /protein_id="ABL68653.1"
FT                   /translation="MTALTDPGAIVEITPSAGIQTARHGWRAKCLQRLVRMELPVPTSF
FT                   ALSAEAVRAIAAGQMPDRARLAAMVERADGLVSVRPSAMNPAWGGPGTVLNVGINHACH
FT                   ARLVQTRGKAAADAIYLGFVQSYAIHVARLDPDMFSDSEGGLEAALRAYEDETDEEFPQ
FT                   DPARQLAEVLRSMARAWDGPTARLLRQAKGAPPLAPLGLVVQDMALAIGPGVTGSGTIQ
FT                   FIDSVTGAPRITGRFRGQTQGRSKGEGAETLYLTRDPRGPSLEEAAPEVFADLVRFGVA
FT                   ARERLREEMQIEFVVSDSRLSIIDAVRVSRNSRASVRIAVALARDGIIPPEEAVMRVEP
FT                   RALSDLLHHQVDPRAPRDVIARGINASPGAATGRIVFTAAAAQAAEARGERCVLVRRET
FT                   VPEDIRGMHAAVAVLTERGGMTSHAAVIARGIGLPCIVGASGISIDPRARTMLVGGRLF
FT                   HEGEEITIDGTSGEVLAGAAEMLEPALDDGFTQLLEWADAHCRIKIRANADTPEDARTA
FT                   RMFNAQGIGLCRTEHMFFDDERLPAMREMIFAGKPEDRSLSLERLLPMQRSDFAALFEI
FT                   MAGLPVTIRLFDPPLHEFLPHDREGMRELAESLDLPLSDVTRRVEALSEFNPMLGMRGV
FT                   RLGITVPEIYDMQARAIFEATIEASRNGDPVVPEIMIPLVSARREVELVKTRIDAVAAA
FT                   VRNETRKDFTYRLGVMVETPRAALRAGDIAEHSAFLSFGTNDLTQMTYGLSRDDAGRFM
FT                   GTYVSQGVYSEDPFHILDFDGVGELVAIGTERARDHKPDITIAVCGEHGGNPESIAFCL
FT                   RTGVNYVSCSPFRVPVARLAAAQESILMGREEAESSVEVES"
FT   gene            515619..516158
FT                   /locus_tag="Pden_0542"
FT   CDS_pept        515619..516158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0542"
FT                   /product="cell wall hydrolase, SleB"
FT                   /note="PFAM: cell wall hydrolase, SleB; KEGG: rsp:RSP_1860
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68654"
FT                   /db_xref="GOA:A1AZG0"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZG0"
FT                   /protein_id="ABL68654.1"
FT                   /translation="MSISKSWLTRVSVCVAVALSPVAAVPAMADGQHQVAYETKKGRAA
FT                   RQATVQINPTDLQCLSEALYFEARGEGVQGQQAVAEVILNRVDHPRFPKTVCGVVNQRG
FT                   QFTYNKGARIREKGTYARVQKVAMAALAGAPRTLTNGATYFHTRAVRPSWSKRFERTTR
FT                   IGSHIFYRSDRRLASN"
FT   sig_peptide     515619..515708
FT                   /locus_tag="Pden_0542"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 30"
FT   gene            516201..517019
FT                   /locus_tag="Pden_0543"
FT   CDS_pept        516201..517019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0543"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="PFAM: dihydroneopterin aldolase; KEGG: rsp:RSP_1861
FT                   probable dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68655"
FT                   /db_xref="GOA:A1AZG1"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZG1"
FT                   /protein_id="ABL68655.1"
FT                   /translation="MRRGRFPENTSGMDQPDRIHLRDYVLSAEIGAFQTERGHPQRLRF
FT                   DIEVELATHVVGVNDEVDRILSYDILTGAVAAGLADRRYDLLETLAEKIAAQILAHPRA
FT                   AQVSVTVEKLDRIPGALGVTLVRRQPRVKADQVQAPIRVIFHGRELVLPEGAVALVPDA
FT                   PGLPLPQGGNAREIELLALDQAAWALAGHLGLTVADSRTELDWAASEGRAVVWAPARMV
FT                   RDVAGLPAEPHALALWLAERLGAIRLDWALPEGAPEPVLPAGFRVPTGHL"
FT   gene            517064..518035
FT                   /locus_tag="Pden_0544"
FT   CDS_pept        517064..518035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0544"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: rsp:RSP_1862 dihydropteroate synthase, DhpS;
FT                   TIGRFAM: dihydropteroate synthase; PFAM: dihydropteroate
FT                   synthase, DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68656"
FT                   /db_xref="GOA:A1AZG2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZG2"
FT                   /protein_id="ABL68656.1"
FT                   /translation="MTDYFRPIPCETGRWQLAGGWVRFSQFELLRRGEVPRVVDSVPEA
FT                   VLAALIAPRAPLLGLSMDRPRIMGIVNATPDSFSDGGSYDGAEQARLLAGQGAEILDIG
FT                   GESTRPGAREVPVAEEIARVAPAIAAARGLAAVSIDTRKAGVARAAIVAGAGLVNDVSG
FT                   FDFDPDMAGLVAAAGVPVCLMHAQGIPETMQDNPTYGDVLLDVYDALAERIARAEAAGI
FT                   PRDRIVIDPGIGFGKTQAHNLAILRRISLYHGLGCTVLLGVSRKRFIGSIGGAERPADR
FT                   VAGTLALTLAGIAQGIQIHRVHDAAETRQGLALWRAVTAETR"
FT   gene            518046..519389
FT                   /locus_tag="Pden_0545"
FT   CDS_pept        518046..519389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0545"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase C terminal;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: rsp:RSP_1863
FT                   phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68657"
FT                   /db_xref="GOA:A1AZG3"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZG3"
FT                   /protein_id="ABL68657.1"
FT                   /translation="MSRKLFGTDGVRGRANTHPMTAEMALRLGAAAGRYFRRSGEDHHR
FT                   VVIGKDTRLSGYMLENALTAGLTSTGMNVLLLGPVPTPAVGYLTRSMRADVGIMISASH
FT                   NPAHDNGIKFFGPDGFKLSDEAEARIEAIVAGEIIPAQPQNIGRAKRIDDGRGRYVEYA
FT                   KTTFPSGQRLEGLKVVVDCANGAAYRAAPDVLWELGAEVIPLGVSPNGHNINDGLGSTH
FT                   PEACARAVLEHGADMGISLDGDADRVMIVDEKGQVADGDQIMALLAARWAAQGRLRGGA
FT                   LVATVMSNLGLERFLQGRGLRLERTAVGDRYVVERMRGAGFNLGGEQSGHIVMTDYATT
FT                   GDGLIASLQFLAALSDSGQRASELVAQFEPVPQLLKNVRYAVGADPLSKDSVQAEIARA
FT                   EARLNGSGRVLIRKSGTEPLIRVMAEAEDETVLREVVEDIVAAVEKAA"
FT   gene            complement(519472..520593)
FT                   /locus_tag="Pden_0546"
FT   CDS_pept        complement(519472..520593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0546"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /note="PFAM: monooxygenase, FAD-binding; KEGG: rsp:RSP_2656
FT                   putative salicylate hydroxylase (salicylate
FT                   1-monooxygenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68658"
FT                   /db_xref="GOA:A1AZG4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZG4"
FT                   /protein_id="ABL68658.1"
FT                   /translation="MSGLKQHPVTIIGAGVAGLTAACALAQRGAQVTVLERAGALREVG
FT                   AGLQISPNAVRVLAALGLESRFQAISVPSERVELCDSVGRLVARLDLARHRPRDPFRLV
FT                   HRARLVALLEEAAREAGARIELGHEVADPPDVPLLIGADGVKSRLRPQLNGAETPFFTG
FT                   QTAWRALIPADPDAAPMVQVFMGPGRHLVSYPLGHGQRNIVAVVERPDWHEEGWSIPGD
FT                   PTELRAAFARFGGPVPGWLEQVREVGIWGLHRHPVAAHWQDGRRALIGDAAHPTLPFMA
FT                   QGAVMAIEDAWVLAACLDAGPDQQAALARFQALRQPRCQRIVEAANANARNYHLRGPTR
FT                   AVAHAGLRAVSRLAPARLIERFAWLYDYEPTAV"
FT   sig_peptide     complement(520513..520593)
FT                   /locus_tag="Pden_0546"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.963) with cleavage site probability 0.836 at
FT                   residue 27"
FT   gene            complement(520635..521057)
FT                   /locus_tag="Pden_0547"
FT   CDS_pept        complement(520635..521057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0547"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="TIGRFAM: RNA polymerase-binding protein DksA; PFAM:
FT                   zinc finger, DksA/TraR C4-type; KEGG: rsp:RSP_2654 DnaK
FT                   suppressor protein, DksA family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68659"
FT                   /db_xref="GOA:A1AZG5"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZG5"
FT                   /protein_id="ABL68659.1"
FT                   /translation="MKAQTFLPEDYRPAEDEPFMNERQLEYFRRKLIAWKQELLDQSAE
FT                   TLEGLQDSARNVPDLADRASEETDRSLELRTRDRQRKLVSKIDAALRRIETGEYGYCEM
FT                   TGEPISLKRLDARPIATMTLEAQERHERRERVHRDD"
FT   gene            521219..522058
FT                   /locus_tag="Pden_0548"
FT   CDS_pept        521219..522058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0548"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_5"
FT                   /note="PFAM: AAA ATPase, central domain protein; ATPase
FT                   associated with various cellular activities, AAA_5; SMART:
FT                   AAA ATPase; KEGG: rsp:RSP_2653 ATPase, AAA family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68660"
FT                   /db_xref="GOA:A1AZG6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZG6"
FT                   /protein_id="ABL68660.1"
FT                   /translation="MQFSSTETYVAPPDLAMAVNAAITLERPLLVKGEPGTGKTELARQ
FT                   VAASLDLPIVEWNVKSTTRAQQGLYEYDAVSRLRDSQLGEARVHDIANYIRKGKLWQAF
FT                   EAPGKVVLLIDEIDKADIEFPNDLLQELDRMEFHVYETGEMVQARHRPVVIITSNNEKE
FT                   LPDAFLRRCFFHYIRFPDAETLKRIVEVHYPGLKHRILDEALSQFLELREVQGLKKKPS
FT                   TSELLDWLKLILAEDLSPEDLKRPAGEMLPKLHGALLKNEQDVALFERLAFMARRQR"
FT   gene            522070..522510
FT                   /locus_tag="Pden_0549"
FT   CDS_pept        522070..522510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0549"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rde:RD1_2794 acetyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68661"
FT                   /db_xref="GOA:A1AZG7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZG7"
FT                   /protein_id="ABL68661.1"
FT                   /translation="MIRALRPEDRKGWQRLYEAYQAFYGFDDRPPSFYDRAFSRLMARD
FT                   PRDFHGLVAEADGRLVGLTHYVFHPNLWRDEGVCYLQDLFTAPEARGRGIARALIEAVY
FT                   AEADRAGSPAVYWLTAEDNYPGRMLYDRVGQKSPFIRYNRKL"
FT   gene            complement(522559..523053)
FT                   /locus_tag="Pden_0550"
FT   CDS_pept        complement(522559..523053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0550"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   sil:SPO2284 transglycosylase SLT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68662"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZG8"
FT                   /protein_id="ABL68662.1"
FT                   /translation="MKSIIALLALGGVLAVGACGDNRVDPDRRYLVEPRASAAQVAALH
FT                   PNETPELRRLINKYAAEYEVPVDLVHRVIIRESTHRPGARNGPYYGLMQILPATARGMG
FT                   YRGSPAGLLDAETNLKYGVKYLRGAYMVADGNKDAAVKWYARGYYYEAKRKGLLEATGL
FT                   R"
FT   sig_peptide     complement(522991..523053)
FT                   /locus_tag="Pden_0550"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.745 at
FT                   residue 21"
FT   gene            complement(523200..524594)
FT                   /locus_tag="Pden_0551"
FT   CDS_pept        complement(523200..524594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0551"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; HI0933 family protein;
FT                   FAD dependent oxidoreductase; KEGG: sil:SPO0340
FT                   2-oxoglutarate dehydrogenase, E3 component,
FT                   dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68663"
FT                   /db_xref="GOA:A1AZG9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZG9"
FT                   /protein_id="ABL68663.1"
FT                   /translation="MSTYDLIVIGAGPGGYVCAIRAAQLGLKVACVEGRETLGGTCLNV
FT                   GCIPSKALLHASHMLHETHENFEKMGLMGAKPKVDWGKMQGYKAETVGGNTKGIEFLFK
FT                   KNKIDWLKGWASIEAPGKVKVGDTTHETKNIVIATGSEPASLKGVEVDNDAGIVVDSTG
FT                   ALSLPKIPKSMVVIGAGVIGLELGSAYARLGAEVTVVEFLDAITPGMDGEVQKQFQRIL
FT                   AKQGLKFVLGAAVSGVEVEKGKAEVKYKLRKDDSEHEIKAECVLVATGRRPYVAGLGLD
FT                   KVGVALTDRGFVQIDDHWQTSVKGIYAIGDAVPGPMLAHKAEDEGMAVAEVIAGKHGHV
FT                   NYDVIPGVIYTTPEVASVGLTEEAAKESGRKIKVGKFPFMGNARAKALFQAEGFVKMIA
FT                   DAETDRVLGCHIIGPNAGEMIHEVCVAMEFGASAQDIALTCHAHPTCSEAVREAALACG
FT                   DGAIHA"
FT   gene            complement(524645..525037)
FT                   /locus_tag="Pden_0552"
FT   CDS_pept        complement(524645..525037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0552"
FT                   /product="inner membrane protein"
FT                   /note="KEGG: jan:Jann_0835 inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68664"
FT                   /db_xref="GOA:A1AZH0"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZH0"
FT                   /protein_id="ABL68664.1"
FT                   /translation="MAAETTALALAALLQAVQIGLAAALMNRDVGANWNASPRDRQPEF
FT                   SALTGRLRRAVDNHFEGLILFTIAVVLVVLSDAGSPLTVLCSWSYLLARLLYVPAYAYG
FT                   WSPWRSVIWGVGFIATLVMILTTLFT"
FT   sig_peptide     complement(524969..525037)
FT                   /locus_tag="Pden_0552"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.790) with cleavage site probability 0.593 at
FT                   residue 23"
FT   gene            complement(525037..525294)
FT                   /locus_tag="Pden_0553"
FT   CDS_pept        complement(525037..525294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68665"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZH1"
FT                   /protein_id="ABL68665.1"
FT                   /translation="MTQMIAHYSIADYARFRTAFDADAEDRGNNGLSLLQLWRENDQSA
FT                   WALFQVGDAAVARAYLEGAAGVFNSQAGVSATAFHFVETA"
FT   gene            complement(525437..526969)
FT                   /locus_tag="Pden_0554"
FT   CDS_pept        complement(525437..526969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0554"
FT                   /product="2-oxoglutarate dehydrogenase E2 component"
FT                   /EC_number="2.3.1.61"
FT                   /note="TIGRFAM: 2-oxoglutarate dehydrogenase, E2 subunit,
FT                   dihydrolipoamide succinyltransferase; PFAM: biotin/lipoyl
FT                   attachment domain-containing protein; catalytic domain of
FT                   components of various dehydrogenase complexes; E3 binding
FT                   domain protein; KEGG: rsp:RSP_0964 dihydrolipoamide
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68666"
FT                   /db_xref="GOA:A1AZH2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZH2"
FT                   /protein_id="ABL68666.1"
FT                   /translation="MAVELRVPTLGESVSEATVATWFKKPGDRVAVDEMLCELETDKVT
FT                   VEVPSPVAGKLAEIVAPEGAVVAPNALLAQIMEQGDAGPEEMLPKADAGTKAQEGQRNM
FT                   SGKSVDVMVPTLGESVTEATVATWFKKVGDSVAQDEMLCELETDKVSVEVPAPAAGVLA
FT                   EILAPEGATVDASAKLAIITEGAAGVAKAEAPAAAVQSPGAGPETPAPRKDVEDAPSAK
FT                   KAMAEAGVSRDAVTGTGRDGRVMKEDVARAASAPQAASPAPAPAQAPRAPSSADDAARE
FT                   ERVKMTRLRATIARRLKDAQNTAAMLTTYNEVDMKGIMDLRNTYKDQFEKKHKVKLGFM
FT                   SFFVKACCHALKEVPEVNAEIDGGDVVYKNFVHMGVAVGTPNGLVVPVVRDADQKSFAR
FT                   IEKEIAELGTRARDGKLTMAEMQGGTFTISNGGVYGSLMSSPILNPPQSGILGMHKIQD
FT                   RPVVVDGQIVIRPMMYLALSYDHRIVDGKGAVTFLVRVKEALEDPRRLLMDL"
FT   gene            complement(526971..529937)
FT                   /locus_tag="Pden_0555"
FT   CDS_pept        complement(526971..529937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0555"
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /note="KEGG: rsp:RSP_0965 2-oxoglutarate dehydrogenase E1
FT                   component (alpha-ketoglutarate dehydrogenase); TIGRFAM:
FT                   2-oxoglutarate dehydrogenase, E1 subunit; PFAM:
FT                   dehydrogenase, E1 component; Transketolase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68667"
FT                   /db_xref="GOA:A1AZH3"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZH3"
FT                   /protein_id="ABL68667.1"
FT                   /translation="MNDQSPNSAFHDSSFLQGHNAAYVEQLYGQWAQNPAAVDQAWDAF
FT                   FRSLGDDEAVVTREAKGASWHRADWPPVPADDTTAALTGEWPMLPKTEAKAALDKIAAK
FT                   AGEKGVNLTDDQLKRAVLDSVRAIMLIRAFRIRGHLHADLDPLGMREIPDHGELDPKTY
FT                   GFSEADLDRPIFIDNVLGLQIATIRQIVDLMSRTYCGTFALQFMHISNPEEAAWLKERI
FT                   EGYGKEIAFTREGRRAILNKLVEAEGFEKFLHVKYMGTKRFGLDGGEALIPAMEQIIKR
FT                   GGALGVKDVVIGMPHRGRLSVLANVMGKPYRAIFHEFQGGSYKPDDVDGSGDVKYHLGA
FT                   SSDRTFDDNTVHLSLTANPSHLEAVNPVVLGKVRAKQDQLSDHTHRTAVLPILLHGDAA
FT                   FAGQGIVAECFQLSGIKGHRTGGCIHIVVNNQIGFTTAPHFSRTSPYPTDIALMVEAPI
FT                   FHVNGDDPEAVVHAARVATEFRQKFHKDVVIDIFCYRRFGHNEGDEPMFTNPAMYKAIK
FT                   GHKTTLQRYTERLVADGLVPEGEIEEMKAAFQSHLNEEFEVGKNFKPNKADWLDGKWSG
FT                   IEAEHAEENLGQTGIAPETMAEIGSALTRVPEGFDLHRTVGRLLESKKQMFETGKGFDW
FT                   ATGEALAFGSLLVEGHPVRLAGQDSTRGTFSQRHSAFVDQATEERCYPLNHIRGGQARY
FT                   EVIDSMLSEYAVLGFEYGYSLAEPNSLVMWEAQFGDFANGAQIMFDQFITSGEKKWLRM
FT                   SGLVMLMPHGYEGQGPEHSSARLERWLQMCAEDNWIVANCTTPANYFHILRRQLKRPFR
FT                   KPLVLMTPKSLLRHPLAVSTADEFLTGSTFNRVLVDDADRGKSEFKLAPDDKIRRVVIC
FT                   SGKVYYDLAQARDAAGAEDVYILRLEQFYPFPAQTMSKELERFKDAEIVWCQEEPKNQG
FT                   GWTFVEPNIEWVLSRIGAKHGRPRYVGRHAAASPATGLASRHKAEQEALVHEAITIGA"
FT   gene            complement(529934..530182)
FT                   /locus_tag="Pden_0556"
FT   CDS_pept        complement(529934..530182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68668"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZH4"
FT                   /protein_id="ABL68668.1"
FT                   /translation="MVPAEPPKDIAQGRRDLPQSRGAQMAGRTLPALPRQSRAGLSAWY
FT                   QDIQTRLMTGRVPGVARTIRPPQIKARTDKDSPEASQ"
FT   gene            530201..530545
FT                   /locus_tag="Pden_0557"
FT   CDS_pept        530201..530545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68669"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZH5"
FT                   /protein_id="ABL68669.1"
FT                   /translation="MVARVAALPPGMAAEKTGDAGQGRPLGRGRRDARATAKRPAAVMG
FT                   RDAGRPVLCRHGRGGTLHGRRGLHGHAAPRLGRAGPRAGQGAAPAVLATIWRRRRSNLA
FT                   PAGKVWRGPK"
FT   gene            complement(530589..531473)
FT                   /locus_tag="Pden_0558"
FT   CDS_pept        complement(530589..531473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0558"
FT                   /product="succinyl-CoA synthetase (ADP-forming) alpha
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase; KEGG: rsp:RSP_0966 succinyl-CoA
FT                   synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68670"
FT                   /db_xref="GOA:A1AZH6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZH6"
FT                   /protein_id="ABL68670.1"
FT                   /translation="MAVLVNKDTKVICQGITGSQGTFHTEQAIAYGTQMVGGVTPGKGG
FT                   TEHLGLPVFNSVHEAVAKTGANATAIYVPPPFAADSILEAIDAEIPLIVAITEGIPVLD
FT                   MMKVKRALEGSKSLLIGPNCPGIMTPDECKIGIMPGSIFKRGSVGVVSRSGTLTYEAVK
FT                   QTSDVGLGQSSAVGIGGDPIKGMEHIDVLRMFLDDPETESIIMIGEIGGSAEEEAAEFL
FT                   AEQKRKGKWKPTAGFIAGRTAPKGRRMGHAGAIVSGGKGDAESKIEAMKSAGIVVADSP
FT                   AGLGEAVLKALGR"
FT   gene            complement(531478..532671)
FT                   /locus_tag="Pden_0559"
FT   CDS_pept        complement(531478..532671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0559"
FT                   /product="succinyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="KEGG: rsp:RSP_0967 succinyl-CoA synthetase subunit
FT                   beta; TIGRFAM: succinyl-CoA synthetase, beta subunit; PFAM:
FT                   ATP-citrate lyase/succinyl-CoA ligase; ATP-grasp domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68671"
FT                   /db_xref="GOA:A1AZH7"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZH7"
FT                   /protein_id="ABL68671.1"
FT                   /translation="MNIHEYQAKALLRQYGAPVSDGRVVMKADEAKAAAGELDGPLWVV
FT                   KAQIHAGGRGKGHFKEKEAGEKGGVRLAKSVEEAEELARQMLGRTLVTHQTGETGKQVN
FT                   RIYIEDGSDIERELYLALLVDRGTSRVSFVASTEGGMDIEEVAASTPEKIVSFSVDPAS
FT                   GLSDFHGRRVAFALGLSGAQVKQCVALVKNLYRMFIEKDMEMLEINPLIVMKDGNLKAL
FT                   DAKMGFDNNALYRQPDILALRDETEEDPKELAASKFDLNYIALDGEIGCMVNGAGLAMA
FT                   TMDIIKLFGAEPANFLDVGGGATKEKVTEAFKIITSDPNVKGILVNIFGGIMRCDIIAE
FT                   GIIAAVKEVGLQVPLVVRLEGTNVELGKQIIGESGLNVIAADDLSDAAQKIVKAVKG"
FT   gene            532894..536133
FT                   /locus_tag="Pden_0560"
FT   CDS_pept        532894..536133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0560"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   pol:Bpro_4929 hemolysin-type calcium-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68672"
FT                   /db_xref="GOA:A1AZH8"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZH8"
FT                   /protein_id="ABL68672.1"
FT                   /translation="MAQTGRARQFLLTSAAGSALFGAHISINLRERRFMATITGTDNSE
FT                   TLLGTANADLINGLGGNDTITGGSGNDTMHGGSGDDTFLIGGTDIGHDIYDGGDGADQI
FT                   RLNGTLKVSNLSLTSANVISTETLNFYGYGVEGTGGNDVFDISGMTYVSGYSRIYMFDG
FT                   NDTFTGYAGNDNVDGGAGNDVLNGGAGNDTLIGGSGNDTLNGGSGNDYFYIGGTNFGHD
FT                   VYNGGEGSDEIRLVGKVTVSNLSLTSANVISTETLNFYGYGVEGTGGNDVFDISGMTYV
FT                   SGYSRIYMFDGNDTFTGYAGNDNVDGGAGNDVLNGGAGNDTLIGGSGNDTLNGGSGNDY
FT                   FYIGGTDFGHDVYNGGEGSDEIRLVGKVTVSNLSLTSANVIGTETLNFYGYGVEGTGGN
FT                   DVFDISGMTYVSGYSRIYMFDGNDTFTGYAGNDNVDGGAGNDVLNGGAGNDTLIGGSGN
FT                   DTLNGGSGNDYFYIGGTDFGHDVYNGGEGSDEIRLVGKVTVSNLSLTSANVISTETLNF
FT                   YGYGIEGTGGNDVFDISGMTYVSGYSRIYMQDGNDRFTGYAGNDNVDGGAGNDTLIGGA
FT                   GNDTLNGGSGIDTAAYGSATAGVTVNLALTTAQAVGGGQGVDTLIDIENVNGSAYADAL
FT                   LGNAAANLLQGAGGNDTLDGGAGNDTLSGGAGMDTAAYGRASSGVTVNLGLTGAQLVGG
FT                   GQGRDVLRSIENIDGSGFADRLTGNAGSNALRGGAGNDSLSGLGGNDRLFGGAGADQLL
FT                   GGAGNDVLNGDAGNDLLNGGAGNDTLNGGAGIDTAAYGGASSGVTVNLGLTVAQLIGGG
FT                   QGRDVLRNIENVNGSGFADRLTGNTGNNVLNGAAGNDTLSGGAGRDQLLGGAGADQLLG
FT                   GAGNDTLNGGAGNDTLNGGAGIDTAAYGGASSGVTVNLGLTVAQLIGGGQGRDVLRNIE
FT                   NVNGSGFADRLTGNAGNNVLNGAAGNDTLSGGAGRDQLSGGAGADRLLGGAGNDTLNGG
FT                   AGNDTLTGGVGADVFVFAVGNGADRITDWQDGTDVIRIVSGNWQGERYDSFDDLSITQS
FT                   AGNAVVSFGGTTITLAGIGSGQLDASDFIFV"
FT   gene            complement(536193..537155)
FT                   /locus_tag="Pden_0561"
FT   CDS_pept        complement(536193..537155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0561"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /note="TIGRFAM: malate dehydrogenase, NAD-dependent; PFAM:
FT                   Lactate/malate dehydrogenase; KEGG: rsp:RSP_0968 malate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68673"
FT                   /db_xref="GOA:A1AZH9"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZH9"
FT                   /protein_id="ABL68673.1"
FT                   /translation="MARPKIALIGAGQIGGTLAHLAAMKELGDVVLFDIAEGTPQGKAL
FT                   DIAQSGPSEGFDAVMKGANDYADIAGADVCIVTAGVPRKPGMSRDDLLGINLKVMKSVG
FT                   EGIKQHAPNAFVICITNPLDAMVWALREFSGLPHEKVVGMAGVLDSARFRHFLSLEFGV
FT                   SMRDVTAFVLGGHGDTMVPLTRYSTVGGIPLPDLVKMGWTTQEKLDAIVQRTRDGGAEI
FT                   VGLLKTGSAFYAPATSAIEMAEAYLKDQKRVLPCAAYVKGAYGLDGLYVGVPTVIGAGG
FT                   IERVIDITLDKDEQAMFDKSVDAVKGLVTACKGIDGTLA"
FT   gene            537341..538075
FT                   /locus_tag="Pden_0562"
FT   CDS_pept        537341..538075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0562"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   rsp:RSP_0969 putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68674"
FT                   /db_xref="GOA:A1AZI0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZI0"
FT                   /protein_id="ABL68674.1"
FT                   /translation="MEMLGWVLAVIAAFSIGLAKGGLSMVGTISVPLLALVMSPVQAAG
FT                   ILLPVYIISDIGGLIAFRRDFDRRVLRTLVPGAITGIGLGWATAHHVDDAQVGLIVGVI
FT                   GLAFALNALLRSRVSASAKPPRWGAGSFWGTVSGYTSFVSHSGAAPYQVYAQPLRMTPM
FT                   TYAGTTTIFFAICNAVKLIPYAMLGQLSAHNLSVAAVLMVPGVLGVLAGLWLVRRMSPR
FT                   IFYGFITWALMLVSAQLIWDGI"
FT   gene            538156..538995
FT                   /locus_tag="Pden_0563"
FT   CDS_pept        538156..538995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0563"
FT                   /product="Citryl-CoA lyase"
FT                   /EC_number="4.1.3.34"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: rsp:RSP_0970
FT                   putative citrate lyase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68675"
FT                   /db_xref="GOA:A1AZI1"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZI1"
FT                   /protein_id="ABL68675.1"
FT                   /translation="MTRPYRSVLYIPAANARAMEKAQTLAADAIIFDLEDAVAPAEKVG
FT                   ARELLARALQADYGGRARIVRINGMDTEWGEGDARTFAAGADAVLVPKVSRGADLDRVA
FT                   ALVPDTPLWAMMETAEGMLNAAEIAAHPRLQGMVMGTNDLAKELNSRFRADRLPMMAGL
FT                   GLCLLAARAHGRVIVDGVFNAFKDEEGLRAECEQGRDMGFDGKTLIHPAQLAVANEVFA
FT                   PSEAEVDLARRQIEAFDEAQAQGKGVAVVDGRIVENLHVETARATLAKAAAIAELAG"
FT   gene            539041..539592
FT                   /locus_tag="Pden_0564"
FT   CDS_pept        539041..539592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0564"
FT                   /product="NnrUfamily protein"
FT                   /note="PFAM: NnrUfamily protein; KEGG: jan:Jann_0815 NnrU"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68676"
FT                   /db_xref="GOA:A1AZI2"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZI2"
FT                   /protein_id="ABL68676.1"
FT                   /translation="MFILILGLALWWGAHLFKRLAPQRRAVMGDRGKGVVAGLLALSVV
FT                   LMVVGYRQADGPYWWGASAPLKGINNLLVLVAFYFFAADGMKTRITRHLRHPQLTGFAL
FT                   WAFAHLVPNGDLPSFVLFGGLLVWALVEMVVINRAQPDWTPPAGPFPARKEIMAVAGAV
FT                   VVLLVVGLIHAWLGYNPFGG"
FT   gene            539594..539800
FT                   /locus_tag="Pden_0565"
FT   CDS_pept        539594..539800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sil:SPO0354 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68677"
FT                   /db_xref="InterPro:IPR013619"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZI3"
FT                   /protein_id="ABL68677.1"
FT                   /translation="MPKIYRLLTEDDTSAFCHKVSEALSKGWELHGGPAYAFDAARGVM
FT                   RCAQAVTKQIDADYHPEMKLGQQ"
FT   gene            539810..540844
FT                   /locus_tag="Pden_0566"
FT   CDS_pept        539810..540844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0566"
FT                   /product="L-erythro-3-methylmalyl-CoA dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   sil:SPO0355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68678"
FT                   /db_xref="GOA:A1AZI4"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR016790"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZI4"
FT                   /protein_id="ABL68678.1"
FT                   /translation="MSKTNPGRFFEDYRIGQVIRHAVPRTVAEGERALYHALYPARHAL
FT                   YSSDEFAAASGLEGSPMDDLIAFHIVFGKTVPDISLNAVANLGYAEGRWLKPVWPGDTL
FT                   RAESEVIGLKENSNGKSGVVWVRTRGLNQLDEVVLEYVRWVMVRKGDAAAPAPEPVAPE
FT                   LAKSVAPADLVLPEGLDFLQYDFDLAGEPHRWGDYQIGEVIDHVDGVTIEEAEHMLATR
FT                   LWQNTAKVHFDATFREDGQRLIYGGHVISMARALSFNGLANAQMIVALNGGAHANPCFA
FT                   GDTIRAWSEVLDKADTHAPGVGAIRLRLVAHKGRAGDHALRGEDGKYAPQVLLDLDYWA
FT                   LMPK"
FT   gene            541157..541549
FT                   /locus_tag="Pden_0567"
FT   CDS_pept        541157..541549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0567"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /note="PFAM: succinate dehydrogenase, cytochrome b subunit;
FT                   KEGG: rsp:RSP_0974 succinate dehydrogenase cytochrome b-556
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68679"
FT                   /db_xref="GOA:A1AZI5"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZI5"
FT                   /protein_id="ABL68679.1"
FT                   /translation="MADVNRGNRPLSPHLQVYRLPLAAITSIMTRITGHALVAGIVLIT
FT                   WWLVAAVTSPGAFACADWVVRSWLGFIILTGSMWALWYHLLAGLRHLFYDAGYGLEIEQ
FT                   AHKSSQALIAGSVVLAVLTLIVFFVF"
FT   gene            541566..541955
FT                   /locus_tag="Pden_0568"
FT   CDS_pept        541566..541955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0568"
FT                   /product="succinate dehydrogenase subunit D"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: rsp:RSP_0975 putative succinate dehydrogenase,
FT                   hydrophobic membrane anchor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68680"
FT                   /db_xref="GOA:A1AZI6"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZI6"
FT                   /protein_id="ABL68680.1"
FT                   /translation="MRYITPRKAAEGLGSAHEGTQHHWAMTVSAVALTVLTPLFMIVVA
FT                   RAIGLSQEQLLAYFGRPFPALITALFVIVGMVHFIKGTRIMIDDYFQGGTRKAAIIFSV
FT                   IFGWAVIAAAVYALARMGLGAIVVL"
FT   gene            541965..543767
FT                   /locus_tag="Pden_0569"
FT   CDS_pept        541965..543767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0569"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: rsp:RSP_0976 succinate dehydrogenase; TIGRFAM:
FT                   succinate dehydrogenase, flavoprotein subunit; succinate
FT                   dehydrogenase or fumarate reductase, flavoprotein subunit;
FT                   PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68681"
FT                   /db_xref="GOA:A1AZI7"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZI7"
FT                   /protein_id="ABL68681.1"
FT                   /translation="MAAYKYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPT
FT                   RSHTVAAQGGIAASLSNMGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEH
FT                   YGVPFSRTEEGKIYQRPFGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKEKAE
FT                   FFIEYFALDLIITDGACTGVVCWKLDDGTIHVFNAKMVVLATGGYGRAYFSATSAHTCT
FT                   GDGGGMVARAGLPLQDMEFVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAP
FT                   TYKDLASRDVVSRCITIEIREGRGVGPHKDHMHLNLMHLPPESLAERLPGISESAKIFA
FT                   GVDVTREPIPILPTVHYNMGGIPTNYWGEVLNPTQDNPDQVFPGLMAVGEAGCASVHGA
FT                   NRLGSNSLIDLVVFGRAAAIRAGQVIDREAQIPTTNKEQVDKALDRFDRIRNADGSVST
FT                   ADLRLEMQRTMQADAAVFRTDKTLAEGVDKMRVIAGKLSDLKVTDRSLIWNSDLMETLE
FT                   LTNLMPNALATIVAAEARKESRGAHAHEDYPERDDANWRKHSLAWIEGNDVKLAYRPVH
FT                   LEPLTRQDEGGIDLKKIAPKARVY"
FT   gene            543767..544123
FT                   /locus_tag="Pden_0570"
FT   CDS_pept        543767..544123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0570"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: jan:Jann_0807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68682"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZI8"
FT                   /protein_id="ABL68682.1"
FT                   /translation="MRLPLILTAAALALSGCVVQNPGMAPVAPLPVPQVTPPDAAIRSS
FT                   ARVVVNREMARRLPGANVAPYTDCVLQNATSAELASIAAAGAAGAGNAVAAIVGRPATT
FT                   QCIAGAAAAAKQAA"
FT   sig_peptide     543767..543829
FT                   /locus_tag="Pden_0570"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.974) with cleavage site probability 0.703 at
FT                   residue 21"
FT   gene            544123..544449
FT                   /locus_tag="Pden_0571"
FT   CDS_pept        544123..544449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_0978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68683"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZI9"
FT                   /protein_id="ABL68683.1"
FT                   /translation="MAGRGALGLGFAPALLGLAACAPAPVRISVAEAERLCMVQALDAR
FT                   APRTEVGLGIGSHGYRGGFVRVDLSSDQILGRDPSQVFNECVRRRSGQQPTRPLYQQPG
FT                   WRVN"
FT   sig_peptide     544123..544218
FT                   /locus_tag="Pden_0571"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.833) with cleavage site probability 0.484 at
FT                   residue 32"
FT   gene            544520..545299
FT                   /locus_tag="Pden_0572"
FT   CDS_pept        544520..545299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0572"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; KEGG: rde:RD1_1630 succinate
FT                   dehydrogenase, iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68684"
FT                   /db_xref="GOA:A1AZJ0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZJ0"
FT                   /protein_id="ABL68684.1"
FT                   /translation="MVQLTLPKNSRMRVGKTWPKPEGATNVRRFNIYRWDPDTGENPRI
FT                   DTYFVDMDKCGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGGNHLACIYGM
FT                   DEIKGDVNIYPLPHMPVVKDLVPDLTHFYAQHASVQPYLITETPTPDKEWRQSIEDRKK
FT                   LDGLYECVMCASCSTACPSYWWNGDRYLGPAALLHAYRWIIDSRDEATGERLDSLEDPF
FT                   KLYRCHTIMNCTNTCPKGLNPAKAIASIKHMMVDRIV"
FT   gene            545816..546649
FT                   /locus_tag="Pden_0573"
FT   CDS_pept        545816..546649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rde:RD1_1633 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68685"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZJ1"
FT                   /protein_id="ABL68685.1"
FT                   /translation="MTRIIPEDAVERRAVRPVICYLNETLPDPDLPGLQALRLTARKSG
FT                   ECLVPPREARCFHVPAGHFFRITSVEGPQVGDLNLWSAADPRERFYSGKTRALHGTHLT
FT                   RGDRMWSSFPNLRPMATVTEDTLEWYGIDEYGGSVHDVIGTRCDPYTHRLLSGQDYHHC
FT                   CHSNLTNALMAELSLARDEAEPLVHDVLNVFMCTGFTRDSGQYFMKASPVRPGDYIEFF
FT                   AEIDLIGGLSACPGGDCGSAHSSDAAACHPLLVEIFAPARSAARAQPGPSAYRWP"
FT   gene            complement(546646..547338)
FT                   /locus_tag="Pden_0574"
FT   CDS_pept        complement(546646..547338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0574"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rsp:RSP_2268 metallo beta lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68686"
FT                   /db_xref="GOA:A1AZJ2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZJ2"
FT                   /protein_id="ABL68686.1"
FT                   /translation="MKLTWLGHSGFRLEIEQAVILIDPWLSGNPMFPEDRRDEAIQGAT
FT                   HILLTHGHGDHTGDTLSIARELKIPVVGIYDLINTWQTHQGIEGLGFNKGGTVDLGGAK
FT                   VTMVNASHSSSFDGNEGPVYAGHESGYMIAGEGHVIYVSGDTDIMADMQWMGEYHQPDI
FT                   GILCAGGHFTMDMDRAAWAARKYFDFKTVIPCHYKTFPLLAQDAEVLKAGLPGVQVIEP
FT                   EVMQPIPL"
FT   gene            547470..547757
FT                   /locus_tag="Pden_0575"
FT   CDS_pept        547470..547757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0575"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; PFAM: Glu-tRNAGln amidotransferase, C subunit;
FT                   KEGG: rsp:RSP_6043 Glu-tRNA (Gln) amidotransferase, subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68687"
FT                   /db_xref="GOA:A1AZJ3"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZJ3"
FT                   /protein_id="ABL68687.1"
FT                   /translation="MAITEDEARKVAHLARIAVKDADLPALAQELNGILHFMEQLNEVD
FT                   VEGVQPMTGVEPMRLKRRQDIVTDGEMQDLILKNAPDAREGFFAVPKVVE"
FT   gene            547754..549235
FT                   /locus_tag="Pden_0576"
FT   CDS_pept        547754..549235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0576"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase; KEGG: sil:SPO2969
FT                   glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68688"
FT                   /db_xref="GOA:A1AZJ4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZJ4"
FT                   /protein_id="ABL68688.1"
FT                   /translation="MSDLNKLTIAAARDGLRKGDFTSAELTETCLVAIEAAGALNAWCH
FT                   KTPEKAREMAAAADKRIAAGDAPAMCGIPLGIKDLFCTRDVPSQAASRILDGFLPQYES
FT                   TVTQNLWDAGAVMLGKLSMDEFAMGSSNESACYGPVVNPWKVDDRQLTPGGSSGGSAAA
FT                   VAADLCLAATGTDTGGSIRQPAAFTGTVGLKPTYGRVSRWGVIAFASSLDQAGPMTKTV
FT                   RDAAIMLGAMASVDAKDSTSAERAVPDYEAALTGDIRGRRIGIPREYRMEGMSDEIDAL
FT                   WHKAAEMLRDAGAEVVDITLPHTKYALPAYYVIAPAEASSNLARYDGVRYGRRARLGAG
FT                   DGVVEMYEKTRAEGFGPEVQRRVMIGTYVLSAGFYDAYYNRARKVRALIKRDFDQVFAD
FT                   GIDAILTPATPSAAFGLGEMSGKDPVEMYLNDVFTVTVNLAGLPGISVPVGLDRQGLPL
FT                   GMQLIGRPWDEGGLLNLAQSLESAAGFTAKPSRWW"
FT   gene            549259..549783
FT                   /locus_tag="Pden_0577"
FT   CDS_pept        549259..549783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0577"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_2271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68689"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZJ5"
FT                   /protein_id="ABL68689.1"
FT                   /translation="MRNLAILAVLGLAACGENTGWNPNYSAMHNGSPYAEYLQAREVAL
FT                   HGKGPVPTAIPVQLPAQAPTAADIAGTPAKKQPAQAAAPAAPVRAQAVPPSLLRYAQQE
FT                   TQAPGTRKYQRSGGSESAAARACRSYGSADAAQSAFISAGGPVIDPGGLDPDGDGFVCG
FT                   WDPRPLRQSGL"
FT   sig_peptide     549259..549309
FT                   /locus_tag="Pden_0577"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.890) with cleavage site probability 0.445 at
FT                   residue 17"
FT   gene            549780..550406
FT                   /locus_tag="Pden_0578"
FT   CDS_pept        549780..550406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0578"
FT                   /product="N-acetylmuramoyl-L-alanine amidase, family 2"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase, family 2;
FT                   KEGG: rsp:RSP_2272 N-acetylmuramoyl-L-alanine amidase,
FT                   family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68690"
FT                   /db_xref="GOA:A1AZJ6"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZJ6"
FT                   /protein_id="ABL68690.1"
FT                   /translation="MSPSPNHGDRRGQRPSLVVIHYTGMADGPSARARLCDPEAEVSAH
FT                   WLVHEDGLTEALVPEDRRAWHAGAGSWQGCEDVNSRSIGIELANPGDRPFPEPQMAALE
FT                   ALLRGIMARWPIGPEGVIGHSDMAPGRKIDPGPRFDWRRLALQGLAVWPEGEGRDLSLA
FT                   ESLSRIGYAKEPAQLAAFRLRFRPWAEGPEDATDRRLAAALAYRS"
FT   gene            complement(550394..551167)
FT                   /locus_tag="Pden_0579"
FT   CDS_pept        complement(550394..551167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0579"
FT                   /product="protein of unknown function DUF519"
FT                   /note="PFAM: protein of unknown function DUF519; KEGG:
FT                   sil:SPO0421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68691"
FT                   /db_xref="GOA:A1AZJ7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZJ7"
FT                   /protein_id="ABL68691.1"
FT                   /translation="MLSYQHAYHAGNLADLYKHALLASILAYLTAKPKPLSYLETHAGR
FT                   GLYDLSSPEADKTGEAAAGITRALAENWLPADHPLCLALDAVRARHGASAYPGSPLIAR
FT                   HFLRPGDVAHLAELHPAEHEALAEIAGFAHLHRQDGFQMAQAICPPTPRRGLLLIDPSY
FT                   EVKADYDAIPRQIAKLARKWNVGVIVLWYPILTDLRHAPMVEALRRNHPEALVSEVRFP
FT                   PARPGHGMVGSGMVVLNPPYGLAEEALRIEALYDR"
FT   gene            complement(551716..552015)
FT                   /locus_tag="Pden_0580"
FT   CDS_pept        complement(551716..552015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0580"
FT                   /product="protein of unknown function DUF1127"
FT                   /note="PFAM: protein of unknown function DUF1127; KEGG:
FT                   sit:TM1040_2023 protein of unknown function DUF1127"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68692"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZJ8"
FT                   /protein_id="ABL68692.1"
FT                   /translation="MFVSTARQGKPTAPSARRKRVYEMAVLDLIHGGMHRNDIAGNGAI
FT                   AKFVANVRENMARRAVYRQTLRELGELSNRDLADLGLNRGNIRSVAYEAAWGKK"
FT   gene            552277..553380
FT                   /locus_tag="Pden_0581"
FT   CDS_pept        552277..553380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0581"
FT                   /product="putative Mrp (multidrug resistance-associated
FT                   proteins) family protein"
FT                   /note="KEGG: rsp:RSP_2093 putative Mrp (multidrug
FT                   resistance-associated proteins) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68693"
FT                   /db_xref="GOA:A1AZJ9"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZJ9"
FT                   /protein_id="ABL68693.1"
FT                   /translation="MTISRERVLEELARIAVPGGGNLVSADLVRALSVESGVVRFVIEA
FT                   ADAAARSLGPVEAEAQRALSALPGVEKVQIVTTAPTVPRGAAPQVTARSGGEGAPPSLK
FT                   IGRHPTPQAGPAPVSGVARILAIGSGKGGVGKSTLTSNLAVALARKGRRVGLLDADIYG
FT                   PSQPRMLGLTGQRPTSDGQMIEPLHAHGVTVMSLGLMMKEGEAVVWRGPMLMGALQQML
FT                   NQVKWGELDVLLVDLPPGTGDVQLSLCQKAQVSGAIIVSTPQDVALIDARRAIDMFDKL
FT                   KTPVLGLVENMSTYICPNCGHEAHLFGHGGVAAEAAALGLPFLGEIPLNLDLRLSGDAG
FT                   TPIAAGDGPVAQSFARLAERLIDGGMA"
FT   gene            554021..554530
FT                   /locus_tag="Pden_0582"
FT   CDS_pept        554021..554530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0582"
FT                   /product="protein of unknown function UPF0040"
FT                   /note="PFAM: protein of unknown function UPF0040; KEGG:
FT                   rde:RD1_3370 MraZ protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68694"
FT                   /db_xref="GOA:A1AZK0"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZK0"
FT                   /protein_id="ABL68694.1"
FT                   /translation="MARRFRGSEEVKVDAKGRVSIPAKFRRVFEASDPDWQAGKRAQLV
FT                   IVYGTRDWNWLQLFTIQAMEEIEDGIAAMPRGSAARNLLENIYQGHADEAEIDGDGRLV
FT                   LPQKLREKIGLTDSAFFISAGDSLKVWTPEAYAEEERALEARVPELEPGADPLSLLAPA
FT                   TARDEG"
FT   gene            554532..555500
FT                   /locus_tag="Pden_0583"
FT   CDS_pept        554532..555500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0583"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase; KEGG: rsp:RSP_6038 methyltransferase
FT                   MraW/YabC"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68695"
FT                   /db_xref="GOA:A1AZK1"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZK1"
FT                   /protein_id="ABL68695.1"
FT                   /translation="MAEAPHIPVLLGPLLRAVAPVEGTWVDGTFGAGGYARGLLEQGAD
FT                   RVIGIDRDPAVFRMAEAWAGEYGDRLRLVEGTFSDLDSLAGGPVDGVVLDLGVSSMQLD
FT                   QPERGFSFLRDGPLDMRMGGDGPTAAELLNTAPEQVIADVLYLYGEERASRRIAKAIVA
FT                   ARPLSRTGQLSDIVSACLPRPKPGQSHPSTRAFQAIRIWVNDEFGQLVAGLAAAERALR
FT                   PGGKLAVVSFHSLEDRIVKRFMQARSNSAGGGSRYAPEAAREEPAFTLPFRRAIGPDEA
FT                   ELATNPRARSALLRVGIRTEAPAGRVDPAALGLPLLSERRA"
FT   gene            555500..555883
FT                   /locus_tag="Pden_0584"
FT   CDS_pept        555500..555883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0584"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sil:SPO1180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68696"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZK2"
FT                   /protein_id="ABL68696.1"
FT                   /translation="MRSVLYLLTALSVMGLAFWAYRENYRTQAAISEMSDIQRQIGRLR
FT                   EDLGVLRAEWAYLNRPGRLRQLVDLNFERLKLVPFGSDQFVDVGQVAFPTPKAPEREPG
FT                   ADADMPVERPAGFPPRRPQESTP"
FT   gene            555880..557685
FT                   /locus_tag="Pden_0585"
FT   CDS_pept        555880..557685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0585"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   Penicillin-binding protein, dimerisation domain; KEGG:
FT                   rsp:RSP_2098 cell division protein FtsI/penicillin-binding
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68697"
FT                   /db_xref="GOA:A1AZK3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZK3"
FT                   /protein_id="ABL68697.1"
FT                   /translation="MIRTPLRPLARILRARETGENPDAIEAENRAQRHAAIQERARGSA
FT                   RTRLFFMSCAFALAFGTVGAKMGVLAASQPSEPRVQTTGAQIISQRADITDRHGRVLAT
FT                   NLLTHSLYAHPQQMVEPERAARELVRIFPDLEVERLDKDFTGKRTFVWIKKKISPEQMQ
FT                   AVHDIGEPGLLFGPREMRLYPNGHIAAHILGGATFGKEDVASAEVVGVAGVEKAFDHWL
FT                   RDPANDGAPLMLSLDLTVQAAMEEVLGNGMKVMNAKGATGILMEIKTGEIVAMASLPDF
FT                   DPNDRPRPLLKGDPSDSPLFNRAVQGQYELGSTFKIFPVAQAIDLKLVSPTTMINAKAP
FT                   MKIGKYLINEFRGHNYGTLSVTDIIVKSSNVGTVRVAQLLGPDRQRDFLQKLGFFDPTP
FT                   IEMSEAPTGKPLVPKRWPAVTSATVAFGHGLAASPLHLATAYATVANGGKRVMPTLIHD
FT                   RSQRGGEQVLSPEAARIAVQMLRQVVVRGSGRSANVEGYEVAGKTGTADKPRPTGGYYG
FT                   NKVVSTFASVFPASDPQYVLVLSLDEPSTIGAGGESRTAGATSAPVAAEVIRRVAPLLG
FT                   LRPSTETQLPMVERPLPDRLKLVSN"
FT   gene            557715..559184
FT                   /locus_tag="Pden_0586"
FT   CDS_pept        557715..559184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0586"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetases;
FT                   PFAM: cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: sil:SPO1182
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68698"
FT                   /db_xref="GOA:A1AZK4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZK4"
FT                   /protein_id="ABL68698.1"
FT                   /translation="MRLSLLGLRGDKGRDPEVTGLAVDSRQVRPGHLFAALPGSATHGG
FT                   EFIQYALRQGAGAILTDRKGAEIAAAELVGADAALVVAEDPRAALAGAAALWFAAQPET
FT                   MVAVTGTSGKTSVASFTRQIWQALGHKAISLGTMGVQGDYQAKLAHTTPEPITLHRVLA
FT                   EAAAAGVTHAAMEASSHGLDQRRLDGVRLKAGAFTNFSQDHLDYHKDFDEYFAAKALLF
FT                   DHILEEGAGAVINIDDPRGRQMAQIAGERGLKLTTIGKDERADLRILGQRYDATGQDLR
FT                   FGFHGQAHLVRLALIGGFQAENVLAAAGLAIAAGDEAPRVIETLPGLTTVRGRMELAAV
FT                   RENGAAVFVDYSHKPGALASALQSLRPHVMGRIVVVFGAGGDRDRLKRPLMGEAARQFA
FT                   DVVYVTDDNPRSEDPAAIRAEVMAGAGPDAIEVGDRAEAILRGVDALQPGDALLIAGKG
FT                   HETGQIIGSDVYPFDDAEQASVAVAALDGKI"
FT   gene            559181..560566
FT                   /locus_tag="Pden_0587"
FT   CDS_pept        559181..560566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0587"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: sil:SPO1183
FT                   UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68699"
FT                   /db_xref="GOA:A1AZK5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZK5"
FT                   /protein_id="ABL68699.1"
FT                   /translation="MTLWTSQDAAEATGGRATRDFAVGGVSIDTRTIRPGDLFVALQAA
FT                   RDGHDFVARALEKGACAALVSRIPEGVAPDAPLLVVPDVLPALEALGRAGRARMRGKVV
FT                   AITGSVGKTSTKEMARVALAGQGRVHAAEASYNNHWGVPLTLARMPEDTDFAIVEIGMN
FT                   HPGEIEPLARLARPHVAMVTTVAAAHLEAFGAIEGIAREKGAIFRGLIQPGTAIIPEDL
FT                   PVTQLLRDCADDAAAIVIGFGQQGMARPLKAETLDGVTRVRARVLGETVDFMLASAGTH
FT                   FVMNAVGMLAALSAAGADVAEAAKHLSDWRPPLGRGAVEDLDGIRLIDDAYNSNPTSLS
FT                   AGLATLARLTGGRRVAILGDMLELGPDEIALHAGMAGDPAMEAVDLVHTAGPRMRALHE
FT                   ALPQGRRGMHAETAAELAGKVGELVASGDIVLVKGSKSSKVSTVVDALRRTRQSTPPGE
FT                   RTA"
FT   gene            560566..561648
FT                   /locus_tag="Pden_0588"
FT   CDS_pept        560566..561648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0588"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: rsp:RSP_2101
FT                   phospho-N-acetylmuramoyl-pentapeptide transferase; TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   glycosyl transferase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68700"
FT                   /db_xref="GOA:A1AZK6"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZK6"
FT                   /protein_id="ABL68700.1"
FT                   /translation="MLYWLTNLSDGGDFFNLFRYITFRAGGAFFTALLFGFFFGRPLID
FT                   LLRRKQKKGQPIRDDGPENHFSKAGTPTMGGLLILAALTIGTLLWARLDNGYVWIVLLV
FT                   TLGFAAIGFADDYAKVTKQHHAGLSGKVRLLIGLCIAAAAGAAAAWLHPAALSGELALP
FT                   FFKDALINLGLLYVPFTVLVILGAANAVNLTDGLDGLAIMPVMIAAASFSVIAYMVGNA
FT                   NFANYLGVHFVPGTGELAVFVAALIGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIA
FT                   VVTKHEIVLAIVGGLFVVEALSVIIQVLYFKRTGKRVFLMAPIHHHFEKKGWGEAQIVI
FT                   RFWIIALILALIGLATLKLR"
FT   gene            561731..563131
FT                   /locus_tag="Pden_0589"
FT   CDS_pept        561731..563131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0589"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase; PFAM: cytoplasmic peptidoglycan synthetases domain
FT                   protein; Mur ligase, middle domain protein; KEGG:
FT                   rsp:RSP_2103 UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68701"
FT                   /db_xref="GOA:A1AZK7"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZK7"
FT                   /protein_id="ABL68701.1"
FT                   /translation="MIPVQGVQNQTIAVLGLGRSGRATAAALAAGGARVVAWDDGVDTR
FT                   EQAEQEGLHLLDLTQDQNWDGISALIASPGIPHLYPKPHPVIARAYALGVPVDNDIGLF
FT                   FRSFATAEWERFDTTPRVIAVTGSNGKSTTTALIHHILKETGRPTQIGGNIGTGVLSLD
FT                   PAHDGEVVVLELSSYQTDLARALTPDVAVFTNLSPDHLDRHGGLGGYFAAKRRLFAEGG
FT                   PDRAVIGVDEVEGRYLAGQLGMGAADDRVIRVSSGQKLEGFGWSVFARKGYLAEYRKGR
FT                   QVASIDLRGIQGLPGAHNHQNACAAYAAARAVGIAPREIERAFHSFQGLPHRSQTVAEI
FT                   GGVAWVNDSKATNVDAAAKALAAFPRIRWIAGGMGKDGGIEALAPCLGPVVKAYLIGHS
FT                   ARDFALQIGQTPYEIVETMEQAVARAAAEAQPGETVLLAPAAASFDQYPNFEKRGEHFT
FT                   ALVKALQA"
FT   gene            complement(563332..564489)
FT                   /locus_tag="Pden_0590"
FT   CDS_pept        complement(563332..564489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0590"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: rsp:RSP_0007 putative outer
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68702"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZK8"
FT                   /protein_id="ABL68702.1"
FT                   /translation="MKRIITGIGALLATAAPVLAGGIERAPQSLAPLFEQGNYLELSFG
FT                   GVNPTVRGRDVAGVSTGDVAQGYGFFGLAYKHQFNENLSGALIVEQPFGADVLYPTANS
FT                   PVLGGTRVEVNSTTYTALLRYKFENNFSVHGGIRGSHADGNVRLQGAGYANSSGYNLDI
FT                   DGAWGVGWVAGVAYEMPEIAARVSLTYNSPIEHDFEMTESGGLLAATGQGTVRGEHTVK
FT                   TPRSWTLEGQTGIAADTLLFGSIRWVKWSEFKVENAHFPISPETFPGIVPPGTNIPLVE
FT                   LEDTTTYTIGVGRKFTDNWSGSVSFLYEPSEGNTVSPLAPVNGRKAVTVAAIYTMDNIK
FT                   ITTGINYTKLGDATLGVGQSGNKTEVARMDDGEAWAVAMRIGYSF"
FT   sig_peptide     complement(564427..564489)
FT                   /locus_tag="Pden_0590"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 21"
FT   gene            564656..565627
FT                   /locus_tag="Pden_0591"
FT   CDS_pept        564656..565627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0591"
FT                   /product="putative tellurite resistance protein"
FT                   /note="KEGG: rsp:RSP_2869 possible tellurite resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68703"
FT                   /db_xref="GOA:A1AZK9"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZK9"
FT                   /protein_id="ABL68703.1"
FT                   /translation="MRFAPPRINPPGLWRRVPPAIFPPLLGALGLALAWRAATARFGLP
FT                   QGLSGMMMGMAVAAWVFATLAYGGKLARRPAVLAEELRILPGRAGIAAALVGIYVAAQL
FT                   LAPFAPALARVVLIAGMAAQAVFWAVAIPVMARTPGQGRVTPVWQLTFVGPIVAAQAAA
FT                   GFGWLGLAQALWWPMAAIAGFVWTVSLYQALTERLPAPLRPLLMIHLAPIAMLGNVAAA
FT                   LGWQDVALGLAWATAAALALAALRLRWLVEAGFSPLWGAFTFPLAATAGLWTAVSGFAS
FT                   GWSLPAQILLVAASLVVLPILFRVWRAWASGRLAMKTNAAIA"
FT   gene            565697..567145
FT                   /locus_tag="Pden_0592"
FT   CDS_pept        565697..567145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0592"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="KEGG: rsp:RSP_2868 putative inosine-5'-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: CBS domain containing protein; IMP
FT                   dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68704"
FT                   /db_xref="GOA:A1AZL0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZL0"
FT                   /protein_id="ABL68704.1"
FT                   /translation="MQIREALTFDDVLLVPAASSVMPSTADVTTYVTRQIRMNIPLLSS
FT                   AMDTVTESRMAIAMAQAGGIGVVHRNLTAEQQADEVRRVKRFESGIVYDPITLTPEQTI
FT                   ADAKALQERYNVTGFPVVDAAGRVVGIITNRDMRFANSDDMPVRAVMTSGNLAILREPA
FT                   DRAEAIDLMKARRIEKLLITNAEGKLTGLLTLKDTEKSVLNPLACKDELGRLRVAAAST
FT                   VGDEGYERSLALIEAGVDLVVIDTAHGHSEGVARAVSRIKAYSNQVQVVAGNVATADAA
FT                   RALVDAGADAIKVGIGPGSICTTRIVAGVGVPQLTAIMDAARGAGDVPVIADGGIKFSG
FT                   DFAKAIAAGASCAMVGSAIAGTDESPGEVILYQGRSFKSYRGMGSLGAMARGSADRYFQ
FT                   KDAASDKLVPEGIEGQVPYKGSAAAVIHQLVGGLRAAMGYTGNATVAEMRGGCEFVRIT
FT                   GAGLKESHVHDVQITRESPNYRLG"
FT   gene            567470..568273
FT                   /locus_tag="Pden_0593"
FT   CDS_pept        567470..568273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0593"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1319 possible invasion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68705"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZL1"
FT                   /protein_id="ABL68705.1"
FT                   /translation="MSGFSSLFRILALALALMPLRGLALPPADACEWAAQQAAAEIGVP
FT                   ADILGALALTETGRRLDGIVRPWAWSANAEGEGAWFDDPASAVAFAEDRVTRGRTNIDI
FT                   GCFQLNYRWHGAHFPSVARMFDPLENARYAARFLRQLHDEMGDWRVAAGAFHSRTPAHA
FT                   QRYLARFDTLHRMLRERGPAGMTGTPQTYNSFASIDSGRRKRVRDSVMLLGAPLGSGGT
FT                   GQPGSLAVLASGRSPLRAGSAPLIAVRMAATGDEDASLWRSSVPP"
FT   sig_peptide     567470..567562
FT                   /locus_tag="Pden_0593"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.501 at
FT                   residue 31"
FT   gene            568349..569500
FT                   /locus_tag="Pden_0594"
FT   CDS_pept        568349..569500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0594"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="PFAM: Fmu (Sun) domain protein; KEGG: rsp:RSP_0455
FT                   possible NOL1/NOP2/sun family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68706"
FT                   /db_xref="GOA:A1AZL2"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZL2"
FT                   /protein_id="ABL68706.1"
FT                   /translation="MTPAARAAAAIDILDRILDGQAAEAALIRWARASRFAGSGDRAAV
FT                   RDLVFDALRRLRSRAALGGALSGRGLLLGMCREEGIDPATLFTGEGHAPSVLSEGEGQA
FT                   GRAPTPDEALDLPDWLLPLWRKALGGDAEPVALAMRDRAPVWLRVNLRRADPARAAAAM
FT                   AEQGIATAPHPDLPTALRITEGARRLAGCHAYREGLVELQDLSPQMACALLPAQGSLLD
FT                   FCAGGGGKALALAAQGAGPVTAHDIDAGRMADLPARAERAGVRIRLAAPGKVAGRFDTV
FT                   VADVPCSGSGTWRRGPDAKWRLTRDDLEQLAARQCRILDQAAGFVADGGHLAYMTCSVL
FT                   DAENDDQVQGFLARNRRFEQVLARRFTPLTASDGFYLALMRRR"
FT   gene            569558..571600
FT                   /locus_tag="Pden_0595"
FT   CDS_pept        569558..571600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0595"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; PAS fold-4 domain
FT                   protein; KEGG: sit:TM1040_1228 multi-sensor hybrid
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68707"
FT                   /db_xref="GOA:A1AZL3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZL3"
FT                   /protein_id="ABL68707.1"
FT                   /translation="MNSERSEALRSAQIVLPFLTLPAVIGALWLALRPQDAGGGVTFLA
FT                   VGAAVTAWYLLGGVISVRHLRRGLAVRRDLDRVLPAVLEHDLTAFAVDPDGLVLAQNQV
FT                   GVERIGDLVGRYIHDALGRRHADPAMLWNGLGLGLSRRGRMRADLGDAGEYLVTRAPGS
FT                   TIQLWQAAAPERPSPPTPLPPRVEEDDFDLLPVSLLILDPGANIVRANMAACELLGGDI
FT                   LGQNLAALLDGLGRELAGWVSDVGAGRTIGGSEVLHVKAEGPDRFVQLSLTRGRGGHVT
FT                   AVLSDASALKTLEAQFVQSQKMQAIGQLAGGIAHDFNNLLTAITGHCDLLMLRHDKADP
FT                   DYADLDQISQNANRAAALVRQLLAFSRKQTLKLQIMDLRDTLSELTHLLNRLVGERIVL
FT                   TFDHDPALRMVHADRRQLEQVIMNLVVNARDAMPEGGDITICTDNVRLETRAELGRAVL
FT                   PAGDYVRVQVRDQGCGIAPDDLAKIFEPFFTTKRTGEGTGLGLSTAYGIVKQTGGYIFC
FT                   DSTPGEGSCFSLFFPAHDRAVPEETQRPAPAGPIRVRRDVEATVLLVEDEAPVRAFASR
FT                   ALKLQGFHVLEAACAEDALSLLADRGLAVDVFVTDVVMPGMDGPAWVRTALRDRPDTKV
FT                   IFMSGYAEDIFSEGRPPVPDAAFLAKPFSLSDLTALVTRQLEGAR"
FT   gene            complement(571624..572208)
FT                   /locus_tag="Pden_0596"
FT   CDS_pept        complement(571624..572208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0596"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_0453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68708"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZL4"
FT                   /protein_id="ABL68708.1"
FT                   /translation="MLIFWERRLVFLATPKAGSTAVETALEALASVVVQRPAELKHADL
FT                   RTYRHHIEPWLRSVTGEKFTTIALMREPIGWLRSWYRFRLRDDDEDPNHAMIGLSFADF
FT                   AQAYADPGGPDVARVGAQADFLTAEVDRVDCIFRYEDMDAFTHFLEDRLDCEISLPRVN
FT                   VPPAVDVSLNPEQEGSLRKIMARDFALYASL"
FT   gene            572452..573522
FT                   /locus_tag="Pden_0597"
FT   CDS_pept        572452..573522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0597"
FT                   /product="recA protein"
FT                   /note="KEGG: rsp:RSP_0452 recombinase A; TIGRFAM: recA
FT                   protein; PFAM: RecA domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68709"
FT                   /db_xref="GOA:A1AZL5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZL5"
FT                   /protein_id="ABL68709.1"
FT                   /translation="MAGATLFDMNDKRSADKQKALDSALAQIERQFGKGSIMKLGADNP
FT                   VAEIEATSTGSLGLDIALGIGGLPKGRIIEIFGPESSGKTTLTLHVVAEEQKKGGVCAF
FT                   VDAEHALDPQYAKKLGVNLDELLISQPDTGEQALEIVDTLVRSGAVSLVVVDSVAALTP
FT                   KSEIEGDMGDMQMGSQARLMSQAMRKLTASIGRSNCMVIFINQIRMKIGVMFGSPETTT
FT                   GGNALKFYASVRLDIRRAGSIKDRDEVTGNATRVKVVKNKVAPPFRQVEFDIMYGEGIS
FT                   KVGELIDLGIKAGVVEKSGSWYSYGDERIGQGRENAKQFLRDHPDMAHAIEDKIRASHG
FT                   LDFGVADDGDEVMAED"
FT   gene            573749..576406
FT                   /locus_tag="Pden_0598"
FT   CDS_pept        573749..576406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0598"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="KEGG: rsp:RSP_0451 alanyl-tRNA synthetase; TIGRFAM:
FT                   alanyl-tRNA synthetase; PFAM: alanyl-tRNA synthetase, class
FT                   IIc; phosphoesterase, DHHA1; Threonyl/alanyl tRNA
FT                   synthetase, SAD"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68710"
FT                   /db_xref="GOA:A1AZL6"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZL6"
FT                   /protein_id="ABL68710.1"
FT                   /translation="MPSLNDVRSTFLNYFERNGHRVVESSPLVPRNDPTLMFTNSGMVQ
FT                   FKNLFTGVETRDYKRATTAQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKD
FT                   GAIPFAWELLTKDFGIPKDKLLVTVYHTDDEAADIWKKVAGLSDDRIIRIPTSDNFWQM
FT                   GPTGPCGPCTEIFYDHGEQIWGGPPGSADEDGDRFIEIWNLVFMQNEQFEDGTMRALDM
FT                   QSIDTGMGLERIGALLQGKHDNYDTDLMRGLIEASAHATSADPDGPGKVHHRVIADHLR
FT                   STSFLIADGVMPSNEGRGYVLRRIMRRAMRHAHMLGAKDPVMHRLVPALVREMGAAYPE
FT                   LGRAQALIEETLKLEETRFKQTLDRGLRLLDDELAKLPEGANLPGEAAFKLYDTYGFPL
FT                   DLTQDALREKGRAVDTAGFDSAMAEQKAKARAAWAGSGETKDAAIWFDIAEEHGATEFL
FT                   GYDTEISEGQVLALVQDGAAVEEAGEGQQVQIVVNQTPFYGEAGGQVGDTGLIKTETGA
FT                   ARVTDTKKTGGVFIHIAEVTLGTIQRGQGAQLSVDHDRRSAIRANHSATHLLHEALRRA
FT                   LGEHVAQRGSLNAPDRLRFDFSHAKAMTPEELAQVEREVNDFIRQNSPVETRIMTPDDA
FT                   RALGAQALFGEKYGDEVRVVSMGELPGSGKGTGGQTYSLELCGGTHVARTGDIGMFALT
FT                   SETASAAGIRRIEALTGQAAMDELRRVDGELNEIAGIVKAQAGDVVSKVRALADERKAL
FT                   ANEVAQLKRQLAMGGGSEDKPREINGIKLIARRVEGVSGKELGPLVDEMKSRLGSGAVV
FT                   VLAEADGKATVAAGVTPDLTGRISAVELVQTATAALGGKGGGGRPDRAQGGAPSLAAAD
FT                   SAISAVETLIGEKA"
FT   gene            576403..576693
FT                   /locus_tag="Pden_0599"
FT   CDS_pept        576403..576693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0599"
FT                   /product="protein of unknown function DUF1330"
FT                   /note="PFAM: protein of unknown function DUF1330; KEGG:
FT                   rsp:RSP_0450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68711"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZL7"
FT                   /protein_id="ABL68711.1"
FT                   /translation="MTALWIAHVNVTDPEAYGEYARLAGPAIAAHGGAFLARGSRYVQL
FT                   EGKDRARNVVARFPSLEDAVACYRSAEYQAALEHAKGAAERDLVIVEENPA"
FT   gene            576760..577554
FT                   /locus_tag="Pden_0600"
FT   CDS_pept        576760..577554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0600"
FT                   /product="putative glutamine amidotransferase"
FT                   /note="KEGG: rsp:RSP_0449 putative glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68712"
FT                   /db_xref="GOA:A1AZL8"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZL8"
FT                   /protein_id="ABL68712.1"
FT                   /translation="MCRWAAYLGSPIYLEDVICRPGHSLVRQSHGATRCHTPVNADGFG
FT                   IAWYGEREEPGLYRDIMPAWSDSNLRSLTATVKSHLFLAHVRASTGTATSRNNCHPFVV
FT                   DRWCFMHNGQFGGYDSYRRHAEVLIPDELYAHRKGATDSEALFLMALGEGLGGDPAGAM
FT                   ARATAKFEALARQRGTAPHVRLTAAFSDGTKLYALRYASDEHAPTLFHRWSDTRGGRAV
FT                   VSEPLESDEADWLEVPAQSFCIFDGAEVTITPFRPEPLRAAA"
FT   gene            complement(577694..577939)
FT                   /locus_tag="Pden_0601"
FT   CDS_pept        complement(577694..577939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68713"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZL9"
FT                   /protein_id="ABL68713.1"
FT                   /translation="MCAHALAGRRNGRRRIDDKAVLDCADRFPRRWCLALHDGLFGSRW
FT                   PASIPAMPCWISMGKGLGEIRDFLIRESRRVLSIPI"
FT   gene            complement(577960..578181)
FT                   /locus_tag="Pden_0602"
FT   CDS_pept        complement(577960..578181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68714"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZM0"
FT                   /protein_id="ABL68714.1"
FT                   /translation="MATIATNRFSPRLPDLFAAVRKRLSRGAAAYITKHSRRAEIEALE
FT                   AKSDAELARMGLTRDRIVHYVFADRIWF"
FT   gene            578569..579861
FT                   /locus_tag="Pden_0603"
FT   CDS_pept        578569..579861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0603"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG:
FT                   rsp:RSP_0366 adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68715"
FT                   /db_xref="GOA:A1AZM1"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZM1"
FT                   /protein_id="ABL68715.1"
FT                   /translation="MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVI
FT                   GNQVFKLSLLPSGIVRKGKMAVIGNGVVLDPWSLFAEIDKLSAQGVEISPANLMIAENT
FT                   PLILPLHQDLDKLREEAAGASKIGTTGRGIGPAYEDKVGRRTIRVADLGDEETLDSRLD
FT                   RLLAHHDALRQGLGAAPIDRAELRAKLLEIAPKLLQYAQPVWKVMNDYRKAGKRILFEG
FT                   AQGSLLDIDFGTYPYVTSSTTMSGMAASGTGLGPSAIGFVLGIVKAYTTRVGEGPFPTE
FT                   LDDADGQRLGERGHEFGTVTGRKRRCGWFDAVLVRQTCAISGVDGIALTKLDVLDGFQT
FT                   LKICTGYEVDGQHYDHLPTAASLQAKAKPVYEEMEGWQESTQGARSWADLPANAIKYVR
FT                   RIEELIQCPVALLSTSPERDDTILVTDPFAD"
FT   gene            579873..580085
FT                   /locus_tag="Pden_0604"
FT   CDS_pept        579873..580085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0604"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sil:SPO1317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68716"
FT                   /db_xref="GOA:A1AZM2"
FT                   /db_xref="InterPro:IPR021265"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZM2"
FT                   /protein_id="ABL68716.1"
FT                   /translation="MDLKTRKRWSLVILLVGLPLYIVVAVSLVNWMDRTWGRQPILVEL
FT                   AVYVALGILWALPFRKVFTGIGKGE"
FT   sig_peptide     579873..579956
FT                   /locus_tag="Pden_0604"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.870) with cleavage site probability 0.378 at
FT                   residue 28"
FT   gene            580103..580738
FT                   /locus_tag="Pden_0605"
FT   CDS_pept        580103..580738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0605"
FT                   /product="thiamine diphosphokinase"
FT                   /note="TIGRFAM: thiamine pyrophosphokinase; PFAM: Thiamin
FT                   pyrophosphokinase, catalytic region; KEGG: rde:RD1_1915
FT                   thiamine pyrophosphokinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68717"
FT                   /db_xref="GOA:A1AZM3"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR036371"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZM3"
FT                   /protein_id="ABL68717.1"
FT                   /translation="MASARPVTLIGGAPVGRADLEQALALAPVVAAADSGADTALSHGL
FT                   MPAAVWGDFDSISARARAEIPLANQHPIAEQNSTDFEKCLSNLDAPFVVALGFSGARHD
FT                   HFLSVLNVLARRIGPPCILIAGEDVITLAPPRLALDLAPGTRVSLFPMGPATGRSQGLK
FT                   WPIDGLAFAPGGRSGTSNQATGPVTLECDGPMLLILPRSELATLARAL"
FT   gene            complement(580824..581795)
FT                   /locus_tag="Pden_0606"
FT   CDS_pept        complement(580824..581795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0606"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sil:SPO2816
FT                   peptide/nickel/opine uptake family ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68718"
FT                   /db_xref="GOA:A1AZM4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZM4"
FT                   /protein_id="ABL68718.1"
FT                   /translation="MTDRLLIEESAVNAPAPGAEALPPADPPPQAPARSQWRDIWRQFR
FT                   NHRGAMLALVLFVAILLFVGLGPLVWTIDPGFVDIRARNQGFSAAHPLGTDQLGRDMLA
FT                   RLMAGGQVSLAVGLTAMAVALTLGSLIGISSGYFRRLDAPLMRLTELFLALPLLPLLLL
FT                   MVTLFREPLGRAMGPAGGTFLLIVSAIGITSWMQTARILRGEVLGLKEREFILAAQSIG
FT                   TPAPRMILRHVLPNVISPIVVAATLGIATAIITESALSFLGLGFPPDFPTWGRLLYDAV
FT                   DQMQMYPWRVVLPGLLISLTVLSVNYIGDGLRDAMDPRIRGR"
FT   gene            complement(581788..582795)
FT                   /locus_tag="Pden_0607"
FT   CDS_pept        complement(581788..582795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0607"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sil:SPO2815
FT                   peptide/nickel/opine uptake family ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68719"
FT                   /db_xref="GOA:A1AZM5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZM5"
FT                   /protein_id="ABL68719.1"
FT                   /translation="MLSFALRRLLLAVPTLLFISLVIFLLLEASPGDPLGDVPLTVPPE
FT                   VKERMREALGLGQAWYIRYVLWLKQFFWVEPLYWFDRAFGTGFSEGMQRIISFQSRSPV
FT                   FDVIAERLPQTLTVVGMSYLVGVMIALPIGIISAYRQYSWFDQIGTFISMVGFSLPTFF
FT                   TGVVLIIVFGIKLQWFPSIYDTTHRVTDWDSFVVQLRQMAMPVTVLALYNAAQISRFMR
FT                   ASMLDNLRQDYVRTARAKGLSERVVVLKHVLRNSLIPVVTVIALGLPAVFGGAIITEQV
FT                   FKVNGLGQLLILAIHANDMPMVMTLTFIFAVLIVGFTLIADLLYGVLDPRIRYD"
FT   sig_peptide     complement(582706..582795)
FT                   /locus_tag="Pden_0607"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.968) with cleavage site probability 0.755 at
FT                   residue 30"
FT   gene            complement(582803..584503)
FT                   /locus_tag="Pden_0608"
FT   CDS_pept        complement(582803..584503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0608"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: sil:SPO2814 peptide/opine/nickel uptake family ABC
FT                   transporter, periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68720"
FT                   /db_xref="GOA:A1AZM6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZM6"
FT                   /protein_id="ABL68720.1"
FT                   /translation="MKLKTLMLGAAATAAMAPAAFAERGSDGQVNVIMWQAPSTMNPYL
FT                   SAGTKDIIAGSVVLEPLASFTPEGEVVPRLAAEIPSVENGGISEDLKTVTWKLQPDIKW
FT                   SDGTPFTAEDVAFTAEYCMSPNGGCAQLAKFEGVEKVEAVDELTVRVTFVSPRPDPFSA
FT                   FVGAQSPILQKAQFQNCLGEAAPTCTQQNFNPVGTGAFVVKEFRTNDVISFAANPEYRD
FT                   PAKPAFATLLMKGGGDSAAAARAVLETGEFDYAWNTQLAPDVIAGMEAAGKGKNVAAFG
FT                   SLVERIHVNLTDPSPGLPEGERSTVKHPHPILTDPAVRKALSMAIDRELLTEIGYGPAG
FT                   QPTCNLVPAPAAWASENTECFTQDIEGAKALLDEAGWTVGAGGVREKDGKRLTLLFQTS
FT                   VNAVRQDFQALIKQWWSEIGVETELKVVDPSVFFGGDAGSPDTFQKLYADVEMYANNFE
FT                   GSNPEPYLARQTCDKAPGPENQWQGENTSRYCDPEYDRLIAEMTQIVDPAERGAMGRRL
FT                   NEMLTKDSNAIIPLVYRGTTSAHANSLGGVALNAWDSELWNVADWHRVK"
FT   sig_peptide     complement(584435..584503)
FT                   /locus_tag="Pden_0608"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            584724..586553
FT                   /locus_tag="Pden_0609"
FT   CDS_pept        584724..586553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0609"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase; KEGG: sil:SPO2813
FT                   peptide/nickel/opine uptake family ABC transporter,
FT                   ATP-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68721"
FT                   /db_xref="GOA:A1AZM7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZM7"
FT                   /protein_id="ABL68721.1"
FT                   /translation="MLDTKPLVRIEGLRVEFQTHDGPVTGVEDLSFDIRPGECLCVVGE
FT                   SGSGKSVSSLSLMRLVEFGGGEIANGRLLFQRERDEIDLAKAPPAAMRDIRGNEIAMIF
FT                   QEPMTALNPVFTVGEQLAEGLIVHRGLTRAQARARAPELLHEVRIPEPERRLRQYPHEL
FT                   SGGMRQRVVIAMAMACRPRLLICDEPTTALDVTIQAEILTLIDRLKRETGMAVLFITHD
FT                   MAVVAQMADRVVVMFRGNKVEEGPVGQIFEAPREPYTQALLAAVPRLGEMTGRDAPEPM
FT                   RLMREGQVARPEPVIPPAPAPLLVVRNLCTRFAVKGGILRRTVAQVHAVEDVSFTVNAG
FT                   ETLSLVGESGCGKSTTGRSILRLVEPSSGQVSLGGRDILALGASDLRKARRDMQMIFQD
FT                   PFASLDPQMRLLDQIEEPMLNYGIGNRVERRDRIARLFDRVELPRGFMKRYPHELSGGQ
FT                   RQRIAIARALALNPKLIIADEAVSALDVSVQAQVLNLLMELQRDLGISMLFISHDMAVV
FT                   ERVSHHVGVMYLGRIVEIGTRRQVFENPQHGYTRQLMAAVPVADPRRRKIGEDLRFRPI
FT                   PSPIHPVGHVPAPSVYREVAPGHLVLAEPATHG"
FT   gene            586652..587821
FT                   /locus_tag="Pden_0610"
FT   CDS_pept        586652..587821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0610"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: sit:TM1040_0719 peptidase M20D,
FT                   amidohydrolase; TIGRFAM: amidohydrolase; PFAM: peptidase
FT                   M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68722"
FT                   /db_xref="GOA:A1AZM8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZM8"
FT                   /protein_id="ABL68722.1"
FT                   /translation="MPVKNRFAELLPEITAWRRDFHENPELDYQVHRTAGRVAELLRGF
FT                   GVDEVNEGVGRTGVVGVIRGRSNSSGRVIGLRADMDALPINEQTGAEYASKNPGVMHAC
FT                   GHDGHTAMLLGAAKYLAETRNFDGTAVVIFQPAEEGGAGGLAMVQDGLVDRWGIQEFYG
FT                   MHNMPGYPTGSFAIREGAMMAAADQFDIVVTGKGGHAAKPHEAIDTTLVAAQIIVALQS
FT                   IVARNVDPLKSGVISVCVVQTDSTAHNVIPQVVKLKGTARSLAPEVRDQLEEGIKRVAT
FT                   HTAAAFGAAAEVTYDRGYPVTMNHPEATGFAAEVARQVAGEVNMEMEPLMAGEDFSYML
FT                   NERPGAYIFVGNGDTAMVHHPAYDFDDNAIPAGSSWYAGMVEARMPILA"
FT   gene            complement(587908..589299)
FT                   /locus_tag="Pden_0611"
FT   CDS_pept        complement(587908..589299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0611"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A;
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; FAD dependent oxidoreductase; KEGG: rsp:RSP_2968
FT                   dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68723"
FT                   /db_xref="GOA:A1AZM9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZM9"
FT                   /protein_id="ABL68723.1"
FT                   /translation="MAQSFDMVVIGSGPGGYVCAIRGAQLGLKVACIEREHLGGICLNW
FT                   GCIPTKALLRSAEVFHLMHRAKEFGLSADKIGYDLGAVVQRSRGVAKQLAGGVGHLLKK
FT                   NKVTVIMGEASLTAPGKISVKTDKGTEEVTGKAIVLATGARARELPGLEPDGDLVWNYK
FT                   HALQPPRMPKKLLVIGSGAIGIEFASFFNTLGADTTVVEVMDRVLPVEDAEISALAKKQ
FT                   FVKQGMKILEKAAVKKLDRAKGKVTAHIETGGKTETHEFDTVISAVGIVGNVENLGLEK
FT                   LGAKIDRTHVVTDEYCRTGVEGLYAIGDVAGAPWLAHKASHEGVMVAELIAGGHPHPIK
FT                   PNSIPGCTYCNPQVASVGLTEEKAKAAGYEVKVGRFPFIGNGKAIALGEPEGLIKTVFD
FT                   AKTGELLGAHMVGAEVTELIQGYVVGRTLETTEAELMETVFPHPTLSEMLHEATLSAYG
FT                   RAIHF"
FT   gene            complement(589345..589926)
FT                   /locus_tag="Pden_0612"
FT   CDS_pept        complement(589345..589926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0612"
FT                   /product="protein of unknown function DUF924"
FT                   /note="PFAM: protein of unknown function DUF924; KEGG:
FT                   sil:SPO2224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68724"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZN0"
FT                   /protein_id="ABL68724.1"
FT                   /translation="MTDTVTPEGINRFWLDEVGEEGWYARSDDLDETIRQRFQPAWARA
FT                   ADLVPGWATTPEGALAGLILTDQFPRNMFREDARAFDTDPLARSLAREAIANGFHLRIE
FT                   PPGRQFFYLPFEHSEDLADQERAVSLFAEFMPGENLRHAELHRDAIARFGRFPWRNAAL
FT                   NRVPTAAESRVMEAGGYGALVSGKLSLADV"
FT   gene            complement(589984..591234)
FT                   /locus_tag="Pden_0613"
FT   CDS_pept        complement(589984..591234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0613"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rsp:RSP_2970 transporter, major facilitator superfamily
FT                   (MFS)"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68725"
FT                   /db_xref="GOA:A1AZN1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZN1"
FT                   /protein_id="ABL68725.1"
FT                   /translation="MLTVLRTTWPLLLGILLLMVGNGMQGTLLGIRGKIEGISTTQMSV
FT                   VMSAYFGGFLLGSRVVPELIRQVGHVRVFAALGSLISSVLILYAAAPHWISWSLMRLLI
FT                   GFCFSGVYITAESWLNAGTTNENRGQAMSAYMIMQMLGIISAQFLMNTADPAGYLLFVI
FT                   PSVLVSVSFLPILLSTQPAPQFATLKRMSFGSLFRVSPLGCIGIFLMGGVFSALFGMAS
FT                   VWGSTKGLSVREISAFVAAIYAGGLLLQYPIGWLSDHGDRRFIVLGLSVLGAAVSLATV
FT                   TLQPDIWGLLLAAALIGGVANPVYSLLLAYTNDFLDSSDMAAASAGLLFINGVGAMAGP
FT                   LITGWLMSLLGPDGFWVYIGLLLAVLAFYAGWRRTRRPAAPVADQQSFAVIAPSATPVA
FT                   VEAALETASSDDGDKPA"
FT   sig_peptide     complement(591157..591234)
FT                   /locus_tag="Pden_0613"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.803) with cleavage site probability 0.717 at
FT                   residue 26"
FT   gene            complement(591234..592313)
FT                   /locus_tag="Pden_0614"
FT   CDS_pept        complement(591234..592313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0614"
FT                   /product="Queuosine biosynthesis protein"
FT                   /note="PFAM: Queuosine biosynthesis protein; KEGG:
FT                   rsp:RSP_2971 S-adenosylmethionine tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68726"
FT                   /db_xref="GOA:A1AZN2"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZN2"
FT                   /protein_id="ABL68726.1"
FT                   /translation="MARTEPKPMKLDDFDFHLPETLIATRPARPRSSARLLLAQGDSIR
FT                   DLHVRDLADLLGSGDLLVLNDTKVIPARLNGTRARQTPQGEAVAKVEVTLLEPVAHGWK
FT                   ALAKPLRKLKPGEVIRFGSALSAEVAEIAGGELTLRFDATGEAFDAALAQVGAMPLPPY
FT                   IAALRAPDEADRQDYQTVWARNSGAVAAPTASLHFDGELLDGLAARGVRFTHVTLHVGA
FT                   GTFLPVKVEDVTTHKMHGEWGEVTPEAAAAINATRAAGGRVIPVGTTALRLIESAAAED
FT                   GTVHPFQGVTEIFIYPGYRFRVTDALMTNFHLPKSTLLMLVSALMGQDRIRGIYRHAVE
FT                   SGYRFFSYGDASLLIPKDP"
FT   gene            592411..592701
FT                   /locus_tag="Pden_0615"
FT   CDS_pept        592411..592701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0615"
FT                   /product="putative bacterioferritin-associated ferredoxin"
FT                   /note="KEGG: sit:TM1040_2200 putative
FT                   bacterioferritin-associated ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68727"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZN3"
FT                   /protein_id="ABL68727.1"
FT                   /translation="MIVCHCTQISDYDIKAAIDWMRAADPETIITPGKIYHALGKRADC
FT                   GGCMPLFLDTMRGCDNLAVPPILRGLKANRTGVSHEGRRKGHRVSQRSATV"
FT   gene            592649..593134
FT                   /locus_tag="Pden_0616"
FT   CDS_pept        592649..593134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0616"
FT                   /product="bacterioferritin"
FT                   /note="TIGRFAM: bacterioferritin; PFAM: Rubrerythrin;
FT                   Ferritin, Dps family protein; KEGG: rsp:RSP_3342
FT                   bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68728"
FT                   /db_xref="GOA:A1AZN4"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZN4"
FT                   /protein_id="ABL68728.1"
FT                   /translation="MKGDAKVIEYLNAALRSELTAVSQYWLHYRLQEDWGYGKVADKSR
FT                   AESIEEMHHADRLIQRIIFLEGHPNLQKLDPLRIGQNLKETLESDLAAEHDARTLYIEA
FT                   REYCDKVGDYVSKNLFDALLTDEEGHIDFLETQLGLYEEIGAQNYGQLNAKSADEAE"
FT   gene            complement(593194..593868)
FT                   /locus_tag="Pden_0617"
FT   CDS_pept        complement(593194..593868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0617"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /EC_number="3.1.3.18"
FT                   /note="KEGG: rsp:RSP_2504 phosphoglycolate phosphatase;
FT                   TIGRFAM: HAD-superfamily hydrolase, subfamily IA, variant
FT                   3; HAD-superfamily hydrolase, subfamily IA, variant 1;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68729"
FT                   /db_xref="GOA:A1AZN5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZN5"
FT                   /protein_id="ABL68729.1"
FT                   /translation="MAGTVVFDLDGTLADTSGDLIAAANACFQARGLGPLLDPVEDALI
FT                   AFHGGRAMLRAGYGRLPADRLLPPGAEDEDYPRLLVHYGKAIAVHTRLYPGTEAALEQL
FT                   AAAGHRLAVCTNKPAALAETLLRQLGIRDRFAAMIGADTLPVRKPDPRPYAAAVEAAGG
FT                   TVARSFLVGDTETDRKTAAAAGVRVALVAFGPEGEALRRLAPEAMLAHFDDLPGLAADW
FT                   LA"
FT   gene            593973..595313
FT                   /locus_tag="Pden_0618"
FT   CDS_pept        593973..595313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0618"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /note="PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase; transferase hexapeptide repeat containing
FT                   protein; Nucleotidyl transferase; KEGG: rsp:RSP_2503
FT                   glucosamine-1-phosphate N-acetyltransferase;
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68730"
FT                   /db_xref="GOA:A1AZN6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZN6"
FT                   /protein_id="ABL68730.1"
FT                   /translation="MTEKPVALIVLAAGQGSRMQSDLPKVLHRLGGVPLVGHALSTGRT
FT                   LEPEAVVVVAGHGAEAVAKAVAKLNPEAKIALQEQQLGTGHAVSQALPQLEGFEGRVIV
FT                   LYGDTPFIGQETLASLAAHPADVVVLGFEASDPGRYGRLVTGPEGLERIVEYKDADEAT
FT                   RAIRLVNSGVLAADAALLREFLPMIGNRNAAGEYYLTDIPELARAAGHRVEVVTCDEAE
FT                   TLGINTRAELAAAEAAFQVRARARALEDGVTMTDPATVWFALDTCIGRDAVIGQNVVFG
FT                   PGVTVESGAEILPFCHLEGCHVSAGATVGPFARLRPGAELGGDVHVGNFVEIKNSVLDE
FT                   GAKVGHLTYLGDAHVGEATNIGAGTVTCNYDGVSKHRTEIGAHAFIGSDTMLVAPVRVG
FT                   ARAMTGSGSVITEDVPDDALALGRAKQVVKPGLATRLMQALRQKKGN"
FT   gene            595315..597132
FT                   /locus_tag="Pden_0619"
FT   CDS_pept        595315..597132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0619"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /note="TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase, class-II; sugar isomerase (SIS); KEGG:
FT                   rsp:RSP_2502 D-fructose-6-phosphate amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68731"
FT                   /db_xref="GOA:A1AZN7"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZN7"
FT                   /protein_id="ABL68731.1"
FT                   /translation="MCGIIGILGDHEVSPQLVEALKRLEYRGYDSAGVATVDASGHLDR
FT                   RRAVGKLVNLSDRLVHEPLAGHAGIGHTRWATHGAATEANAHPHRRGPVAVVHNGIIEN
FT                   FRELRDEVTRLGMQPESQTDTETVALLTAWHMGQGLAPVEAARAVLARLDGAFALAFLF
FT                   EGEPDLMIAARKGSPLAVGHGEGEMFLGSDAIALAPFTDRITYLEDGDHAVIRRSGAEI
FT                   FDAEGRPANREIQQIDVGATRIDKGGYRHFMAKEIAEQPVVLGDALNHYIKGDRIVLPE
FT                   ALDFRDVDRLTLVGCGTAFYAAHVARYWFESLAGLPCDLDVASEFRYREPPLSPASWAI
FT                   FVSQSGETADTLAALHYARDKVARTVGVVNVGTSAIARDADIALPTLAGIEVGVASSKA
FT                   FTCQLAVLAVLALKAARDRGRLTDSELAAHLADLRALPGLLNQALTVSDECRRLAGWLA
FT                   EAQDVLYLGRGALYPVALEGALKLKELSYIHAEGYASGELKHGPIALIDRNVPVVVLAP
FT                   RDALFEKTVSNMQEVMARHGQVLLISDPEGLETGGHGIHARLAMPPGGGLFQPILYAVP
FT                   MQYLAYHTAVAKGTDVDQPRNLAKSVTVE"
FT   gene            complement(597136..598119)
FT                   /locus_tag="Pden_0620"
FT   CDS_pept        complement(597136..598119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0620"
FT                   /product="peptidase S58, DmpA"
FT                   /note="PFAM: peptidase S58, DmpA; KEGG: sit:TM1040_2667
FT                   peptidase S58, DmpA"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68732"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZN8"
FT                   /protein_id="ABL68732.1"
FT                   /translation="MRPGPRNLITDVPGLRVGNARDDALRSGATVLLCETPFACGFNVM
FT                   GGAPGTRETELLAPDKLVGGVDALVLSGGSAFGLAACDGVSDGLRAMGRGFQIGPVRVP
FT                   IVPGAIVFDLLNGGDKDWDANPYPALGRAALAAAGADFALGSEGAGTGALTHRWKGGLG
FT                   SASAMLEDGITVGALVVVNALGSVTAGETRQFWAAPWELAGEFGGLGLSGPYPAGDEPN
FT                   PAKRLGEATTIAIVATDAALDKAGLTRLATAAQDGMARAIVPSHTPFDGDLVFAVSTGA
FT                   KPLPDPALTPFRLGHAAACTLARAIARGIHAASPRPGDLQPCWREG"
FT   gene            598259..598843
FT                   /locus_tag="Pden_0621"
FT   CDS_pept        598259..598843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0621"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="KEGG: rpa:RPA4834 peptide methionine sulfoxide
FT                   reductase; TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68733"
FT                   /db_xref="GOA:A1AZN9"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZN9"
FT                   /protein_id="ABL68733.1"
FT                   /translation="MNAPIHRIFGRPLDAEMPKGYDQAIFGMGCYWGVERLFWQQEGVW
FT                   LTEVGFAGGTTENPSYKQVCAGGTGHAEVVHVVYDSSRVSYERLLQIFWENHDPTQGNR
FT                   QGNDVGSQYRSLIMVFNDSQKAAAELSKADYGNRLAVQGYPDITTQILPAGPFWRAEDD
FT                   HQQYLDRYPDGYCGLRGTGVKAPLTDIAEGY"
FT   gene            598844..599713
FT                   /locus_tag="Pden_0622"
FT   CDS_pept        598844..599713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0622"
FT                   /product="[LSU ribosomal protein L11P]-lysine
FT                   N-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: methyltransferase small; ribosomal L11
FT                   methyltransferase; Methyltransferase type 11; KEGG:
FT                   sit:TM1040_2376 ribosomal L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68734"
FT                   /db_xref="GOA:A1AZP0"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZP0"
FT                   /protein_id="ABL68734.1"
FT                   /translation="MATWTALTHTIGREAAEALAEAGEDLTPEPVGSGVFEIEDGSNRW
FT                   EVGLYFTEAPDDVALALLAAAWNAEPFVVSELPEVDWVAHVRRELSPVEAGRFFVHGGH
FT                   DVDKVPAGAEALLIEAAMAFGTGHHATTKGCLLALDRLIAEGVEPRRIVDIGCGTAVLA
FT                   MAAARSFPVIVLAGDIDPQAVDVARANVIANGLDGRVECVEAVGFDHPLIENAAPFDLV
FT                   FANILKQPLIDLVPDMARHLASGGRAILSGILATQAEEVIAAYAAGGLTLERRDDMGEW
FT                   STLVVRRG"
FT   gene            complement(599834..600028)
FT                   /locus_tag="Pden_0623"
FT   CDS_pept        complement(599834..600028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0623"
FT                   /product="protein of unknown function DUF1127"
FT                   /note="PFAM: protein of unknown function DUF1127; KEGG:
FT                   sit:TM1040_2374 protein of unknown function DUF1127"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68735"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZP1"
FT                   /protein_id="ABL68735.1"
FT                   /translation="MSAIDTNRIHGGAGSLGIGSKIWAALSAWNDARVTRNALSRLTDR
FT                   ELDDIGLCRGDIEQIARAR"
FT   gene            complement(600267..600986)
FT                   /locus_tag="Pden_0624"
FT   CDS_pept        complement(600267..600986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0624"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   sil:SPO3629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68736"
FT                   /db_xref="GOA:A1AZP2"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZP2"
FT                   /protein_id="ABL68736.1"
FT                   /translation="MAKIRLFIDHPLAEGQGIELNADQSHYLSSVMRQGAGDEILVFNG
FT                   QDGEWLARIERIAKRGGALEALRQTAPQLNPPDLWLVFAPIKKARTDFIVEKAAEMGAA
FT                   RILPVQTDHTNSERIRQDRLQAHAVEAAEQCGGTHVPEVCDLVPLSRLLDGWDAGRRIL
FT                   WADEALAGPAQVLSGLPRGPWAILIGPEGGWSESERKRLSAMDCVTRIALGPRILRADT
FT                   AAVASLALWQASLGDWR"
FT   gene            601003..601974
FT                   /locus_tag="Pden_0625"
FT   CDS_pept        601003..601974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0625"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: rsp:RSP_1008
FT                   4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68737"
FT                   /db_xref="GOA:A1AZP3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZP3"
FT                   /protein_id="ABL68737.1"
FT                   /translation="MQTDHRTPEGPTPEGPSTVADAPPDNWVDRYAPPDWRPWLRLSRA
FT                   DRPIGTWLLLLPCWWGIGLAMIAGSPGWRDLWIAVACGVGAVLMRGAGCTWNDITDRDI
FT                   DDKVARTRSRPIPSGQVTVRGAMVWLVAQSLAGFAILLTLGGAAIALGVASLLLVAIYP
FT                   FAKRFTWWPQLFLGLAFNWGVLLAWAAHMGNLAPAPVLAYLAGIAWTIFYDTIYAHQDA
FT                   EDDALIGVKSTARLFGRDTPRWLAGFGTASVLLLGLAVMAAAPEGLGLTLGLLGVAGFA
FT                   AHLAWQLRQFDMADGAGCLRLFRSNRDAGLVVALFLALAGLV"
FT   gene            602001..604307
FT                   /locus_tag="Pden_0626"
FT   CDS_pept        602001..604307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0626"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: rde:RD1_4081
FT                   OmpA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68738"
FT                   /db_xref="GOA:A1AZP4"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZP4"
FT                   /protein_id="ABL68738.1"
FT                   /translation="MRRVGNSPKVPRMANPQRPARRAPVLAASLIALAAAAGLSFLGAR
FT                   AAADFVETRSAEDLRAALADYDWVQVRTDGLQVQLEGIAPDEVQRFRARARAETVVDSG
FT                   RVIDKMQVAASAELATPAFEIELLRNDQSISIIGLVPASLDRVALVERLKRQTGAPQVS
FT                   DLMEGADYPVPDGWEDAFAFGLKAAQLAKRAKVSIAAGEVSIRAIADSPREKRDLETAL
FT                   QRAKPASVTLTADITAPRPVIAPFTLRFVKDATGTRFDACAADTETARDRILEAGRDAG
FT                   VPDQPQCTLGLGAPSPRWADAAVPAIRAIKALGAGSVTISDTDVALFAPADVEAAQFDE
FT                   AVGRLEAALPPAFTLAARHEKPGEAEAGPAEFSALVDPGGVSLRGRITDERMRDAVESL
FT                   ARARFGQVDSALRSDVSVPEGWTLRAIAALEALDGLARGEAKVTRDLVRISGVSGSQTA
FT                   SDMAAARLAQRLGAGARYELAIRYDRRMDPLLGLPSGIECVDRLNAAMQQSEIGFEPNK
FT                   SVIAGDPGPTLERLAETMKLCADFRIEIGGHTDSQGSEGFNAELSRARAQAVLAAMTAA
FT                   GIDTANMTAKGYGESQPIADNDTDAGREANRRIEFLLLADDPVVTEAPAPAELVKGVTD
FT                   SPEVVAARVTAAALHAATAAIGPALGVPTDPEAALFAATEPVRLLVSGIDPSRVASRPA
FT                   QEAALPELPALRAATLPAASLLPEAAELVEPAEAATRAVQEALVGAAIEAATMPARAAL
FT                   HVNRPLPRPEPASAP"
FT   sig_peptide     602001..602141
FT                   /locus_tag="Pden_0626"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.532 at
FT                   residue 47"
FT   gene            604338..604664
FT                   /locus_tag="Pden_0627"
FT   CDS_pept        604338..604664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0627"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68739"
FT                   /db_xref="GOA:A1AZP5"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZP5"
FT                   /protein_id="ABL68739.1"
FT                   /translation="MNRTEFIVATAIILFAAFMLGWFASWLIHRLSRVTRAEMGELESM
FT                   AQQLHEAEEARDRAVDELETREADLVARLSTTEAELRAAQGQLRESLTEIEELREYIDR
FT                   KLKR"
FT   gene            complement(604661..605521)
FT                   /locus_tag="Pden_0628"
FT   CDS_pept        complement(604661..605521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68740"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZP6"
FT                   /protein_id="ABL68740.1"
FT                   /translation="MTTEQDQIGEFDDVKRVIANDLKFKARLGIREDAFASVKLGKTIG
FT                   SLSDLGGAAATGAGIAQSGMVASTFFAKSGLMAALGIGGAAATPVGWVIAAALASGGAY
FT                   YGVTRLFKGYEDSRVDVVPRFLNTPIDLLGASMLDLMGSLSLKVAAMDGQVDPREVAVI
FT                   RDYFVDDWGYDADYVDHALSVLQANADKSRLAEMTQALAEFVHANPDCKFTAIQQEIKV
FT                   LLHEIAQADGKLDEREDMAIERILRALDEQNSIRASIGRAASGTVAAASSAAGWIGSRF
FT                   GLGKT"
FT   gene            complement(605518..605964)
FT                   /locus_tag="Pden_0629"
FT   CDS_pept        complement(605518..605964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68741"
FT                   /db_xref="GOA:A1AZP7"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZP7"
FT                   /protein_id="ABL68741.1"
FT                   /translation="MSESFVPSSLDEAIEFCQSAMPLRKIKDFLDRTALSADLKALLYD
FT                   LAQFTVKVGEVVVAIGRRMISIAMWLAQTIPNTALGVTVALALTAVIGTVPVMGGFLAV
FT                   ALQKLLLLIGLTAGAIEDLRQHAMKDAIDRMARQFAAFNGGVVA"
FT   gene            complement(606107..607291)
FT                   /locus_tag="Pden_0630"
FT   CDS_pept        complement(606107..607291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0630"
FT                   /product="aromatic amino acid aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.57"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   rde:RD1_0935 aromatic amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68742"
FT                   /db_xref="GOA:A1AZP8"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZP8"
FT                   /protein_id="ABL68742.1"
FT                   /translation="MLGNLKPQAPDKILALMGEFRADPRQGKIDLGVGVYKDATGHTPI
FT                   MRAVHAAEQRMLETETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLATVGGTGAL
FT                   RQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADL
FT                   AAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDA
FT                   AGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMAFLNRQTYS
FT                   FPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAE
FT                   HRGMFSRLGATPEQVKRIKEEFGIYMVGDSRINIAGLNDNTIPILARAIIEVGV"
FT   gene            complement(607291..608151)
FT                   /locus_tag="Pden_0631"
FT   CDS_pept        complement(607291..608151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0631"
FT                   /product="3-mercaptopyruvate sulfurtransferase"
FT                   /EC_number="2.8.1.2"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: rsp:RSP_0885
FT                   thiosulfate sulfurtransferase, rhodanese-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68743"
FT                   /db_xref="GOA:A1AZP9"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZP9"
FT                   /protein_id="ABL68743.1"
FT                   /translation="MSTDSDDPKVLVSTDWLAAHLSDPDLRVIDATWFLEPGRDARAEY
FT                   MAAHIPGARFFDIDEIADKRSELPHMAPQPEMFISRMRAMGIGDGHQVVIYDNSPVRSA
FT                   ARVWWTFKLMGKQDVAVLDGGFGKWLAEGREIEDMPPILRDRHITVQRQAALVRDVTQV
FT                   AAASKLGDHEIVDARSAERFRGEATEPRAGLRSGHIPGSKSLPFGRLYDQDGTLKSPDA
FT                   LRAEFEAAGVDLSKPVITTCGSGVTAAVLFLALERIGHRDHSLYDGSWAEWGSFPDLKI
FT                   ATGDA"
FT   gene            complement(608217..608687)
FT                   /locus_tag="Pden_0632"
FT   CDS_pept        complement(608217..608687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0632"
FT                   /product="SsrA-binding protein"
FT                   /note="TIGRFAM: SsrA-binding protein; PFAM: SmpB protein;
FT                   KEGG: jan:Jann_0031 SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68744"
FT                   /db_xref="GOA:A1AZQ0"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZQ0"
FT                   /protein_id="ABL68744.1"
FT                   /translation="MATKSDPNYKIIAENRRARFDYFIESDLEVGIVLTGSEVKSLRTG
FT                   QSNIAESYASVENGELWLINAYIAAYKQAGVFGHEERRRRKLLVSRKELARLWQAIGRE
FT                   GMTLVPLVMYFNDRGKVKLKIGVAKGKKVADKRETAAKRDWNRQKQRLLKQG"
FT   gene            608839..610500
FT                   /locus_tag="Pden_0633"
FT   CDS_pept        608839..610500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0633"
FT                   /product="thiamine pyrophosphate enzyme TPP binding domain
FT                   protein"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; thiamine pyrophosphate enzyme, central region;
FT                   thiamine pyrophosphate enzyme TPP binding domain protein;
FT                   KEGG: jan:Jann_0137 thiamine pyrophosphate enzyme-like
FT                   TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68745"
FT                   /db_xref="GOA:A1AZQ1"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZQ1"
FT                   /protein_id="ABL68745.1"
FT                   /translation="MRHGGQILVDALKTNGVGRVFSVPGESFLAVLDGLYASGIRNVVC
FT                   RHEGGAAMMAEAHGKLTGRPGVGFVTRGPGATNASAGVHVARQDGTPMILFVGQIARAD
FT                   RDRDAFQEVDYRAMFGPLAKWVAEIDQTERIPEYVSRAFHLAMSGRPGPVVLALPEDMI
FT                   SARAEVPDLPPPAAPLAAVAAESVEAVAQALAGAERPLVVPGGTLWSQAAADDLARFAE
FT                   SWGLPVAVPFRRQGHIDNAHPNYVGDLGVGMNPALGQALSQADCVLSLGSRLGDTLTRG
FT                   YELMDPVRPHARVIHVHPSPDELGRLWRPDPGLAADPRVVVAALAALPVPRRWDGWTAG
FT                   LRAAYEAWQQPRPTPGAVRMEAVVRWLSDHLPPDAIITNGAGNYAAFVHRYYRFRRWGT
FT                   QLAPTSGSMGYGLPAAIAAKLEHPGRSVVCMAGDGCLQMTVNELSTAAQHGAAVIVIVA
FT                   NNGHYGTIRMHQERSYPGRVSGTALANPDFVALARAYGGHGETVTRQEDFADAFARAQA
FT                   AGRLAVLELMLDPEALSTGATLAETRAAGAAGLRRA"
FT   gene            complement(610511..611935)
FT                   /locus_tag="Pden_0634"
FT   CDS_pept        complement(610511..611935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0634"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: rsp:RSP_2170
FT                   phosphate transporter, Pit family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68746"
FT                   /db_xref="GOA:A1AZQ2"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZQ2"
FT                   /protein_id="ABL68746.1"
FT                   /translation="MRREPREYRTLDKDLSRVTNAERAGLHSARPLMRLGLALIFIAAA
FT                   SYVGTGFLADQPALGILAASIAVAAYLALSIGGNDVANALGPAVGAGAIGMTAGLLLMA
FT                   AMEVLGAVIAGSAVTATLTEGLVGSTLGEGEATARMMLAALLAAGSWISLATWLGAPVS
FT                   TTHSVVGAIAGAGMATFGAGAVNWPAMAMIAFGWIASPLVSGLIAAGLMVLLRMLVLDR
FT                   EDRIAAARTWMPVIVGLASAMLAGVAELAWHGSGLAANAVLVLVCGGLGWLYTRRRIDR
FT                   QTRGMGGGRLAMKQLLAVPLIAAALVMGFAHGANDVSNVAAPLTIILDSLSAGGDDDLR
FT                   ARLVLLLGGLGIALGILLFGRRLVHMVGSRITRLNASRALCVSLATAATVLWASLLGLP
FT                   VSTTHVAVGGVFGVGFYREWRDRRLAASHAPLPAEERRRRHLVRRSYMRMILGAWLVTV
FT                   PAAATLAAALVRIVGL"
FT   gene            complement(611932..612402)
FT                   /locus_tag="Pden_0635"
FT   CDS_pept        complement(611932..612402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0635"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: sit:TM1040_0668 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68747"
FT                   /db_xref="GOA:A1AZQ3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZQ3"
FT                   /protein_id="ABL68747.1"
FT                   /translation="MIIEFRERLARLIGRRPPDMQVAALCLNETTGDVLLVTSRGTGRW
FT                   IVPKGWPMPGRSLADAARQEAWEEAGVVGRVTETEIGRYHYDKDQDRGFAIPVEVRVFP
FT                   LYVDRLEREFPEAHERKRRWFTPEDAARMVAETGLKQLLRRLPAAKHRPAPE"
FT   gene            complement(612399..612830)
FT                   /locus_tag="Pden_0636"
FT   CDS_pept        complement(612399..612830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0636"
FT                   /product="Class I peptide chain release factor"
FT                   /note="PFAM: Class I peptide chain release factor; KEGG:
FT                   rsp:RSP_1366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68748"
FT                   /db_xref="GOA:A1AZQ4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZQ4"
FT                   /protein_id="ABL68748.1"
FT                   /translation="MLRINDQIAIEEWELSEQFTRSQGPGGQNVNKVETAVELRFEAER
FT                   SPHLAPPVKARLKRLAGRRWTQDGAVLIRAEETRSQARNRELARERLAELIRQALVAPR
FT                   KRIPTRPTLGSQRRRLAAKTQRGEVKATRGRIRDAEDPA"
FT   gene            complement(612897..614948)
FT                   /locus_tag="Pden_0637"
FT   CDS_pept        complement(612897..614948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0637"
FT                   /product="penicillin-binding protein 1C"
FT                   /note="TIGRFAM: penicillin-binding protein 1C; PFAM:
FT                   glycosyl transferase, family 51; penicillin-binding
FT                   protein, transpeptidase; Penicillin-binding domain protein;
FT                   KEGG: sil:SPO0135 penicillin-binding protein 1C"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68749"
FT                   /db_xref="GOA:A1AZQ5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZQ5"
FT                   /protein_id="ABL68749.1"
FT                   /translation="MRSRRFALSLMAAVLVLGIGAGARDRFDDWVDATALPRLEVPVGA
FT                   EVVARDGTLLRAFQVADGRWRLDAGPVDPLFLDMLLLWEDRRFPGHSGIDARALLRAGV
FT                   QALRHGRVVSGGSTLTMQAARLIEDGPTGQWAGKGRQMRLALALERRLGKREIMELYLR
FT                   LAPYGANVEGIRAASLQWFGKEPRRLTPAQAALLVALPQSPETRRPDRFPERATAARDR
FT                   VLARAARAGLISDADARAAMAEPVPRVRRAFPALAPLLAARLVREHPGALRIETTIDAR
FT                   LQRRAEELASRAVRGAGRRLSAAVVLADHRNGEILAEVGAADWTDGASAGFVDMARAWR
FT                   SPGSTLKPFVYGLAFDDGLAHPETLIEDRPTVFGRWQPQNFDHHFRGTVSLKNALIWSL
FT                   NIPVVKLADAVGPNRVTQALRRGGVELRLPGEVPGLAVVLGGAGVTLEGLAEGYAALAR
FT                   GGRGITLSALPGGGEERPAPMFGPVAAWQVGNILGQNPAPQGVRQRVLAYKTGTSYGHR
FT                   DALAVGFDGARVGAVWLGRPDGTPVPGAFGGDLAAPVLFDLFDALPSVALPPPPPQTLT
FT                   LPNSALPLPLRRFAPAGTASAMAARPAGPDALRLTYPPDGAEIDARGPLTAKARGGRGP
FT                   WTFLLNGAPAAIAQPQPLASLPNPGPGFAELTVVDADGASATAAIRLH"
FT   sig_peptide     complement(614877..614948)
FT                   /locus_tag="Pden_0637"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.848 at
FT                   residue 24"
FT   gene            complement(615033..616142)
FT                   /locus_tag="Pden_0638"
FT   CDS_pept        complement(615033..616142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0638"
FT                   /product="conserved hypothetical protein 1620"
FT                   /note="PFAM: conserved hypothetical protein 1620; KEGG:
FT                   sil:SPO3140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68750"
FT                   /db_xref="GOA:A1AZQ6"
FT                   /db_xref="InterPro:IPR006507"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZQ6"
FT                   /protein_id="ABL68750.1"
FT                   /translation="MAEPPKRRGPVLMEMGAEPQAPRSEPMPEPRTDQRDRKAPRAEWR
FT                   EGEPAPSPADAPMIDDGLAPPLPQPRTMQL