(data stored in ACNUC7421 zone)

EMBL: CP000490

ID   CP000490; SV 1; circular; genomic DNA; STD; PRO; 1730097 BP.
XX
AC   CP000490; AAIT01000000-AAIT01000037;
XX
PR   Project:PRJNA13020;
XX
DT   14-DEC-2006 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Paracoccus denitrificans PD1222 chromosome 2, complete sequence.
XX
KW   .
XX
OS   Paracoccus denitrificans PD1222
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales;
OC   Rhodobacteraceae; Paracoccus.
XX
RN   [1]
RP   1-1730097
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Munk A.C., Brettin T., Bruce D., Han C., Tapia R., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Lykidis A., Spiro S.,
RA   Richardson D.J., Moir J.W.B., Ferguson S.J., van Spanning R.J.M.,
RA   Richardson P.;
RT   "Complete sequence of Chromosome 2 of Paracoccus denitrificans PD1222";
RL   Unpublished.
XX
RN   [2]
RP   1-1730097
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Munk A.C., Brettin T., Bruce D., Han C., Tapia R., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Lykidis A., Spiro S.,
RA   Richardson D.J., Moir J.W.B., Ferguson S.J., van Spanning R.J.M.,
RA   Richardson P.;
RT   ;
RL   Submitted (04-DEC-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; f6da8ed13db9fea32ad9f5f42abb49ba.
DR   BioSample; SAMN02598290.
DR   EnsemblGenomes-Gn; EBG00001178127.
DR   EnsemblGenomes-Gn; EBG00001178128.
DR   EnsemblGenomes-Gn; EBG00001178129.
DR   EnsemblGenomes-Gn; EBG00001178130.
DR   EnsemblGenomes-Gn; EBG00001178131.
DR   EnsemblGenomes-Gn; EBG00001178132.
DR   EnsemblGenomes-Gn; EBG00001178133.
DR   EnsemblGenomes-Gn; EBG00001178134.
DR   EnsemblGenomes-Gn; EBG00001178135.
DR   EnsemblGenomes-Gn; EBG00001178136.
DR   EnsemblGenomes-Gn; EBG00001178137.
DR   EnsemblGenomes-Gn; EBG00001178138.
DR   EnsemblGenomes-Gn; EBG00001178139.
DR   EnsemblGenomes-Gn; EBG00001178140.
DR   EnsemblGenomes-Gn; EBG00001178141.
DR   EnsemblGenomes-Gn; EBG00001178142.
DR   EnsemblGenomes-Gn; Pden_R0055.
DR   EnsemblGenomes-Tr; EBT00001756320.
DR   EnsemblGenomes-Tr; EBT00001756321.
DR   EnsemblGenomes-Tr; EBT00001756322.
DR   EnsemblGenomes-Tr; EBT00001756323.
DR   EnsemblGenomes-Tr; EBT00001756324.
DR   EnsemblGenomes-Tr; EBT00001756325.
DR   EnsemblGenomes-Tr; EBT00001756326.
DR   EnsemblGenomes-Tr; EBT00001756327.
DR   EnsemblGenomes-Tr; EBT00001756328.
DR   EnsemblGenomes-Tr; EBT00001756329.
DR   EnsemblGenomes-Tr; EBT00001756330.
DR   EnsemblGenomes-Tr; EBT00001756331.
DR   EnsemblGenomes-Tr; EBT00001756332.
DR   EnsemblGenomes-Tr; EBT00001756333.
DR   EnsemblGenomes-Tr; EBT00001756334.
DR   EnsemblGenomes-Tr; EBT00001756335.
DR   EnsemblGenomes-Tr; Pden_R0055-1.
DR   EuropePMC; PMC3925955; 24517536.
DR   EuropePMC; PMC5107571; 27895629.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00435; ROSE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000490.
DR   SILVA-SSU; CP000490.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634481
CC   Source DNA and bacteria available from Stephen Spiro
CC   (stephen.spiro@utdallas.edu)
CC   Contacts: Stephen Spiro (stephen.spiro@utdallas.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1730097
FT                   /organism="Paracoccus denitrificans PD1222"
FT                   /chromosome="2"
FT                   /strain="PD1222"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:318586"
FT   gene            405..1751
FT                   /locus_tag="Pden_2833"
FT   CDS_pept        405..1751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2833"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: rsp:RSP_1342 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator, DnaA C-terminal domain; Chromosomal replication
FT                   initiator, DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2833"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70917"
FT                   /db_xref="GOA:A1B5X3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5X3"
FT                   /protein_id="ABL70917.1"
FT                   /translation="MDRLWGQAREELQKIVGTDSFSTWIEPLRLTGVADGTATIACPTR
FT                   FLSDWVSRHYSDDILKVLDRMGGPVQRLSFETRSQTARQAAAPVVKRPAPPRVSGEEEL
FT                   AAPLDSRFTFENFVVGKPNELAHAAARRVAEGGPVTFNPLFLYGGVGLGKTHLMHAIAR
FT                   EIQIRQPEARVLYLSAEQFMYRFVQALRDRTVMDFKELFRTVSVLMVDDVQFIAGKDST
FT                   QEEFFHTFNTLVDQGKQIVISADRAPGEIKDMEERIKSRLQCGLVVDLHPTDYELRLGI
FT                   LQSKTDSFRAQYPGLLIAPGVLEFLAHRITSNVRVLEGALQRLFAFASLMGREITLDMT
FT                   QECLADILRANDRKVSIEEIQRKVAEHYNIRLADMIGPKRVRTVARPRQIAMYLAKQMT
FT                   SRSLPEIGRRFGGRDHTTIMHGVKKIEELRGSDRSLSEDIDLLRRLLEA"
FT   gene            1843..2961
FT                   /locus_tag="Pden_2834"
FT   CDS_pept        1843..2961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2834"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sil:SPO0150 DNA polymerase III, beta subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2834"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70918"
FT                   /db_xref="GOA:A1B5X4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5X4"
FT                   /protein_id="ABL70918.1"
FT                   /translation="MKFSIERADLVKAVSQAQSVVERRNTIPILANVLIEAAPEGVSFR
FT                   ATDLDTEIVDRAPAQVERPGATTVSAGMLNDIARKLPDGALVQLSLDAASGRLSVQAGR
FT                   SNFSLATLPREDFPVMSSSEYGANFSAPAAVLRRLFDKSKFAISNEETRYYLNGVYMHV
FT                   AQTEDGPGLRCVATDGHRLARIDAPLPAGAEDMPGVIVPRKTVAELRKLLDDDEAEIAV
FT                   SVSETKVRFATPTITLTSKVIDGTFPDYSRVIPSGNARKLEVDAGDFAKAVDRVATVSS
FT                   ERSRAVKLSLDEDRLVLSVNAPDAGAADEELPVAYADEPLEIGFNAKYLHEIASQIERE
FT                   NAVFLFNGSGDAALIREGGDTSAVYVVMPMRV"
FT   gene            2958..4034
FT                   /locus_tag="Pden_2835"
FT   CDS_pept        2958..4034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2835"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: sit:TM1040_0003 DNA replication and repair
FT                   protein RecF; TIGRFAM: DNA replication and repair protein
FT                   RecF; PFAM: SMC domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2835"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70919"
FT                   /db_xref="GOA:A1B5X5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5X5"
FT                   /protein_id="ABL70919.1"
FT                   /translation="MTLSLLHLTQFRSWARLEIEADHRPVAIHGPNGAGKTNILEAVSM
FT                   LSPGRGMRGAAPGDQARKGPEVGWQIRAEIGTHQVLTRALPGQPREVVIDEKPSTQIAL
FT                   GRLMRVIWLTPAMDRLWTDAPEQRRRFLDRVTLSFTPGHAEDALGYEKAMRERNRLLRD
FT                   EVRDAGWYRALEAQMAETGAALTRNRLDAIARIMAAQEGAGTAFPSASLTLLPGEGSAD
FT                   DPDAESIAARLAEGRGRDMAAGRTLTGPHRADLGAHWGPQAMPAALSSTGEQKALLLSL
FT                   ILANARALAEESPVLLLDEVAAHLDADRRAALYDEICALRAQAWLTGTGPELFEALRGR
FT                   AQFLAVVREAEASRIMGI"
FT   gene            complement(4068..5861)
FT                   /locus_tag="Pden_2836"
FT   CDS_pept        complement(4068..5861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2836"
FT                   /product="Adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /note="KEGG: sit:TM1040_2799 adenine deaminase; TIGRFAM:
FT                   adenine deaminase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2836"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70920"
FT                   /db_xref="GOA:A1B5X6"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1B5X6"
FT                   /protein_id="ABL70920.1"
FT                   /translation="MNKETGMLKPWIEAQARLVEVAAGRAPADLVIRGGQWVNVHTREV
FT                   IPGMDVAVADGRVAYVGPDAGPSVGPGTQVIEADGRFMVPGLIDAHMHVESGMLTPAGF
FT                   AAAVIPHGTTTIFHDPHEIANVLGLEGVRLMRDESLLQPISMFTQMPSCAPSAPGLETT
FT                   GQPITEGEVAQAMGWDGIVGLGEMMNFPGVASGDRQMLTEIAATRAAGKTVGGHYASPD
FT                   LGRPFHAYVAGGANDDHETTTEAQGIARVRQGMGCMMRLGSAWYDVESQITAITEKGLD
FT                   PRFFILCTDDSHSGTLVNDGHMNRVVRHAVDCGCDPLVAIQMATINAASHFGLERELGS
FT                   ITPGRRADVILTSDLRSLPIETVIAQGVVVAETGKLLVDCPRIAWPEAARDSVHLGRSL
FT                   TGADFAVRATGDSARVRVIGVVENQAPTRALTAQLPIRDGVVEPQGETCHIALVERHRG
FT                   TGGVVNGFVSGFGYQGRMAVASTVAHDSHHMIVVGTDRDSMAAAANHLGRIGGGVTVFR
FT                   DGEELATVALPIAGLMSDRPAAEVAEAAQGIVKAMQDCGCTLNNAYMQHSLLALVVIPE
FT                   LRISDLGIVDVTRFELVDLMV"
FT   gene            5907..6635
FT                   /locus_tag="Pden_2837"
FT   CDS_pept        5907..6635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2837"
FT                   /product="DNA repair protein RecO"
FT                   /note="TIGRFAM: DNA repair protein RecO; PFAM:
FT                   Recombination protein O, RecO; KEGG: rsp:RSP_1678 DNA
FT                   repair protein RecO"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2837"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70921"
FT                   /db_xref="GOA:A1B5X7"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1B5X7"
FT                   /protein_id="ABL70921.1"
FT                   /translation="MEWSGEASVMALQRHGESAVILTVLSRETGLIRGLVPGGASAKRA
FT                   AMLQPGNRVSLRWRARLEEQLGTFAVEPARARPGLLGSGDALAGVNAVTALLTFALPER
FT                   DPHPRLADATEALLDLMDAGEGWAEAYLHWEMRLLDELGFGLDLTSCAVTGAREGLAYV
FT                   SPRSGRAVSAQAAGEWAPRLLPLPAMLGGRGNGGIEDALALTGHFLQVRLAEAHAGKPL
FT                   PPARARLVARLTASRHASGW"
FT   gene            complement(6604..6987)
FT                   /locus_tag="Pden_2838"
FT   CDS_pept        complement(6604..6987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2838"
FT                   /product="protein of unknown function DUF306, Meta and
FT                   HslJ"
FT                   /note="PFAM: protein of unknown function DUF306, Meta and
FT                   HslJ; KEGG: sil:SPO3197 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2838"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70922"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5X8"
FT                   /protein_id="ABL70922.1"
FT                   /translation="MRKLILALTLGLAACGAESDETAQIAGEYTLIAVEGVEVSGQPTL
FT                   RIAEDGAVSGQGPCNLFTGQNRAALPALDLGALATTRRACLQEGGEHAFFQALGAVREA
FT                   RREGDELVMTGPDVTIRWRAATQ"
FT   sig_peptide     complement(6928..6987)
FT                   /locus_tag="Pden_2838"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.875 at
FT                   residue 20"
FT   gene            complement(7020..7439)
FT                   /locus_tag="Pden_2839"
FT   CDS_pept        complement(7020..7439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2839"
FT                   /product="protein of unknown function DUF306, Meta and
FT                   HslJ"
FT                   /note="PFAM: protein of unknown function DUF306, Meta and
FT                   HslJ"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2839"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70923"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5X9"
FT                   /protein_id="ABL70923.1"
FT                   /translation="MTRIPMISAAIAATLGLAACEPASPPVPGSTIPTGPYVLVGIGSD
FT                   TVPQRNVGMTIGADGSISGRAPCNTYSASQSAEPPAFALGSLTRTEMACGGLAGRLESR
FT                   YFQALSAANGITFEGGVLTIKGPTYLTYEPGYRKE"
FT   sig_peptide     complement(7380..7439)
FT                   /locus_tag="Pden_2839"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.975 at
FT                   residue 20"
FT   gene            complement(7517..9172)
FT                   /locus_tag="Pden_2840"
FT   CDS_pept        complement(7517..9172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2840"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.-"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   rsp:RSP_1679 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2840"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70924"
FT                   /db_xref="GOA:A1B5Y0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="PDB:6ES9"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5Y0"
FT                   /protein_id="ABL70924.1"
FT                   /translation="MKDMPAMPADTPSALLALAGEALPELESLQSRATEALRALVAPAG
FT                   KPQPALLEQHQHAAHALSWLTTYVESIRQLSGWAGRLAEAGNLGRIEALILQIGLGEYL
FT                   GQIAGGIPMSQTEFARLSDLELDWQPGEAAAKLMRGNTAPARAELARLMQDNHGRATFG
FT                   ATGLDEDLEMIRDQFRRYAEERVIPNAHEWHLKDQLIPMEIIEELAELGVFGLTIPEEF
FT                   GGLGLSKASMVVVTEELSRGYIGVGSLGTRSEIAAELILCGGTEAQKAKWLPGLASGEI
FT                   LSTAVFTEPNTGSDLGSLRTRAVRDGEDWVVTGNKTWITHAQRTHVMTLLARTDPETTD
FT                   WRGLSMFLAEKEPGTDDDPFPTPGMTGGEIEVLGYRGMKEYELGFDGFRIKGENLLGGE
FT                   PGRGFKQLMETFESARIQTAARAVGVAQSAAEIGMRYAVDRKQFGKSLIEFPRVADKLA
FT                   MMAVEIMIARQLTYFSAWEKDHGRRCDLEAGMAKLLGARVAWAAADNALQIHGGNGFAL
FT                   EYAISRVLCDARILNIFEGAAEIQAQVIARRLLD"
FT   gene            9330..10103
FT                   /locus_tag="Pden_2841"
FT   CDS_pept        9330..10103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2841"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   sit:TM1040_2445 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2841"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70925"
FT                   /db_xref="GOA:A1B5Y1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5Y1"
FT                   /protein_id="ABL70925.1"
FT                   /translation="MFGLDPFHFWTAIAITLFSGFVKGAIGFAMPMIMLAALGSFLTAQ
FT                   QAVAAVILPVLVTNIRQALRGGWRPAWQASWAYRWHIGMVMLFIPVSAFFATRVPQWLM
FT                   YAIIGLPITAFALWQILGRSLVLPVHHRRRMEIATGVVGGLIGGVSGIWGPPLLVLLLS
FT                   LHAPKAEQMRVQGVVFFLGAAVLTVSHLQSGLLNAQTLPFSAILVIPALIGMGLGYLAH
FT                   DRLDVAQFRRWTLVLLVLTGANLLRRALELAGPAV"
FT   sig_peptide     9330..9479
FT                   /locus_tag="Pden_2841"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.721) with cleavage site probability 0.633 at
FT                   residue 50"
FT   gene            10132..11280
FT                   /locus_tag="Pden_2842"
FT   CDS_pept        10132..11280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2842"
FT                   /product="succinyldiaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /note="TIGRFAM: succinyl-diaminopimelate desuccinylase;
FT                   PFAM: peptidase M20; peptidase dimerisation domain protein;
FT                   KEGG: rsp:RSP_1128 succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2842"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70926"
FT                   /db_xref="GOA:A1B5Y2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1B5Y2"
FT                   /protein_id="ABL70926.1"
FT                   /translation="MTPIPDPAQLTARLIRCASVTPDEGGALVLLADVLGAAGFECHRV
FT                   DREGVPNLFARWGAQGARTFGFNGHTDVVPPGDPASWTHPPFSGHEAEGWIWGRGATDM
FT                   KSGVAAFAAAAIGFVTQTPPPDGAVILAITGDEEGPGKHGTRALLDWMAARGERMDVCI
FT                   VGEPSNPDRMGEMIKIGRRGSMTLQIEAHGIQGHAAYPHRARNPIHALLRLLHELTDAP
FT                   LDEGTEHFDPSGLQVTTVDCGNPASNVIPERARAVINIRFNDAHTAESLDRMIRARAAA
FT                   ISAETKVDFAISTDVSGESFLTAPGPFVDLVAGVVREETGLDPVLSTSGGTSDARFVKD
FT                   HCPVLEFGLVGHFMHQVDERVPADQVRQLARIYRRILERYFA"
FT   gene            11277..11696
FT                   /locus_tag="Pden_2843"
FT   CDS_pept        11277..11696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2843"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rsp:RSP_1127 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2843"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70927"
FT                   /db_xref="GOA:A1B5Y3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5Y3"
FT                   /protein_id="ABL70927.1"
FT                   /translation="MIEKTTDLATCRAIRHEVFVIEQAVPEAEEWDGRDGDAIHLLARD
FT                   ATGAAVGTARILIEGATGKIGRVAVLKSARGTGAGAALIRAALDELRALSGVTRAKLGA
FT                   QTHAIGFYEKLGFAAYGPEYDDVGIPHRDMAQDLG"
FT   gene            11693..12208
FT                   /locus_tag="Pden_2844"
FT   CDS_pept        11693..12208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2844"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2844"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70928"
FT                   /db_xref="GOA:A1B5Y4"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5Y4"
FT                   /protein_id="ABL70928.1"
FT                   /translation="MIRPELAEKLRPWAETGIALAATAFGLWVFSLGGWILWPIGATIA
FT                   GASALWALDARRRMRFRHDTLGPGMVELDEGAIRYLSPNRLLGGEIALRELAEIRLMRL
FT                   NGRRHWRLKSGDGQALLIPVDAAGAEHLAGAFATLPGIEMGRLASALAPDAPTIQTVWT
FT                   RPARARLT"
FT   gene            12258..13637
FT                   /locus_tag="Pden_2845"
FT   CDS_pept        12258..13637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2845"
FT                   /product="glutamate--cysteine ligase"
FT                   /note="TIGRFAM: glutamate--cysteine ligase; PFAM:
FT                   glutamate--cysteine ligase, GCS2; KEGG: sil:SPO3626
FT                   glutamate--cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2845"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70929"
FT                   /db_xref="GOA:A1B5Y5"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011556"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5Y5"
FT                   /protein_id="ABL70929.1"
FT                   /translation="MSIPQQGGGPIERPEQLAEYLASGEKPRESWRIGTEHEKFGYRHA
FT                   DLMPLPYEAPAGQPSVKAMLEGLQARFGWTPVLEAGHIIGLERDGANVSLEPGGQLELS
FT                   GAPLETIHQTCDEVNSHLAEVKAVADDLGAGFIGLGAAPIWTQDQMPMMPKGRYRLMTD
FT                   YMGRVGTLGTQMMYRTCTVQVNLDFASEADMVQKLRVALALQPVANALFANSPFLDGKP
FT                   NGWKSWRAHIWQNLDAARTGMLPFAFEDGFGYERWVDYVLDVPMYFVYRDGKYIDALGQ
FT                   SFRDFLNGRLPALPGEIPTLSDWADHLTTVFPEARVKKFIEMRGADGGPWRRLCALPAL
FT                   WVGLLYDQAAQDAAWDLVKGWDAETRESWRRGAGLKALDAEVNGTKMRDLAREVLAISE
FT                   AGLKARARTGSGGLVPDETHFLNTLKESVETGKVPADELLGKYHGEWAGDLSRIYAEYS
FT                   Y"
FT   gene            complement(13690..14103)
FT                   /locus_tag="Pden_2846"
FT   CDS_pept        complement(13690..14103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2846"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: jan:Jann_1905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2846"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70930"
FT                   /db_xref="GOA:A1B5Y6"
FT                   /db_xref="InterPro:IPR021273"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5Y6"
FT                   /protein_id="ABL70930.1"
FT                   /translation="MNTDIAPRPSVLDRIGATLAGIRDWLDERGKGAWIAAMILAFIAC
FT                   WPLGLAILGYMIWSKRMFSCRHRHHHGRHHCHGFNAPTGNTAFDAYREETLKRLEDEHR
FT                   EFLDFLQKLREAKDKAEFDQFMQNRNEPSAPQA"
FT   gene            complement(14216..14827)
FT                   /locus_tag="Pden_2847"
FT   CDS_pept        complement(14216..14827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2847"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: rsp:RSP_0014
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2847"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70931"
FT                   /db_xref="GOA:A1B5Y7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5Y7"
FT                   /protein_id="ABL70931.1"
FT                   /translation="MARSSYHHGNLRQALVEATVQLIEERGPQAFTLAEAARLAGVSAA
FT                   APYRHFAGREDLLEEVARQGFEEFADRLEAAFDEGRPRPLTAFLRMGQEYLTFAAERRG
FT                   FYMAMFEAGLSIAGNAGLSQASERARGILVRGAEALFAQLPAGRRPPPGMVADHIWALS
FT                   HGVVELFGRGKPGSRSPISPADMLESGALIYLRGLGVIRD"
FT   gene            complement(14837..15127)
FT                   /locus_tag="Pden_2848"
FT   CDS_pept        complement(14837..15127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2848"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: rsp:RSP_1686 putative
FT                   phosphocarrier HPr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2848"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70932"
FT                   /db_xref="GOA:A1B5Y8"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5Y8"
FT                   /protein_id="ABL70932.1"
FT                   /translation="MNDMTNGAVTRELAIINEKGLHARASAKFVETVERFDAQATVEKD
FT                   GISVSGDSIMGLLMLAAPRGSAIRVTVRGAQARELADALTALVEDYFGEGM"
FT   gene            complement(15124..15549)
FT                   /locus_tag="Pden_2849"
FT   CDS_pept        complement(15124..15549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2849"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: sil:SPO0714 PTS system IIA component, Man family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2849"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70933"
FT                   /db_xref="GOA:A1B5Y9"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5Y9"
FT                   /protein_id="ABL70933.1"
FT                   /translation="MIGIVIVAHGGLAREYLSAVEHVVGPQTGIKAVAIEENHDRGEKQ
FT                   AEICAAADAVDSGDGVVVVTDLFGGSPSNLSLMACAMRNRSILYGANLPMLVKLAKSRK
FT                   LPVADAVTLAKDAGRKYINSYDVLPADVLPIPKRAAS"
FT   gene            complement(15574..16533)
FT                   /locus_tag="Pden_2850"
FT   CDS_pept        complement(15574..16533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2850"
FT                   /product="Uncharacterized P-loop ATPase protein UPF0042"
FT                   /note="PFAM: Uncharacterized P-loop ATPase protein UPF0042;
FT                   KEGG: rsp:RSP_1684 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2850"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70934"
FT                   /db_xref="GOA:A1B5Z0"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1B5Z0"
FT                   /protein_id="ABL70934.1"
FT                   /translation="MPEAMTAMDSQDERAQRLVLVTGPSGAGRSTAINVLEDLGYEAID
FT                   NLPLSLIPRLLDGPARPMPLALGVDVRNRDFSVANLIELIDRLTRLPEYAPEVLFLDCT
FT                   TEQLLRRFNETRRRHPLRGEGSPLDAIRAERDMLGPIRARADVLVDTSELSPHDLKAEL
FT                   ARWFETEPGRRLTVSVQSFSYKRGVPRGVDMMFDCRFLANPHWRTELRPLDGRDSPVQQ
FT                   YVMADSRFDEFFRRVRDLVLFALPAHLEEGKAHLAIGFGCTGGRHRSVTMAEKMADALA
FT                   KAGWQVSIRHRELERREKAPAPGDEGHMRAARTAWAQG"
FT   gene            complement(16542..16970)
FT                   /locus_tag="Pden_2851"
FT   CDS_pept        complement(16542..16970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2851"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /note="KEGG: sil:SPO0712 HPr serine kinase/phosphatase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2851"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70935"
FT                   /db_xref="GOA:A1B5Z1"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5Z1"
FT                   /protein_id="ABL70935.1"
FT                   /translation="MILHASCIAYRDKGLLILGPSGAGKSTLALEMMAFGAALVADDRT
FT                   VLRSEGARIVADAPDSIRGRIEARGVGILHAAPHGPVEVVLAVDLGRPEADRLPPDRRL
FT                   DLLGRSMPLVLGAGRVHLASILLQYLAAGRADTDLRER"
FT   gene            17197..18795
FT                   /locus_tag="Pden_2852"
FT   CDS_pept        17197..18795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2852"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (ATP); KEGG:
FT                   rsp:RSP_1680 phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2852"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70936"
FT                   /db_xref="GOA:A1B5Z2"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1B5Z2"
FT                   /protein_id="ABL70936.1"
FT                   /translation="MTEPRVNPNCRLEDQGITGLGNVHYNLLEPALIDAAIQRGEGKLG
FT                   LGGTFLVSTGAHTGRSPKDKHVVRTPAVEDSIWWENNRPMEPEAFDRLHADMLEHMKGK
FT                   DYFVQDLYGGADPALRLDVRVVTELAWHGLFIRNLLRRPEASELAGFLPEFTIINCPSF
FT                   KADPARHGCRSETVIALNFDKKLILIGNTAYAGENKKSVFTLLNYILPEKGVMPMHCSA
FT                   NHALGNPNDSAIFFGLSGTGKTTLSADPSRTLIGDDEHGWSDNGIFNFEGGCYAKTINL
FT                   SAEAEPEIYATCFKFGTVIENMVYDPDTLELDFEDNSLTDNMRCAYPLEQISNASETSL
FT                   GGQPRNVIMLTCDAYGVLPPIARLTPAQAMYHFLSGFTSKTPGTEVGVTEPTPTFSTCF
FT                   GAPFMPRRPEVYGKLLQEKIAKTGAACWLVNTGWTGGAFGTGKRMPIKATRALLTAALD
FT                   GSLNDAQFRKDPNFGFEVPVSVPGVEDKLLDPRQTWTDGAAYDAQARKLVGMFSDNFAQ
FT                   YADKIDDDVRAAAIG"
FT   gene            complement(18955..21219)
FT                   /locus_tag="Pden_2853"
FT   CDS_pept        complement(18955..21219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2853"
FT                   /product="RNAse R"
FT                   /EC_number="3.1.-.-"
FT                   /note="KEGG: rsp:RSP_1126 exoribonuclease R; TIGRFAM: VacB
FT                   and RNase II family 3'-5' exoribonucleases; ribonuclease R;
FT                   PFAM: ribonuclease II; RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2853"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70937"
FT                   /db_xref="GOA:A1B5Z3"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5Z3"
FT                   /protein_id="ABL70937.1"
FT                   /translation="MAQLPSRQEILDWVSAHPDATAKRDIAKAFGIKGAERIELKRLLK
FT                   ELEAEGLLERRRRHYHDAERLPPVTVLQLLPPDRDGDIFAKPLEWQGEGPMPRILYAAL
FT                   KSDPAVAPGERILARLIETRGEDHDYQARLIRRIGTVQHRIVGIFRAATGGAEAGGRIL
FT                   PIDKGQDKEWQVRPGDVHGAKSGELVEAEQVGPRGRLGLPLARIVERLGDPSAPRAVSL
FT                   IAIHQHGIPDDFPDEVIAEADAARPATMKGREDLRHLPFVTIDPSDARDRDDAVAAEMH
FT                   EDGGATIWVAIADVAHYVRPGSALDREARNRGNSTYFPDRVVPMLPDILSSDLCSLHQG
FT                   VDRPVIAVRMRLDAQGDKTGHSFHRGMIRSAASLAYEQAQAAADGNPDEQTEPLVEPAI
FT                   RPLWHAYGLLRAARQRRQPLELDLPERRIVLTADGRVKSVNFRERYDAHRLIEEFMVLA
FT                   NVAAAEELERLRRPLLYRVHEEPTVEKLDALREVAEASGFTLAKGQVLQTRHLNRLLEQ
FT                   AEGSEFDELINMTALRSMQQAYYNPENFGHFGLALRSYAHFTSPIRRYSDLIVHRALVM
FT                   GHKWGNDGLSAQDIEMLSETAQHISETERRSMAAERDTTDRYLAAYLADRVGAEFTGRI
FT                   SGVQKFGAFVRLDETGADGLLPIREIGREYFHYDPEAQVLMGSETGLEIGIGQRVTVRL
FT                   TEAVPLTGGLMLELLELEGRPLPRGSAGGRGKGPMRKRATQARLAEIKRAQKRRRVRRQ
FT                   R"
FT   gene            complement(21264..21485)
FT                   /locus_tag="Pden_2854"
FT   CDS_pept        complement(21264..21485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2854"
FT                   /product="putative NAD-dependent formate dehydrogenase
FT                   delta subunit protein"
FT                   /note="KEGG: sme:SMc03086 putative NAD-dependent formate
FT                   dehydrogenase delta subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2854"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70938"
FT                   /db_xref="InterPro:IPR021074"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5Z4"
FT                   /protein_id="ABL70938.1"
FT                   /translation="MSHDHSKLIRMATQMAQFFTSQPDRPAPEAVAAHINESWSPRMRQ
FT                   DFVDQIRAGAEADPIVREAAAFVRLPAA"
FT   gene            complement(21492..22313)
FT                   /locus_tag="Pden_2855"
FT   CDS_pept        complement(21492..22313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2855"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase, subunit FdhD;
FT                   KEGG: rpd:RPD_0622 formate dehydrogenase family accessory
FT                   protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2855"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70939"
FT                   /db_xref="GOA:A1B5Z5"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5Z5"
FT                   /protein_id="ABL70939.1"
FT                   /translation="MRDVKAGVLRWDGGGDGRPGGWHPVEPPPAPQECPVAIVIDGMSQ
FT                   AVLMATPHDLRDFALGFALTEGLIASPGDVEGFEEAEVSAGGFPAREARLWLRPGLAAR
FT                   LAERRRSMIGPVGCGLCGVDSIEAALPQIVPVALGWSMPPGDVARAMAALTQGQVLRRE
FT                   TPAIHGAAFWDGDHAITREDVGRHNALDKLAGALAQAGLVAGQGAIVMSSRLSVDLVQK
FT                   AARIGAPILIGASAPTALALEWAERAGITVIARARGDGFDLYTHPRRIAGS"
FT   gene            complement(22318..25197)
FT                   /locus_tag="Pden_2856"
FT   CDS_pept        complement(22318..25197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2856"
FT                   /product="formate dehydrogenase alpha subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="TIGRFAM: formate dehydrogenase, alpha subunit; PFAM:
FT                   ferredoxin; 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: rsp:RSP_1080 NAD-dependent formate
FT                   dehydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2856"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70940"
FT                   /db_xref="GOA:A1B5Z6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5Z6"
FT                   /protein_id="ABL70940.1"
FT                   /translation="MKDFIIPDRDMGTPAVKSDVTVNLLVDGIPVSVPAGTSVMRAAAV
FT                   AGISVPKLCATDHVSAFGSCRLCVVQIDGMRGLPASCTTPVAEGMVVHTQTDEVAQVRK
FT                   GVMELYISDHPLDCLTCAANGDCELQDMAGAVGLREVRYEPGKNHFARRDAEGPNPEYR
FT                   PKDQSNPYFTFDPAKCIVCSRCVRACEEVQGTFALTIEGRGFDSRVSAGLASDDFLSSD
FT                   CVSCGACVQVCPTATLIENSVIQIGTPEHIVKTTCAYCGVGCSFDAHMRGEEVVRMVPS
FT                   KDGKANHGHSCVKGRFAWGYATHRERQTQPMVRERITDPWRVVSWDEALDFAATRLRQA
FT                   QADFGRDSIGVITSSRCTNEETYLVQKLARAVFHNNNTDTCARVCHSPTGYGLKTTFGT
FT                   SAGTHDFDSVDDTDLALVIGANPTDGHPVFASRLRKRLREGAGLIVLDPREIDLLKSPH
FT                   MGEGLHLPLRPGTNVAMLTAMAQVIVAEKLYDEAFIRERCDWDEFLAYAEFLMDPRHAP
FT                   EEVEKLARVPAELIRKAARAYAAAPRASIYYGLGVTEHSQGSTTVMAIANLAMMTGNIG
FT                   RPGTGVNPLRGQNNVQGSCDMGSFPHEYPGYRHVSDPETRAIYERIWGVELSPEPGLRI
FT                   PNMFDEALAGRFRGLYCQGEDIVQSDPDTRHVTSALSAMDIVIVQDLFLNETANYAHVF
FT                   LPGSSFLEKNGTFTNAERRINMVRRAMTPKNGYEDWEVTQLLANRMGAAWTYVHPREIM
FT                   AEIALTTPSFSGVSYDLLEREGSVQWPCNDKAPLGTPLMHIDGFVRGRGKFVHTEYVAT
FT                   EERTGARFPLLLTTGRILSQYNVGAQTRRTENVVWHPEDILEIHPSDAENRGVREGDWV
FT                   RLASRSGDTTLRAHITERVAPGVVYTTFHHPTTQANVVTTDNSDWATNCPEFKVTAVQV
FT                   SPSNGPSDWQEEYRHHSDLARRILPTAAE"
FT   gene            complement(25194..26735)
FT                   /locus_tag="Pden_2857"
FT   CDS_pept        complement(25194..26735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2857"
FT                   /product="formate dehydrogenase beta subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase domain,
FT                   51 kDa subunit; KEGG: rsp:RSP_1079 NAD dependent formate
FT                   dehydrogenase, beta subunit (51 kDa)"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2857"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70941"
FT                   /db_xref="GOA:A1B5Z7"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5Z7"
FT                   /protein_id="ABL70941.1"
FT                   /translation="MRVWVPLDAAARALGADEVAEALGREFTITRNGTRGMIWLEPLVE
FT                   VERDGVRYGYGPVAPEDAASVAEAIRSGGEHPLALGPVEELPWMKAQTRLTFARVGVID
FT                   PLSVSEYEAHGGLVGLSRAIEIGPERIVEEVTESGLRGRGGAGFPTGIKWKTVAGAKAA
FT                   RKYIVCNADEGDSGSFADRMLMEGDPLVLIEGMAIAGIATGAVQGYVYIRSEYPDAIRL
FT                   MEAAIGKARQAGILGQSVLGSAHAYDMEVRVGAGAYVCGEETSLLNSLEGKRGVVRAKP
FT                   PIPALEGFLGRPTVVNNVISLASVPWILSHGGAEYAKLGIGRSKGTIPIQIAGNVKYGG
FT                   LFEAAFGMSLGQIINEVGGGTASGRPVKAAQVGGPLGSYIPHWNFDVPFGYEELAGKEG
FT                   LLGHAGITVFDDTADMLKLARFAMEFCAVESCGKCTPCRIGSIRGVETIDRIAQGDETG
FT                   IAILTDLCNTMKWGSLCALGGFAPFPVMSALTHFPDDFSGRREPRAIIRSREAAE"
FT   gene            complement(26732..27211)
FT                   /locus_tag="Pden_2858"
FT   CDS_pept        complement(26732..27211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2858"
FT                   /product="formate dehydrogenase gamma subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone), 24 kDa
FT                   subunit; KEGG: gbe:GbCGDNIH1_1932 NAD-dependent formate
FT                   dehydrogenase gamma subunit (FdsG)"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2858"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70942"
FT                   /db_xref="GOA:A1B5Z8"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5Z8"
FT                   /protein_id="ABL70942.1"
FT                   /translation="MTSPATDADFLLRLDEIIAAHKGREGPLLPILHDLQAEWGYVPEE
FT                   AQPVLAEALGMTRAEVHGVVSFYHDFRDHPHGRHVLRLCRAEACQSMGAEALADEVRAA
FT                   LGIDWHETTPDGRLTLEPVFCLGLCACAPSAQMGERLIGRASLAKVQKLVAEAGA"
FT   gene            complement(27287..28159)
FT                   /locus_tag="Pden_2859"
FT   CDS_pept        complement(27287..28159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2859"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: rsp:RSP_1077 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2859"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70943"
FT                   /db_xref="GOA:A1B5Z9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B5Z9"
FT                   /protein_id="ABL70943.1"
FT                   /translation="MIDKLSMFMALAREKHFGRAAESLGITQPTLSSAIRALEEQLGVQ
FT                   LVRRGSRFQGLTPEGERVLGWARRIVADARAMQAEMQASRKGVSGLLRIGVIPTAMPRI
FT                   AELTGPFLRRHPNAGVSILSRSSDEIRDQIEALELDAGVTYLDSEPLGRVQSLPLYRET
FT                   YCLIDRSEMDGPADWAETATRPLCLLTPDMQNRRIVTRHLVEAGADAAPRVESTSMLAI
FT                   LSHVATGDWAAILPRALARGLPLPEGVRARDLTGNGHMVGLVVARREPHPPLVEALLRI
FT                   VSSIDTFNQ"
FT   gene            complement(28248..28487)
FT                   /locus_tag="Pden_2860"
FT   CDS_pept        complement(28248..28487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2860"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; KEGG: rsp:RSP_2127 component of
FT                   phosphoribosylformylglycinamidine (FGAM) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2860"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70944"
FT                   /db_xref="GOA:A1B600"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:A1B600"
FT                   /protein_id="ABL70944.1"
FT                   /translation="MKARVTIMLKDGVLDPQGEAIRHALGGLGFAGVSGVRQGKVIELD
FT                   LAATDADAAKAEVARMCEGLLANTVIEKYAVEIV"
FT   gene            complement(28499..29263)
FT                   /locus_tag="Pden_2861"
FT   CDS_pept        complement(28499..29263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2861"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: rde:RD1_2262
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   TIGRFAM: phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2861"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70945"
FT                   /db_xref="GOA:A1B601"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:A1B601"
FT                   /protein_id="ABL70945.1"
FT                   /translation="MAPRRKKIYEGKAKILYEGTEPGTLIQYFKDDATAFNAQKKATIE
FT                   GKGVLNNRLSEFFMTGLTNIGVPNHFIRRINMREQLVRQVEIIPLEVIVRNFAAGSISK
FT                   RLGMEEGTPLPRPIVEYSFKNDELGDPFVSEEYIIAFGWAAQQDLDDIVSLALRVNDFL
FT                   SGVFFGVGIKLIDFKIEVGRIWDGDFMRLVVADEISPDSCRLWDVKTGQKLDKDVFRRD
FT                   LGNLTDAYTEVARRLGLMPANTTSLTKPTLIN"
FT   gene            29411..29725
FT                   /locus_tag="Pden_2862"
FT   CDS_pept        29411..29725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2862"
FT                   /product="protein of unknown function DUF1476"
FT                   /note="PFAM: protein of unknown function DUF1476; KEGG:
FT                   sil:SPO1886 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2862"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70946"
FT                   /db_xref="InterPro:IPR009945"
FT                   /db_xref="InterPro:IPR038293"
FT                   /db_xref="PDB:2LL0"
FT                   /db_xref="PDB:2MDZ"
FT                   /db_xref="PDB:5DN6"
FT                   /db_xref="UniProtKB/TrEMBL:A1B602"
FT                   /protein_id="ABL70946.1"
FT                   /translation="MTTFDDRERAHEAKFAHDAELNFKAEARRNRLLGEWAAGLLGKTG
FT                   DDARAYALTVVTSDFDEPGDEDVFRKLAADLEGKADEETIRAKMVELRATAREQIISEI
FT                   "
FT   gene            complement(29772..31109)
FT                   /locus_tag="Pden_2863"
FT   CDS_pept        complement(29772..31109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2863"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: rsp:RSP_2204
FT                   multidrug efflux pump, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2863"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70947"
FT                   /db_xref="GOA:A1B603"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A1B603"
FT                   /protein_id="ABL70947.1"
FT                   /translation="MVEALPGQSGRRAKAEISNRRVLAIALPVVLSNATIPILGAVDTG
FT                   VIGQLGEAAPIGAVGLGAVILASIYWIFGFLRMGTSGLVAQAHGAGDEGESGAHLLRAL
FT                   GIGLAAGLVFILLQGSLFAAAFRLAPASAEVEALARQYLALRIWGAPAAISLYAITGWL
FT                   IAIERTRRVLVLQLLMNGLNILLDLWFVLGLGWGVRGVAGATLIAEWSGLALGLWFARH
FT                   ALHAAIQRAGLLARERIQELARVNGDIMIRSVLLQGSFTTFMFMAAGQGDVTLAANQVL
FT                   LQFLSIVAYGLDGFAFAAESLVGQAVGARRPDRLRRAAALSSAWGVAGAALLSAAFLLG
FT                   GPAIIDLLTTAPEVRAEAREFLPWLVAAPLVGIASWMLDGIFIGATRTREMRNAMLVTV
FT                   GIYAVLVVVLPPVFGNHGLWAALMGLNALRGLTMWRLYHRVEAAAA"
FT   gene            complement(31102..31605)
FT                   /locus_tag="Pden_2864"
FT   CDS_pept        complement(31102..31605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2864"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   rsp:RSP_2203 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2864"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70948"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1B604"
FT                   /protein_id="ABL70948.1"
FT                   /translation="MARRNESLDAIKTRRNNTLNALVSSVPYIRWLGIGFDRRGDELTA
FT                   VLPFDEKLIGNPMLPAIHGGVTAAFLEVTAIVELTWTAIWEDMEQGRIAPDAAVPESLP
FT                   RLPKTIDFTVDYLRSGLPRDAYARARVVRSGRRYASVHVEAWQDQRQKLFAQATGHFLM
FT                   PQDG"
FT   gene            complement(31607..32110)
FT                   /locus_tag="Pden_2865"
FT   CDS_pept        complement(31607..32110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2865"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: uncharacterized domain 1; PFAM:
FT                   thioesterase superfamily protein; KEGG: sil:SPO2911
FT                   thioesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2865"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70949"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1B605"
FT                   /protein_id="ABL70949.1"
FT                   /translation="MPAGFGLLPFRLHAKQEARGMSEPLPEDELEQRRRIARQFIEVIP
FT                   HARALGMRLDQLSPEGAEISLPWREDLVGDPRSGVIHGGVISALMDTCSGAAVMAHPAG
FT                   ARSTATIDLRIDYMRAATPGQTIRARANCYHITRSVAFVRAWAMDDDESRPVASATGAF
FT                   TVER"
FT   gene            32188..32604
FT                   /locus_tag="Pden_2866"
FT   CDS_pept        32188..32604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2866"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: rsp:RSP_2201
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2866"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70950"
FT                   /db_xref="GOA:A1B606"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A1B606"
FT                   /protein_id="ABL70950.1"
FT                   /translation="MSDSEYIGFKEMCARFDVTPRTLRYYEYIELLSPRKEGRSRFYGP
FT                   REIARMKLILRGRRFGFSLEDIRQWLLIYGEKGTREQYRVWIELADRQLEVLRQQRDEL
FT                   EASMTELLALRNETVSLLDGMGPTEDAGEAGKAG"
FT   gene            32576..33085
FT                   /locus_tag="Pden_2867"
FT   CDS_pept        32576..33085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2867"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG:
FT                   sit:TM1040_1556 transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2867"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70951"
FT                   /db_xref="GOA:A1B607"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A1B607"
FT                   /protein_id="ABL70951.1"
FT                   /translation="MPARPGKRAEPGADATFPLTRTSTRPIFRLVNEPDGRGSAMSDDL
FT                   LTIRQMCDAFEVTPRTLRFYEARELLFPQRRGQHRLYGRSDRARLTLILRGKRFGFSLE
FT                   QIRQLLELYDPAERNITQTEATLATARDRLADMERQHRELGEAIAELRQQIAEGEASLQ
FT                   NLKSDA"
FT   gene            33110..34888
FT                   /locus_tag="Pden_2868"
FT   CDS_pept        33110..34888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2868"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   rsp:RSP_2199 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2868"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70952"
FT                   /db_xref="GOA:A1B608"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1B608"
FT                   /protein_id="ABL70952.1"
FT                   /translation="MTIYSAPIRDMQFVLHDVLDISNQDLPGYGDLDRDFTQAVLEASG
FT                   KLASEVLAPLNAVGDREGCRLENGVVHTPKGFLEAFEQMREGGWTALDCDPEYGGQGMP
FT                   YVIGLAAGEMFSASNMAFTMYQGLTHGAYSAIHAHGTDQQKATYLPRMVSCEWTGTMNL
FT                   TEPHAGTDLGLLRTKAEPQEDGSYLITGQKIFISAGDHDMAQNVIHLVLAKAPGGGEGT
FT                   RGISLFIVPKFLVNEDGSPGERNALSVGNLEEKMGIHGNATCVMNYDGAKGWLLGELHK
FT                   GMRAMFTMMNEARIGVGLQGYSVAEAAYQNAVAYARDRLQGRAVTGDANPSGPADPLIV
FT                   HPDIRRNLMDQKSFLEGARALAFWGAHLIDRAVLADDKEAHDLVSLLTPVIKGFLTDKG
FT                   FETAVQAQQVFGGHGYIEEQGMSQFVRDARITMIYEGANGVQALDLVGRKLAAEGGKPI
FT                   MAFFELIRSEIKAHEGDEALKADFLDPLKAASKDLQSAAMFFMEQGMKDPNAALAGSYD
FT                   FMHLFGHAALGLMWTRMAVAARAALAAGTEDPAFHEAKLATGRYYMARQLPMTAAHLAR
FT                   IRSGAEPVMALAADRF"
FT   gene            35165..35806
FT                   /locus_tag="Pden_2869"
FT   CDS_pept        35165..35806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2869"
FT                   /product="Glutathione S-transferase, N-terminal domain"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   Glutathione S-transferase, C-terminal domain; KEGG:
FT                   sit:TM1040_1560 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2869"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70953"
FT                   /db_xref="GOA:A1B609"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A1B609"
FT                   /protein_id="ABL70953.1"
FT                   /translation="MTAQLHCFGESGHSYKVALMMQLTGHPWQPVFVDFFGGATRGAEY
FT                   RQLNEMGEAPVFVEDGLTLTQSGVILLHLAEQTGRFMDGDQGEILRWLFWDNHKGSSQF
FT                   GALRFLMNFLPPEKRPAEVIAWLQGRCKAALKTLDGHLAARGWLAGDQATIADLSCCSY
FT                   LYYPEPFGFDRAEWPHIDAWLSRIQALPGWKHPYDLMPGNPADRAAKEDA"
FT   gene            35803..37014
FT                   /locus_tag="Pden_2870"
FT   CDS_pept        35803..37014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2870"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: sil:SPO2918 acetyl-CoA
FT                   acyltransferase/thiolase; TIGRFAM: acetyl-CoA
FT                   acetyltransferases; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2870"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70954"
FT                   /db_xref="GOA:A1B610"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1B610"
FT                   /protein_id="ABL70954.1"
FT                   /translation="MTEAYIYDAARTPRGKGRPDGSLHEVTSVALSARLLNAVKERNGL
FT                   TGHAVEDVIWGNVTQVKEQGGCLARSAVLESDLDESIPGLAINRFCASGMEAVNLAANQ
FT                   VRGGAGQAYIAGGVEMMGRVAMGSDGAAIAVDPSLTFKTYFVPQGISADIIATEYGFSR
FT                   EDADSLAVESQRRAAIAWDEDRFARSIVPVRDQNGLTILDRDEYMRPGTTLEDLAKLKA
FT                   SFKEMGETMPGFDKVAMLKYPHLGRIEHIHHAGNSSGIVDGAAAVLIGNAEFGKAYGLK
FT                   PRARIRATAKIGTDPTIMLTGPVPVTEKILKDSGMAISDIDLFEVNEAFASVVLRFMQA
FT                   FQVDPGVVNVNGGAIALGHPLGATGAIIIGTLLDELERQDKTVGLATLCIASGMGAATI
FT                   IERV"
FT   gene            37026..39209
FT                   /locus_tag="Pden_2871"
FT   CDS_pept        37026..39209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2871"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD-binding; KEGG:
FT                   rsp:RSP_2196 enoyl-CoA hydratase / 3-hydroxyacyl-CoA
FT                   dehydrogenase / 3-hydroxybutyryl-CoA epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2871"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70955"
FT                   /db_xref="GOA:A1B611"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1B611"
FT                   /protein_id="ABL70955.1"
FT                   /translation="MTDFTMQKDADGVAIVTWDVPGKSMNVLSLDGAAELNALIDDALA
FT                   DEAVKGIVITSGKKDFAAGMDLNVIAGMRQGGAQAVFDGVMTLHHLLRKIELAGMDPKT
FT                   KKGGKPIAAALPGTALGIGLELPLATHRIFAAENPKAKIGLPEIMVGIFPGAGGTTRLV
FT                   RKLGAMGAAPFLLEGKLSDPARAKSAGLIDEVVADPVAAAREWVLKAADADLVKPWDAK
FT                   GYKMPGGEPYHPAGFMTFVGASAMVHGKTLGVYPAAKALLSAVYEGAMVPFDTALKIEA
FT                   RWFTHVLMNPSSTAMIRSLFINKEALEKGANRPEAPDQSVRKVGILGAGMMGAGIAYVS
FT                   AMAGIKVVLIDSTQEAAERGKSYSTGLLDKAISRRKSTEEKKAEVLSRITATTDYAALA
FT                   GCDLIVEAVFEDPKVKAEVTKRAEAVIPQDAIFATNTSTLPISELAKASARPDQFIGIH
FT                   FFSPVDKMLLVEIIKGRETGPRAVAKALDFVRQIRKTPIVVNDARFFYANRCIIPYINE
FT                   GIRMVAEGVSPTLIENAAKMMGMPLGPLQLVDETSIDLGVKIAKATKAAMGDAYPDGAV
FT                   DAVIFKLADQGRLGRKTKAGFYDYDDAGKRQGFWSGLASEWPEADTQPDLTEIQHRLMF
FT                   AQSLEAVRALEEGVLEDIREGDVGAILGWGFAPWSGGPFGWLDMLGAPRAAGIADSLAE
FT                   KFGPRFAAPQLLRDMAAKGESFYGRFGAGKQAA"
FT   gene            complement(39349..40356)
FT                   /locus_tag="Pden_2872"
FT   CDS_pept        complement(39349..40356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2872"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: jan:Jann_1671 PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2872"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70956"
FT                   /db_xref="GOA:A1B612"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1B612"
FT                   /protein_id="ABL70956.1"
FT                   /translation="MTTPYVIGIGNAVMDVIAPTSDASLDRLRIEKGIMQLIDRERSEF
FT                   LMAAQSADADAAKARLVPGGSVANTLAGLGMLGLRTAFIGRVAGDPLGLSYAEQTEQQG
FT                   TVFVNPPVAGEVLPTSRSIIFVTPDGERSMNTYLGISAELGAEDVNPATFSGADWLFLE
FT                   GYLFDKDAGKAAFLKAADACHKAGGQAGIALSDPFCVDRHRADFRRLVAGPMDYVIGNI
FT                   HEWQSLYQVEDLEEALRLASADCGTVICTRSGEDAILIRGDERVTAPVHRVVPVDATGA
FT                   GDQFAAGLIYGLAIGADLAAAGRMGCIAAAEVISHVGARPESDLRAAFRAEGLV"
FT   gene            complement(40353..41021)
FT                   /locus_tag="Pden_2873"
FT   CDS_pept        complement(40353..41021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2873"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: rsp:RSP_1031 endonuclease III; TIGRFAM:
FT                   endonuclease III; PFAM: helix-hairpin-helix motif; HhH-GPD
FT                   family protein; SMART: iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2873"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70957"
FT                   /db_xref="GOA:A1B613"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A1B613"
FT                   /protein_id="ABL70957.1"
FT                   /translation="MARSTFSRLPPALPYATQVAIFSRFREANPHPVTELEYTNAFTLL
FT                   VAVALSAQATDVGVNKATKSLFQRVSTPQEMLELGVEALTEQIKTIGLYRQKAKNVIAL
FT                   SRRLVEEYGGEVPQSRAALMTLPGVGRKTANVVLNSVFDFPAQAVDTHIFRVGNRTRIA
FT                   PGRDVEEVERAIEDNVPVPFQQNAHHWLILHGRYICQARRPRCRICPIEDLCPYEEKTE
FT                   "
FT   gene            41122..41718
FT                   /locus_tag="Pden_2874"
FT   CDS_pept        41122..41718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2874"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase; KEGG: sit:TM1040_2450 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2874"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70958"
FT                   /db_xref="GOA:A1B614"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A1B614"
FT                   /protein_id="ABL70958.1"
FT                   /translation="MTQTFFTFAQPQPGLRVSITTQPAQDLGAVLCRGRFATPLGTVVA
FT                   MGAGGALWGLGFAGAMSEDQVEADLAARWPRARLVEASEALAPSIQALLAGEGVITVHL
FT                   TGTEFQLQVWRALVTVPPGQVISYATLAERIGRPNALRAVGTAVGQNPVSWAIPCHRVT
FT                   RTGGRIGGYHWGEAVKRALLVREGASIAPRTIAAL"
FT   gene            41880..42527
FT                   /locus_tag="Pden_2875"
FT   CDS_pept        41880..42527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2875"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: rde:RD1_0967
FT                   OmpA family domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2875"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70959"
FT                   /db_xref="GOA:A1B615"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR027367"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A1B615"
FT                   /protein_id="ABL70959.1"
FT                   /translation="MKTRISLLLASAGLIAISACTPADPYGQPQQTSRTQQGAIAGAVV
FT                   GGLIGAGESRSNAVKGAIIGATAGAVGGSILDQQQRSLQQSLNNPNIQIVNHGTHLSVV
FT                   MPESTLFATDSAAVGAQGQNDLYTIARNLTQYPNSRIQIVGHTDSTGSAAYNQDLSERR
FT                   ARSVAGILTAGGVAQSRVTTLGRGATQPVASNDTAAGRAQNRRVEILITPTR"
FT   sig_peptide     41880..41963
FT                   /locus_tag="Pden_2875"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.644 at
FT                   residue 28"
FT   gene            complement(42697..43251)
FT                   /locus_tag="Pden_2876"
FT   CDS_pept        complement(42697..43251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2876"
FT                   /product="H+-transporting two-sector ATPase, B/B' subunit"
FT                   /note="PFAM: H+-transporting two-sector ATPase, B/B'
FT                   subunit; KEGG: rsp:RSP_1035 FoF1 ATP synthase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2876"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70960"
FT                   /db_xref="GOA:A1B616"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1B616"
FT                   /protein_id="ABL70960.1"
FT                   /translation="MKRLSVLFALVASPALAASGPFFSLRNTDFIVTLAFLLFVGILVY
FT                   FRVPQIVGGLLDKRAEGIRNDLAEARRLREEAQEIYASYERRQREVKSQADDIVANAKR
FT                   EAVAEAEKAKKALQLSIERRLKAAEEQIAGAEAEAVRAVRDRAIQTAIAAATEILGKQA
FT                   SPAERSAGIDKAIDEVAQRLN"
FT   sig_peptide     complement(43198..43251)
FT                   /locus_tag="Pden_2876"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 18"
FT   gene            complement(43248..43895)
FT                   /locus_tag="Pden_2877"
FT   CDS_pept        complement(43248..43895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2877"
FT                   /product="H+-transporting two-sector ATPase, B/B' subunit"
FT                   /note="PFAM: H+-transporting two-sector ATPase, B/B'
FT                   subunit; KEGG: rde:RD1_1324 ATP synthase F0, B' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2877"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70961"
FT                   /db_xref="GOA:A1B617"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:A1B617"
FT                   /protein_id="ABL70961.1"
FT                   /translation="MFSLLQQTAPVVVEESETVIITESAEAAGHGADAAHAVAGAADAA
FT                   HGASAPGMPQLDFTTFGNQIFWLLVILAVIYWVLSRIALPRIGGVISDRQGAITGDLMA
FT                   AEEFKQKAKEAEAAYDKALADARAEAGKIVAANKAEIQKELDAAIAHADAEIAARAAES
FT                   ETRIGEIRASAVEDARSVARDVTAALVENFGGKLDQSLVDAAVDQRLKGALQ"
FT   gene            complement(43975..44208)
FT                   /locus_tag="Pden_2878"
FT   CDS_pept        complement(43975..44208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2878"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /note="PFAM: H+-transporting two-sector ATPase, C subunit;
FT                   KEGG: jan:Jann_0768 H+-transporting two-sector ATPase, C
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2878"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70962"
FT                   /db_xref="GOA:A1B618"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="PDB:5DN6"
FT                   /db_xref="UniProtKB/TrEMBL:A1B618"
FT                   /protein_id="ABL70962.1"
FT                   /translation="MENLGQLGQYLGAGLACVGMAGAAMGVGNVAGNYLAGALRNPSAA
FT                   ASQTATLFIGMAFAEALGIFSFLVALLLLFAV"
FT   sig_peptide     complement(44128..44208)
FT                   /locus_tag="Pden_2878"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.798) with cleavage site probability 0.769 at
FT                   residue 27"
FT   gene            complement(44268..45014)
FT                   /locus_tag="Pden_2879"
FT   CDS_pept        complement(44268..45014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2879"
FT                   /product="ATP synthase F0 subcomplex A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+-transporting two-sector ATPase, A subunit; KEGG:
FT                   sil:SPO3236 ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2879"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70963"
FT                   /db_xref="GOA:A1B619"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="PDB:5DN6"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1B619"
FT                   /protein_id="ABL70963.1"
FT                   /translation="MAEEEAGGLVFHPMDQFVIKPLFGEGPVNWYTPTNATLWMALAAL
FT                   AITALLVFGTRGRAIVPNRVQSIAELLYGMVHKMVEDVTGKDGLKYFPYVMTLFCFILF
FT                   ANFLGLLPKSFSPTSHIAVTAVLAVLVFAGVTVLGFVKNGAHFLGLFWVSSAPLALRPV
FT                   LAVIELISYFVRPVSHSIRLAGNIMAGHAVIKVFAAFAAVAAIAPVSVVAITAMYGLEV
FT                   LVCLIQAYVFTILTCVYLKDALHPAH"
FT   gene            complement(45017..45358)
FT                   /locus_tag="Pden_2880"
FT   CDS_pept        complement(45017..45358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2880"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sit:TM1040_2595 ATP synthase F0, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2880"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70964"
FT                   /db_xref="GOA:A1B620"
FT                   /db_xref="InterPro:IPR016989"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:A1B620"
FT                   /protein_id="ABL70964.1"
FT                   /translation="MAEDDHDATRARDAERLRALEARLGEKAGEKPPSRGEEHFSQANM
FT                   AWRMVTELVAGLALGFGIGFGLDYLTGLRPVFMVVFVLLGLAAGIRTMMRTANEIGKAP
FT                   GRPGDDKGE"
FT   gene            45545..45901
FT                   /locus_tag="Pden_2881"
FT   CDS_pept        45545..45901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2881"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: sil:SPO3238
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2881"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70965"
FT                   /db_xref="GOA:A1B621"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B621"
FT                   /protein_id="ABL70965.1"
FT                   /translation="MPAQQPSLDAIFSALADPTRRAILGMLLEDDMAVTDVAAPFEMSL
FT                   AAISKHLAVLAAAGLIRQERRGRIIWCKLEPDGLRNASVWMQGFGQFEPVDLDDFERFL
FT                   REALPLADGDDAQP"
FT   gene            complement(45967..47568)
FT                   /locus_tag="Pden_2882"
FT   CDS_pept        complement(45967..47568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2882"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="PFAM: metallophosphoesterase; 5'-Nucleotidase domain
FT                   protein; KEGG: sit:TM1040_1548 5'-nucleotidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2882"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70966"
FT                   /db_xref="GOA:A1B622"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:A1B622"
FT                   /protein_id="ABL70966.1"
FT                   /translation="MKRWLMVSAAIVALSSGAAQADYTLHVLHINDFHSRIEPINAFDS
FT                   TCDAETEAKGECFGGVARLATKIRELRDGLKADGQNVIVLDAGDQYQGSLFYTTYKGKD
FT                   TVEFMNAIGFDAMAVGNHEFDDGPQGLQILVEGVTFPVVSGNLDLSQSPELKDKVGDVL
FT                   VLDVGGEKVGIVSALAMDTPETAAPGDKVIFMDDMDSLKADVQELTDQGVDKIIALTHS
FT                   GFKRDQEFAAEVAGIDAVIGGHSHTLLGQVEGAAGPYPTMVKGADGAEVPVATAYAYGK
FT                   YLGHLVLTWDDEGKLVKAEGQPILLDGSVVPDEKLAARVKEMAAPIEQLKQKRVAEIAA
FT                   PIDGSRETCRAQECEMGSLVADAMLARVKDQGITIAIQNGGGLRASIPAGVVTMGDVLS
FT                   VLPFQNTLSTFQLKGADVVEALENGASQIEEGAGRFAQVAGLKYTLDPSAPAGSRISDV
FT                   QVRDGSEWVPIDREAVYGVVSQNYMRAGGDGYKVFAEHAMNAYDFGPDLADVLAEHLAR
FT                   QGPDFTPKLDGRITVK"
FT   sig_peptide     complement(47503..47568)
FT                   /locus_tag="Pden_2882"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.965 at
FT                   residue 22"
FT   gene            47660..48034
FT                   /locus_tag="Pden_2883"
FT   CDS_pept        47660..48034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2883"
FT                   /product="protein of unknown function DUF952"
FT                   /note="PFAM: protein of unknown function DUF952; KEGG:
FT                   rsp:RSP_0956 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2883"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70967"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:A1B623"
FT                   /protein_id="ABL70967.1"
FT                   /translation="MPLDGPHPATHEPAMLVYKIFRAAEFQAFQRQGRSAGAPVDLADG
FT                   YVHLSTAAQLPGTLARHFAAEDGLHLLALDGDALPELRWEPSRGGDLFPHLYRELRMDD
FT                   VLWSRALPLGPGGHDIGDIA"
FT   gene            48031..49089
FT                   /locus_tag="Pden_2884"
FT   CDS_pept        48031..49089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2884"
FT                   /product="dihydroorotate oxidase A"
FT                   /EC_number="1.3.98.1"
FT                   /note="PFAM: dihydroorotate dehydrogenase; KEGG:
FT                   sil:SPO2907 dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2884"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70968"
FT                   /db_xref="GOA:A1B624"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1B624"
FT                   /protein_id="ABL70968.1"
FT                   /translation="MTPIERLGLAALHRLDPERAHDLSILALRHGLVPLPGRPVTSDRL
FT                   RIRISGLDLPNPVGLAAGYDKNARALPALMRAGFGFVEIGAATPRPQPGNPRPRLFRLT
FT                   PDRAIINRFGFNNEGAQAIADRLAQRPAGIPVGLNIGANKDSADRSADFAQVVRIAGAH
FT                   ADFLTVNVSSPNTEKLRDLQGPEALSALLQGVLAARDALPNRPPVFIKIAPDLDDTALA
FT                   DIAAVALAAPVDAIIATNTTLSRDGLASPHANEAGGLSGAPLFDRATRILARLYRETGG
FT                   RVPLIGVGGIGSAEQAWQKLRAGASAVQIYSALVYQGFSLAAQIARDLDERLARENVTL
FT                   AELTGSGNADWL"
FT   gene            complement(49086..49925)
FT                   /locus_tag="Pden_2885"
FT   CDS_pept        complement(49086..49925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2885"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="KEGG: rsp:RSP_2481 serine acetyltransferase;
FT                   TIGRFAM: serine O-acetyltransferase; PFAM: transferase
FT                   hexapeptide repeat containing protein; serine
FT                   acetyltransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2885"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70969"
FT                   /db_xref="GOA:A1B625"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A1B625"
FT                   /protein_id="ABL70969.1"
FT                   /translation="MNLQKDMIEPLSDARDAPRDSVWGRIQREARVAVRDEPLLGALIH
FT                   AGLLHHATFEAALAYRFSLKLASREMSEQILREIADDAFARAPELSAAAQADLLAVYER
FT                   DPATHRLMQPILFFKGYQALQAYRIGHWLWQQGRRDMAYFVQMRCSEVFGVDIHPAAKI
FT                   GTGVMIDHAHSIVIGETAVVGNDVSMLHSVTLGGTGKEDGDRHPKIGNGVMIGAGAKVL
FT                   GNIRVGHHSRIAAGSVVLAEVPPCKTVAGVPARIVGDAGCSDPSNTMNQLLGHEDLF"
FT   gene            complement(49990..50712)
FT                   /locus_tag="Pden_2886"
FT   CDS_pept        complement(49990..50712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2886"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: jan:Jann_1647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2886"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70970"
FT                   /db_xref="InterPro:IPR021251"
FT                   /db_xref="UniProtKB/TrEMBL:A1B626"
FT                   /protein_id="ABL70970.1"
FT                   /translation="MPENTTANCALPLLMPAQAQKHVTVNEALMRLDGQVDLVLQSLTR
FT                   ITPPETVVDGLCWGVPQGAVNAWEGQGGKIAIGANGGWIFVQPGFGRRAVVADQGVVAI
FT                   HGGAGWVPGAVTLGQHGSGLLARQLLEDVTLGAGAWFETAMAIPPGALVIGAAARVQEA
FT                   ITGSAASWSLGTVGDAGSLARFGQGLGKAQGSWARGVLSPPMAFWEPTPLRLTAVGGQF
FT                   AGGKVRVVLHWWELRLPD"
FT   sig_peptide     complement(50647..50712)
FT                   /locus_tag="Pden_2886"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.662) with cleavage site probability 0.557 at
FT                   residue 22"
FT   gene            complement(50705..54595)
FT                   /locus_tag="Pden_2887"
FT   CDS_pept        complement(50705..54595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2887"
FT                   /product="putative phage host specificity protein"
FT                   /note="KEGG: rsp:RSP_2479 putative phage host specificity
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2887"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70971"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025195"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="UniProtKB/TrEMBL:A1B627"
FT                   /protein_id="ABL70971.1"
FT                   /translation="MATILLAAVGASLGAGFGGTVLGLSGAVIGRAVGATLGRVIDQRL
FT                   LGGGSKAVETGRVDRMRIQTAGEGTPIPRLWGQMRVPGHAIWAGPLVETRRSHGGGKGS
FT                   GPRVTEIGYRLSFALALCEGPILGVGRIWADGEEISADDLDMRVYPGDEAQLPDPAIAA
FT                   QEGDAAPAYRGIAYVVFEDLALERWGNRVPQLSFEVTRAARDGRGLSREVQAVAMIPGT
FT                   GEYSLATTAVSYDLGLGEMQVANRNTALAPTDFLASMRILGRELPNVGSVSLVVSWFGD
FT                   DLRVGECAVRPKVEDLSRDGQGMAWRAGGIGRNGAAEVARVDGRPIYGGTPADGSVIEA
FT                   LRAIAGSGRKAVFYPFILMEQLAGNGRPDPWSGAADQPVMPWRGRITTSIAPGQAGSPS
FT                   GTAAAEAEVARFFGTAEAADFSRDGLTIRYDGPDEWSYRRFILHYAHLCAAAGGIDAFL
FT                   IGSEMVGLTTIMAAGHSFPAVAQLRRLAADVRAILGEGVRIGYAADWSEYFGHHPGNGD
FT                   VHFHLDPLWADENIDLIGIDNYMPLSDWREGEEHLDAHWGRIDDPAYLRANVAGGEGYD
FT                   WYYASEADRQAQRRTEIRDGAHHEHWVWRYKDIRGWWRNAHHDRIGGVRQALPTAWVPR
FT                   SKPVWFTEMGCAALDKGTNQPNKFLDAMSSESMLPYFSDGRRDDGIQAAYVRAMTGFWS
FT                   DPANNPARAAFGRTGAGRMIDMGRAHVWCWDARPYPAFPARTDLWSDGPAWERGHWLNG
FT                   RAGAVPLADVVAEICREAGVRAFDAEGLRGLVRGYVLSGAETGRAALQPLMLAHGFDAV
FT                   ERDGVLRFVMRGARVDAELGPGDMALAEEVDAVEVSRAADAEMVGRIRLTHVEAGGDYA
FT                   ARTAETAMPGAEFLAVSDSELAMALTRGEGRALAERWLSEAAVARDAVRFALPPSLGHL
FT                   GPGDVVRLVEPGVEARRWRIDRTERAGAITVDAVRVEPGVYRPARVVEGEAALRPFVPP
FT                   IPVWPVFLDLPLLRGDEVAHAPHLAVTATPWPGAAAVWASTEEAGGYALNTTLAEPSAM
FT                   GRTEGPLAAARPGVWDRGPPLRLRVKGGNLRSAGVEALMAGANLLAIGDGSAEGWELLQ
FT                   FAEARLVSAGLWEISLRLRGQAGTDAFMPAVWPAGSVVVVLDGAAQQVELAPSARNQLR
FT                   HWRIGPATRSPDDASHRHVAAAFRGAGLRPLSPCHIAVSGRVVTWIRRTRVQGDGWDGP
FT                   DVPLGEAQERYAARLVRDGQVLAEAVVAEPRWAVPEGVWSQAIAGGGFAVEVAQLSDTF
FT                   GPGPFARRMIDA"
FT   sig_peptide     complement(54524..54595)
FT                   /locus_tag="Pden_2887"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.664 at
FT                   residue 24"
FT   gene            complement(54614..55039)
FT                   /locus_tag="Pden_2888"
FT   CDS_pept        complement(54614..55039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2888"
FT                   /product="putative phage cell wall peptidase, NlpC/P60
FT                   family"
FT                   /note="TIGRFAM: putative phage cell wall peptidase,
FT                   NlpC/P60 family; PFAM: NLP/P60 protein; KEGG: rde:RD1_3017
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2888"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70972"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR011929"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1B628"
FT                   /protein_id="ABL70972.1"
FT                   /translation="MSAVVVQAARAWIGTPYVHQGSVRGAGTDCLGLVRGIWRELCGAE
FT                   PEGMPAYTPDWGEVGGAELLLGGAERQLLPAPDERPGDVLVFRMRAGAIAKHMGILAET
FT                   GERASFVHAYDRHGVVESPLSTPWRARIAGRFRFPAA"
FT   gene            complement(55036..55854)
FT                   /locus_tag="Pden_2889"
FT   CDS_pept        complement(55036..55854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2889"
FT                   /product="phage conserved hypothetical protein BR0599"
FT                   /note="KEGG: sit:TM1040_1070 phage conserved hypothetical
FT                   protein BR0599"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2889"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70973"
FT                   /db_xref="InterPro:IPR011928"
FT                   /db_xref="InterPro:IPR018964"
FT                   /db_xref="InterPro:IPR019228"
FT                   /db_xref="UniProtKB/TrEMBL:A1B629"
FT                   /protein_id="ABL70973.1"
FT                   /translation="MSGTIARAWAVRRCDGLVLGFTDHDRALSFEGIAFRPDSGLSARA
FT                   VVQGLGLSVDNSEAVGALSDAAITERDLMAGRWDAADVRLWEVDWSDAANRRLIFRGHL
FT                   GEVVRSGAAFRAELRGLSEPLNRAQGRVYHPRCAAVLGDGLCRFDLTRAGYSAEGVVVL
FT                   EEGDRLELSGVAGHDAGWFEHGQLVVLSGAAEGLSGMVKADAALPGGRREVGLWTALGI
FT                   RPAPGDRVRLLAGCDKRAETCRMKFLNYLNFRGFPHLPPEDWLIAPKVNR"
FT   gene            complement(55851..56492)
FT                   /locus_tag="Pden_2890"
FT   CDS_pept        complement(55851..56492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2890"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sit:TM1040_1069 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2890"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70974"
FT                   /db_xref="InterPro:IPR011740"
FT                   /db_xref="UniProtKB/TrEMBL:A1B630"
FT                   /protein_id="ABL70974.1"
FT                   /translation="MGEMAFHEIRFPANLSFGSVGGPERRTEIVALTNGHEERRTPWAH
FT                   SRRRYDAGLGLRSLDDVAALVAFFEARAGQMHGFRWKDWADFKSCAPGAAVSFQDQEIG
FT                   MGDGVRRDFALRKAYASGPARYWRPVAKPVEGTVLAGAGHVELRAGVDFAVDMATGVLR
FT                   FAAPPEAGAVVTAGFEFDVPVRFDTDRIAVSVASFQAGDLPQVPVVEVRL"
FT   gene            complement(56485..57156)
FT                   /locus_tag="Pden_2891"
FT   CDS_pept        complement(56485..57156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2891"
FT                   /product="phage-related minor tail protein-like protein"
FT                   /note="KEGG: jan:Jann_1642 phage-related minor tail
FT                   protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2891"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70975"
FT                   /db_xref="UniProtKB/TrEMBL:A1B631"
FT                   /protein_id="ABL70975.1"
FT                   /translation="MANKDGFDRLEGDQDGPAALGKGLEQSARLAAEFDAELARLRGSM
FT                   IHTNREVGTLTQGIGSGLRRAFSGLVFDGMKLSDALKGIARSMADSAFAVAMKPVEQAL
FT                   AGAIAQGVNGMVSAVLPFGQGAGFAQGRVMPFARGGVVSQPTYFPMRGATGLMGEAGAE
FT                   AIMPLRRGADGRLGVAAAGGGRPVNVTFNVSTPDVAGFQRSQSQIAAQMGRLLARGERN
FT                   G"
FT   gene            complement(57181..57393)
FT                   /locus_tag="Pden_2892"
FT   CDS_pept        complement(57181..57393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2892"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sit:TM1040_1067 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2892"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70976"
FT                   /db_xref="InterPro:IPR019056"
FT                   /db_xref="UniProtKB/TrEMBL:A1B632"
FT                   /protein_id="ABL70976.1"
FT                   /translation="MSRGLDWPGLMRAGLGPVRLGGLGLRPAEFWALTPAELALMLGVE
FT                   ARGAAAMTRERLAELVARYPDRPAA"
FT   gene            complement(57390..57707)
FT                   /locus_tag="Pden_2893"
FT   CDS_pept        complement(57390..57707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2893"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sil:SPO2256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2893"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70977"
FT                   /db_xref="InterPro:IPR021791"
FT                   /db_xref="UniProtKB/TrEMBL:A1B633"
FT                   /protein_id="ABL70977.1"
FT                   /translation="MANPLAGEVEIFLDGRAYVAKLTLGALAGLEAELGAESMIALVER
FT                   FEGGRFSSRDVMAVLVAGLRAGGWPGGMAELAAAELRGGPVAAAHAAAALLARAFRIEG
FT                   T"
FT   gene            complement(57709..58122)
FT                   /locus_tag="Pden_2894"
FT   CDS_pept        complement(57709..58122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2894"
FT                   /product="phage major tail protein, TP901-1 family"
FT                   /note="TIGRFAM: phage major tail protein, TP901-1 family;
FT                   KEGG: sit:TM1040_1065 phage major tail protein, TP901-1"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2894"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70978"
FT                   /db_xref="InterPro:IPR011855"
FT                   /db_xref="InterPro:IPR022344"
FT                   /db_xref="UniProtKB/TrEMBL:A1B634"
FT                   /protein_id="ABL70978.1"
FT                   /translation="MAVQNGRDLLIKMDMTGDGHFETVAGLRATRLGFNAETVDVTSLE
FT                   SEGRWRELLAGAGVRSASISGSGVFRDGTTDERARQVFFDGEVPRFQVVIPGFGTVEGP
FT                   FQITALEYAGSYNGEATYEISMASAGAISFVAF"
FT   gene            complement(58135..58554)
FT                   /locus_tag="Pden_2895"
FT   CDS_pept        complement(58135..58554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2895"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: jan:Jann_1638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2895"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70979"
FT                   /db_xref="InterPro:IPR021508"
FT                   /db_xref="UniProtKB/TrEMBL:A1B635"
FT                   /protein_id="ABL70979.1"
FT                   /translation="MSYRGTAALQAAVYRALREDGALAAMVGDAIHDAMPVAPPAGIHV
FT                   SLGPEEVRDAGDMTAPGAVHDFVVSVLSGAEAAGGFGAVKAAAVAVSEALENAEMALDR
FT                   GRLAGLWFLRARARRAENGAGRRVDLTFRARIDLG"
FT   gene            complement(58551..58901)
FT                   /locus_tag="Pden_2896"
FT   CDS_pept        complement(58551..58901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2896"
FT                   /product="head-tail adaptor, putative"
FT                   /note="KEGG: sil:SPO2259 head-tail adaptor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2896"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70980"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="InterPro:IPR038666"
FT                   /db_xref="UniProtKB/TrEMBL:A1B636"
FT                   /protein_id="ABL70980.1"
FT                   /translation="MSGPRPTVPLVVESPLREPDGMGGFRLTWQEVGRIWAEMRSGAGA
FT                   ERLAEVGAQSVVTWRITVRAAPAGDPRRPRPEQRLRLGEGAHARRFRIEAVAESDAGGR
FT                   WLVCVAKEEAPA"
FT   gene            complement(58898..59515)
FT                   /locus_tag="Pden_2897"
FT   CDS_pept        complement(58898..59515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2897"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_2472 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2897"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70981"
FT                   /db_xref="InterPro:IPR011738"
FT                   /db_xref="UniProtKB/TrEMBL:A1B637"
FT                   /protein_id="ABL70981.1"
FT                   /translation="MMLVEVTAPATEALPVAGLRDHLRLGTGFGMAEDAAETAALAGFL
FT                   RAAIATIEARTGKVLLARQFRLRLAAWRDPEGQPLPLAPVEAVERVEIADAAGAVTVVD
FT                   PAGYRLVPDMQRPVLEPAGTFLPAVPLGGFAAITFRAGFGAAWPQVPADLAQAVLLLAA
FT                   RYHEDRSFEGSAGALPFGVSALIERWRSVRVLGGRGDPRGRA"
FT   gene            complement(59644..60810)
FT                   /locus_tag="Pden_2898"
FT   CDS_pept        complement(59644..60810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2898"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /note="TIGRFAM: phage major capsid protein, HK97 family;
FT                   PFAM: phage major capsid protein, HK97; KEGG: sil:SPO2261
FT                   major capsid protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2898"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70982"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:A1B638"
FT                   /protein_id="ABL70982.1"
FT                   /translation="MTEVKAAAGADVPGDLGAEMLGFVQELKAFRSEIQNRLEAQEERM
FT                   TMLDRKTISRPRAPLSVEADQGAPHQKAFDAYIRHGDDGALRGLPLEGKAMTSTSDGGF
FT                   LAAPTVAMQVQEALNVTASLRRVANVVAVESASYEVLVDMGDIAHGWASEAAAQAETGT
FT                   PSVQRVVIPVHELSAMPKASQRLLDDAAFDVETWLAGRIAEKFARAEATAFISGDGVNK
FT                   PRGILTHAKAPNGSATNVQIGTIPSGGTGDFAATNPANALIDLVYALGAQYRANASFVM
FT                   NSKTAAAVRKMRDADGRFLWADSLAMGQPAQLLGYPVLVCEDMPDIAQGSHSIAFGDFR
FT                   SAYTIVERPDLRVLRDPFSAKPHVLFYASKRVGGGVTDARAVKLMVFG"
FT   gene            complement(60834..61391)
FT                   /locus_tag="Pden_2899"
FT   CDS_pept        complement(60834..61391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2899"
FT                   /product="prohead peptidase, Unknown type peptidase, MEROPS
FT                   family U35"
FT                   /note="TIGRFAM: phage prohead protease, HK97 family; PFAM:
FT                   peptidase U35, phage prohead HK97; KEGG: rsp:RSP_2470
FT                   putative prohead protease"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2899"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70983"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="UniProtKB/TrEMBL:A1B639"
FT                   /protein_id="ABL70983.1"
FT                   /translation="MRRKEAEVSLKDYGLELKYAAGGSLVAEGTRIEGYASLFGMSDQG
FT                   GDVVVRGAYAASLKRLAARGDRVRMLWQHDPARPIGVWEEIREDGKGLWVRGRLLPEIA
FT                   QAREAAALVAAGAIDGLSIGYRTIAAERDGKGRRLLSEVELWEVSLVTFPMLAEARVGT
FT                   KSDAGHEMAAAFRAATLALRAK"
FT   gene            complement(61372..61605)
FT                   /locus_tag="Pden_2900"
FT   CDS_pept        complement(61372..61605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2900"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rde:RD1_3031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2900"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70984"
FT                   /db_xref="UniProtKB/TrEMBL:A1B640"
FT                   /protein_id="ABL70984.1"
FT                   /translation="MEGSRFVKEPFDWHDQRLETQERIMALQFGQVERRLERIEALIER
FT                   LERRLWMTVYGVVAVILTQAVQSILEYAPKGG"
FT   gene            complement(61607..62809)
FT                   /locus_tag="Pden_2901"
FT   CDS_pept        complement(61607..62809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2901"
FT                   /product="phage portal protein, HK97 family"
FT                   /note="TIGRFAM: phage portal protein, HK97 family; PFAM:
FT                   phage portal protein; KEGG: rde:RD1_3033 phage portal
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2901"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70985"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:A1B641"
FT                   /protein_id="ABL70985.1"
FT                   /translation="MAFPWFGRRAAPARPPVAEVEQKASAAGKLVALAAGSGRVVWSPR
FT                   DTVSLTRLGFVGNPVGFRAVRLIAEAAAAVPLICQDRERRYDVHPVLDLLRRPNPGQGR
FT                   AELFEALFGQILLSGDGYLEAVGADARGLPAELHVLRADRMAVVPGPDGWPVAYEYGVG
FT                   GRKVRFDMAGSPDPICHIRSFHPLDDHHGLSPMQAAAVAVDVHNSASSWSKALLDNAAR
FT                   PSGAIVYRGADGQGGLSPDQYDRLVTEMEMHHQGARNAGRPMLLEGGLDWKPMGFSPSD
FT                   MEFHQTKLAAAREIAQAFGVPPMLIGIPGEATYANYAEAHRAFYRLTVLPLVSRVAGAL
FT                   AWWLSEHLGAEIDLRADPDQVPALAEERDQQWKRVGEASFLTDAEKRAVLGLPPLPEGE
FT                   G"
FT   gene            complement(62958..64349)
FT                   /locus_tag="Pden_2902"
FT   CDS_pept        complement(62958..64349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2902"
FT                   /product="protein of unknown function DUF264"
FT                   /note="PFAM: protein of unknown function DUF264; KEGG:
FT                   rde:RD1_3034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2902"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70986"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:A1B642"
FT                   /protein_id="ABL70986.1"
FT                   /translation="MLPGGSVQAHSTLTRHETRSGAAWLACAAQEEVDAFLGALGENAL
FT                   ASLPWLFEFWALPHQLPPEGDWKSWVIMGGRGAGKTRAGAEWVRAQVEGATPEAPGRAR
FT                   RVALVSETLDQARDVMVFGESGILASSPPDRRPVWEAGRRRLVWPNGAVAQLYSAHEPE
FT                   ALRGPQFDAAWVDELAKWKKAEECWDMLQFALRLGEHPQQVVTTTPKNVAVLKRLLRQS
FT                   STVTTHAPTDANRAYLAESFLAEVQARYGGTRLGRQELEGLLLEDVEGALWSAGLLERC
FT                   RVEAAPALSRIVVAVDPAVTGGAAADECGIVVAGVVSEGPVTQWRAYVLEDASVRGGPL
FT                   DWARAAIAAMGRHGAERLVAEVNQGGDLVESVIRQVDPLVPFRALRAGRGKGLRAEPVA
FT                   ALYEQGRVHHLRGLGPLEEQMCRMTVAGYDGKGSPDRLDALVWAIHELVIEPAAHHLRP
FT                   AVRGL"
FT   gene            complement(64871..66049)
FT                   /locus_tag="Pden_2903"
FT   CDS_pept        complement(64871..66049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2903"
FT                   /product="aminodeoxychorismate lyase"
FT                   /note="PFAM: aminodeoxychorismate lyase; KEGG: rsp:RSP_2465
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2903"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70987"
FT                   /db_xref="GOA:A1B643"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:A1B643"
FT                   /protein_id="ABL70987.1"
FT                   /translation="MIWRHIASNFLTLLIVILIAVAAAIAWGKHEYTRPGPSAVAACVR
FT                   VAPGASLNAVSQQLAEQGVVSNAYVFRAGADYQGKSRDLKFGSYLMAPQSSMEDVVKVI
FT                   TAGGPSTCGTEVLFRIGVRENSVILRDMDAETGMFAEQAKYNPASEPAPEVITAAEAKP
FT                   DARLRILVAEGVTSWQVAEGLKQAGFLDGEVSKLPGEGSLAPDTYDVEKGADRAALLAE
FT                   MERRQAAILAAAWEAREPDLPYATPEEALVMASIIEKETGVPNERRMVASVFVNRMRRG
FT                   MRLETDPTVIYGVTEGKGVLDRGIRASELRRRTPYNTYQIDGLPPTPIANPGRAAIAAA
FT                   MDPEDTDYVFFVADGSGGHAFARTLEEHNRNVARWREIERQRGEPLSPVQGD"
FT   sig_peptide     complement(65969..66049)
FT                   /locus_tag="Pden_2903"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.449 at
FT                   residue 27"
FT   gene            complement(66046..67308)
FT                   /locus_tag="Pden_2904"
FT   CDS_pept        complement(66046..67308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2904"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="PFAM: beta-ketoacyl synthase; KEGG: rsp:RSP_2464
FT                   3-oxoacyl-(acyl carrier protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2904"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70988"
FT                   /db_xref="GOA:A1B644"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A1B644"
FT                   /protein_id="ABL70988.1"
FT                   /translation="MRRVVVTGLGMVTPLASGVEETWSRLLAGESGAGPITRFDTKDVA
FT                   TKYACEIPLGDGSEGTFNPDDWMEPKDRRKVDDFILYGMAAAEQAVKDSGWEPANEDER
FT                   ERTGVMIGSGIGGLRSIAETAVLIKERGPKRVSPFFIPGALINLVSGQVSIRFGFKGPN
FT                   HAVVTACSTGAHAIGDAARLIALGDADVMVAGGTESPICEIGIAGFNACKALSTKREDD
FT                   PKAASRPWDEDRDGFVMGEGAGVVVLEEYEHAKARGARIYAEILGYGLSGDAYHITAPS
FT                   EDGDGGFRSMTNALKRANLSPGDLDYINAHGTSTMADVIELGAVERLLGDAAGNVVMSS
FT                   TKSSIGHLLGAAGAVEAIFCILAIRDQICPPTINLDNQARETAIDLAANAAVRRKVDHV
FT                   LSNSFGFGGTNASLVMGRVKE"
FT   sig_peptide     complement(67252..67308)
FT                   /locus_tag="Pden_2904"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.845) with cleavage site probability 0.682 at
FT                   residue 19"
FT   gene            complement(67429..68199)
FT                   /locus_tag="Pden_2905"
FT   CDS_pept        complement(67429..68199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2905"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mmc:Mmcs_4156 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2905"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70989"
FT                   /db_xref="GOA:A1B645"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1B645"
FT                   /protein_id="ABL70989.1"
FT                   /translation="MAELIEITREGRVALIRLNRPEALNALNSALAEELTAAAEALDAD
FT                   RGVGAIVVTGSDRAFAAGADISEMAEKSAEEMVEADFFAIWDRFAATRTPKIAAVNGYA
FT                   LGGGCELVMMCDFAIAGEGAKFGQPEVKLGVIAGMGGTQRMTKLIGRALSMDLHLTGRM
FT                   MDAAEALRAGLVARVVPDDQVVAEAMAAARQIAGYSRPATRLAREAVMRAEELSLAEGV
FT                   AWERRLFHRLFGTEGQREGMRAFLEKRKPEFHRD"
FT   gene            complement(68209..69336)
FT                   /locus_tag="Pden_2906"
FT   CDS_pept        complement(68209..69336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2906"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   bms:BRA0447 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2906"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70990"
FT                   /db_xref="GOA:A1B646"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1B646"
FT                   /protein_id="ABL70990.1"
FT                   /translation="MMLTEEQEQIRDAARDFARERLAPGAAQRDREHAFPRAELTEMGE
FT                   LGFLGMLVPEEHGGSETGAVAYALALEEIAAADGACSTIMSVHSSVGCVPILRFGTDEQ
FT                   KARFLPKMASGEWIGGFALTEPHAGSDASNLRTKARREGDHYVIDGAKQFISSGKNGKV
FT                   VIVFAVTDAAAGKKGISAFIVPTDTPGYEVVSVEHKLGQHSSDTCALAFTGMRVPVENR
FT                   LGAEGEGYRIALSNLEGGRIGIAAQAVGMARGAYEAALAYARERITFGRPIIEHQAVAF
FT                   RLADMATQIDAARLMVLRAAMLREAGKPCLTEASMAKLFASEMAERVCSAAIQLHGGYG
FT                   YLADYPVERIYRDVRVCQIYEGTSEVQRLVIARNL"
FT   gene            complement(69333..70514)
FT                   /locus_tag="Pden_2907"
FT   CDS_pept        complement(69333..70514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2907"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: bms:BRA0448 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferases; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2907"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70991"
FT                   /db_xref="GOA:A1B647"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1B647"
FT                   /protein_id="ABL70991.1"
FT                   /translation="MSTDPIVIVGSARTPMGGFQGDFAGVEAAALGATAIKAALGGLDP
FT                   QAVDEIIMGCVLPAGQGQAPARQAALGAGLPLGAGATTVNKMCGSGMKAAMLGHDLILA
FT                   GSADVVVAGGMESMSNAPYLLPKARSGYRMGHGQVMDHMFLDGLEDAYDKGRLMGTFAE
FT                   DCAEAYQFTREAQDEFAISSLTRAQKAIAAGHFTGEIAPVTVRGRGGETVVDTDEQPGK
FT                   ARPDKIPTLRPAFRKDGTVTAANSSSISDGAAALVLMRASEAERRGLVPRARILGHATF
FT                   ADKPGLFPTAPIGSVRRLLERTGTAIGDYDLFEVNEAFAVVAMAAMRDLGLSHDAVNVH
FT                   GGACALGHPIGASGARVLVTLLAALETHGGRRGIASLCIGGGEATAVAIERMQ"
FT   gene            complement(70527..71294)
FT                   /locus_tag="Pden_2908"
FT   CDS_pept        complement(70527..71294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2908"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: bms:BRA0449 3-hydroxyacyl-CoA dehydrogenase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2908"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70992"
FT                   /db_xref="GOA:A1B648"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1B648"
FT                   /protein_id="ABL70992.1"
FT                   /translation="MQIESRVFVITGAGSGLGAAVARMAVGAGARAVLLDVNAEAGAAM
FT                   AAELGEAARFVRTDVTSGPEGEAAVAAALEAFGRIDVAVNCAGVAPGEKIVGREGPHGL
FT                   ESFARAVQINLIGTFNMLRLAADAMAKNAPGEGGERGVIVNTASIAAYDGQIGQAAYAA
FT                   SKGGVAALTLPAARELARHGIRVVTIAPGIFATPMMAGLPQEVQDSLGANVPFPPRLGN
FT                   PAEYAALVRHIVENQMLNGEVVRLDGALRMAPK"
FT   sig_peptide     complement(71211..71294)
FT                   /locus_tag="Pden_2908"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.876) with cleavage site probability 0.379 at
FT                   residue 28"
FT   gene            complement(71302..72993)
FT                   /locus_tag="Pden_2909"
FT   CDS_pept        complement(71302..72993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2909"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bms:BRA0450 acetyl-CoA synthetase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2909"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70993"
FT                   /db_xref="GOA:A1B649"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1B649"
FT                   /protein_id="ABL70993.1"
FT                   /translation="MRESLRRRDMSATTLSRSRPGYEQAVAQFRIEDAIAGLRGDLETG
FT                   LNACVECCDRHCGADRVALRCLSADEALVEYTFEDLRALSARAANLMRDKGIRPGDVVA
FT                   GLLPRTVELVATVLGAWRLGAVYQPLFTAFGPKAIEHRLKTSGAKLVVTNAAQRPKLDE
FT                   VEDCPLVATLRGDGPLAPGDVDFREALAMASDQFEPVMRRGEDLFMMMSTSGTTGLPKG
FT                   VPVPLRALLAFGAYMRDAIDLRETDVFWNIADPGWAYGLYYALTGPLLLGQPTILYEGG
FT                   FTAETTYRIIERMGVTSLAGSPTAYRLLIAAGPEAAGAVKGRLRVVSSAGEPLNPEIIR
FT                   WFGEHLAVPIHDHYGQTEMGMCVNNHHGLEHPVRPGSAGLAMPGYRIVVLDDDGNELGP
FT                   NQPGVLAIDMKRSPLMWFSGYLNQATPALAGGYYRTGDSVEFEPDGSISFIGRSDDVIT
FT                   SSGYRIGPFDVESALIEHPAVVEAAVVGVPDPERTEIVKAFVVLAKGVEGTEALREELA
FT                   QHVKKRLSAHAYPRMIDFVADLPKTPSGKIQRFVLRKAEVEKLARE"
FT   gene            73096..74118
FT                   /locus_tag="Pden_2910"
FT   CDS_pept        73096..74118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2910"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bms:BRA0451 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2910"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70994"
FT                   /db_xref="GOA:A1B650"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A1B650"
FT                   /protein_id="ABL70994.1"
FT                   /translation="MERRTISPGFVEDALDCLHRRGIDPAPLLAHAGIAALGEPVSNLQ
FT                   YGKLWLAIADLIRDEFFDEAARPMRPGSFQLLCHAVLHAGTLERALRRALLFLSVTLDD
FT                   PTGELRLRDGQAEIVLADAGPPRRAFAYRTYWLVLLGVMCWLIGRRIPLMQVDFACPAP
FT                   ENRRDYHQFFGAPVHFDQPASRLTFAASYLSLPTIRSEKALQGFLRGAPANILLRYRHD
FT                   QGLSARIRARLRAAPPEDWPDFDRLAADLRLSPATLRRRLRAEGQGFAAIRAEIRLMRA
FT                   RQLLRDTDLSVAEIAARLGYGEPSAFHRAFLKIAGTTPAAFRRAALSPPPSTAGTAARR
FT                   "
FT   gene            complement(74075..75058)
FT                   /locus_tag="Pden_2911"
FT   CDS_pept        complement(74075..75058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2911"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2911"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70995"
FT                   /db_xref="InterPro:IPR021068"
FT                   /db_xref="UniProtKB/TrEMBL:A1B651"
FT                   /protein_id="ABL70995.1"
FT                   /translation="MPSASDTEYHGKSAAHQFFDASEWFSAQAGLTADLARAAFALGRL
FT                   DGAVAALEPEAQAGANRRLALIEVEAMLWAQGTPLRREDIGRDLMEARAGADLEAMRLA
FT                   RWGIRRLEGQGDPRDLRGFLGLHRAEVSGLDELLATRPTGRDFDAAVGEFRELAAQVAG
FT                   LAPLVRAAALRVLWRLCGLSAPEVLAEPATWTARDMAEGCEALCFVPLGRHGRGVWVDG
FT                   GSPAERMARHLAAVTAAIMDARHELARVAEWQARALEAMAGVKGENAGRVIRALAAHPL
FT                   LSAAMLEDSAGISRDTAERMLSRMKALGLAREITGGRRFRLWMAAG"
FT   gene            complement(75215..76324)
FT                   /locus_tag="Pden_2912"
FT   CDS_pept        complement(75215..76324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2912"
FT                   /product="replication protein, putative"
FT                   /note="KEGG: sil:SPOA0303 replication protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2912"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70996"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR037972"
FT                   /db_xref="UniProtKB/TrEMBL:A1B652"
FT                   /protein_id="ABL70996.1"
FT                   /translation="MSRKRRMFEIDMPDEAAGAAPETFPAGKEEKEHRRGPMATAITET
FT                   AESTRDRARLEAQIRAENDALAQEHVRLKRAGLITDLIPLDAIDAQKLIRDRAPGPDYE
FT                   LTELVESIRDIGLSNPIRVEPAEDGRYELIQGWRRLSAYRQLLEETGDAEKWGRIPAGI
FT                   AARGDELERLYRRMVDENMVRKDISFAEMAQLALHYAMDPATEENDPEKAVAILFKSAG
FT                   YQKRSYIRSFIRLIEALGDALLYAPDIPRALGLALAQRLDEVPGAAAAIRAELKDWDSR
FT                   SVKDELDVLRRYAGQGSDTESTAAAPRSTTPAVPAGKARISFQIQRPQGSAKCTASNGR
FT                   LEIRLPRDFSAVDRRKLEAAVRVMLESLD"
FT   gene            complement(76321..77625)
FT                   /locus_tag="Pden_2913"
FT   CDS_pept        complement(76321..77625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2913"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   sil:SPOA0304 replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2913"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70997"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1B653"
FT                   /protein_id="ABL70997.1"
FT                   /translation="MYTHEDLAKLQAQSLKMQGWIRRQTFSPANEKTLRRFSSWEVSEL
FT                   IFRINQSTFRGKLAAEPNLPPGEVEEDGRQRWFSLDEINELRRRIRINRKTLMPWRPEG
FT                   KRAFRAAIANFKGGAGKSTVALHFAHAAALDGYRVLVVDFDPQATLSHSMGLTDVGEDH
FT                   TVWGIMARDLERETDRMNAAARGAESGTALPQRKLPASIRDMGLGMLRPADFIKPTAWP
FT                   TIDIIPSCANAAFVEFASAQYRHLNPEWTFFGAVSRFLDSLADDAYDLILFDCPPAIGY
FT                   QSMNAVFAADMLYIPSGPGYWEYDSTTSFIGQLSEALEDLSHGFENFPTGKIKLPKAFA
FT                   DIRFLMTRYEPSNELHQAMYGAFQQVFGQHMAQHPIELTRAVEQSGRFLSSIYEIDYRE
FT                   MTRGTWRRARATFDQAYEEFKSHVVAAWDKLEDEA"
FT   gene            78109..78783
FT                   /locus_tag="Pden_2914"
FT   CDS_pept        78109..78783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2914"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sil:SPOA0305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2914"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70998"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A1B654"
FT                   /protein_id="ABL70998.1"
FT                   /translation="MQVIRAVGREAAAKKYDLLSAMMAHGLAGDKHRQRLVLRLMALIT
FT                   TRYNWQRDELTIGQREIARLWCVDERTVKREMAKLRALGWIEIKQQGARGRVSVLGLNL
FT                   DRILLDTKAEWPNIGPDFVERVGGKRAEPTSNVVPLHRPEPMPAEGLWAEARTRLAEED
FT                   PALFDAWFAGLIEAERDETCLTLFAPSRFHAAYVQTHLLERLRIAVQRCDGRVGKVRLI
FT                   GP"
FT   gene            78876..79133
FT                   /locus_tag="Pden_2915"
FT   CDS_pept        78876..79133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2915"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_7166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2915"
FT                   /db_xref="EnsemblGenomes-Tr:ABL70999"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A1B655"
FT                   /protein_id="ABL70999.1"
FT                   /translation="MRLVTLMLAIPALASPAVAHDRCTVPQDQRRPANELRAELKAKGW
FT                   TVGKIELEEGCYEVRGEDQTGLSVEVLFDPASFQEIGRDD"
FT   sig_peptide     78876..78935
FT                   /locus_tag="Pden_2915"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            79269..80231
FT                   /locus_tag="Pden_2916"
FT   CDS_pept        79269..80231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2916"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: atc:AGR_L_1708 biotin synthetase; TIGRFAM:
FT                   biotin synthase; PFAM: Radical SAM domain protein; biotin
FT                   and thiamin synthesis associated; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2916"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71000"
FT                   /db_xref="GOA:A1B656"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1B656"
FT                   /protein_id="ABL71000.1"
FT                   /translation="MPQQSRSAAEIYHQPLMDLLFQAQTVHRAHFDPNVVQCSKLLSIK
FT                   TGGCPEDCAYCSQSARNGSELSASKLMEVQRVLAEARRAKEAGATRYCMGAAWRSPKER
FT                   DMPAVLAMIRGVKAMGMETCMTLGMLDADQALRLKDAGLDYYNHNIDTSERYYSEIITT
FT                   RTFQDRIETLERVQAAGINVCAGGIVGMGETAEDRISMLETLAGLEVPPQSVPINMLMP
FT                   MAGTPLADVPRLDAIEMVRTIATARILMPASYVRLSAGRSEMSDEMQAMCFFAGANSIF
FT                   VGDTLLTAGNPDEDKDALLFAKLGLRAEVPEASQEGCAA"
FT   gene            80228..81343
FT                   /locus_tag="Pden_2917"
FT   CDS_pept        80228..81343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2917"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   rpb:RPB_4344 8-amino-7-oxononanoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2917"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71001"
FT                   /db_xref="GOA:A1B657"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1B657"
FT                   /protein_id="ABL71001.1"
FT                   /translation="MSFSRHGAALEAMARRGRLRRVAPAAGADFASNDYLGLAGSELLA
FT                   RAAREALARGVPVGAGGSRLLRGNHPEHQALEAEAAAFFGAEAALYMGGGFQANQAIFS
FT                   ALPMQGDLVVHDALVHASAHEGMRLGRAECRGFAHNDAGDAARVIAEWRASGGRGRIWI
FT                   AVESVYSMEGDRAPLEALAALAAREDGVLVVDEAHATGVFGPQGRGLAHRLACPLVSLH
FT                   TGGKGLGASGALVCADRVLVETLVNKARPFIYATAPAPLSAAVLRGALRTLEEVPALVE
FT                   GARARMAQAAEAARRCGIVAQSQIVPVIVGEDFRALEMAGALQAQGFDIRAIRPPTVPK
FT                   GTARLRVSVTGNVGAGEIAALFAALEAAWVR"
FT   gene            81340..81948
FT                   /locus_tag="Pden_2918"
FT   CDS_pept        81340..81948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2918"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG: rpd:RPD_4239
FT                   dethiobiotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2918"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71002"
FT                   /db_xref="GOA:A1B658"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1B658"
FT                   /protein_id="ABL71002.1"
FT                   /translation="MIVVGTDTGIGKTVFSAGLARALGASYWKPVQAGLEEETDSEVVA
FT                   RLSGRPVLAEAYRLRLPASPHLAAEREGVAIDPARLALPPVAPLVVEGAGGLMVPLTRH
FT                   LLYLQVIAGWGAPVVLCCRTALGTINHSLLSLTALRAAGCRVAGVAFIGEEMADSRRVI
FT                   CEIGAVRDLGRLPVLERVTAEALADAFAGIDLAAIREVS"
FT   gene            81948..83231
FT                   /locus_tag="Pden_2919"
FT   CDS_pept        81948..83231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2919"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.62"
FT                   /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   ngo:NGO0308 putative
FT                   adenosylmethionine-8-amino-7-oxononanoate aminotranferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2919"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71003"
FT                   /db_xref="GOA:A1B659"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1B659"
FT                   /protein_id="ABL71003.1"
FT                   /translation="MRDLAFDRRHLWHPYSSMREPGPVHEVAAAEGVWLELADGVRMID
FT                   AMSSWWAAAHGHRHPRLVEAMQAQLDRLPHVMFGGLTHAPAVGLARRLVAMLPVGLDRI
FT                   FYSDSGSVAVEVALKMAVQAQLGLGQAGRVAFASARGGYYGDTWKAMSLCDPQTGMHAH
FT                   FGAALQVQHFVPRPPIPFGAEWDEDPARNGLGAVEALFAGKAHEIAGFIVEPVVQGAGG
FT                   MWFYHPRWLAGLRTLCDRHGVLLIFDEIATGFGRTGTLFAMERAGVVPDILCLGKALTG
FT                   GMMSFAATVASGRVAEAISDGPAPVLMHGPTFMGNPLACAVACASLDLLAEGAWQAQVA
FT                   GIEAGLAQGLAPARGLPGVRDVRVLGAIGVIETQAPVDMGRVHGFCRDSGVWLRPFGRL
FT                   LYCMPPFVAAPDEVARICAAMVEIAGWP"
FT   gene            83228..83836
FT                   /locus_tag="Pden_2920"
FT   CDS_pept        83228..83836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2920"
FT                   /product="protein of unknown function DUF452"
FT                   /note="PFAM: protein of unknown function DUF452; KEGG:
FT                   nme:NMB0473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2920"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71004"
FT                   /db_xref="InterPro:IPR007398"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1B660"
FT                   /protein_id="ABL71004.1"
FT                   /translation="MRAEWLRREGAPELIVVLTGWAVGAGPFRHLAGPADVLVLSDYRD
FT                   LSAPDWPQGYAATDLVAWSFGVAAACRLPALDGFRRKVAVCGSWAPCDDELGIPCETVR
FT                   ATAANLSELSLRQFARRAECPTEPGADPAALGEELRAVMGWGGVQAPDFDRIVLGASDR
FT                   IFPLKNLIRAWQAWPVETRVLDCGHNPFALWRDWDEVLA"
FT   gene            83833..84576
FT                   /locus_tag="Pden_2921"
FT   CDS_pept        83833..84576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2921"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: cte:CT0049 biotin synthesis protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2921"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71005"
FT                   /db_xref="GOA:A1B661"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1B661"
FT                   /protein_id="ABL71005.1"
FT                   /translation="MNALAGRVARSFARGMKTYDGAALAQRQIAARLFAAYRGAAAGHR
FT                   PARVLEAGYGSGHLTRHLLELRPRRLWLNDLAAPELPGVAAEYLPGDVAEVALPEAVDL
FT                   AASASTIQWVADPARVLGRLCQAVAPGGWLAISGFAPGHFPELRALGSRAAAPSYLAGA
FT                   GMAALLPAGWRVRGAGEWRVRLHFPGALEVLRHLRATGVNGCAGQFRSPGALRDFMARY
FT                   EAQHGGAGGVALTYVASWLVAERRA"
FT   gene            complement(84573..85238)
FT                   /locus_tag="Pden_2922"
FT   CDS_pept        complement(84573..85238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2922"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: mlo:mlr7428 transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2922"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71006"
FT                   /db_xref="GOA:A1B662"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B662"
FT                   /protein_id="ABL71006.1"
FT                   /translation="MSAGSEETLAVRISRVLADRIVSGEIGPGERLRQDRIAEEFGASH
FT                   VPVREAFRRLEAQGLAISEPRRGVRVAAFDLPEVKEVAEMRAALEELALRHAAPHLTPA
FT                   ILNAAEEATKAGDASRDVRSWEAANRRFHKLILTPCAMPRLLAAIDDLHAASARFLFAA
FT                   WQSNWETRTDHDHRAILAALRKGDVDTACATLARHVRWIGRRPAPSTSGKPDAFAIHG"
FT   gene            complement(85282..85866)
FT                   /locus_tag="Pden_2923"
FT   CDS_pept        complement(85282..85866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2923"
FT                   /product="2',5' RNA ligase"
FT                   /note="PFAM: 2',5' RNA ligase; KEGG: bxe:Bxe_A1918 putative
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2923"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71007"
FT                   /db_xref="GOA:A1B663"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:A1B663"
FT                   /protein_id="ABL71007.1"
FT                   /translation="MTDAPQPQDMPQELPREHFLLFVAIPPPGVAARIEDAWRLANRRD
FT                   RFRRATLHMTILPVIRTPQLAPGMAEALGRPLDGLDFPAFDLMLDHLTTFGPPRRRDRP
FT                   LVLVGRQESPAPDALCQTLWQRLAGAGLAIARHRVTPHVTLAYGKPLPPQGIPVPPVHW
FT                   RVDELVLIDSLQGLGRHVPLARWPLPSRSGP"
FT   gene            complement(85916..86572)
FT                   /locus_tag="Pden_2924"
FT   CDS_pept        complement(85916..86572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2924"
FT                   /product="protein of unknown function DUF162"
FT                   /note="PFAM: protein of unknown function DUF162; KEGG:
FT                   rde:RD1_0071 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2924"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71008"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1B664"
FT                   /protein_id="ABL71008.1"
FT                   /translation="MTARDRILSAIRTALGPGKPPAQIAAEAAALLDPAGIARPHLVAP
FT                   VLPDAFALKATALGTTIDRVASMADLPQAMARYLDAHGLPPRFAMQPAPELAALDWQGL
FT                   APHQGTAPDEPTALGLALCGIAESGSLVIHSGPDNPILMSFLPLHHVAVLRESTLLPYL
FT                   EDYAARLSAQAVPRNAILITGPSGTTDIEGSYVRGAHGPGFLHVILIADAGTEPG"
FT   gene            complement(86569..87984)
FT                   /locus_tag="Pden_2925"
FT   CDS_pept        complement(86569..87984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2925"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /note="TIGRFAM: iron-sulfur cluster binding protein; PFAM:
FT                   4Fe-4S ferredoxin, iron-sulfur binding domain protein;
FT                   KEGG: rde:RD1_0072 4Fe-4S binding domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2925"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71009"
FT                   /db_xref="GOA:A1B665"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1B665"
FT                   /protein_id="ABL71009.1"
FT                   /translation="MNAPSKAPFKARAKAALADPVLKTAIDRTTGNAERKRAAAVAAFP
FT                   EFEAARARGKAIKDHVVAHLDHYLEMFERNAAARGAQVHWAADDAEARAIVTRICLAAD
FT                   ARLVTRAKSMLGEEIGLPHALADAGIERVETDLAEHIIQLAGEAPSHIIWPAMHRTREQ
FT                   VAELFKTGHHPPPAAEDPATMVQSARTQLRTKFLSADIGISGANFLVADTGATCTVTNE
FT                   GNAELTTTPPRIHIVTAGIEKLVPSTAHAFALLRLLVRSATGGEMTQYTTFHAGPKRPG
FT                   DADGPEEMHIVLVDNGRTKMLADEFREMLRCIRCGACMNHCVVYRQIGGHAYGGTYPGP
FT                   MGSVLTPVLDGLAASRDLPNACTMNGRCAEVCPVGIPLPTLLRAWRRRSWREGLEPGSI
FT                   RTGIGLWAQLARRPRLYRLATRIGLPLLRLFGRGGWISRLPLAGGWTDHRDLPRPAAQS
FT                   FMDQYRAQQKGRK"
FT   gene            complement(87981..88751)
FT                   /locus_tag="Pden_2926"
FT   CDS_pept        complement(87981..88751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2926"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224,
FT                   cysteine-rich region domain protein; KEGG: rde:RD1_0073
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2926"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71010"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:A1B666"
FT                   /protein_id="ABL71010.1"
FT                   /translation="MPGEPKPTVGLFVTCLVDAIRPQIGFAALQLLEEAGCTVEVPQAQ
FT                   TCCGQPALNSGDDRDAAHLARQTIAAFEGYDHVVLPSGSCAATMVHGYPDLLAGDPEWA
FT                   ARARAMAAKTHEITSFLADVMGYAPSGRRCDASATYHDSCSGLRELGIADQPRALLAHV
FT                   EGLEMRGLPGNDACCGFGGTFCVKYSDISNAIVTEKAEAIEETGADILLAGDLGCLMNM
FT                   AGKLHRRGAKTRCFHTVEVLAGRATGPAIGEDAP"
FT   gene            complement(88761..90527)
FT                   /locus_tag="Pden_2927"
FT   CDS_pept        complement(88761..90527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2927"
FT                   /product="L-lactate transport"
FT                   /note="TIGRFAM: L-lactate transport; PFAM: L-lactate
FT                   permease; KEGG: par:Psyc_1653 glycolate/L-lactate:H+
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2927"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71011"
FT                   /db_xref="GOA:A1B667"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:A1B667"
FT                   /protein_id="ABL71011.1"
FT                   /translation="MAGLITFILALLPIATVFVLLVVLAKSAKFSMLVAYLVTAATALL
FT                   IWGTELNKVLGATVNGAVTAISLLYIVFGAILMLYTLEESGGIRSIRAGFTSISPDRRV
FT                   QAIIIAWLFGSLIEGASGFGTPAAIAAPLLVAIGFPAMAAVMVTLIIQSTPVSFGAVGT
FT                   PILVGVRTGLADQQIVEATIAPMAFGDYLLEIAVKVATIHGLIGFLIPLILVGMLTRFF
FT                   GANRSFAEGFRIWKFALFAGLAFTVPYYLIAATLGPEFPSLLGGIVGLLIVVPAAKRGF
FT                   LIPRETFDFPPRRDWNDNWVGKLDDLEDHNAHKPVMPLVKAWAPYVFVVALLVITRSIA
FT                   PIKAWLTSPEMTIAFRDLFGSGINASVQVLFLPGTILILASLFTFVLHGMSGRDYGRAL
FT                   KASGVTMIAAAPALLLAVPMVQVFLNSASDSYASMPIVLAQGVSSVVGDAWPMFAPLIG
FT                   AMGAFVAGSNTVSNMMFSLFQFSTAEQIGLGAAGAGTVVALQAIGGAAGNMICVHNVVA
FT                   ASATVGLTDREGAIIRQTLIPMAYYVVQGGLIGFALLTGNLMWWVAAAIWAAAVLFFMS
FT                   RNRGPRPVTVAN"
FT   sig_peptide     complement(90450..90527)
FT                   /locus_tag="Pden_2927"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.911 at
FT                   residue 26"
FT   gene            complement(90605..92314)
FT                   /locus_tag="Pden_2928"
FT   CDS_pept        complement(90605..92314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2928"
FT                   /product="D-lactate dehydrogenase"
FT                   /EC_number="1.1.1.28"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   bbr:BB4787 D-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2928"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71012"
FT                   /db_xref="GOA:A1B668"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012256"
FT                   /db_xref="InterPro:IPR015409"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016172"
FT                   /db_xref="InterPro:IPR016173"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1B668"
FT                   /protein_id="ABL71012.1"
FT                   /translation="MTRPGQAEAAADRTALLDRLRRIVGPAHVLTADRATRRYTRGFRY
FT                   GEGPVAAVVRPGSLVQMWRVLNAAVASGRAVILQAANTGLTGGSTPWGQDYDREIVLVS
FT                   VMRLRGIHLIGAGEQVLCLPGATLDALEKRLRPLGREPHSVIGSSCIGASVLGGICNNS
FT                   GGALIQRGPAYTEMSLYAEVREDGSVALVNHLGLDLGDDPEEILARVEAGELPAPAPTD
FT                   AWASDREYADHVRDIEAETPARFNADPRRLHESSGCAGKLAVFAVRLDTFQAEKDTAVF
FT                   YVGSNDPDELTEIRRHILAHFQSLPIAGEYIHREAYDIAAKYGKDTFLFIRHAGTDRMP
FT                   AFFAAKARMDALTERLGLGATLSDRLAQGVAALMPQHLPRRMNDFRDRYEHHLLLRMGG
FT                   AGIAEARDYLGAIFPSASGAMFECTPDEGKAAFLHRFAVAGAAVRYRAIHAREVQDIVA
FT                   LDIALRRNDRDWVERLPPDLDAKLEKKLYYGHFFCHVFHQDYVVKKGQDCLAVEHEMWR
FT                   LLDRRGAEYPAEHNVGHLYHAKPELAGFYRQLDPTNSLNPGIGQTSKCAHWH"
FT   gene            92529..93302
FT                   /locus_tag="Pden_2929"
FT   CDS_pept        92529..93302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2929"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; Helix-turn-helix, type 11 domain protein; KEGG:
FT                   mag:amb0238 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2929"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71013"
FT                   /db_xref="GOA:A1B669"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B669"
FT                   /protein_id="ABL71013.1"
FT                   /translation="MPSEVNKGAPAAETTARHIEDLILEGSLRPGDPLLPEREMALRLN
FT                   VSRPTLRQGIRMLEERGLIVADPGGGRRVAPLATSITDPLIELMASRGEVVDDYLELRG
FT                   TLEGMAASLAATRASDVDRATLTRCMERIDLAHDEADFRDEAEADVDLHVAVYEASHNV
FT                   VLLQIMRALSGMLRKGVFHNREKLYARPEVRDVLRAQHRAIYDAIMVRDPEAAARAAQD
FT                   HMTYTKRVRAEIIAAEARLEISLRRIEGGSLTARN"
FT   gene            93367..93633
FT                   /locus_tag="Pden_2930"
FT   CDS_pept        93367..93633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2930"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_2678 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2930"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71014"
FT                   /db_xref="UniProtKB/TrEMBL:A1B670"
FT                   /protein_id="ABL71014.1"
FT                   /translation="MDMMDRLAARIDGLEGRLIAHRRMLEKLLDLSSAEMRAEMLAWLE
FT                   DREVMLDGQEDPGVVSGPEAALELALSDEMRLLHDRLAAAKGR"
FT   gene            93763..95139
FT                   /locus_tag="Pden_2931"
FT   CDS_pept        93763..95139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2931"
FT                   /product="gluconate transporter"
FT                   /note="TIGRFAM: gluconate transporter; PFAM: Gluconate
FT                   transporter; Citrate transporter; KEGG: eca:ECA4158
FT                   gluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2931"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71015"
FT                   /db_xref="GOA:A1B671"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A1B671"
FT                   /protein_id="ABL71015.1"
FT                   /translation="MNPVEPVHSTPVLLLIAAAAVLVLLVFIMRFRLHAFVSLVLVSLL
FT                   TAIVAGIPMGDVIPTLLQGFGSTLATVALLVGFGAMIGRLLEITGGAQVLADRLIGQFG
FT                   AERAPFALGVASLLFGFPIFFDAGLVVMLPIIFSVAYRFGGSVLLYALPAAGAFAAMHA
FT                   LLPPHPGPVAAGDLLGADIGLLVLVGLAVALPTWFFGSYLFGLWAGRRFVLPIPQILGA
FT                   VDAGSHDRNPPSFGTVMLVLLLPLALIFLNTGLGTLATMGVVDGGAGWVTVLRLIGQTP
FT                   IALLITVLVAMALLGRGRNAAEIEKIMDGALAPICAIILVTGAGGMFGGVLRASGIGEA
FT                   LAGSLDAIGMPLIVAAFVISMALRVAQGSATVALTTTAGLIAPTVAATTGLSEFDRCFL
FT                   VVAIAGGATVLSHFNDSGFWLVGRFLEMDEKTTLKTWTVMETLLGTIAFGFALLGWWLL
FT                   "
FT   sig_peptide     93763..93870
FT                   /locus_tag="Pden_2931"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.868) with cleavage site probability 0.862 at
FT                   residue 36"
FT   gene            95148..95651
FT                   /locus_tag="Pden_2932"
FT   CDS_pept        95148..95651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2932"
FT                   /product="gluconate kinase, SKI family"
FT                   /EC_number="2.7.1.12"
FT                   /note="KEGG: tfu:Tfu_2114 carbohydrate kinase,
FT                   thermoresistant glucokinase; TIGRFAM: carbohydrate kinase,
FT                   thermoresistant glucokinase family; PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2932"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71016"
FT                   /db_xref="GOA:A1B672"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A1B672"
FT                   /protein_id="ABL71016.1"
FT                   /translation="MQHIVVMGVSGAGKSTTGEALARHLGWPFVEGDSFHPEANVAKMR
FT                   DGIPLDDGDREPWLRALAAEIARNEARGQSSVMGCSSLKRAYRDILRQGAPVVRFVHVH
FT                   GSRALLESRLSHRAGHFFPAKLLDSQLATLEPLAPDEDGVVVDMALSVEDQLHQALRLL
FT                   GLGG"
FT   gene            complement(95810..97648)
FT                   /locus_tag="Pden_2933"
FT   CDS_pept        complement(95810..97648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2933"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: rsp:RSP_3074 dihydroxy-acid and
FT                   6-phosphogluconate dehydratase; TIGRFAM: dihydroxy-acid
FT                   dehydratase; PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2933"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71017"
FT                   /db_xref="GOA:A1B673"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1B673"
FT                   /protein_id="ABL71017.1"
FT                   /translation="MPAYRSRTTTHGRNMAGARGLWRATGVKNSDFGKPIIAIVNSFTQ
FT                   FVPGHVHLKDLGQMVAREVEAAGGIAKEFNTIAVDDGIAMGHDGMLYSLPSRELIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPAIFVSGGPMEAGKVTLGDGRKVSL
FT                   DLVDAMVAAADDKISDADLAAIEEAACPTCGSCSGMFTANSMNCLSEALGLSLPGNGST
FT                   LATHAFRKNLFLEAGRRIVEVTRRHYEQDDASVLPRAIASKAAFLNAMSLDIAMGGSTN
FT                   TVLHLLAIAQEGGVDFTMDDIDALSRKVPCLCKVAPNTANVHMEDVHRAGGIMAILGEL
FT                   DRAGLIDRDCPTVHAPTIGAAIDQWDIARSNDPQARELFLAAPGGVPTQVAFSQATLWP
FT                   DLDLDREHGVIRSAKAPFSKDGGLAVLKGNVALDGCIVKTAGVDESILVFSGRAKVYES
FT                   QDAAVSGILTGKVEAGDVVVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALITDGRF
FT                   SGGTSGLSIGHVSPEAAAGGTIGLVRDGDRIEIDIPNRSIRLAVPEDELAARRAEQDAK
FT                   GWKPAQPRQRQVSAALKVYAQFAASADKGAVRILPE"
FT   gene            complement(97755..98402)
FT                   /locus_tag="Pden_2934"
FT   CDS_pept        complement(97755..98402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2934"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   sme:SMc02159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2934"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71018"
FT                   /db_xref="GOA:A1B674"
FT                   /db_xref="UniProtKB/TrEMBL:A1B674"
FT                   /protein_id="ABL71018.1"
FT                   /translation="MTEDFSRRPIASRNTKWAAHVTRRLVARGIAPNRISAGSVVAAAL
FT                   SGGALALSAQTGALWASGVLLVLGALFCQLRLLCNLFDGLVAVEGGMGSPDGAFWNEVP
FT                   DRLSDLMILAGLGVAAGLPGLGLLAGALAILTAYLREFGRASGLGSDFSGPGAKSHRMA
FT                   AVTLGALAQAGAWIAGAGWPVLVWTLWLVLALTVATIVRRSRRILCGLAGGA"
FT   sig_peptide     complement(98247..98402)
FT                   /locus_tag="Pden_2934"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.396 at
FT                   residue 52"
FT   gene            complement(98399..99337)
FT                   /locus_tag="Pden_2935"
FT   CDS_pept        complement(98399..99337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2935"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; KEGG:
FT                   xcv:XCV0555 putative phosphatidate cytidiltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2935"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71019"
FT                   /db_xref="GOA:A1B675"
FT                   /db_xref="UniProtKB/TrEMBL:A1B675"
FT                   /protein_id="ABL71019.1"
FT                   /translation="MDRFYSPSAFVFYGLFAFLVLASLVARFLIRSGRVGGPTAQNLAD
FT                   RIRAWWVMIGVLALIFTLGAGAITLFFALCSMAALREFATITHTRRDDHDGLAIAFYLI
FT                   LPLQYLLVYFEVPVFAALLIPVYSFLLLPVVTVFKGEVQGFLTRVSETQWGLMVCVYCV
FT                   SHIPAILTLDIPFYRYSAFTLVAWLILVVQASDVLQYVWGKSIGRHLLAPRVSPSKTVE
FT                   GLAGGMLSATALGMALTPITPFLWWEAGLIALTVTGFGTLGGLIMSAIKRDRGVKDWGT
FT                   LVQGHGGILDRLDSLVFSAPVFLHILAWGWM"
FT   sig_peptide     complement(99269..99337)
FT                   /locus_tag="Pden_2935"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.795) with cleavage site probability 0.779 at
FT                   residue 23"
FT   gene            complement(99341..99973)
FT                   /locus_tag="Pden_2936"
FT   CDS_pept        complement(99341..99973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2936"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   reu:Reut_B4015 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2936"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71020"
FT                   /db_xref="GOA:A1B676"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A1B676"
FT                   /protein_id="ABL71020.1"
FT                   /translation="MTATIPARLTRAGLVATARILISLRAIDLPPPGAAPRILVANHVS
FT                   HADFVALWSALPKPHRLRTRPVAGADYWERSAIRRWIAHQVFRAVLIDRDPASRRADPV
FT                   ETVAQVLRGGEDVIFFPEGTRNLTDARLLPLKSGIYHLARAVPEAEIVPAWILNLDRIL
FT                   PKGAFLPVPLNCAVRFGNPIRVETGESREDFLQRLAAAMLALSDTKA"
FT   gene            complement(100393..102399)
FT                   /locus_tag="Pden_2937"
FT   CDS_pept        complement(100393..102399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2937"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; protein of unknown
FT                   function DUF214; SMART: AAA ATPase; KEGG: rpb:RPB_2235
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2937"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71021"
FT                   /db_xref="GOA:A1B677"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1B677"
FT                   /protein_id="ABL71021.1"
FT                   /translation="MAETGAPLIRLRGVGREYPSGEGVLRVLTDIDLDIGQGEFVAVMG
FT                   ASGSGKSTLMNILGCLDRPSSGSYRMDGREVARLGAGELAALRRETFGFIFQRYHLLSE
FT                   MTALGNVEVPAIYRGLPADARRARARDLLERLGLGDRTGHRPGQLSGGQQQRVSIARAL
FT                   VNDARVILADEPTGALDSRSGDEVLGILERLNAEGRTVVIVTHDPRVAARAHRVVEIAD
FT                   GRIVADRRTGAPAADPGPGPAQAPQPAPQPAPVQAPVQARVQARAAVPVLGRLAEALRM
FT                   ALLSMRAHKLRSFLTMLGIIIGIASVVSVVALGEGSRRQVLQNIAGLGTNTLQIFPGRD
FT                   FGDMRSGRVTTLVTADAAALARQPHVASVSPTVGTSATLRHGATEASAQISGVGEQYFD
FT                   VAGVALTQGRGFDEADVAAMGQNVVIDENTRTSLFGDGPALGQVFMAGKVPLRVIGVAE
FT                   AQNRGPGGSTSLTVYAPYTTVQARYLGSTSVSGLTLRVADDVDMALAEQMVADILTRRH
FT                   GTRDFFIVNNDQIRQTITSTTQTLALLIAAIAVISLVVGGIGVMNIMLVSVTERIGEIG
FT                   LRMAVGARRGDIRAQFLIEAVLVCVIGGIAGILAALGFGLAFERMSSDFTLVYSPLSML
FT                   AALASACAIGLAFGYLPAVNAAKLDPVKALQKG"
FT   gene            complement(102392..103726)
FT                   /locus_tag="Pden_2938"
FT   CDS_pept        complement(102392..103726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2938"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   rpc:RPC_1868 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2938"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71022"
FT                   /db_xref="GOA:A1B678"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1B678"
FT                   /protein_id="ABL71022.1"
FT                   /translation="MRKPWSRGDANRARSIARRAAPDKGRARADPLSPGRRRPNVTEHP
FT                   MRKPVLLVLIAAALVTLWAGLAGITQGKPATPGYISAEVSRGSLEVSVLAEGRLKPSNL
FT                   VAVGAQVSGRITELAVVLGQRVEQGDLIARIDSVQQANELRTAQAALANLKAQMAERRA
FT                   VLALAEKTLERQQNLIRSNAASRSTMDSAQQDVDVARAQIAALQAQIAQAEVAIEIART
FT                   DLDYTRITAPMAGTVLAIVSQAGQTVNAVQSSPTIVVLGQLDRMDVHAEISEADIGKVR
FT                   PGQKVRFSLLDDSGRSYEGVLDSIAPAPQSIVNDSAIQGGTGTDSSSGAIYYTGIVPVE
FT                   NPDGRLRSYMTAQVSIVLGAAQDVLTIPSSALGRRNPDGSHQVRVLGGAGIETRDVVIG
FT                   LNDKVAAEVVSGLAEGERVVTGEQGAAPAAAAPRGSRRMMGPLGG"
FT   gene            104045..104569
FT                   /locus_tag="Pden_2939"
FT   CDS_pept        104045..104569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2939"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2939"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71023"
FT                   /db_xref="UniProtKB/TrEMBL:A1B679"
FT                   /protein_id="ABL71023.1"
FT                   /translation="MRFLLTFHSAATGQWRCLDTALLAAFRSGRAEDLPAALRDEPELA
FT                   MRWLLGRYEIAEALTPAAEGAAPAPRQGDLIAVYALGAERSVIGFENTYNGAWLEMFVL
FT                   ENRPLGHIAARKVMAPARAMASLEDRVARPLHAADEACRLTVSRIIEHQQVLDRRRKDG
FT                   AGRTTPEVERT"
FT   gene            104685..105251
FT                   /locus_tag="Pden_2940"
FT   CDS_pept        104685..105251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2940"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: rru:Rru_A1116
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2940"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71024"
FT                   /db_xref="GOA:A1B680"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041479"
FT                   /db_xref="UniProtKB/TrEMBL:A1B680"
FT                   /protein_id="ABL71024.1"
FT                   /translation="MGRKRTIDRDELMAAIERVARRSGITGLSIDAVAKEAGISKSSVV
FT                   YDCDSKAGLLAAFIRHKMAQHQARFVEIRARREGEPNARLRALIDEYRRVPTDEELDMA
FT                   LLVSASMGEHAECREIMREKLASDAETVAAQAADRRRMLMALLTLHGMAFLEYFGFHRF
FT                   DQETRNEILDELMAVAESDPGAAGD"
FT   gene            105290..106483
FT                   /locus_tag="Pden_2941"
FT   CDS_pept        105290..106483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2941"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   atc:AGR_L_3215 RND multidrug efflux membrane fusion protein
FT                   MexC precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2941"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71025"
FT                   /db_xref="GOA:A1B681"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1B681"
FT                   /protein_id="ABL71025.1"
FT                   /translation="MTMRLSPGVCAGLVLCCLMAAAPAAAQQLPPPQVSVQEMTPEALP
FT                   VVNELPGRVAATRTAEVRPRVGGIVIERVFEQGGKVEAGDVLYRIDPAPYDVRVASAEG
FT                   ALARAEATALNAADQEKRARALRERKVTAGVDLDNAATALAQAQADVAIARASLQEAQL
FT                   NRSYTEVAAPIAGVVGRALVTEGALVNAQTDIMATIQQLDPVYVDFTQSSSELFALRRA
FT                   LAAGQLAMISADAAAVRLIFDDGSEYAHPGKLLFSEASVDSSTGQITLRAEFPNPEGDL
FT                   LPGLYVRVRIEQAVRDNALTVPQMAVQRDQSGQAYVYALKDADTVERRDVTLGQTAGNR
FT                   WLVESGLKPGDRVVVAGAQKLYPDAKVVPQPVDAAQPAVPAGAAAAAEAPAPAPAQE"
FT   sig_peptide     105290..105370
FT                   /locus_tag="Pden_2941"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 27"
FT   gene            106488..109613
FT                   /locus_tag="Pden_2942"
FT   CDS_pept        106488..109613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2942"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   atc:AGR_L_3217 RND multidrug efflux transporter MexD"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2942"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71026"
FT                   /db_xref="GOA:A1B682"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1B682"
FT                   /protein_id="ABL71026.1"
FT                   /translation="MARFFIHRPVLAWVISIFIVIAGVLALPMMPIAQYPQVAWPQITI
FT                   STAYTGAAPGEINQAVAQPIEDELNGVEGLAYYESVSDSSGAMSITATFEPGTDIARAQ
FT                   VDVQNAVARVEPLLPQSVVDQGVLIEEAGTGFLMMVALTSDDGAMDDIALGDYLNRNVA
FT                   GEIRRIEGVGRAQVFAPERALRIWVDPAKMTGLNLSSAEIVAAVRAQNAQVAAGKVGAD
FT                   PNPIGQQLTATVLIKGQLDDVEEFGKIVLRANPDGSTVLLRDVARLEVGAESYSFASRI
FT                   NGKPAAALGIQLSAAGNALSTSEAVHQKMEELSRFFPDGVSHTIPYDTTPFVEASIEKV
FT                   LHTLLEAVALVFVVMFLFLQNFRYTIIPTIVVPIALTGTVAVMLAAGFSINVLTMFAMV
FT                   LAIGILVDDAIVVIENVERIMATEGLPPREATEKAMGQISGAIVGITLVLAAVFVPMAF
FT                   FPGSSGIIYRQFALTMVVSILFSAFLALTLTPALCATFLKPISGHHERKGFFGWFNRNF
FT                   DRLTERYTSAVGLVTRRRLVMMAFYLVLVGATAMGFLRLPTSFLPNEDQGFIIADIQTP
FT                   ATASSNRTDEVLGQATQMFQRSDAVENTVAIRGFSFSGQGPNAGLMFVTFKDWAEREQS
FT                   AQDIANAANMEMFGYQDAQAFALSPPPIPGFGATGGFSFRLQDRGGQGQEALLAAAQQI
FT                   IAKAQENGIATGLRIEGLPSAAQVFVTIDREKANAFGVTFADISATISQYLGSAYINDF
FT                   PNAGKMQRVVMQAEDDSRMQAEDILALTVRNAGGGMVPFSSFASVAWEQGPSQVVGYNG
FT                   YPAIRIAGAAGPGYSSGAAMAEMERLAAELPPGFGYEWTGQSLEEIQAGSQATLLYAMS
FT                   ILFVFLLLSGLYESWSIPLSVMLVVPLGVLGCVVAVMLRDMPNDIYFKVGLIAIIGLSA
FT                   KNAILIVEFAKDLREQGQSLIDAAVTAAKLRFRPILMTSLAFTLGVVPLAIATGPSAAS
FT                   QNAIGTGVIGGMVAATVLAVFFVPVFFVFVLGGVSRLTGGRTAAGPQADTAG"
FT   sig_peptide     106488..106568
FT                   /locus_tag="Pden_2942"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.735) with cleavage site probability 0.345 at
FT                   residue 27"
FT   gene            109715..111163
FT                   /locus_tag="Pden_2943"
FT   CDS_pept        109715..111163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2943"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: atc:AGR_C_4622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2943"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71027"
FT                   /db_xref="GOA:A1B683"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A1B683"
FT                   /protein_id="ABL71027.1"
FT                   /translation="MIQTLPLSRRGLLGGLVSTLALAACNPVSHTAPRAEVAGAFAASS
FT                   PARRAGANAWWAAFRDKRLDGLIAAGLNRNLDVQTAVATIREAQANARLVGASDLPQVE
FT                   AQGAAARNRSETGIVESSSATLGVSWLVDLFGQNRAARQGASARLDAAYLSAEVARLTV
FT                   ASAIASAYVDARYYQEALALTRQSLTSRKRTLEMTRTQDAFGSVSRLEVLQAEQLVAQA
FT                   EAALPGLEVGFDQSVNRLATLTAGRSADLAAQLRQGGGQPRARYSASVGVPADVVRVRP
FT                   DVRMAERNLAAAAADVGEAQAAFYPRLTLSGSITPTNIGGGGSSKSWGFGPQISLPLFS
FT                   GGANQAQLSAAQARAEQARLAWQASVLGAVEEVENALAGYNRDARAVAAQSRLVENARE
FT                   TVNLTRSSYELGEADFFPVLDAERSLLSARQELAAAVRQQALNFVALSAASAGGVGLPA
FT                   TSGIDRPAGNGHVPLTSGESRLGD"
FT   sig_peptide     109715..109810
FT                   /locus_tag="Pden_2943"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.716 at
FT                   residue 32"
FT   misc_binding    111129..111259
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 60.73"
FT   gene            111383..113182
FT                   /locus_tag="Pden_2944"
FT   CDS_pept        111383..113182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2944"
FT                   /product="hydroxymethylpyrimidine synthase"
FT                   /note="PFAM: thiamine biosynthesis protein ThiC; KEGG:
FT                   gox:GOX2225 thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2944"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71028"
FT                   /db_xref="GOA:A1B684"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1B684"
FT                   /protein_id="ABL71028.1"
FT                   /translation="MSQTIPQITTGPLPGSRKIHVPGSLHDIRVPMREIAVSNEPPLVV
FT                   YDSSGPYTDAAVQADIARGLPDLRGDWQLRRGDVAPYPGRQVTAADNGFAEGARLTPAF
FT                   PLRRDPLRAAAGRAVTQLAYARAGIVTPEMEFAAIRENEGRLVAHARDGAPMGAELPDL
FT                   VTPEFVRAEIAAGRAIIPANINHRELEPMIIGRNFKVKINANIGNSAVTSSMEEEVEKM
FT                   VWAIRWGADTVMDLSTGRNIHNIRDWIIRNAPVPIGTVPLYQALEKVGGVAEDLSWEVF
FT                   RDTLVEQAEQGVDYFTIHAGVRLHMIPLTARRVTGIVSRGGSIMAKWCLHHHRESFLYE
FT                   RFDEICEIMQAYDVSFSLGDGLRPGSIADANDEAQCAELRTLGELTKIAWARDCQVMIE
FT                   GPGHVPMHKIKANMEEQLRHCHEAPFYTLGPLTTDIAPGYDHITSAIGAAMIGWFGTAM
FT                   LCYVTPKEHLGLPDRDDVKTGVITYKLAAHAADLAKGHPGAQRRDDALSRARFEFRWQD
FT                   QFNLGLDPDTAQAMHDETLPKEAHKLAHFCSMCGPKFCSMRISHDIRAEAEKQAGMARM
FT                   AEKFREGGALYLPVAESVAEAAD"
FT   gene            complement(113238..113993)
FT                   /locus_tag="Pden_2945"
FT   CDS_pept        complement(113238..113993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2945"
FT                   /product="Exopolysaccharide synthesis, ExoD"
FT                   /note="PFAM: Exopolysaccharide synthesis, ExoD; KEGG:
FT                   mes:Meso_1827 exopolysaccharide synthesis, ExoD"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2945"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71029"
FT                   /db_xref="GOA:A1B685"
FT                   /db_xref="InterPro:IPR010331"
FT                   /db_xref="UniProtKB/TrEMBL:A1B685"
FT                   /protein_id="ABL71029.1"
FT                   /translation="MARAAGFDADDQGSPRNQDRMSQNQPPEPTPPPKDPMPPNGDAGT
FT                   PDDPAAEGRTHRQHLSQFLMRIADDDTRARISVTDLLVLLEGRATAGLLLLFAFPNVLP
FT                   MPPGTSGILGLPLVYLSFQMMLGHRPWLPRFIAGRSVPRADFAAIIARSAPFLARAERL
FT                   LSPRIPVLTGPLALHIIGALCLVLSILLLLPIPLGNMLPALAISVLALGVLERDGIWIV
FT                   AGSLIAVLAAAVVWGVIWAFFRGLALLLA"
FT   gene            complement(114101..115021)
FT                   /locus_tag="Pden_2946"
FT   CDS_pept        complement(114101..115021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2946"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: rsp:RSP_2257
FT                   putative fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2946"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71030"
FT                   /db_xref="GOA:A1B686"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1B686"
FT                   /protein_id="ABL71030.1"
FT                   /translation="MILCAGESLIDMVPEGANYRPLPGGAVYNTAIALGRMGAQAGYLW
FT                   PISRDGFGDMLLRPLAEAGVDTGLCPRSDRLTTLAFVTLTGGEARYSFYDEGSAGRMFA
FT                   PGALPDIPDDVSALFIGGISLVPDPCGSAVEVLVERVRHRMPVMLDPNIRPFFIADEAA
FT                   YRARLDRLIGMADLVKLSGDDLEWLMPGASFEEAAAAILDRGPRVVFQTGGSAGARAHW
FT                   SGAPLAAQAVRVEVADTIGAGDTFNAGVLAALDRAGVLTREGIQRLTPEAIAAALALGT
FT                   RAAAITVSRPGANPPWAHELAALPS"
FT   gene            complement(115042..116349)
FT                   /locus_tag="Pden_2947"
FT   CDS_pept        complement(115042..116349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2947"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_2260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2947"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71031"
FT                   /db_xref="GOA:A1B687"
FT                   /db_xref="UniProtKB/TrEMBL:A1B687"
FT                   /protein_id="ABL71031.1"
FT                   /translation="MPTPPSEYRYPCENCGASLEFSPGQQSLVCPYCGHEQHIGPGPAR
FT                   APARQPQQGPWGESAILLDPATGRALQWDGGHKSPGLRELPLEHGLSLDQHSDLTETVR
FT                   TLSCPNCGAKVEITSDRHASACPFCATAVVTDTGTTRHIKPQGVLPFVITEVQAKTALE
FT                   DWLHGLWFAPSGLTAYARRGKRMSGVYSPFWTFDADTASRYTGARGDWYYETVYVTQMV
FT                   NGRQQRVAQQVRKTRWTPVSGQVARDFDDVLVLASSSLPRRITDALTPWELSHLVPYQP
FT                   EYLAGFLAEGYTIPLASGHGIARQEMAGVIAMDVRRAIGGNEQRITGIETRYSDETFKH
FT                   VLLPVWTAAYRYNGKSYRFVVNGQSGRVQGERPWSVWKIAFAVLLALALLLALLWLNER
FT                   GDFVRIGAAPLTPDISMSGSYRYQETGAGGPAVRSG"
FT   gene            complement(116359..117489)
FT                   /locus_tag="Pden_2948"
FT   CDS_pept        complement(116359..117489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2948"
FT                   /product="antifreeze protein, type I"
FT                   /note="KEGG: rsp:RSP_2261 antifreeze protein, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2948"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71032"
FT                   /db_xref="InterPro:IPR025640"
FT                   /db_xref="InterPro:IPR033880"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A1B688"
FT                   /protein_id="ABL71032.1"
FT                   /translation="MSLFNILGGEFIEIIEWTDDSRDTMVYRYPTVGKAIKYGAKLTVR
FT                   EGQAAVFIHEGQLADVFAPGLYMLETNNLPILTRLQHWDHGFRSPFKSEIYFVNTTRFN
FT                   DLKWGTKNPVIARDPEFGPVRIRAFGTYSMRVTDPGRFMTEIVGTDGEFTRDEISFQLR
FT                   NIIVQEFSRMIAGSGIPVLDMAANTGDLGQMVAKAISPTVAAYGLTIPEFYIENISLPD
FT                   EVEKMLDKRTSMGIVGDLNRFGQYAASEAMLNASNQPGGMGAGIGAGLGAGMGVAMAQR
FT                   GPWGAVPQQPPQQQAPQTPPPLHHPETVWHIAVNGQADGPYGRAHLGRLVREGGFTRET
FT                   LVWTPGQDGWKPADEVAELAQLFTVAPPPPPLPKAE"
FT   gene            complement(117505..118170)
FT                   /locus_tag="Pden_2949"
FT   CDS_pept        complement(117505..118170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2949"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2949"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71033"
FT                   /db_xref="UniProtKB/TrEMBL:A1B689"
FT                   /protein_id="ABL71033.1"
FT                   /translation="MRWPARLLVALLALGAAGTGNAGPDATPARDWIAQASGRPGAWTD
FT                   HGLLELPSGMLFVGDPTWGDDYHIRDPRRLATAALRVFSRSDEQGRNLALWLEAAGGEP
FT                   KATGERIEFGVDAATIALGDLEGGRALVAWGESRLEKGLGDSFDWLSPILQEKMNFARW
FT                   LPIPPDDRPIFIASTGMDGGLAAVWLLDERGSLSGILIDIAGRASDGQYLDTLLPAAQ"
FT   sig_peptide     complement(118102..118170)
FT                   /locus_tag="Pden_2949"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 23"
FT   gene            complement(118177..119208)
FT                   /locus_tag="Pden_2950"
FT   CDS_pept        complement(118177..119208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2950"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_2263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2950"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71034"
FT                   /db_xref="InterPro:IPR021323"
FT                   /db_xref="UniProtKB/TrEMBL:A1B690"
FT                   /protein_id="ABL71034.1"
FT                   /translation="MTLTARSRLPRSAALALLALLAACAPEPPAEAPPPAVEAPPPPDR
FT                   PDPPPVDQAALRRERAENARAAAARAEAAAASPASRNMRDYLAGIEEALIARGRLRTDA
FT                   GSEIALTPEKLTDAFIEVALHDEYMREGGKLISRPTPAPLRRWQQPVLMRLEFGDSVAP
FT                   DQRARDRAEIAGFAARLARVSGHPVALTGGAGNVNVLILNEDERRAIGPRLSSLMPGIP
FT                   SGDIAALRDLAPQNYCTVFAYSSGNSPVYAQAVALIRAELPPRLRRSCIHEELAQSMGL
FT                   ANDSPRARPSVFNDNEEFAYLTRHDELLLQILYDPRLRPGMTEAEARPIVLQIARELLG
FT                   TEV"
FT   sig_peptide     complement(119113..119208)
FT                   /locus_tag="Pden_2950"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.760 at
FT                   residue 32"
FT   gene            complement(119205..120398)
FT                   /locus_tag="Pden_2951"
FT   CDS_pept        complement(119205..120398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2951"
FT                   /product="toxic anion resistance family protein"
FT                   /note="PFAM: toxic anion resistance family protein; KEGG:
FT                   sil:SPO2986 tellurite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2951"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71035"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:A1B691"
FT                   /protein_id="ABL71035.1"
FT                   /translation="MKGRSRMTTQTQASAQAALDEIQTVTAVVLPEPPAAAPTLTEAEP
FT                   AVAAEIRRRMEEVDIRDSGSIVHFGARAQNELQEISQAMLADVKNKDVGPAGESLREIV
FT                   TTIRGFSVSELDVRRQRSWWERLLGRAAPFAKFVANYEEVQGQIDRIAMDLDQHQHRLL
FT                   KDIRSLDLLYDRTLNFYDELALYIAAGEEKLAQIDRDEIPAKEAAVEAAAENDKVMAAQ
FT                   ELRDLRSARDDLERRVHDLKLTRQVTMQSLPSIRLVQENDKSLVTKINSTLVNTVPLWE
FT                   TQLAQAVTIQRSAEAARAVKEANDLTNDLLTANAKNLREANAQIRTQVERGVFDIEAVR
FT                   TANAELISTIEDSLRIADEGRTRRAAAEEDLKVMEAELRKTLASASARSATPAAKTP"
FT   gene            complement(120579..121031)
FT                   /locus_tag="Pden_2952"
FT   CDS_pept        complement(120579..121031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2952"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2952"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71036"
FT                   /db_xref="UniProtKB/TrEMBL:A1B692"
FT                   /protein_id="ABL71036.1"
FT                   /translation="MPNKATVRGVLMDATLAPVAAGKIVATLQGSDVFEGGVRVVTEQV
FT                   EATTDAQGGWSLDLIVNGEGERAGTTWTVAGYSPYVAKLFEVRSLFLASALETTLGDLE
FT                   RTSAQNLKAAREGGAVRLIVAPDYDRYLALPEGQRRPNDLVLVRPQ"
FT   gene            complement(121116..122165)
FT                   /locus_tag="Pden_2953"
FT   CDS_pept        complement(121116..122165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2953"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: mes:Meso_0590 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2953"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71037"
FT                   /db_xref="GOA:A1B693"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1B693"
FT                   /protein_id="ABL71037.1"
FT                   /translation="MIATPIMDESRQMPGHDPSPDLNQPRLQIGFLLTPRFTLSAFATF
FT                   VDVLRLAADDGDGSRPIRCRWRVLSADMAPVQSSCGMRIEPEERLGDPGRFDYIITVGG
FT                   LIDGGPGLSPEQAAFLRRAAMGRVALGGLCTGVFAMARIGLMDGYRCCVSWFHHQDFLA
FT                   EFERMRPVSDQIFVVDRDRISCSGGVSAAHLAAFLIDRHLGRAAARKALSILMIDEPMA
FT                   GDRPQPGLPLELNARDPLVRRALLAMQQNLHAPLPIARIARDLGVGRRKLERHFNADLG
FT                   IPPADASIRIRLAQARMLLARTDRTVTRIAEETGFCDASHLIRVFRETEGTTPDLWRQN
FT                   RGLLAEDAP"
FT   gene            complement(122201..123535)
FT                   /locus_tag="Pden_2954"
FT   CDS_pept        complement(122201..123535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2954"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   jan:Jann_2214 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2954"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71038"
FT                   /db_xref="GOA:A1B694"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A1B694"
FT                   /protein_id="ABL71038.1"
FT                   /translation="MPSDRERRSHMFPLSPPSDKGVAKVANWAVIGIFVILLFSFFAQA
FT                   RSFLMPVTLAILLFFVFIPFRRLMERLGIGAVITAAIVSLGLVVAVVLIGFVISGPANR
FT                   LIENAPQITQRLEQRFTEIRSNFRGLERAAEKIDEIAGGSSSPPEPAAPPGEAPPDATL
FT                   TGTLSAIPAPGAPQPPDQQIQVEVNATPETSTLASALNLGPALVGQIIFTLFLLFFLIS
FT                   SGDLLYLKIVQSFDSMREKRAAYLALREIEDSLGTYLGAITLINACLGVAIGLAMWAWG
FT                   MPSPVLFGLAAFLLNFIPYLGSVAGIIIATLVGVFVFDDLFAPLMVGLTYLAITALEGQ
FT                   LITPYFVSRRLQLNTVVVFLTVALWAWLWSVIGMIVAVPLLVVMRVLAEHIPGLQKFGN
FT                   FLAGEDPPALEDDDEEEARELVEAGDEAGDAAAASAATMVLATKD"
FT   gene            complement(123627..124850)
FT                   /locus_tag="Pden_2955"
FT   CDS_pept        complement(123627..124850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2955"
FT                   /product="carboxynorspermidine dehydrogenase"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG: rsp:RSP_1475
FT                   saccharopine dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2955"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71039"
FT                   /db_xref="GOA:A1B695"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1B695"
FT                   /protein_id="ABL71039.1"
FT                   /translation="MAKNVLIIGAGGVAQVVAHKVAQNAKEFGTLHIASRTVSKAEKII
FT                   ASIREKGHSVEFTAHPLDAMDSKAVAELIRGIEAGIVINVGSAFVNMTVLQGCIDTGAA
FT                   YIDTAIHEDPAKVCETPPWYANYEWKRREDCAAAGVTAILGAGFDPGVVNAYARLAEDE
FT                   YFDKIDSIDIVDINAGSHGRWFATNFDPEINFREFTGTVYSWQGGEWRQNKMFEVGREW
FT                   DLPVVGKRTAYLSGHDEVHSLSARYKDADVRFWMGFGEHYINVFTVLKNLGLLSEQPVK
FT                   TAEGQEVVPLKVVKAVLPDPASLAPDYEGKTCIGDLVKGTLDGKPGEVFIYNVADHKDA
FT                   YNEVGSQGISYTAGVPPVAAAILVARGTWDVKRMVNVEDLAARPFLELLGELGLPTRVI
FT                   DATGDHPL"
FT   gene            complement(124897..126003)
FT                   /locus_tag="Pden_2956"
FT   CDS_pept        complement(124897..126003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2956"
FT                   /product="carboxynorspermidine decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /note="TIGRFAM: carboxynorspermidine decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: sme:SMb21631 putative
FT                   carboxynorspermidine decarboxylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2956"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71040"
FT                   /db_xref="GOA:A1B696"
FT                   /db_xref="InterPro:IPR005730"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A1B696"
FT                   /protein_id="ABL71040.1"
FT                   /translation="MSDLQTPYYLIDLARLRENMERIRYLRERSGAKCLLALKCFATWS
FT                   AFDFMRDFMDGTTSSSLFELRLGHEEFGKETHAYSVAWADHEIDEALGYADKIIFNSLG
FT                   QLDRFGARAAQRGIAMGLRLNPRFSTSGFDLADPARPFSRLGEWDLNRLEQALDRISGV
FT                   MIHYNCENADFELFDAQLARIETEFGGFLERLDWVSLGGGIHFTGEGYPLDRLADRLRA
FT                   FSERFGVQVFLEPGEASITRSTSLEVTVLDVIHHGKDVAIVDSSIEAHMLDLLIYRETA
FT                   KLPQDGEHPWQIAGKTCLAGDIFGEGRFAQPLKVGDRLSIADAGGYTMVKKNWFNGVPM
FT                   PAIAIRDEDGTIHEVRRFTYDDYKASLS"
FT   gene            complement(126127..127152)
FT                   /locus_tag="Pden_2957"
FT   CDS_pept        complement(126127..127152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2957"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; homoserine
FT                   dehydrogenase, NAD-binding; KEGG: mes:Meso_2709
FT                   oxidoreductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2957"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71041"
FT                   /db_xref="GOA:A1B697"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1B697"
FT                   /protein_id="ABL71041.1"
FT                   /translation="MRVLVAGLGNMGRSHALAWLKQPGAELVGLVNRSPVDLPPELAAI
FT                   PQSQDFHEALHRLRPDVAVVSTYSDSHAEYAVAAMRAGAHVFVEKPLATTVEDARRVVE
FT                   CAGETGRKLVVGYILRHHPSWQRLIAEARALGGPYVFRLNLNQQSSGATWQVHKALMRT
FT                   TPPIVDCGVHYVDVMCQITDARPVEVRGMGLRLSDEIATEMYNYGHFQVIFDDGSLGWY
FT                   EAGWGPMMSDTAFFVKDVVSPRGAVSIRMSEDARSDDIDTHTRTATLRLHRVGEPDSDI
FT                   SMQGEPGHQELCDAEAAFMARAIAEDMDLDRHMRDAVSSLAVCLAADESVRTGQPVRLR
FT                   I"
FT   gene            complement(127156..127614)
FT                   /locus_tag="Pden_2958"
FT   CDS_pept        complement(127156..127614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2958"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: putative transcriptional regulator, Rrf2
FT                   family; PFAM: protein of unknown function UPF0074; KEGG:
FT                   rsp:RSP_0443 Rrf2 family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2958"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71042"
FT                   /db_xref="GOA:A1B698"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B698"
FT                   /protein_id="ABL71042.1"
FT                   /translation="MKLSTKGRYAMVALVDLAIAKGDELTSLAEISKRQDISLPYLEQL
FT                   FVRLRRAGLVDSVRGPGGGYRLAKAPETIRVADVLEAVDETVSALHIGAGASGGISGSR
FT                   AQTLSNRLWESLSAHVYVFLHNHTLADVARNQLLPCPALPKILSIVDD"
FT   gene            127780..128439
FT                   /locus_tag="Pden_2959"
FT   CDS_pept        127780..128439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2959"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: jan:Jann_2367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2959"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71043"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1B699"
FT                   /protein_id="ABL71043.1"
FT                   /translation="MPELIFPGPEGRLEGRYHAQAAPDAPIAIILHPHPQYGGTMNNRV
FT                   VYNLHYAFHRMGFTVMRFNFRGVGRSQGEFDQGIGELSDAASALDYLQAMNPNSKHCWV
FT                   AGFSFGAWIGMQLLMRRPEITGFISVAPPANMYDFSFLAPCPSSGLIINGTADRVAPPK
FT                   DTHALVAKLREQKGITITHEEIEGADHFFRDDEVHMKPMIDTVQAYVRRRLTENTR"
FT   gene            128477..129601
FT                   /locus_tag="Pden_2960"
FT   CDS_pept        128477..129601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2960"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase, HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase, HD region;
FT                   KEGG: sil:SPO2028 HD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2960"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71044"
FT                   /db_xref="GOA:A1B6A0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6A0"
FT                   /protein_id="ABL71044.1"
FT                   /translation="MTDLTLRFAFLTEADRLKSVERANVLMDLSRPENSAEHSWHVALY
FT                   ALVFGASDRAIAMLLLHDLVEIDCGDHPIHLVHDTAAVQAAEDAAARRLFGMLPGGETL
FT                   LALWREFEAGESPDARIAKRMDHVQPLFQVLCAPRPLADHVGIVRDNMTSGRARRLWAE
FT                   WPEAMEAAQALLEGRAPCGELAQRLAFLAEADRLKSVLRASLLCDGSRRENSAEHSWHL
FT                   ALYALVMAAHAGPGVEIGRVIRMLLLHDLVEIDTGDVPIHAQNGAAHHGAAQLQAEAEA
FT                   AERIFGLLPKAQGAELRALWTEFEANETPDAVFAKSLDRAQPVMQNIASGGGTWVEYRV
FT                   SYEQLVERVGLRIERGAPTLWTWLSESARVYFRG"
FT   gene            129721..130935
FT                   /locus_tag="Pden_2961"
FT   CDS_pept        129721..130935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2961"
FT                   /product="isocitrate dehydrogenase (NADP)"
FT                   /EC_number="1.1.1.42"
FT                   /note="KEGG: rsp:RSP_1559 isocitrate dehydrogenase;
FT                   TIGRFAM: isocitrate dehydrogenase, NADP-dependent; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2961"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71045"
FT                   /db_xref="GOA:A1B6A1"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6A1"
FT                   /protein_id="ABL71045.1"
FT                   /translation="MSKIKVENPVVELDGDEMTRIIWDFIKKKLILPYLDLDLKYYDLG
FT                   IEERDATSDQITVDAAEAIKQYGVGVKCATITPDEARVEEFGLKKMWKSPNGTIRNILG
FT                   GVIFREPIICKNVPRLVPGWTQPIVVGRHAFGDQYKATDFRFPGKGKLTIKFVGEDGET
FT                   IEHEVYQAPGAGVAMAMYNLDQSIIDFARASMNYGLNRGYPVYLSTKNTILKAYDGRFK
FT                   DLFQKVYEEEFEAEFKKKGIHYEHRLIDDMVASAMKWSGGYVWACKNYDGDVQSDTVAQ
FT                   GFGSLGLMTSVLMTPDGKIVESEAAHGTVTRHYREHQKGNQTSTNSIASIFAWTGGLKH
FT                   RAKLDDNAALLNFAQTLERVTVQAVEDGFMTKDLALLVGPDQKWLTTMGYLEKVDEYLN
FT                   KALAG"
FT   gene            131180..131848
FT                   /locus_tag="Pden_2962"
FT   CDS_pept        131180..131848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2962"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   I; PFAM: CobB/CobQ domain protein glutamine
FT                   amidotransferase; KEGG: rsp:RSP_2128
FT                   phosphoribosylformylglycinamidine synthase I (FGAM)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2962"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71046"
FT                   /db_xref="GOA:A1B6A2"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6A2"
FT                   /protein_id="ABL71046.1"
FT                   /translation="MKAAVITFPGSNCDRDLAVALQQAGAEVARVWHKDEALPAGTDLV
FT                   AVPGGFSFGDYLRCGAIAAHSPIAGAIKAHAARGGYVLGICNGFQVLTELNLLPGALMR
FT                   NAGLRFLCREAVLRVATAASPFTAAYAPGEEIRVPVAHHDGNYQIDPEGLAALKDQDRI
FT                   AFTYAPGVNGSVEDIAGVLSENRRVLGMMPHPERAADPAHGGTDGARLFASLVQELVAA
FT                   "
FT   gene            131915..133708
FT                   /locus_tag="Pden_2963"
FT   CDS_pept        131915..133708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2963"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: rsp:RSP_2129 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2963"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71047"
FT                   /db_xref="GOA:A1B6A3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6A3"
FT                   /protein_id="ABL71047.1"
FT                   /translation="MQEEDNSIGFPEGRAGLTSRWGLRGAIAVLLIVAAGTVWFTNAWL
FT                   TARFSETTRVRTELRSALYTGNLLSELQRTSVVPLLLARDPALISALSGNDFSGTSARL
FT                   ISAQKEIAAASIKLLDASGRVVGSTDRNLIGTNYVQEPFFVEALRSKDTVFTVSPSPQG
FT                   VYEFTYSRTVVSDGRTLGVVVVGADLTRLVRSWAGISDAIAVTDSAGQIILSTEPRWRG
FT                   LTLPEALAVRSAPSAIARAFQVTADWAATPADAYVQGRAVMQSETRIPFRGWKMIAFTT
FT                   YESVRERVNAVLAMVIMGFAILLAAVFYLLSRRARVESAAWMRESADLRALNMRLTREI
FT                   AERERMQKELRVAEQTVQQSSKLAALGEMSAGVSHELNQPLAAMKTYLAGARLLLQRGR
FT                   AEEAQSSFQRIDDLVERMGAITRQLKSYARKGGEAFEPVDLRAALSSALVMMEPQLRSR
FT                   TIRLQRTIPRYPVMVYCDRIRLEQIIINLLRNAVDAIKGVRDPAIEITVSSGSHAFLSV
FT                   RDNGPGVSDLENLFEPFFTTKKPGEGTGLGLAISSGIAADFGGRLTAHNALDEGGRGAV
FT                   FELELPLHDPGQKAGPRLAAE"
FT   gene            133728..135053
FT                   /locus_tag="Pden_2964"
FT   CDS_pept        133728..135053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2964"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor,
FT                   interaction domain-containing protein; helix-turn-helix,
FT                   Fis-type; SMART: AAA ATPase; KEGG: sit:TM1040_1461 two
FT                   component, sigma54 specific, transcriptional regulator, fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2964"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71048"
FT                   /db_xref="GOA:A1B6A4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6A4"
FT                   /protein_id="ABL71048.1"
FT                   /translation="MSRTLKIAVVDDEPDMRESISQWLALSGFDAETFATAEEALKAIG
FT                   ADWPGVVISDIRMPGMDGMAFLKRLMGIDSGLPVIMITGHGDVPMAVEAMRIGAMDFME
FT                   KPFNPERLTELVKKATQARRMTLDNRALRRDLSEGQQVMSKLIGSSPVMDRLREDILDL
FT                   GQADGHVLIDGETGTGKTLVAHALHAVGPRASKKFVPISCAAYNDEVLSAKLFGPVENG
FT                   LPAVEEARGGTLCLEDIEALSDALQARLLAFIAEQGSPAETRIIAISNARGEGRRAEDS
FT                   LRPDLFYRLTALKITLPPLRSRGEDILTLFTRMTEQFAEEYGCEPPQVTAQEAAQLLQA
FT                   PWPGNVRQLINVAERAVLQNRRGSGSITSLLMADGEDTQEATTTEGKPLKEYVESFEKM
FT                   LIDNTMRRHKGSIAAVMDELCLPRRTLNEKMAKYGLSRSDYL"
FT   gene            135504..138113
FT                   /locus_tag="Pden_2965"
FT   CDS_pept        135504..138113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2965"
FT                   /product="RNAse E"
FT                   /EC_number="3.1.4.-"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein; KEGG: sil:SPO1893 ribonuclease,
FT                   Rne/Rng family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2965"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71049"
FT                   /db_xref="GOA:A1B6A5"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR028878"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6A5"
FT                   /protein_id="ABL71049.1"
FT                   /translation="MSKKMLIDATHSEETRVVVVDGTKVEEFDFETVNKRQLAGNIYLA
FT                   KVTRVEPSLQAAFVDYGGNRHGFLAFAEIHPDYYQIPAADRKALLEEERQAAAAEADEG
FT                   EKPKRNPRRRKPAKAAAAESGDAVLVSDEIAGMTVVDPSEGEAVPLDAPLAADTAEAAA
FT                   PAAAADSAEDAPAEEAAEDDGIESVAEEDMAEEISAPKKPRARRYKIQEVIKVRQIMLV
FT                   QVVKEERGNKGAALTTYLSLAGRYCVLMPNTARGGGISRKITNAADRKKLKEIASELEV
FT                   PEGAGLIIRTAGSQRTRTEIRRDYEYLMRLWEQIRDLTFKSIAPAPIYEEGDLIKRTIR
FT                   DLYSKEIDEVLVEGERGYRTAKDFMKMIMPSHAKNVKHYTDAMPLYARYQVESYLGGMF
FT                   NPVVQLKSGGYIVIGVTEALVAIDVNSGRATKEGSIEDTALKTNLEAAEEIARQLRLRD
FT                   LAGLIVIDFIDMEERKNNAAVEKRFKDKLKTDRARIQVGRISGFGLMEMSRQRLRPGML
FT                   ESTTQPCPHCHGTGLIRSDDSLALTILRAIEEEGTRKRSREVLVKAPVAVANFLMNAKR
FT                   EHIANIEARYGLSVRVEADPALISPDYAIEKFKTATRNVPEVVSPVVSVDARLMAQIDD
FT                   EEPAEEEVEEIADEPVEEDRAESGDGENGSKRRRRRRRRRGGKNGEDEAPHAGDDADEV
FT                   ALETEEADQPAEVEVIVEAVESAPEPVAEEAEKPRRRTRTRRRKADEPAEAVAEAGPAE
FT                   GAQPGEPAETAADAPQPVAEASEVEQPAEAVEPAVEPEPEAAAADVPPADEAVETVPAG
FT                   ETAGSEAVAPQSEADTAAEPAPAPEPEALPAAVRVPEPAAANEEPARPKRRGWWSLG"
FT   gene            138190..138933
FT                   /locus_tag="Pden_2966"
FT   CDS_pept        138190..138933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2966"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region; KEGG: rde:RD1_2269 cytochrome c-type biogenesis
FT                   protein CcdA"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2966"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71050"
FT                   /db_xref="GOA:A1B6A6"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6A6"
FT                   /protein_id="ABL71050.1"
FT                   /translation="MLGIELADAAFLPAATVALLAGILSFLSPCVLPIVPPYLAYMTGV
FT                   GVGGLKSGERSAVVPALFFVMGLSTVFLLMGMAASAFGRMFLQWQDLLARGAGVVVILL
FT                   GLHFLHIIRIPFLDAEARIDAQERGGSALGAYALGLAFAFGWTPCIGPQLGMILSLAAT
FT                   GGAMGKGTALLAVYALGLGIPFLLSAIFINRAIGLMNRIKPHLKLIERVMGGLLVVVGA
FT                   ALLTGAFPAFAYWLLETFPWLAALG"
FT   gene            complement(138930..139730)
FT                   /locus_tag="Pden_2967"
FT   CDS_pept        complement(138930..139730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2967"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rsp:RSP_3833 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2967"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71051"
FT                   /db_xref="GOA:A1B6A7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6A7"
FT                   /protein_id="ABL71051.1"
FT                   /translation="MKDGNPEPLVLRKDDGPVARLILNSPMNYNALSTAMIDTLSDALD
FT                   EIGADDGVRVVVLAARGKAFCAGHDLREMQGARNDEDDGRAAYARLFSRCAAMMQKLPA
FT                   LPQPVIAEVQGIATAAGCQLVASCDMAVAAEGVRFGVNGVNIGLFCSTPMVALTRAIPP
FT                   RAAFELLVTGEFMDAARARELGLVNRVAPPEALEAETMALARSIAAKLPAAVRMGKRAF
FT                   HAQRNLGLADAYATAGAVICENLLLPDTAEGIQAFLEKRPPNWD"
FT   gene            139815..140237
FT                   /locus_tag="Pden_2968"
FT   CDS_pept        139815..140237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2968"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: uncharacterized domain 1; PFAM:
FT                   thioesterase superfamily protein; KEGG: sit:TM1040_1390
FT                   phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2968"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71052"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6A8"
FT                   /protein_id="ABL71052.1"
FT                   /translation="MALAMGREALNEFLDRVFPQIAGQVRVESLDEARLTARLAVDDQH
FT                   LRPGGTVSGPAMFALADVTIYLAILARIGEVALAVTTNASIDFMRKPEAGRDLLAECRI
FT                   LKLGRILAVGEVLIRSEGAEEPVARCSMTYSIPPKR"
FT   gene            140388..140852
FT                   /locus_tag="Pden_2969"
FT   CDS_pept        140388..140852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2969"
FT                   /product="LSU ribosomal protein L13P"
FT                   /note="PFAM: ribosomal protein L13; KEGG: rsp:RSP_0022 50S
FT                   ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2969"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71053"
FT                   /db_xref="GOA:A1B6A9"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1B6A9"
FT                   /protein_id="ABL71053.1"
FT                   /translation="MKTYTAKPAEIEKKWILIDAEGVVLGRLASIVAMRLRGKHKPTFT
FT                   PHMDMGDNVIIINADKVQMTGDKRDAKKYYWHTGHPGGIKHRTARQVLEGAHPERVVIK
FT                   AVERMISRNKLGKQQMTNLRVYAGAEHPHEAQQPEVLDVKSMNAKNTRSA"
FT   gene            140856..141335
FT                   /locus_tag="Pden_2970"
FT   CDS_pept        140856..141335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2970"
FT                   /product="SSU ribosomal protein S9P"
FT                   /note="PFAM: ribosomal protein S9; KEGG: rsp:RSP_0021 30S
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2970"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71054"
FT                   /db_xref="GOA:A1B6B0"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6B0"
FT                   /protein_id="ABL71054.1"
FT                   /translation="MAEDIKTLDDLKSVATAAPAAAPVREAQRDSLGRSYATGKRKDAV
FT                   ARVWVKPGSGKVVVNGKDIAEYFARPVLQMILRQPFEVAGVTGQYDVYATVAGGGLSGQ
FT                   AGAVKHGISKALQLHEPSLRPALKAAGFLTRDSRVVERKKYGKAKARRSFQFSKR"
FT   gene            141439..141723
FT                   /locus_tag="Pden_2971"
FT   CDS_pept        141439..141723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2971"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2971"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71055"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6B1"
FT                   /protein_id="ABL71055.1"
FT                   /translation="MRLGTNLLPGPVRELQLAWAKAGIIRLNLRQKNDRKSLVCDFSSD
FT                   GAHFSACKPGAQPLDTASPTRRGAAAGRTVGAEARVARKFWEAMAWTSP"
FT   gene            complement(147370..148221)
FT                   /locus_tag="Pden_2972"
FT   CDS_pept        complement(147370..148221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2972"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lbl:LBL_1989 transposase, ISLbp9"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2972"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71056"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6B2"
FT                   /protein_id="ABL71056.1"
FT                   /translation="MHASLAITPEGLPLGLTAAKFWSRSKFKETTALKRKINPTRVPIE
FT                   QKESMRWLDNLRLSTELAGAPGRCVHIGDRKSDIYELYCLAVELGTGFLMRSCVDRLAE
FT                   DGVTTVSKVMAQIQSSGTHEVRFRDAQNQEHRALLTIRHATMAVRPPIGKQRKYRHQTL
FT                   QIIHAEEMDPPEGRAPVFWKLITNLPVESHTQAVHKLDWYAPSVIAAACTSPRPRCRQK
FT                   TVISNTAVGVSLPALVGRRSPARICDPVDFALGFAPGCFRCDSGAAGARMQKASRRRLK
FT                   RL"
FT   gene            148297..148500
FT                   /pseudo
FT                   /locus_tag="Pden_2973"
FT   gene            complement(148499..150403)
FT                   /locus_tag="Pden_2974"
FT   CDS_pept        complement(148499..150403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2974"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; KEGG: rpe:RPE_2164
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2974"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71057"
FT                   /db_xref="GOA:A1B6B3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6B3"
FT                   /protein_id="ABL71057.1"
FT                   /translation="MLDILSGQWCEDEERAFIIVCGDNPTIDMLRVALPRYFPSLVDGI
FT                   SVLRRPVATDVEGVTNLREIQETLAPLLSGDNRLLLVGDWVQAGLNLHHVADGIIFFSL
FT                   PWEIDSIDQLIGRVDRLGATGERKGGRRVIDIWRILIEGSQETAIADTVAELGVFDSPL
FT                   PPLSPTDLAELQTTLGHAAIRRKAALLVTPLAGKGIGLPSLFRDAEPFTQQQAAADFEL
FT                   WREKPCPAPAMMSDIARPNETPIRREERALGAWLRTIKASKDFDTGGRADKEDGYSFQT
FT                   IWYHGVGERGRAGEAPFSLPGASRESWMSGHVPFIYRRSDISVPPRKIVFTDDGELGAD
FT                   GTRSGRPLRFLDHGSELHDALVSGYTGSVLSAFGTAKPVVQTSVRLPEGHPARGLGPLV
FT                   VVTVAQFDPFPDELLPPAWTAKAREILNSAPTDVQKSALSADRRMLHTLFRAFQCRVRV
FT                   AAPAAFMRKGYWKAKDGWRESTEEEVDLCLQPITSSTNNALARGRTPLSALEKHEAVNA
FT                   LRSRQLAKITAEVELYRASALKRIRYEIEDLTDQVSAYFLAEIRNRELNLERRRQAPPE
FT                   AGPVELWQGQVAALERSLSMTRLNFSEATDFLQGLAAGHHLARTVQPCTILLALIADE"
FT   gene            complement(150397..150711)
FT                   /locus_tag="Pden_2975"
FT   CDS_pept        complement(150397..150711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2975"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pat:Patl_4096 DNA-cytosine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2975"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71058"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6B4"
FT                   /protein_id="ABL71058.1"
FT                   /translation="MNPDPSIQPATRIREAPDLPATFGIVDLFSGPGGLGEGFASLDLS
FT                   GHAPFKIGISVEKEASAHRTLTLRAFLRAHQARHGTLPQAFIDFHAGLRTLATAGWRPC
FT                   "
FT   gene            complement(150708..151268)
FT                   /locus_tag="Pden_2976"
FT   CDS_pept        complement(150708..151268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2976"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   sil:SPOA0134 ISSpo7, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2976"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71059"
FT                   /db_xref="GOA:A1B3U0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1B3U0"
FT                   /protein_id="ABL71059.1"
FT                   /translation="MERERHFRQDDDRAGRRPRRGKDRDDRRDLSESAPHRDQHGREKG
FT                   GRGRLVGRTKGGMNTKLHAICDSLGRPLDLFVTAGQVSDYIGARALLSSLPKVDWLLGD
FT                   RGYDADWFREALQDKGIRACIPGRKQRKTPVKYDKRRYKRRNRIEIMFGRLKDWRRVAT
FT                   RYDRCPKVFLSAIALAATVIYWL"
FT   gene            complement(151529..153085)
FT                   /locus_tag="Pden_2977"
FT   CDS_pept        complement(151529..153085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2977"
FT                   /product="TonB-dependent receptor, plug"
FT                   /note="PFAM: Secretin/TonB, short N-terminal domain;
FT                   TonB-dependent receptor, plug; KEGG: rso:RSc2920 putative
FT                   hydroxamate-type ferrisiderophore receptor signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2977"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71060"
FT                   /db_xref="GOA:A1B6B6"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6B6"
FT                   /protein_id="ABL71060.1"
FT                   /translation="MPDRPGRTRILKAVLLASTTFVASGYAAIAQAPQAVQQERMVAFD
FT                   LPAQPLAASLTGFARSTCIKLAYPAALTRGRSAPPQRGSYSPAEALDRLLAGSGLSWRF
FT                   TGANAVAITAPAAAAGTGAAGGGILLDQITLTGESAWGPVSGYVARQTGTATKTDTPIV
FT                   ETPQTINVISADQIKAQGAASVDEALRYTPGVSTDFYGGATYNDYVRLRGFVAPIFAEG
FT                   MRMPSGLRDYAQLRHEPYGLERVEVLKGPSSVLYGQAAPGGMVNALRKRPTAERLRELQ
FT                   LQAGSFGRNQGAFDLGGPLDAGKTLTYRLTGLLRDSGTQVEALRDDRAFLAPSLTWRPD
FT                   ADTALTLYGHYQHDVGGNSPLPALGTVYPTQFGHLPVDAFLGYPDFNRYKRDQFSLGYE
FT                   FEHRFDDRFQLHHKLQYSNIEMDYRYSVLSGLQTDPATGRISLNRSIQHPHDTATALTM
FT                   DNNLQADFDTGPLRHSLLVGLDYTRLDFDSHWGGDYTAGRVDVFAPHHDNRPADPVLYP
FT                   D"
FT   sig_peptide     complement(153002..153085)
FT                   /locus_tag="Pden_2977"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.702 at
FT                   residue 28"
FT   gene            complement(153212..154198)
FT                   /locus_tag="Pden_2978"
FT   CDS_pept        complement(153212..154198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2978"
FT                   /product="putative FecR"
FT                   /note="PFAM: FecR protein; KEGG: nwi:Nwi_2050 probable
FT                   FecR, iron siderophore sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2978"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71061"
FT                   /db_xref="GOA:A1B6B7"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6B7"
FT                   /protein_id="ABL71061.1"
FT                   /translation="MERRQPAHPPRDLSDQALGWIVRLNSGEATRADREAYRSWKALSR
FT                   DHALAAAEAETLWDYASEIGRDPETGLIQPGKGRRRRASRRDALAVLAGLGLAGAGGVW
FT                   LHRRQSPLPDHATGLAQTRTVVLPDGSRVTLNAMSAIGVDYSPQARQVVLIEGQVYFEV
FT                   AADPSRPFEVRAGEIGVLALGTAFDVDRTLPGHALAVSVARHSVSVRRLDDAEPRQSPT
FT                   IVREGERLVIPSAGPVGAPVPQDGSAVAAWRDGIHVAENRRLEEVIAAFRPYHRGWIVI
FT                   RGERLKALRVNAVLDLRTPETSLAALEGGLPIRVCVVSRYLTVITEP"
FT   gene            complement(154267..154779)
FT                   /locus_tag="Pden_2979"
FT   CDS_pept        complement(154267..154779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2979"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   bbr:BB4120 ECF-family sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2979"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71062"
FT                   /db_xref="GOA:A1B6B8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6B8"
FT                   /protein_id="ABL71062.1"
FT                   /translation="MARITDHWLTDLFRRHHRDLLRYATRLVGDRDQGEEVVQNTYLRL
FT                   ARRGAAAAAIRYPKTYAFTAARTAAIDLTARRHAEWLHRVDFDAVAELQGGEDAAQALY
FT                   RRQRILRMAVLLNELPVACQTAFLMNKVEGRSHREIAARLGVSVSMVEKHVMRALMHCR
FT                   DLMREEE"
FT   misc_binding    155234..155429
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 107.72"
FT   gene            155557..156567
FT                   /locus_tag="Pden_2980"
FT   CDS_pept        155557..156567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2980"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: ppu:PP_2418
FT                   iron ABC transporter, periplasmic iron-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2980"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71063"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6B9"
FT                   /protein_id="ABL71063.1"
FT                   /translation="MTLRSLFGAVAICGLAAGMAQATDYPLSIENCGQTLVFDSAPERV
FT                   VTIGQSTTEMLYALGLGEQVQGTSVWFNDVLPEFAEVNARIERLADNHPGFESVMAKEP
FT                   QLVTTQFEFHVGPQGAVGTREQFNELGAQVYAMPADCVGKDNLVGGDGARTSEFSIESM
FT                   YRAVRELAQIFDVEERGAVLEAELRGRVDAAVAKAGELGAEGKTAVVWFSSPDLALDPF
FT                   VAGQNGIAGYVLKTIGLRNVVESDEEWPSVGWETIASADPDYIIIARMDRRRFAADDYE
FT                   VKLDYLKTDPVTSRMAAVRDGRIIIVDAHQIHAGIRIPSGIETVVAGIEAGGAQE"
FT   sig_peptide     155557..155625
FT                   /locus_tag="Pden_2980"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            156564..157625
FT                   /locus_tag="Pden_2981"
FT   CDS_pept        156564..157625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2981"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bmb:BruAb2_0477 iron compound ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2981"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71064"
FT                   /db_xref="GOA:A1B6C0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6C0"
FT                   /protein_id="ABL71064.1"
FT                   /translation="MTASATVPVRRRSLGLSRLILGLAALIAALAFGVSVGETVIAPEV
FT                   IWKTLSNQLFGTDYPLRPIQEGIVWNYRLTRAIVAAACGAGLAVSGVVLQALLRNALAD
FT                   PYILGISAGASTGAVLVMVLGIGAGALSLSVGAFAGGILAFTLVIGLARAAGSGIGLPQ
FT                   AGLIILSGIAGTQLFNALTSFVIAQSANAEQVRGVTFWMMGNMSGVRWPDVRLAVPVSA
FT                   LGVLVCMAHARALDAFTFGAESAVTMGVAVRRTQAVLIGVVTMITATMVSITGAIGFVG
FT                   LVIPHAARFLVGVRHDRLLPASALIGAVFLVMADVVSRVIVPGQVLPIGVITALVGAPG
FT                   FAVILIRGRRQRA"
FT   sig_peptide     156564..156677
FT                   /locus_tag="Pden_2981"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.485 at
FT                   residue 38"
FT   gene            157622..158386
FT                   /locus_tag="Pden_2982"
FT   CDS_pept        157622..158386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2982"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rsp:RSP_3390 ABC Fe3+-siderophores transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2982"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71065"
FT                   /db_xref="GOA:A1B6C1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6C1"
FT                   /protein_id="ABL71065.1"
FT                   /translation="MIRLEEASWRAGQTAIVRDIALHVRRGETFGLVGPNGSGKSTVLR
FT                   LVAGVLTPSTGRVRLDGIDQTRLSRRRAARMVAFVAQQADTAERVTVRDAVELGRTPWL
FT                   SMLRPFGPGDDRIVAHALARVGMSDKAGRYWQGLSGGERQRVHLARALAQEPRILLLDE
FT                   PTNHLDIHQQLSILRLVRKLEVTALVALHDLNQALECDRVGVMQAGRLVACGPPAEILT
FT                   PDLIARVFAVRANYLTDPADGHRLIRFALSED"
FT   gene            158387..158818
FT                   /locus_tag="Pden_2983"
FT   CDS_pept        158387..158818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2983"
FT                   /product="pseudoazurin"
FT                   /note="TIGRFAM: pseudoazurin; PFAM: blue (type 1) copper
FT                   domain protein; KEGG: rru:Rru_A1139 blue (type 1) copper
FT                   subtype"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2983"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71066"
FT                   /db_xref="GOA:A1B6C2"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR001235"
FT                   /db_xref="InterPro:IPR002386"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR012745"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6C2"
FT                   /protein_id="ABL71066.1"
FT                   /translation="MRLFPIALLAALASPALAETHLVKMLNGNHLGGMVYEPEFLSVAP
FT                   GDSVKFLATQRGHNAASIDGFLPEGAETFLGRINEEIEITLAHEGFYGIKCSPHFDMGM
FT                   VMLIRVGDAPLEGVELPENMPQGAKDRFAQIVERAGAGE"
FT   sig_peptide     158387..158443
FT                   /locus_tag="Pden_2983"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 19"
FT   gene            158815..159498
FT                   /locus_tag="Pden_2984"
FT   CDS_pept        158815..159498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2984"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: mba:Mbar_A0646
FT                   UbiE/COQ5 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2984"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71067"
FT                   /db_xref="GOA:A1B6C3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6C3"
FT                   /protein_id="ABL71067.1"
FT                   /translation="MSVAPKTAAAMTVHWDGRAHRFEGAASHNRDRDAWRDVLAAAVGQ
FT                   GAQRVVDLGCGTGACAVLLAGMGHHVTGVDGSSAMLAEARRAAARDGVHVDFIHADMDQ
FT                   CGLANGAADVVTLRNVLWTLEDPAEALHLAARLLRPGGKVLVSDGVWRRNPDPTMADLA
FT                   AHLPNACGVSEVEARDWLCGAGFGGITVWHDRFVHHPYGGLYDEPETPIPFFVLTAIRA
FT                   EATRS"
FT   gene            complement(159505..159954)
FT                   /locus_tag="Pden_2985"
FT   CDS_pept        complement(159505..159954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2985"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: hne:HNE_1237 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2985"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71068"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6C4"
FT                   /protein_id="ABL71068.1"
FT                   /translation="MRLCRYARQADGQRGSAGRFPFSRFGGTCPLWNIHAAFETPERVQ
FT                   TQVIRMPEGASYFSIARTVTRAGGTHGAPAQRLAIGLGCDVAYAPRLVYADGIDLDRIR
FT                   PVDIGLNCYLCERPDCSARAHAPINRRLRVNERERSLAIFSFEED"
FT   gene            159971..160462
FT                   /locus_tag="Pden_2986"
FT   CDS_pept        159971..160462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2986"
FT                   /product="PEP phosphonomutase and related enzymes-like
FT                   protein"
FT                   /note="KEGG: rpa:RPA2395 putative
FT                   carboxyphosphonoenolpyruvate phosphonomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2986"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71069"
FT                   /db_xref="GOA:A1B6C5"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6C5"
FT                   /protein_id="ABL71069.1"
FT                   /translation="MTETLYLSGAAMTASMGLPDQGIITVDEVAFFIRQIAQTSELPLL
FT                   VDGDTIFPEALTSVERFREVRARLPGVKLLANMTEFGRTPALTAEEFQELGYDMVIWPV
FT                   SSLRVANKAQERFYAALARDGATTAMLPEMQTRAQLYELIGLNAFEALDASIAQSVLPA
FT                   "
FT   gene            complement(160576..161202)
FT                   /locus_tag="Pden_2987"
FT   CDS_pept        complement(160576..161202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2987"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase activating protein; PFAM: Radical SAM domain
FT                   protein; KEGG: rpe:RPE_3175 anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2987"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71070"
FT                   /db_xref="GOA:A1B6C6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6C6"
FT                   /protein_id="ABL71070.1"
FT                   /translation="MAEIRIGGLQRLSSCDWPGELVATLFLQGCPWDCPYCHNPHLIPP
FT                   EAEGTLDWQEVLGFLAGRRGLLDGVVFSGGEPTLQRGLPEALRAVRALGFRTGLHTAGP
FT                   YPARLAAVLPLCDWVGFDVKAPFSGYRRVTGAAGSGDRARESLRLLLASGTAHQVRTTV
FT                   DPTLIDGAALARMGAELAALGVADHVLQTCRSTGTRTSRPVHLQG"
FT   gene            complement(161195..161377)
FT                   /locus_tag="Pden_2988"
FT   CDS_pept        complement(161195..161377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2988"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpc:RPC_3516 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2988"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71071"
FT                   /db_xref="GOA:A1B6C7"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6C7"
FT                   /protein_id="ABL71071.1"
FT                   /translation="MFDDRKTGPEEILLADEERQPCEIWTRVMGYHRPVSSFNRGKKGE
FT                   FRERLYFSERRADLG"
FT   gene            complement(161392..163137)
FT                   /locus_tag="Pden_2989"
FT   CDS_pept        complement(161392..163137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2989"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; KEGG: rru:Rru_A1276 ATP-cone"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2989"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71072"
FT                   /db_xref="GOA:A1B6C8"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6C8"
FT                   /protein_id="ABL71072.1"
FT                   /translation="MPAPLTPPPTAPARDVAVDVASSVNEYLDRADWRVNANANQDYSL
FT                   GGLILNVSGKVVANYWLSHVYPPAVGEAHRRGDLHIHDLDMLAGYCAGWSLRSLLTEGF
FT                   NGVPGKVEAGPPKRLSSAIGQIVNFLGTLQNEWAGAQAFSSFDTYMAPFIRKDGLGYAE
FT                   VRQAMQELIFNLNVPSRWGTQTPFTNLTFDWVCPEDLRDQVPVIGGQPMNFTYGALQAE
FT                   MDMINRAYIEVMTRGDEKGRVFTFPIPTYNITPDFPWDSENAKLLFAMTAKYGLPYFQN
FT                   FLNSDLKPNMVRSMCCRLQLDLTELLKRGNGLFGSAEQTGSLGVVTVNCARLGHLHKGD
FT                   EAGLLRRLDELLDLGRDSLEIKRRVIQRLMDDGLFPYSRRYLGTLRNHFSTLGVNGINE
FT                   MIRNFTDDTHDITTEWGHAFALRLLDHLRARITAFQEQTGHLYNLEATPAEGTTYRFAK
FT                   EDRRRFPGILQAGTEHEPYYTNSSQLPVGFTDDPFEALERQEALQRKYTGGTVLHLYMG
FT                   TQLSSAEACRKLVRRALENFGLPYITVTPTFSVCPRHGHIAGEHAFCPRCDEELIAKKR
FT                   QSAAH"
FT   misc_binding    complement(163337..163550)
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 128.99"
FT   gene            complement(163940..164611)
FT                   /locus_tag="Pden_2990"
FT   CDS_pept        complement(163940..164611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2990"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; KEGG: rpe:RPE_3142 two component transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2990"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71073"
FT                   /db_xref="GOA:A1B6C9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6C9"
FT                   /protein_id="ABL71073.1"
FT                   /translation="MQAALKLQSDDARPLQILIVDDHPVVAEGWGRIIRTKTACEIASA
FT                   PSASEGWRAWRQARPDLMVVDLSIGRNKIAGIRLIERLRRVDPDLPILVFTMHRSPVLA
FT                   RRALMFGANGIINKDSPPAEICAAFTEVARGGNYVDSRLAMQIALLNVSRPGTSAPRLT
FT                   GREEEILGMITEGMSYRDIADRACISYKTVSNVSLVLKDKLGAANLADLVVKGIRYFEG
FT                   D"
FT   gene            complement(164596..166023)
FT                   /locus_tag="Pden_2991"
FT   CDS_pept        complement(164596..166023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2991"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase, dimerisation and phosphoacceptor
FT                   region; KEGG: rpe:RPE_3141 putative signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2991"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71074"
FT                   /db_xref="GOA:A1B6D0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR032244"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6D0"
FT                   /protein_id="ABL71074.1"
FT                   /translation="MSAPTEGLAFQAFGRATRVRRTVPLRRIVMGLACAVSLSLCLIVS
FT                   AILIVNARQAVQEETESAFRLAHEAVVRRLPPSHGGRDTMTEAIGLAEEIDGLRHVSAR
FT                   ILDPEGQPLQHRAHGQLRSEASAPQWFSALMTPPLVEALVPITHYPNVLGMLRVAADPT
FT                   DEIAEVWGDFSIILPVLFLAGLAMVGLAFLMTTLLTRRLQSVQAAMAQMQDGRLSVRAP
FT                   DDRLTEFADLAAGVNALASHLQAEQAENDLLQARLIGSSEAERSRIALDLHDEMGPQLF
FT                   ALRAAVSHAQAMTADLPERPAALDETLDAIAGHALEVQRSARTAINDLRPMLLGEASLA
FT                   ELLAELVTGFRDVASETRVVLDVDPEVEGSSPGELAELSIYRFARESVLNAMRHGRATV
FT                   VRVSLDTMPDEPGQIVVRVTDNGKGPQSGTGRPTPGFGQIGIEDRARALGATYLPPWRD
FT                   NRLTHTELRMPRPCKLR"
FT   gene            complement(166020..166484)
FT                   /locus_tag="Pden_2992"
FT   CDS_pept        complement(166020..166484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2992"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2992"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71075"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6D1"
FT                   /protein_id="ABL71075.1"
FT                   /translation="MRFCRGTVLGRSAAGMAVLLALGACYEEDDQTLPSAAPGESVAAE
FT                   STHWLEIDDSRSPETFLSAESGLPAQTLAPLLGALSAHYRESPRMIANRVLQLWQEYPD
FT                   TPLERIMADLVPARDAPEESLGPVAQQYRVLRAGGAGHADAVAAAMGQRE"
FT   sig_peptide     complement(166401..166484)
FT                   /locus_tag="Pden_2992"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.723) with cleavage site probability 0.588 at
FT                   residue 28"
FT   gene            166833..168731
FT                   /locus_tag="Pden_2993"
FT   CDS_pept        166833..168731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2993"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="PFAM: Pyrrolo-quinoline quinone; KEGG: rpe:RPE_3139
FT                   pyrrolo-quinoline quinone"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2993"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71076"
FT                   /db_xref="GOA:A1B6D2"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6D2"
FT                   /protein_id="ABL71076.1"
FT                   /translation="MNRNTPKARGASSLAMAVAMGLAVLTTAPATANDQLVELAKDPAN
FT                   WVMTGRDYNAQNYSEMTDINKENVKQLRPAWSFSTGVLHGHEGTPLVVGDRMFIHTPFP
FT                   NTTFALDLNEPGKILWQNKPKQNPTARTVACCDVVNRGLAYWPGDDQVKPLIFRTQLDG
FT                   HIVAMDAETGETRWIMENSDIKVGSTLTIAPYVIKDLVLVGSSGAELGVRGYVTAYDVK
FT                   SGEMRWRAFATGPDEELLLAEDFNAPNPHYGQKNLGLETWEGDAWKIGGGTNWGWYAYD
FT                   PEVDLFYYGSGNPAPWNETMRPGDNKWTMAIWGREATTGEAKFAYQKTPHDEWDYAGVN
FT                   VMMLSEQEDKQGQMRKLLTHPDRNGIVYTLDRTNGDLISADKMDDTVNWVKEVQLDTGL
FT                   PVRDPEFGTRMDHKARDICPSAMGYHNQGHDSYDPERKVFMLGINHICMDWEPFMLPYR
FT                   AGQFFVGATLTMYPGPKGDRQNALGLGQIKAYDAISGEMKWEKMERFSVWGGTMATAGG
FT                   LTFYGTLDGFIKARDSDTGDLLWKFKLPSGVIGHPMTYKHDGRQYVAIMYGVGGWPGVG
FT                   LVFDLADPTAGLGSVGAFKRLQEFTQMGGGVMVFSLDGESPYSDPNVGEYAPGEPT"
FT   sig_peptide     166833..166931
FT                   /locus_tag="Pden_2993"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 33"
FT   gene            168805..169635
FT                   /locus_tag="Pden_2994"
FT   CDS_pept        168805..169635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2994"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="SMART: extracellular solute-binding protein, family
FT                   3; KEGG: rpc:RPC_1908 extracellular solute-binding protein,
FT                   family 3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2994"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71077"
FT                   /db_xref="GOA:A1B6D3"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR022455"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6D3"
FT                   /protein_id="ABL71077.1"
FT                   /translation="MLIDFRQVCGAGAAALALASPALADTTNLRVCASTKDAPFSDAQG
FT                   AGFENKIAQVLADEMGATLDLVMLEKDAIYLVRDGIEKDLCDVLVGVDAGDERLLTTRP
FT                   YYRSGYAFVTRQDRNFEGDKWQDVDQEGFDTFSYRLHSPAETILKYTGRYEYNLIYQAS
FT                   LTNFEDRRNKYTQVEASRVITEVADGGADLAIVFAPEAARYVRDSREPLRMTLITNEIE
FT                   RSDGVIIPLQYSQSVGVSKTHPELLGPIEQALQSGKARIDAILTEEGIPLLPSS"
FT   sig_peptide     168805..168879
FT                   /locus_tag="Pden_2994"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            169646..170179
FT                   /locus_tag="Pden_2995"
FT   CDS_pept        169646..170179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2995"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: rpc:RPC_1909
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2995"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71078"
FT                   /db_xref="GOA:A1B6D4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR009153"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6D4"
FT                   /protein_id="ABL71078.1"
FT                   /translation="MTKPRILAAFAMTLIIPVAAMAAPQFFNIIDGSPLNFDDAMEEGR
FT                   DTEAVKHFLETGENVYNEDPEILPEAEELYAGMCSGCHGHYAEGKIGPGLNDAYWTYPG
FT                   NETDVGLFSTLYGGATGQMGPMWGSLTLDEMLRTMAWVRHLYTGDPKDASWLTDEQKAG
FT                   FTPFQPKSSGEDQS"
FT   sig_peptide     169646..169714
FT                   /locus_tag="Pden_2995"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            170234..170545
FT                   /locus_tag="Pden_2996"
FT   CDS_pept        170234..170545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2996"
FT                   /product="methanol dehydrogenase, beta subunit"
FT                   /note="PFAM: methanol dehydrogenase, beta subunit; KEGG:
FT                   rpe:RPE_3136 methanol dehydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2996"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71079"
FT                   /db_xref="GOA:A1B6D5"
FT                   /db_xref="InterPro:IPR003420"
FT                   /db_xref="InterPro:IPR036557"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6D5"
FT                   /protein_id="ABL71079.1"
FT                   /translation="MKRILTLTVAALALGTPALAYDGTNCKAPGNCWEPKPDYPAKVEG
FT                   SKYDPQHDPAELSKQGESLAVMDARNEWRVWNMKKTGKFEYDVKKIDGYDETKAPPAE"
FT   sig_peptide     170234..170296
FT                   /locus_tag="Pden_2996"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            170607..171626
FT                   /locus_tag="Pden_2997"
FT   CDS_pept        170607..171626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2997"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_3; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase; KEGG: rpe:RPE_3135
FT                   ATPase associated with various cellular activities, AAA_3"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2997"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71080"
FT                   /db_xref="GOA:A1B6D6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6D6"
FT                   /protein_id="ABL71080.1"
FT                   /translation="MDSNISDWHARFRDAEAALNGVVLGQARTIRLLLISALCRGHVLL
FT                   AGDVGTGKTTLLRAMARALGGPYGRVEGTVDLLPTDLIYSTHIAEDGRPRIEPGPVLEQ
FT                   GEDMAVFFFNEINRARPQVHALLLRLMAERSLSAFRREYRFPHLQVFADRNQIERDETF
FT                   ELPAAARDRFLMEIAVDAPAAPEDRVALAFEPRFHDTTALIAEVGQGILPYRGLNGLAA
FT                   GVQSGTHASPALRRYVFDLCEALRNPASAGLALEGADAARLIRGGVSPRGMQHLVRAAR
FT                   ACAWLEGREAVLPQDVRAVLAPVMAHRIFLSPAYEPRREALVPALIDAAFATIPVPAA"
FT   gene            171623..172477
FT                   /locus_tag="Pden_2998"
FT   CDS_pept        171623..172477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2998"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpc:RPC_1912 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2998"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71081"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6D7"
FT                   /protein_id="ABL71081.1"
FT                   /translation="MNAQLHLFDALAWRLTQGLPGLRMGAHAGRIRGAGESFADIAPLL
FT                   AHPDPRRLDLRRSITDPLGVLHVRRFQTRTDLRLHVALDASASLGAVAHADRAGLARLL
FT                   AAGFAQAARRARDPFSLTVCAGDRVLHDQPPTRRSLAADLLDLPLAPAGRGTAALEAMA
FT                   HDLPQERILVVLISDFELSPDELAALLAALRPRPVLSVWLRDSGFDAPSPRLGLAELCD
FT                   PETGRRRTVLTTPRWAARQAQLLRDRQAALRRILAEHGLSPIEITDSIDVAELAASLSE
FT                   APL"
FT   gene            172474..173277
FT                   /locus_tag="Pden_2999"
FT   CDS_pept        172474..173277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_2999"
FT                   /product="MxaA protein, putative"
FT                   /note="KEGG: rpc:RPC_1913 MxaA protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_2999"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71082"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6D8"
FT                   /protein_id="ABL71082.1"
FT                   /translation="MKWLALVLLPFPALAQQVENPRPYGWWLGDELVQRIRIKGQVDPS
FT                   SLPRPRAVDYWLDLRDVARRDLPGGTELTLRWQNFYSALEPRERQVPASAIRLVDGTAL
FT                   ELPGFRYVTSPIRPILAPSTSDQLQPDPPFHLIDPMPAGLRLLVSAVALVAGALALAWQ
FT                   QGWFPFHRRPARPFTRTARAVARLPEPQARRALHRAFDQSFGRVLIGAELDRFLANAPQ
FT                   FAPLAERLRGFFAASDAAFFGLGSGPAQDIPQLARDLAAIERGRR"
FT   sig_peptide     172474..172521
FT                   /locus_tag="Pden_2999"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.984 at
FT                   residue 16"
FT   gene            173274..174281
FT                   /locus_tag="Pden_3000"
FT   CDS_pept        173274..174281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3000"
FT                   /product="von Willebrand factor, type A"
FT                   /note="PFAM: von Willebrand factor, type A; KEGG:
FT                   rpe:RPE_3132 von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3000"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71083"
FT                   /db_xref="GOA:A1B6D9"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6D9"
FT                   /protein_id="ABL71083.1"
FT                   /translation="MIGFAWPPALFALPLLLLPLVIRWLRASAVPRLDLRAVEGRAVGP
FT                   LLVALAMLAPAALILGLAQPYLRGGSTAYRGIGTNLVLLIDRSSSMDDTFAGRSPQGGD
FT                   ESKAAAARRILLDFIARRPDDRIGIAAFSTAPMLVLPMTESRTAIAAAVAALAEPGLSQ
FT                   TDVGRGLTLAMGMAHEASASDSRAVVLVSDGAAVIAPEVQTALRNLAARRQVNIYWLYL
FT                   RTKGAKGIFEVPEPGQADTPHLRPERHLHIFLQSLGLPYHAFEADSPGAVEDAVTEIGR
FT                   MESRPILTRRPVPRRDLAWACHLLASLCCAALAAARWLERRYAPRRPAPLLVPA"
FT   gene            174278..174829
FT                   /locus_tag="Pden_3001"
FT   CDS_pept        174278..174829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3001"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpe:RPE_3131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3001"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71084"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6E0"
FT                   /protein_id="ABL71084.1"
FT                   /translation="MRRLVFPALLAWVALAAGAVLWSGWQLWGVATDNRAIRSLAGGSD
FT                   VALREAADPRAAHARALFLALRDRPQEAEALLPALAAAPPGLRSEYHYAIGNARMRMGF
FT                   ERIERNRIDEATALVNLAKASYRETLRARPGNFDAKVNLDLAMRLVRDMPREGQDGDED
FT                   PETRPRRLWTDLPGLPRGAP"
FT   sig_peptide     174278..174349
FT                   /locus_tag="Pden_3001"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.453 at
FT                   residue 24"
FT   gene            174955..175758
FT                   /locus_tag="Pden_3002"
FT   CDS_pept        174955..175758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3002"
FT                   /product="von Willebrand factor, type A"
FT                   /note="KEGG: rpe:RPE_3130 von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3002"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71085"
FT                   /db_xref="GOA:A1B6E1"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6E1"
FT                   /protein_id="ABL71085.1"
FT                   /translation="MNVRDMDGASRLDAARDVLTRWIASQPCGARVGLGFFTERRSLTL
FT                   IEPVEICTDYATLAGTLAGLDWRMAWEGDSMISKGLNHALNRARGLDAALIFVTDGQEA
FT                   PPLPYSGPDGWREDSPGGVVLGAGGDQPAPIPKFDDLGRETGFYGPTDVQHAPARIGAP
FT                   PTDAADRPGFHPRNNPYGEADLEGSEHLSAMRAEYLTRLAGERGMGFARLSAGPAALQA
FT                   TLAAHAPARRVATHRSLSPVFGALALAVLLAALLATPLHARKETP"
FT   gene            175755..176288
FT                   /locus_tag="Pden_3003"
FT   CDS_pept        175755..176288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3003"
FT                   /product="MxaD protein, putative"
FT                   /note="KEGG: rpe:RPE_3129 MxaD protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3003"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71086"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6E2"
FT                   /protein_id="ABL71086.1"
FT                   /translation="MMNRRTLLASALTALVATPLLAHGPTPQQLSRSVKVAAPPEKVWA
FT                   LLADPASIAAWHPAIAEASMEGDGAGAKRSIAFKSGGILVDGIDDIGAETMTIRWRLSR
FT                   EDIEVFPVSFYTNSVTVTPDGDGASVAWQASFFRADTTNEPEERFSDEAAVAAMEKYVD
FT                   DALAGIKATAETGS"
FT   sig_peptide     175755..175823
FT                   /locus_tag="Pden_3003"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(176306..177154)
FT                   /locus_tag="Pden_3004"
FT   CDS_pept        complement(176306..177154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3004"
FT                   /product="peptidase S15"
FT                   /note="PFAM: peptidase S15; dienelactone hydrolase; KEGG:
FT                   tte:TTE1809 hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3004"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71087"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6E3"
FT                   /protein_id="ABL71087.1"
FT                   /translation="MRKGLSASAVLALLAFPAHGETLTLTLDRGIAATLEMPAGHGRFP
FT                   AVLMFHGLGSSRDEVGIIFADTATALAMDGIASLRIDFRGFGKSDGDTGAFTLERQNED
FT                   AAIALQALAAMDKIDAERIGLMGFSFGAGAAIELAAAQPETIKSLVVWAPVGNYHDDML
FT                   DSLGQRAFDLAERDGIVGLDLGWRTMALKRDFFDGLNRHDLLAALRAYDAPFMVVNGSD
FT                   DPYRKYTPALMQAAAGAEKRALVIEGGDHVFHVYTPSRSLAPEVIEATVERFRDTLGKT
FT                   R"
FT   sig_peptide     complement(177092..177154)
FT                   /locus_tag="Pden_3004"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(177218..177655)
FT                   /locus_tag="Pden_3005"
FT   CDS_pept        complement(177218..177655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3005"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71088"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6E4"
FT                   /protein_id="ABL71088.1"
FT                   /translation="MNGKFVAIAFLTANMAFSASAQPAPLEELFLKVAAGEDGKPTISQ
FT                   DEFQLSKNEYYRLNFVCAEDAGDTGFQFESVPLLSNSHLRVISIEGQEIHIQGLSFHAL
FT                   QCDEAGTIRFSFYPIRSGTFEFTVQDHEEPANIIRGKFVVE"
FT   sig_peptide     complement(177590..177655)
FT                   /locus_tag="Pden_3005"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            complement(177706..178218)
FT                   /locus_tag="Pden_3006"
FT   CDS_pept        complement(177706..178218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3006"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71089"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6E5"
FT                   /protein_id="ABL71089.1"
FT                   /translation="MIRDGTRRLKVPLYNGENIPRNRGNYPADIIANQCSTPDGIGLSI
FT                   DSNNSTTTDTEQRGRLAIVVVRIFGCYACKRHEQWIIESLSIKVNTAFKGHASNVSRIC
FT                   RPHKAKPRHQDWNSSCASNMIFPAGSAFPKIHQQFFAFVTVGTVACFHQNQNGKLVVSG
FT                   PHQVSTL"
FT   gene            complement(178458..180536)
FT                   /locus_tag="Pden_3007"
FT   CDS_pept        complement(178458..180536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3007"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor, plug;
FT                   KEGG: rru:Rru_A2312 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3007"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71090"
FT                   /db_xref="GOA:A1B6E6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030150"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6E6"
FT                   /protein_id="ABL71090.1"
FT                   /translation="MNGRKIPVLLGTVAMLALATAPALAQDNQGMAETLRLDEIVLTGE
FT                   KQARSIKDTASSVAVLTTRDLEESGGQDSIADAATGIANVTYVASGGQGGAPTIRGQDS
FT                   EGPNSGAVAFFGGTAPRLAFNLDGHYLGYNEIVWGSQALWDVESIEVFRGPQTATQGAN
FT                   SIAGAIIVKTKDPTFQPEGAAQLEYGSHNRRRASLMASGPLSEDLAGRIAVDYWARDNY
FT                   IDYTNPDFAVGSTDQNHESRTIRAKLLWQPKDLPGFEGKLTFSHSLTNRPNWEAATEPY
FT                   EDLESATASNPSWRLRTNTTILDVSYDFGNGWTVFNQLQYSDIWVKRSTEPVNAGTAIL
FT                   DQDVTSNETRVTFGSPEDRISGVAGLFVSRTDSDELLDYRGTTTYDDRKDSLGIFAETT
FT                   WRLADRWSLTGGLRYQRDDITRRGVSSFTPNVLDYDESFDAWLPKLALAYDLDASTRIG
FT                   AMISKGYNPGGVTLNLTSGEYVPFDAETSWNYEIFGRTRLLDDRLELTGNLFYTQLHDA
FT                   QRYVVTSLPENIGSSITVNAERAKSYGLELGMDYLVRDNLRVKAGLGLLHTEISRFTSA
FT                   AADYQGHRFGRSPDYTLSLAADWDITPEWRLSGQLRHTDGYYSDDNEDRDTWVDSYTVA
FT                   NARLTWQPRENLQAFAYVNNLFDDRSVTYLRASRSIGGFEATVVEPREVGIGLKVTF"
FT   sig_peptide     complement(180459..180536)
FT                   /locus_tag="Pden_3007"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            180896..182563
FT                   /locus_tag="Pden_3008"
FT   CDS_pept        180896..182563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3008"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bur:Bcep18194_B0670 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3008"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71091"
FT                   /db_xref="GOA:A1B6E7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6E7"
FT                   /protein_id="ABL71091.1"
FT                   /translation="MADHALDWQARCPFWPRDVADRYREAGIWRYETFFDLLARQAGRL
FT                   GRRIALIDGARQIGYDRLHCDALALAGGLSALGLVRGDRVVVQFPNCGEFVTLFFALCR
FT                   LGVVPVLALPGHRDLELGQFADFTGARAILTAQEPKGYDMVALARRVQERVPSVRHVVA
FT                   LGDGRDATPFDSLFRPDLPLPAGPNAEDVACFQISGGTTGVPKLIPRRHMEYLYNIRMA
FT                   VAASGLDGDTRYLCVLPMMHNFPMACPGFLGTLWAGGTVVVAPEPEAGICFDLIARHRV
FT                   TMTALVPPLALLWLDAQAGLGADLSSLQLLQVGGAKLNPSSARRIRPELGCQLQQVFGM
FT                   AEGLVCFTALTDSEERIVNTQGRPMSPWDELRIIRPDGREAAIGEPGELQVRGPYTIRG
FT                   YYDMAGHNAQAFTADGFYRSGDIARRDADGAIIVEGRAKDQVNRGGEKIGVDEVEDLLV
FT                   AHASVLDAAVVGRPDALMGERLCAFVLAAPGTTPRPGALRRHLAEAGLAAFKIPDEVIV
FT                   LDRFPQTGVGKVNKRQLREQLREAHFPDPVAARQEESA"
FT   gene            182560..183015
FT                   /locus_tag="Pden_3009"
FT   CDS_pept        182560..183015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3009"
FT                   /product="chorismate mutase related enzyme"
FT                   /note="TIGRFAM: chorismate mutase related enzymes; PFAM:
FT                   Chorismate mutase; KEGG: pfl:PFL_3489 isochorismate
FT                   pyruvate-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3009"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71092"
FT                   /db_xref="GOA:A1B6E8"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6E8"
FT                   /protein_id="ABL71092.1"
FT                   /translation="MSPAVVAPEDLAPDLVPPEAVAGLGDVRRGIDMIDARIVGLLGLR
FT                   LRYVLAAADFKPDIASIPAPERVRQMLDERAAWAAEAGLAPDFIGPLFGQVAEWFIRQQ
FT                   VAHWRACRAGQSAADHRRSSAPAPSPSARPPSEPALDRVERVHGAGD"
FT   gene            complement(182950..183927)
FT                   /locus_tag="Pden_3010"
FT   CDS_pept        complement(182950..183927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3010"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: ecs:ECs3913
FT                   putative ferrichrome-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3010"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71093"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6E9"
FT                   /protein_id="ABL71093.1"
FT                   /translation="MRRLLMTALVALAAIGTGQAAEVTDDTGRQVRIPDDPQRVVALHE
FT                   PVLAVPLIELGVPVVGIYGRGDDGSSLTAVDFLHEMLGRSKDADPIPGIGPVGSINLEK
FT                   LRALRPDLIIGTDYDAGKAKALSQAAPVYLQNSSAATAHGFSVQEELARVLHREDRFRE
FT                   LRTAYQARLDGLRGRFPDRLPKAPGERTYLIVMLTDQANVVAGMSGAVQALEDLGYRRA
FT                   EIAGEGSTRQSRSMLILPIGAESLAGLNPDLLLVMTSFAAPARDEAAARAALDRLSPGW
FT                   DRFMAPAREGRVVFLDSARVTSPSVASAMHTLDAVEGWLAGRPR"
FT   sig_peptide     complement(183865..183927)
FT                   /locus_tag="Pden_3010"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 21"
FT   gene            complement(183941..184975)
FT                   /locus_tag="Pden_3011"
FT   CDS_pept        complement(183941..184975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3011"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   hch:HCH_03457 ABC-type enterobactin transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3011"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71094"
FT                   /db_xref="GOA:A1B6F0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6F0"
FT                   /protein_id="ABL71094.1"
FT                   /translation="MSSRALDGRRVLRLPGGMQIGLANLAAALALTLASLGLGAVSLSW
FT                   GETRLDLLAPLDADQAFALYQVRLPRLLLGFMAGWSVALAGAMLQSLARNPLADPSLLG
FT                   LSQGAMVAIMVLTVLAPGLPPAWLPVAALLGGLAVAALLLALVRGHAGGLAVLLMGIAL
FT                   ESTLSAVTAVLVLYTPPETSHALAGWMAGSLALADWPRVTMLAPWFAASPIAILLLGRA
FT                   LRLIDLGAPMAMALGLDAARTRVAVLIVAVLLSSAALTAVGPLMFLGVMAPQLAAALSP
FT                   ASGRARLVLAALTGGLLVTAADMLARNAGTDIGLPVGLVLVTLGAPLFVLAMRMRLFLR
FT                   MSSS"
FT   sig_peptide     complement(184835..184975)
FT                   /locus_tag="Pden_3011"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.710) with cleavage site probability 0.337 at
FT                   residue 47"
FT   gene            complement(184972..185970)
FT                   /locus_tag="Pden_3012"
FT   CDS_pept        complement(184972..185970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3012"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   pfl:PFL_3624 ferric vibriobactin ABC transporter, permease
FT                   protein VC0777"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3012"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71095"
FT                   /db_xref="GOA:A1B6F1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6F1"
FT                   /protein_id="ABL71095.1"
FT                   /translation="MRRGFPVLAALALALCLLLALSAGESWIPPSGIWAALARFDETRQ
FT                   ADVIVIYQRLPRALIAMLAGAALSMSGAVLQGVLRNPLASPSLVGINAGAALAVVAGAF
FT                   LLGLEPRAQGSAALAGGGLGFLASLGVARLAGHAHDPRGLALILSGAIVSMFLGGLTQA
FT                   LLLSDPALRQDYLGWLGGNVSHVHAERLADFWWLAALGMAAMLLLARRLSLLALGAEKA
FT                   ASLGIDVARTQLLALGAAVLASASAVAICGPLGFLGLVVPHLVRPLTGARFGALLPGCA
FT                   LAGACLCLLADLIARMALAPLALHTGVVLELLGGIAFMLMVRRFYLRGAEA"
FT   sig_peptide     complement(185899..185970)
FT                   /locus_tag="Pden_3012"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.623 at
FT                   residue 24"
FT   gene            complement(185967..186746)
FT                   /locus_tag="Pden_3013"
FT   CDS_pept        complement(185967..186746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3013"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_A4781 ABC cobalamin/Fe3+-siderophore
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3013"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71096"
FT                   /db_xref="GOA:A1B6F2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6F2"
FT                   /protein_id="ABL71096.1"
FT                   /translation="MIRIQGLTVGYGRKPVIRGLDASFAPRRFTALVGPNGCGKSTLLK
FT                   AVMGFLRPQAGRVTLDGVPMARIPRRALARRIAWLPQENHCPDYLTLGELVEMGGHARQ
FT                   GLFAGPDDRDRLLFREALRTVGLQDQAHLPVNALSGGQRQRAFIAMVLAQDTPIVLMDE
FT                   PVNHLDVTYQYALLGLVRDLTRRHGRTVVSVLHDLNLALSFADEVVMMSGGEARASGPV
FT                   AEVLNAANLREVFDLDAQVIRHEGRRICLPALPEPSA"
FT   gene            186830..188014
FT                   /locus_tag="Pden_3014"
FT   CDS_pept        186830..188014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3014"
FT                   /product="monooxygenase, NtaA/SnaA/SoxA family"
FT                   /note="KEGG: pfl:PFL_3619 monooxygenase, NtaA/SnaA/SoxA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3014"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71097"
FT                   /db_xref="GOA:A1B6F3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6F3"
FT                   /protein_id="ABL71097.1"
FT                   /translation="MRWRGCCISVWPLPGPGGRRRPRTRRWRWIARWRSGPRPRIARAA
FT                   LDPTLVLTAVAGATRRIGLVTTVSTSFNPPYVAARQLQTLNWLSNGRAGWNIVTALDGE
FT                   RNFGLAAMPSAAERYARAAEFTDVVRRLWDSHGAEGLAAIDHCGAFYQVEGPLNVPRHP
FT                   ARVALFQAGASAEGRGFAASVADAIFASVPDPAAGQELRSDLQRRARAAGRDDAPRLLP
FT                   GFHAYLAPSRSEAQEMFREAQARRDPAALRAKLGALVGRDLGDWPEDRPLTPADLPAGD
FT                   AALRSRTHSGLLQRLIRQESPPLRDLLLRPEVANSGHWTFVGTPAEALAEIAAWSDAGA
FT                   MDGFIALPGGSGESLDLLLSELVPALAEARRFRHAYAGETLAAHLGLASPASSG"
FT   gene            complement(187954..193665)
FT                   /locus_tag="Pden_3015"
FT   CDS_pept        complement(187954..193665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3015"
FT                   /product="amino acid adenylation domain"
FT                   /note="TIGRFAM: amino acid adenylation domain; PFAM:
FT                   AMP-dependent synthetase and ligase; condensation domain
FT                   protein; phosphopantetheine-binding; Non-ribosomal peptide
FT                   synthetase; KEGG: pen:PSEEN2503 non-ribosomal peptide
FT                   synthetase BasA/D"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3015"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71098"
FT                   /db_xref="GOA:A1B6F4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6F4"
FT                   /protein_id="ABL71098.1"
FT                   /translation="MDLTAMQAAYWTGRDWKGPGGGVSAHLHTEFQPAGLEPRRLDRAV
FT                   RGLFRRHPMLRLRVTAAGQQVIQPLDDRHALRLDDLRELAPDQAQERLAATRRRMTHQR
FT                   LDIASGEAAEFRLSLLPGGEQRLHIDLDMIAADPSCFGLVMDDLARLYEDPAGIAASEE
FT                   PESCYFDYLARLPPDPAEVADREWWRARLRDLPSPPSLPLRDQAGAPESTRISALLPPA
FT                   RAAALRGLARELRVTQTALYLAVFAAVLARATGDRAFRLTLPGFFRAPVMRGASRLVGD
FT                   FTNILPLGLRVGPEATLAGLAREAGREIAEALSHQACPGVAVLREMSRGGQGVESAPVV
FT                   FTSGLDLDGAQRQLLSPRVGRLFGRLVWSVSQAPQVALDVQVAALAEGVLLNWDLRLDA
FT                   LPEDWVRAGFDACHAALCRLADAPDLAAAPLSDWLPAPMRMRRLGELQKAYLLGREAEL
FT                   PLGRTAMQEYRCYRGPLDAEALARRAEALIERHEALRCRLDPEYSALRVLDEAEPPLER
FT                   IDLSDMGADEAEARLAALQDEFARAPLPLDGLLWRLVLVEMPQPRDQALLVKMDALPLD
FT                   GAGIAQVVAELLAPELPPACALPAPPLEQADRAADAAWWRARLAGVEGPPCLPWRQPLD
FT                   GIDRPRWRRDSRRIPRDQLARLARLAAAQKLTRNSIAMAVVLEVLARWTPDLAPCVAVP
FT                   VAPPPGGALANRSSFVAVDYRADRGSFLDHARRLQEDLLEGMAHPGLSGIGLSRLLLSQ
FT                   MGGRIALPVVLTNGMGWDRVPADAGLRLVDGLVQTPQVALDLRLALDAEGALLLQADHV
FT                   EQALEPAVVGALLDAAARAFAALAERDELTLAGADFLPPPPAAPAGAEHAGPGHLERIA
FT                   AQLFDGDPDRTALICDTRSTSYGALGLRVRRVMAGLAARGLAPGDMVAICLPRGPEHLV
FT                   LTLACAFSGLVWVPIDAAAPPERRDYLLRNSAPRLVVAGTDLPGWPLASPRTLEAHDPA
FT                   PIPQGLAALSRSEAAAYYLYTSGTTGRPKCVVLNNRATANVIGHTLDAWGIGAQDAVIS
FT                   VTPLHHDMSVFDLFGTLAAGARLVMPAPAEEKDALAWNRLVRDHGVTVWCSVPAIVEML
FT                   LACAPDDGLTSLRLVAQGGDYIKPAVIDRLRRLRPDAALWSLGGPTETTIWSIWHRIGP
FT                   EDDRIIPYGRALPGNRYLLLNPQGEPCPEGVAGRIHTTGVNLALGYLRDGALEQTDFTE
FT                   VGGIRAFRSGDLGRLRGDGTILFDSRVNGYVKVRGVRISLADVEAELAAHPAVAQALVV
FT                   DIPDARGEKVLAALVAGRDLPEPAALRAFLRERLPQSHLPDRILAIPALPLSANGKPDR
FT                   RRARQIAGQPGPEPTAPPEAPGAEPADALTGLILAAFREALGAPGMGPEDDFFDHGGHS
FT                   LVATRIIGRLQAEHGIALRFTDIFRHPTALALAGIATRSAPAAPMPAAGDDAAGPQAAP
FT                   LSLAQQSLWKAYAAFGYGGIFNLPFALRFPTPVDEAVFGLAFGDLIRRHPVLRSHFREE
FT                   NGTPLQEVVPVERLGDYRWFWTSAEAGEANRRTEAGHVFDLARELPLRLRFFREGDEQV
FT                   LSMLFHHIVLDEWSLNLLMDQLDHAYRQRAAGLAPEWPDQPPGFHRFAAAQRAADTDRA
FT                   HLDYWLDHLRGAPRARPILGAAPGGQDPQGGWTRIDLPAEVARGLYATARRNAASLFAT
FT                   AYAAIGAALGRLGGIGDLVIGTSASGRNDPAWFDTVGYFTTMTAHRLALGAQDTPAALI
FT                   AQVRDRIARSLPHSEVPLDLVGEALTGNPVTRLDEMFEVFIQIHARNRMNGAIALMDGS
FT                   RVEYRQIDPDKAESLLGLQFEIVEDVADETAGLRIMLSHRADRYGPAEIRRITEAVEAM
FT                   LARFAQPQDDQPLDAGEASPRCAASVSPA"
FT   gene            193771..194019
FT                   /locus_tag="Pden_3016"
FT   CDS_pept        193771..194019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3016"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG:
FT                   pen:PSEEN2505 2,3-dihydroxybenzoate-AMP ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3016"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71099"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6F5"
FT                   /protein_id="ABL71099.1"
FT                   /translation="MNDIGSIETLDRAWLEARVWALIPDEADIGSDENLLFLGLDSLSV
FT                   LKLVAELKQAGITLSARELLHEPSIEGWWRLIQARRP"
FT   gene            194271..196073
FT                   /locus_tag="Pden_3017"
FT   CDS_pept        194271..196073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3017"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter, transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG:
FT                   eci:UTI89_C2181 putative inner membrane ABC-transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3017"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71100"
FT                   /db_xref="GOA:A1B6F6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6F6"
FT                   /protein_id="ABL71100.1"
FT                   /translation="MRAASHAARPERGDDDDRAWAIMEPVRRQIRLAMGLGAVSGLAVL
FT                   ATMICLAMTVLALRDHPGQVPWVWMLGALAGTVASYLARLGAFNQSHYAAFRLERILRS
FT                   RLAERMAEVPLGYIQALGAGGLTKVIHDDVKALHVFVADSTPLYARAYVTPLATAAILF
FT                   WLDWRLALAVLAVLGLGILSMRGAQKRRRNMARLYNEAREKVSAAVVEFVQAMPVVRNF
FT                   DTGHSSFGRYQQALDAYLAVLARWYRDSGRSVRMTWAILSPLPTLAVVLWLGLWQVREG
FT                   ELDAVRWLAILLLCTGMAESVMPMMMLRHMIDKVRLSIARIHDVLAAPLLPVPAQGHSR
FT                   RPADSGVVFDDVSFRYGPDETEALRHVSFVAVPGSVTALVGPSGAGKSTVARLIPRFWD
FT                   VTGGRILIGGVDIRDMGADDLMRQVAFVFQDTFLFSDSIAENIRLGCPDATDEEVIAAA
FT                   RAAQAHDFIAALPQGYDTPAGERGALLSGGQRQRITIARAILQNRPVLVLDEATAFADP
FT                   ENEAALIRALGELTRGKTVITVTHRLQSVVHADQILVFDAGRLVQAGRHHDLLAQPGRY
FT                   ARLWASHAEAQAWTLGHMRKGAAE"
FT   gene            196070..197857
FT                   /locus_tag="Pden_3018"
FT   CDS_pept        196070..197857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3018"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: yps:YPTB1599 inner membrane ABC-transporter YbtQ"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3018"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71101"
FT                   /db_xref="GOA:A1B6F7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6F7"
FT                   /protein_id="ABL71101.1"
FT                   /translation="MTGRTIPAGRPGPTAIRETWRQLQDSVGEDAPRLRAAILGLLLAA
FT                   ALQGLALAAIAPVLVAAFDGRDWPGALRWLGICTILMVAATAARWWAQGFDFNGRMAAA
FT                   THRVRLRLGEQMRRMPLEMLHGHRTGELNSMVINNVDENLLTTLTILNLIFISVVTPLV
FT                   TGLALLVLDWRAGLLVLVVFPAILPLYRWRRPAIGRGKRILGAAHQQANADVLEYTQGL
FT                   PVLRAALQAGARAGRLERTFRKLEEIQIYGHRKGEKPNLIVSTVVELGLVLMLGLGVAF
FT                   VVAGEMDLALLAALLVIVVRLSEPLATFILYTAILELIEAALDRIKALLAISPLDQALP
FT                   ARTPAHCGIRFEAASFAYAGADAPALRDVDLTIPEGSLTAFVGPSGSGKTTLARLILRH
FT                   ADPQKGRILIGGADLRQIPESALRGMLSVVFQDVHLFNDTVMANIRMARPDATEAEVRE
FT                   AARAAQCLDFIERLPLGWNTPLGEIGSRLSGGERQRISIARALLKDAPILILDEPTAAL
FT                   DTESERAVQRAIDAVVRDRTVIVIAHRLSTIAGADQIAVVDDGRVVQLGTHSALLARPG
FT                   RYRAMWEAQLAAKIWSGRA"
FT   gene            complement(198236..198676)
FT                   /locus_tag="Pden_3019"
FT   CDS_pept        complement(198236..198676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3019"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   lpf:lpl2035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3019"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71102"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6F8"
FT                   /protein_id="ABL71102.1"
FT                   /translation="MLIQKFLPTARRHLQSIDVNAALLQAARRLGEGCDMLLVCDAAGR
FT                   LAGVLTKTDVVRQTGRCTGASCTAPVIEAMTRDVTTVTPDGWLQDVWDIMKARGFKNIP
FT                   IVDANRHPLGVLNARDVLQTLLQEVREEENLLHDYVMNIGYR"
FT   gene            complement(198689..199072)
FT                   /locus_tag="Pden_3020"
FT   CDS_pept        complement(198689..199072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3020"
FT                   /product="succinate dehydrogenase subunit D"
FT                   /EC_number="1.3.5.1"
FT                   /note="PFAM: succinate dehydrogenase, cytochrome b subunit;
FT                   KEGG: mca:MCA1549 succinate dehydrogenase, hydrophobic
FT                   membrane anchor protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3020"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71103"
FT                   /db_xref="GOA:A1B6F9"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6F9"
FT                   /protein_id="ABL71103.1"
FT                   /translation="MTIRHIPPFARARGLGAAGHGTGRWWAQRVSAAGLVPLVLWFALA
FT                   LAGGAAADHAKLVAWLAAPLNSGLMILLLMAGFHHAALGLQVLAEDYIHSGARFVAAAA
FT                   IQLACFAGVVFGIASVLRIAPMA"
FT   gene            complement(199069..199446)
FT                   /locus_tag="Pden_3021"
FT   CDS_pept        complement(199069..199446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3021"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /note="PFAM: succinate dehydrogenase, cytochrome b subunit;
FT                   KEGG: aeh:Mlg_1332 succinate dehydrogenase, cytochrome b
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3021"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71104"
FT                   /db_xref="GOA:A1B6G0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6G0"
FT                   /protein_id="ABL71104.1"
FT                   /translation="MSHRRPKSPNMQNYRPQLTSVLSFGHRLSGVAQSLGALGLAAWLM
FT                   AGASGQDAFGSAQALLLSVPGRIALFLVTLALFYHLCNGVRHLVWDSGRGFELRAIYAG
FT                   GWTVVGTSLILTLALWTWGLA"
FT   sig_peptide     complement(199294..199446)
FT                   /locus_tag="Pden_3021"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.832) with cleavage site probability 0.523 at
FT                   residue 51"
FT   gene            complement(199462..199830)
FT                   /locus_tag="Pden_3022"
FT   CDS_pept        complement(199462..199830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3022"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: rru:Rru_A1205 succinate dehydrogenase/fumarate
FT                   reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3022"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71105"
FT                   /db_xref="GOA:A1B6G1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6G1"
FT                   /protein_id="ABL71105.1"
FT                   /translation="MAGLRRDTFRDDLDDCGPIPLDALIWIKNRIDPTLTFRRSCREGV
FT                   CGSCAMTIDATNWTACTWAIADRAKPATIFLLANLPAIKELVPDQTHLLAQYEMIEPWL
FT                   NPGRAIAEIKKKMIERQG"
FT   gene            complement(199948..200400)
FT                   /locus_tag="Pden_3023"
FT   CDS_pept        complement(199948..200400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3023"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rde:RD1_1693 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3023"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71106"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6G2"
FT                   /protein_id="ABL71106.1"
FT                   /translation="MPGIELQQDGARIDAAVLARAFGISADDLRQGMRDGTITSRFERG
FT                   AGKDAGTVRLIFFSSSRRIRITADESGRILTCGAVDFAGSSGPGSRRPEAGADHGAPGS
FT                   GRDPGQAAHIETLLDLALQGTFPASDPIAISIDAPRRTSLLLGKAP"
FT   gene            complement(200422..200859)
FT                   /locus_tag="Pden_3024"
FT   CDS_pept        complement(200422..200859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3024"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: putative transcriptional regulator, Rrf2
FT                   family; PFAM: protein of unknown function UPF0074; KEGG:
FT                   hne:HNE_1541 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3024"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71107"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6G3"
FT                   /protein_id="ABL71107.1"
FT                   /translation="MRLATFTDYGLRVLMRLAGAPEKPISTGQIAREFAISQHHLAKVV
FT                   SDLGLGGFVRSERGRSGGLRLMRPAHEITLGQVVRHLERKFAIVECFRADGGECVLRPR
FT                   CRLRPQLSAAREAFMAELDRTTLEDCAWPGAGPGGRVVAAE"
FT   gene            201003..201674
FT                   /locus_tag="Pden_3025"
FT   CDS_pept        201003..201674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3025"
FT                   /product="protein of unknown function DUF542, ScdA domain
FT                   protein"
FT                   /note="PFAM: protein of unknown function DUF542, ScdA
FT                   domain protein; Hemerythrin HHE cation binding domain
FT                   protein; KEGG: rso:RS02289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3025"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71108"
FT                   /db_xref="GOA:A1B6G4"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6G4"
FT                   /protein_id="ABL71108.1"
FT                   /translation="MPQTTFPLHDRTVGEIAARLPGASGVFRRFGIDFCCHGEVPLAEA
FT                   ANRRQLDLGALEAVLGDLDPLAIPDAPRETGALIDHIQTRYHQAHRRQIPELIALSRKV
FT                   EAVHAGHPEVPGGLADLLQRIWGELEVHMKKEELILFPAMRRQAADRIAVPIAEMRHDH
FT                   DDHGAFLAELARLTQDHTVPEGACRTWQALYAGTAQLRADLMEHIHLENNVLFPRFEKG
FT                   A"
FT   gene            201788..202111
FT                   /locus_tag="Pden_3026"
FT   CDS_pept        201788..202111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sil:SPOA0172 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3026"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71109"
FT                   /db_xref="InterPro:IPR021111"
FT                   /db_xref="InterPro:IPR038125"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6G5"
FT                   /protein_id="ABL71109.1"
FT                   /translation="MFRSSCILAASLALLPPASLAQTGQSATGAAVAETWLPTLQVDTP
FT                   QQGFDLAIVMARRAVRTTQPDVAMLKAQRSRYAEDAASLIDVSAVAAAWFATIAAANDY
FT                   WRE"
FT   sig_peptide     201788..201853
FT                   /locus_tag="Pden_3026"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 22"
FT   gene            202131..202469
FT                   /locus_tag="Pden_3027"
FT   CDS_pept        202131..202469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3027"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   nha:Nham_4301 alkylhydroperoxidase AhpD core"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3027"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71110"
FT                   /db_xref="GOA:A1B6G6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6G6"
FT                   /protein_id="ABL71110.1"
FT                   /translation="MADISMPKASAALGAKRHALAPAIDDAFLALSKVVFADGALDKRT
FT                   KQLIAVAVAHVTQCPWCIEGHVKGARREGATNEQIMEAIWVAAEMRAGAAYAHANKALA
FT                   VLDEIDGA"
FT   gene            202683..204353
FT                   /locus_tag="Pden_3028"
FT   CDS_pept        202683..204353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3028"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="PFAM: cytochrome c oxidase, subunit I; KEGG:
FT                   rsp:RSP_1877 cytochrome c oxidase, aa3 type, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3028"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71111"
FT                   /db_xref="GOA:A1B6G7"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6G7"
FT                   /protein_id="ABL71111.1"
FT                   /translation="MSAQISDSIEEKRGFFTRWFMSTNHKDIGVLYLFTAGLAGLISVT
FT                   LTVYMRMELQHPGVQYMCLEGMRLVADAAAECTPNGHLWNVVVTYHGILMMFFVVIPAL
FT                   FGGFGNYFMPLHIGAPDMAFPRLNNLSYWLYVCGVSLAIASLLSPGGSDQPGAGVGWVL
FT                   YPPLSTTEAGYAMDLAIFAVHVSGASSILGAINIITTFLNMRAPGMTLFKVPLFAWAVF
FT                   ITAWMILLSLPVLAGGITMLLMDRNFGTQFFDPAGGGDPVLYQHILWFFGHPEVYMLIL
FT                   PGFGIISHVISTFARKPIFGYLPMVLAMAAIAFLGFIVWAHHMYTAGMSLTQQTYFQMA
FT                   TMTIAVPTGIKVFSWIATMWGGSIEFKTPMLWAFGFLFLFTVGGVTGVVIAQAPLDRVY
FT                   HDTYYIVAHFHYVMSLGAVFAIFAGTYYWIGKMSGRQYPEWAGQLHFWMMFIGSNLIFF
FT                   PQHFLGRQGMPRRYIDYPVEFSYWNNISSIGAYISFASFLFFIGIVFYTLFAGKPVNVP
FT                   NYWNEHADTLEWTLPSPPPEHTFETLPKPEDWDRAQAHR"
FT   gene            204776..206932
FT                   /locus_tag="Pden_3029"
FT   CDS_pept        204776..206932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3029"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor, plug;
FT                   KEGG: ecp:ECP_2036 hypothetical TonB dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3029"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71112"
FT                   /db_xref="GOA:A1B6G8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6G8"
FT                   /protein_id="ABL71112.1"
FT                   /translation="MRRAVSNGGIAISFFCLATAGHAQTLPRQDAIVLDQVVIQGGDDS
FT                   GKSGVRAKTATIGPLGRREIKDTPYSVSVIDKTLIENQQATTLPDLLKYMPSTQMEARG
FT                   GGDVGRPQSRGMQGTPVFNNRLDGMNIVATTAQPIEMYERVEVVHGLAGAYFGPASPGG
FT                   LFNFTRKRPTQDPYNRINTGFTGKGTWLAHGDFGGHAADGMLGYRINVLSEEGDGYVKG
FT                   SDLDRSLISGAFDINLTDQTTIELNASRYRFDKFGFPGSFSYDNSVTLPDAPDPTKVGY
FT                   GQKFAGYGLEDTLVGGLVKHRFNEDWSLTAGMQHQRVSRWFVSVSNALLDDDGNYSNSI
FT                   DGGVSGQFRVTSNIAVLNGTLFTGGVKHDVHLGTTGVNWENYSPRSGNPSVQGYLGDAS
FT                   IDNPVQWDAPTGLVRNGPRYRSFSNRSQSLVLGDSITFNGQWSAILSGSYTWFDVKNYD
FT                   ETGTVTQKYSERGLSPSVALSYKPAENITTYVAYVDTLQSGGTAPTTAANAGQVLAPER
FT                   SKQVEAGVKADLGGLDASVAVFRIERPFAFTGEDNVYRIQGDQVNKGIELELRGQLLEN
FT                   LNIHGGVTLLDPKLRNTGNPLTSDTDVVGAPKVQANLFMEYFFKSLPELSASANLHFTG
FT                   KRAGNNINSFKVDSYATLDLGLRYERQMTKDTTAVFNLAINNVFDEHYWASIFPGSIDG
FT                   ATRGANSAFLGAPREVRLSASFKF"
FT   sig_peptide     204776..204847
FT                   /locus_tag="Pden_3029"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.994 at
FT                   residue 24"
FT   gene            206944..207768
FT                   /locus_tag="Pden_3030"
FT   CDS_pept        206944..207768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3030"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: dps:DP0853
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3030"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71113"
FT                   /db_xref="GOA:A1B6G9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6G9"
FT                   /protein_id="ABL71113.1"
FT                   /translation="MGNLIDWDLLDRLLTPPVFAQSPMWDAFADRYNGYVAMQSEYTGL
FT                   QIDMMNIGVDETVLDVGAGPGRIAIPAAARARSVTALDVSRPMLDHLERNARQAGRDNI
FT                   RRLDLAWQDVEPDGNVEVHDIVVAARSPAMNDLRKIDALARKRAYVTLFSGPSLKCFHD
FT                   SLVAGIEPAPPSAAAKPTPMPGYALVFNRLVAMGLEVNVGFVPDGFSQVFPDWDAVLDG
FT                   FSWLGIGKTDEPRFRDNIAPYLSQTQDGLALRMETRTCILWWDKVHPAGFGT"
FT   gene            207773..208786
FT                   /locus_tag="Pden_3031"
FT   CDS_pept        207773..208786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3031"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   nha:Nham_0954 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3031"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71114"
FT                   /db_xref="GOA:A1B6H0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6H0"
FT                   /protein_id="ABL71114.1"
FT                   /translation="MTARSPTLTFLALLLAVSVIFAFGIGRYPIGTRDLFDFVLAATGL
FT                   GRMEQDRYDLLSNLILDIRAPRIAAAVLVGASLATAGAAFQAVFRNPLVSPGLLGVLAG
FT                   AGFGASVGILISGNWVVVQLLAFACAILAVLFALGIANLFGNASLVMLILGGIISGALF
FT                   SALLTLVKYAADPGDQLPAITYWLMGNLGTARIEQLRWAALPVFAGILIVWMLGRALDA
FT                   MSMGDDEAHTLGVPVALIRYAVIAVATMVSAISVSMVGIIGWIGLIIPHIARLMIGPMN
FT                   MRLIPASALLGASFLVGADILARSLSGIEIPIGIVTEIVGIPIFVLVLSRVRRGWT"
FT   sig_peptide     207773..207841
FT                   /locus_tag="Pden_3031"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.853 at
FT                   residue 23"
FT   gene            208783..209553
FT                   /locus_tag="Pden_3032"
FT   CDS_pept        208783..209553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3032"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: nwi:Nwi_2074 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3032"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71115"
FT                   /db_xref="GOA:A1B6H1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6H1"
FT                   /protein_id="ABL71115.1"
FT                   /translation="MSRVVISTQGLGFDRDRRVILSDVELAIRAAEIVAILGANGAGKS
FT                   TLLRLMLKLLRPARGSVSLYGMPLAAMRRRDIAAAVAYVPQHHTPPFPYTVAQVAGLGR
FT                   LVTSGLLKLPGARDEKRVQAVLERLGIAHLAQRDYTGISGGERQLVLIARALVQGARIL
FT                   LMDEPDVGLDYGNQRRLLDLMRALAAEGHTIVFTTHHPDHTLYAADRAVLIDGGKILAD
FT                   GGPASVLTPQVIHAVYGVRVARVGHGPHIIFVPA"
FT   gene            209564..210601
FT                   /locus_tag="Pden_3033"
FT   CDS_pept        209564..210601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3033"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: eca:ECA3564
FT                   iron-chelating periplasmic-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3033"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71116"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6H2"
FT                   /protein_id="ABL71116.1"
FT                   /translation="MFRIRHLATCIACAVALLSQPASAEIMREVVYYGDRSVSLPPEID
FT                   RIATNWEAQNSILTMLGYGDRIVATTRIARSMPLMQKFVPSIKAAALTTLGDGTVNVEE
FT                   LMVLKPDILFSSRALPDAVSRQLRGAGIAVASFRSNSIDALVERVLITGEMLGPDALEV
FT                   ARRYQGYFDDNRRRVAERLEGIPPDRRVRVYLASGAPLSTSGRPSLNQDWMDLGGAINI
FT                   AESWFGDMPYASGIASLENIIAGNPDVIISMNAEDAEEIRTNPQWRNVKAVREGRVYAN
FT                   PRGLFWWCRETSEGALQFLWLASTLYPDALADIDMREETRRFYRKFYRIELTDNEIAEF
FT                   LKPTY"
FT   sig_peptide     209564..209638
FT                   /locus_tag="Pden_3033"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            210616..210993
FT                   /locus_tag="Pden_3034"
FT   CDS_pept        210616..210993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3034"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71117"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6H3"
FT                   /protein_id="ABL71117.1"
FT                   /translation="MIIETAAMNSRTFEPSFFRSGCLGRWRNLSAHPCARVSSHRAICR
FT                   NMPFAFPSLCLNEYNDSVGCEEETGVVVRASHRDPSWGLGKERLQALHLRIGQPEKIAH
FT                   RSGLLAEPESRQTPEINGSGA"
FT   gene            complement(211066..211221)
FT                   /locus_tag="Pden_3035"
FT   CDS_pept        complement(211066..211221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3035"
FT                   /product="butyrate-acetoacetate CoA-transferase"
FT                   /note="KEGG: rru:Rru_A1382 butyrate-acetoacetate
FT                   CoA-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3035"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71118"
FT                   /db_xref="GOA:A1B6H4"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6H4"
FT                   /protein_id="ABL71118.1"
FT                   /translation="MTLIVTELVVMEPTPEDLALRERAPGVSAGEIEAATGADLLIAGE
FT                   VPEIRL"
FT   gene            211416..212906
FT                   /locus_tag="Pden_3036"
FT   CDS_pept        211416..212906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3036"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; Xanthine/uracil/vitamin C permease;
FT                   sulphate transporter; KEGG: rsp:RSP_4197 antisigma-factor
FT                   antagonist, STAS"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3036"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71119"
FT                   /db_xref="GOA:A1B6H5"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6H5"
FT                   /protein_id="ABL71119.1"
FT                   /translation="MNSLTSYRHEWLGNIRADLLSGLVVALALIPEAIAFSIIAGVDPK
FT                   VGLYASFSIAVITAIAGGRPGMISAATAATAVLMVTLVRDHGLQYLLAATVLAGLVQIG
FT                   MGLLRLGFVMRFVSKSVMTGFVNALAILIFMAQLPELDPARVPPLTYLLVAAGLAIIYL
FT                   FPLLTRAIPSPLVTIVVLTALSLAFGWDVRTVGDMGALPDTLPVFLLPDVPLNLETLTI
FT                   ILPYSLAVAVVGLLESLMTQNLVDELTDTRTDRNQECIGQGLANTATGFIGGMAGCAMI
FT                   GQSMINVKSGGRGRLSCFVAGVFLLILVVGLGDLVARIPMPALVAVMIMVSVGTFSWSS
FT                   IGNLRTHPRSSSVVMLATVATVVWTHNLAIGVLIGVLLSGIFFAAKIAQLFRVTSALSL
FT                   DGRSRTYRVEGQLFYGSVEDFMAAFDFREALERVVIDVSAAHIWDISSVQALDMAVLKF
FT                   RRIGAEVEVVGLNEASETILDRLGSHDKPGALDRLNAH"
FT   gene            complement(213391..214716)
FT                   /locus_tag="Pden_3037"
FT   CDS_pept        complement(213391..214716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3037"
FT                   /product="Cl-channel, voltage-gated family protein"
FT                   /note="PFAM: Cl- channel, voltage-gated family protein;
FT                   KEGG: mes:Meso_1046 Cl-channel, voltage gated"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3037"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71120"
FT                   /db_xref="GOA:A1B6H6"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6H6"
FT                   /protein_id="ABL71120.1"
FT                   /translation="MPMPRPRFRILRRSRALITSREQWRGRMVFWCGALLVGLVSTAFA
FT                   KLADLATETFRHLSAGGTSPWLLLALPAGFISSGWVAQRYFPGAQGSGIPQAIAARALE
FT                   GEERRLYLTLRIAAGKFLLTLWGLLCGASIGREGPTVQIGAAIMLASARVGHLAQAKGL
FT                   ILAGSAAGIAAAFNTPLAGIVFAIEEMARTYQSRTNGLVLSTVVIAGIAALAISGSYTY
FT                   FGEAVAYGNFPRDWLLVGVVGIAGGALGAGFSRSVLSLTRRIRRWKLAPGRKLVVVAGA
FT                   AGLAVAVTGLLSGGMAFGTSYGEARLAVQGEQLPASFFLAKLLATLASTVSGIPGGLFA
FT                   PSLSVGAGLGNLIGGLFSASLSFAAVLGMAAYFAGVVQSPMTAFVIVMEMTATQEHALP
FT                   IMAAAMLGFGVSRLLSPEPLYHGLARLWLADALKLRRREGAA"
FT   sig_peptide     complement(214579..214716)
FT                   /locus_tag="Pden_3037"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.989 at
FT                   residue 46"
FT   gene            complement(214845..216509)
FT                   /locus_tag="Pden_3038"
FT   CDS_pept        complement(214845..216509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3038"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: rsp:RSP_3080
FT                   choline/carnitine/betaine transporter, BCCT family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3038"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71121"
FT                   /db_xref="GOA:A1B6H7"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6H7"
FT                   /protein_id="ABL71121.1"
FT                   /translation="MSQISPSEPLIADAGIEALPPPEGPTQIIATDYEIGQDNIEGVKP
FT                   VAFDIHNPVFMISGVAVVVFTAATLLFPSVLGPFFGGLRDVVTSNFDWFFLIAGNVFVL
FT                   LCVGLILSPLGSVRLGGPEATPDFSLTGWFSMLFAAGMGIGLMFYGVSEPLGHFTAALG
FT                   GPVVENGVRTDWAPLDGAPGDELGARRLAMAATIFHWGLHPWAIYAVVALALALFAYNK
FT                   GLPLTLRSVFYPILGERVWGWPGHVVDVLAVMATLFGLATSLGIGAEQASAGFHFLFGW
FT                   STALTAKIVLIVIITGVATASVVLGVEKGVKRLSEINMILAVLLLLFVILTGPTWQILT
FT                   GFFGNLAAYGAKILPLSNPFGRTDDNFRHGWTAFYWAWWISWSPFVGMFIARVSRGRTV
FT                   RQFLTAVLIVPSLISVLWMTAFGGTAISETLAGFSGVTDAALELQLFQMLSQLPLTAIS
FT                   SFIGIVLVIVFFVTSSDSGSLVIDTIAAGGKIHAPVPQRIFWCSFEGLVAIALLLGGGL
FT                   TALQAMAVSTGLPFTLVLLGACWAILKGLLAEKRELT"
FT   gene            216885..218168
FT                   /locus_tag="Pden_3039"
FT   CDS_pept        216885..218168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3039"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_5072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3039"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71122"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6H8"
FT                   /protein_id="ABL71122.1"
FT                   /translation="MTSYWNGRQARPDNLRLLTHEGAWKAWADAEEPMPADPEHRLRGC
FT                   RSIVTQALQDVLHSTNVIILLGSGASFCARNTTGPNAPGMRDLWVGVRAACEAHRAGEF
FT                   DAVVRALVGTAPGVDPDGNPKTGNIERLLSLCKMRLELLSVKEETLKNARSLVDDPGPE
FT                   EAAAVAEMESLSAFVSLAEEAVLTKVGFVNATTELSAHTELLTKFGRRSADKPRVKIFT
FT                   TNYDLCIEEAALRLNAVLVDGFSHSARQRYNRDNFDHDIVRRRNGTARADFVDGVFQLY
FT                   KLHGSVDWRRVGDHVFRSLDMDFEHGAPVLIYPRSTKYQEAFDSPYLDMFAALQAGLRE
FT                   PDTTLIIAKTPPHRTALLRKSADDRTSPFPGHTYPAATVIGIPSAVKRLRTAARIWTSA
FT                   TWRSKSRDISRWPSSFTQFIFVSTLLRR"
FT   gene            complement(218003..218413)
FT                   /locus_tag="Pden_3040"
FT   CDS_pept        complement(218003..218413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3040"
FT                   /product="ISSpo9, transposase"
FT                   /note="KEGG: sil:SPOA0122 ISSpo9, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3040"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71123"
FT                   /db_xref="GOA:A1B6H9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6H9"
FT                   /protein_id="ABL71123.1"
FT                   /translation="MLPDLLAQIPAEEEIATVTADGAYDTRACHDAIAARDAAAIIPPR
FT                   QNARPWKPDTAGARARNEILRASKRLGRALWRNWSGYHRRSRVETKMNCVKLLGQRLMS
FT                   RDFDRQVAEVQIRAAVLNRFTALGIPMTVAAG"
FT   gene            complement(218479..218688)
FT                   /locus_tag="Pden_3041"
FT   CDS_pept        complement(218479..218688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3041"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr1867 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3041"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71124"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6I0"
FT                   /protein_id="ABL71124.1"
FT                   /translation="MALNRKNALFAGHDEGGIAWGRIASLIETCKINGIEPFAYLKATL
FT                   TAIASGHPQSRIDDLLPWNFRPAS"
FT   gene            219164..220487
FT                   /pseudo
FT                   /locus_tag="Pden_3042"
FT   gene            complement(220605..221069)
FT                   /pseudo
FT                   /locus_tag="Pden_3043"
FT   gene            complement(221466..222683)
FT                   /locus_tag="Pden_3044"
FT   CDS_pept        complement(221466..222683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3044"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bja:bll3850 putative multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3044"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71125"
FT                   /db_xref="GOA:A1B6I1"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6I1"
FT                   /protein_id="ABL71125.1"
FT                   /translation="MMPEEPAAPDRSPLPPILAVVAVESAGLGMILPLLPFYASEFGAT
FT                   PLTIGLLLASFSLCELLAAPILGKASDLFGRKRLLVASQIGTCASFLLLALAPNLAVVF
FT                   AARILGGLSAGNISIATAYVSDRTAPHKRRQAIGFVSAAMGVGTMVGPALAGVLAPMGL
FT                   AVPFGVAAVVSLASILATCLLLPAEGQQPIHKPAPAPFLAQIGGLLALPQVKHLLAALA
FT                   LLFMAFSLFGSQFALVLHARFQWQGRPFDPTEIGFVFVAAGAINILVQVVVMPLLGKAL
FT                   RERTLAMASFSLLAIGFMIIGLVGTVPALAAGIVMAATGIALARPTLVAALSLIVPATS
FT                   QGAAMGMAQSMAALINIVAPIAGGLLIEGQHFTGWAMALVGLALAGIAVVALSPAGSDS
FT                   SKRADP"
FT   gene            complement(222708..223940)
FT                   /locus_tag="Pden_3045"
FT   CDS_pept        complement(222708..223940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3045"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   stm:STM1545 putative multidrug efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3045"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71126"
FT                   /db_xref="GOA:A1B6I2"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6I2"
FT                   /protein_id="ABL71126.1"
FT                   /translation="MNDAATADDAAPERLDWRLMLPVFLVVSLYAASAASTLPILPFYI
FT                   QEMGGTPLILGIVMGTEALTHLVAAPLIGQLSDRLGRKRILLATQATAFVSLLLLGLAQ
FT                   AVIPVLLARMLFGFTGGTFAAAAAYAADHSSPANRRQAIGTLHAGVGLGGIVGAGISGY
FT                   LSDISLTAPIYAAMVLSAVSFTVTALWLKRSPAASQTPDASREVSFRSIVGSPLIRVLV
FT                   VVLLCYFFAYGMYSSQLANYLQASFVTPENPFGPRELGYVLAADGAINILVQLFLLRWL
FT                   GRFFTVRRLIIFICAIVATGYMTVGLATTLPVLVLAILCVSFGDAMARPTFFSALSVHA
FT                   PQERQGIVIGTTQSLIALTDVASPVFAGLLIGQALYGLWTGVIIALVALTAAIAWRHLP
FT                   AVDPETAARAD"
FT   gene            224252..225097
FT                   /locus_tag="Pden_3046"
FT   CDS_pept        224252..225097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3046"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; KEGG: rpc:RPC_4092 alcohol dehydrogenase,
FT                   zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3046"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71127"
FT                   /db_xref="GOA:A1B6I3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6I3"
FT                   /protein_id="ABL71127.1"
FT                   /translation="MSQVVKGRAAGSHYSASGGLPFVAGIDGVGRLDDGRRVWFVLPRD
FT                   PFGSMAEQTVVPVAQCLVLPDDLDDLTAAAIANPGMSSWVTYTERARLQPGETVLVNGA
FT                   TGTSGRLAVQIARHLGAGKIIATGRDAEALREVAALGADVTIPLTEDAAALEERFKEQF
FT                   AQGVDVVVDYLWGMSAECLLIAGAKTGRPGTPIRVIQIGSVSGATITLPSAVLRASAIE
FT                   LMGAGHGAVPLDRHLAAVEALLKAVAPANLKIAFHAVPLSDGTRAWDRDDSRNRTVFVV
FT                   "
FT   gene            complement(225122..225607)
FT                   /locus_tag="Pden_3047"
FT   CDS_pept        complement(225122..225607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3047"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG:
FT                   ret:RHE_CH02035 probable transcriptional regulator protein,
FT                   MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3047"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71128"
FT                   /db_xref="GOA:A1B6I4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6I4"
FT                   /protein_id="ABL71128.1"
FT                   /translation="MSTIKVHHTHIRKMLPELHRALMDIASLMNRPERDAQLLEIAGLT
FT                   LERALFPLLVTVERRGPIGVVELADGVGRDYTTVSRQIARLEEIGLVERRASPSDKRVR
FT                   EAVITTKGKAATDAVDAAREKMVLSLFKDWKRDDFDELIRLMKMLADSMSAEPTRSE"
FT   gene            225654..227174
FT                   /locus_tag="Pden_3048"
FT   CDS_pept        225654..227174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3048"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /note="PFAM: monooxygenase, FAD-binding; FAD dependent
FT                   oxidoreductase; KEGG: ret:RHE_CH02034 probable
FT                   monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3048"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71129"
FT                   /db_xref="GOA:A1B6I5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6I5"
FT                   /protein_id="ABL71129.1"
FT                   /translation="MKAQNPVAVLICGAGASGLTLAVDLARRGVAFRIIEKMDQPFAGS
FT                   RGKGIQPRTQEVFADLGVLDRVVAAGGIYPSMREYRADGTWIEKDMAERHDPTPAEPYQ
FT                   IALMVPQFLTERVLRERLAELGHRVEFGTELVGFEQDEKGVTARLVGPDGEETLTARYL
FT                   VGADGGRSFVRRTLGVEFPGKTLGVRAIVADVALTGLGRDAWHQFNDGDMQRMVAICPL
FT                   AGTDLFQLQAPIPPEGEADLSAKALEGMILDRTGRSDIRVHSVAWASAYAMNARLAECY
FT                   RVGRAFLVGDAAHIHPPTGGQGLNTSVQDAWNLGWKLAAVLHGAPDGLLDTYEAERRPV
FT                   AEAMLGLATGLLDAMKRGMTRRGRETRQLDIGYPESPLALDPSGRPGILLAGDRAPDAP
FT                   LRGAAGLSRRLFDLFSGPHWTLIGFEAERDIIAPRGGLHIHRVGPGQELEDEDGHLHAA
FT                   YGLAPGEWVLVRPDGYVAAIVSMQDVALLESFLAEVGVAGARSGDLKS"
FT   sig_peptide     225654..225722
FT                   /locus_tag="Pden_3048"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            228088..229941
FT                   /locus_tag="Pden_3049"
FT   CDS_pept        228088..229941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3049"
FT                   /product="Transketolase, central region"
FT                   /note="PFAM: dehydrogenase, E1 component; Transketolase,
FT                   central region; Transketolase domain protein; KEGG:
FT                   aeh:Mlg_2596 dehydrogenase, E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3049"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71130"
FT                   /db_xref="GOA:A1B6I6"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6I6"
FT                   /protein_id="ABL71130.1"
FT                   /translation="MAALGPCDRVIATYRGHGWALETGVPAQEFFAELCHRKAGVNGGR
FT                   SGSALVTAPNQRFIGENSIVGAGGPIACGIALAAKMEGADRVCLVTFGDGATSQGALHE
FT                   AFVFAAAYKLPVIFVCENNGWSEMTPTLSITGLDRLARRANGYGMASATIDGTDPMAVK
FT                   DSIALARAAVLGGKGPALIECRVPRLWGHYNRDIEHYRPKSDREDSRARDPLALLEARL
FT                   CALGASSAEELAILRGRLDRDWSAVLDTVKAMPLPDAASAADHVVAPIPAAPSAPDQQG
FT                   ESREITYIQAVNEALKRELTEHSEVMVFGEDVGHAGGIFGATRYLQRDFGAERVFDTPI
FT                   AEAAILGSAVGLALEGKRPVVEIMWADFLLVALDQIINQAANIRYLTRGTRTAPIVVRV
FT                   QQGATPGSTAQHSQSLEAMLAHVPGLRVGLPSTADDAYHMLRAAIHGADPTVIIESRAL
FT                   YQRTGTVWPDAARQATAGATLRRAGTSVTLLGWGAVMPAVEAAADALAENCIDVSVLDL
FT                   RWLSPVDWGQLCATVSATGGRVVVVHEANLTGGFGAEIVAGLAERLGPGALSFRRVATP
FT                   DVRMPASPVLQAALLPDAAKIMAAAKDLLQSNLLPQNEEYV"
FT   gene            229941..230696
FT                   /locus_tag="Pden_3050"
FT   CDS_pept        229941..230696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3050"
FT                   /product="regulatory protein, IclR"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG:
FT                   rha:RHA1_ro08622 probable transcriptional regulator, IclR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3050"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71131"
FT                   /db_xref="GOA:A1B6I7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6I7"
FT                   /protein_id="ABL71131.1"
FT                   /translation="MTGSKEKSGRLQINSVVRGVNILTAIARSDQGLSVREIAEAIGVE
FT                   RQTAYHLVHTLEDTGFIARDDQRNYRLGLRVGALAEAFGRQFSAPDYMLPLVRGLATET
FT                   GETCYVVGWWQGEIVIIEVAAGANAIRAAEMPHGQYLHAHARAAGKVLLAYAATARMAE
FT                   YLLNHQPLAKLTENTMTDFKSLQAEFTRIRAEGIGYDNEEFARGTSCMAMPLEAGTAPY
FT                   ALALSAPTERFHAFRETYQQKLAALVQRN"
FT   gene            230709..231107
FT                   /locus_tag="Pden_3051"
FT   CDS_pept        230709..231107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3051"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: mlo:mlr1297
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3051"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71132"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6I8"
FT                   /protein_id="ABL71132.1"
FT                   /translation="MTITLFDCKDVAAAFGNYAHGVVIPPSAVTIHLAGQVGVRPDGTI
FT                   PGDAGEQTRIIFENFRIILESRGFAFSDIVKMNYFVVEAEDLPAIRAVRDSLIPAPFPA
FT                   ASLVLVKALGRPEWKLEIECIAARTGAE"
FT   gene            231104..232495
FT                   /locus_tag="Pden_3052"
FT   CDS_pept        231104..232495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3052"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   pol:Bpro_0421 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3052"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71133"
FT                   /db_xref="GOA:A1B6I9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6I9"
FT                   /protein_id="ABL71133.1"
FT                   /translation="MMRNSLAHTDLNCLLHPQTDPAALVAQGPLILESGDGVFVTDSSG
FT                   RSYLEGMSSLWCASLGFNEPRLARAAADQISRLGTYHTFNRRSNPAVIELAERLLALSP
FT                   MPDGKALFANSGSEAVDTMIKLAWLYHSGRGAPERRKIISRRRAYHGSTVLGATLSGLP
FT                   SMRGAFAWPDPGVIFAEAPHFYTCAEAGESEEAFVDRLVAEVAALIAAEGAGSIAAMIA
FT                   EPVMGAGGVIIPPSGYFPKLAELLREKGILLLSDEVICGFGRTGEWFGCQTFGFRPDMM
FT                   SVAKALSSGYQPIGATLLTAEIHDVVSAEASRLGVLGHGFTYAGHPVTSAVALETLKIY
FT                   EEMDLLAQVRARAPAFLDHINALAGHPLVGEARAVGLIGAVELVADRATRRPFASEAGI
FT                   GARLVTLALDQGLIVRNLGDAIAICPPLIVTTAELELLFNRLRQALDALALETAASQVE
FT                   DRHDQ"
FT   gene            232485..233912
FT                   /locus_tag="Pden_3053"
FT   CDS_pept        232485..233912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3053"
FT                   /product="Amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="PFAM: Amidase; KEGG: mxa:MXAN_2852 amidase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3053"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71134"
FT                   /db_xref="GOA:A1B6J0"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6J0"
FT                   /protein_id="ABL71134.1"
FT                   /translation="MISDILDLDATAQAAAVAKGDVSAAELARAAIARIEAGEPVLNAV
FT                   TQRFFDQALDMASADLPPGPFRGVPFLVKDFYCHMAGTPTTGSAKLLEHNLIDHDSALM
FT                   ARYRQAGFVTLGKTNVPEMVTMGTTEPVWRGPTRNPWNTGHTPGGSSGGSAAAVAAGYV
FT                   AVAHANDGAGSIRIPASCCGLFGLKPSRARVTLGPDVGEAIGGITAEHVVSRSVRDSAA
FT                   VLDATAGALPGDPYIAPEPPEGFLAAIARPRKGLRIGLTLDAPDGTSAAPECQAAALRA
FT                   AVLLRDLGHQVEEVTLPFDGAAFRAALSTFWPMTVTRGLSAIAEARDADPEVLLRELEP
FT                   FNQHLFALGISRRAVDYIRDLVIFQGMARAMGQFFATQDIWLSPVLPFTPPRLGYFDAG
FT                   VLGGETAWNRVLDSFMFTAPANVTGLPSASLPMTVSNEGLPIGIQLTAKLNDEALIFNL
FT                   AAQLEAANPWAMPRHKI"
FT   gene            233971..235251
FT                   /locus_tag="Pden_3054"
FT   CDS_pept        233971..235251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3054"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="KEGG: sil:SPO2534 branched-chain amino acid ABC
FT                   transporter, periplasmic branched-chain amino acid-binding
FT                   protein, putative; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3054"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71135"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6J1"
FT                   /protein_id="ABL71135.1"
FT                   /translation="MLKGSAWLAGAAAVLSGANAARAEASGEPVPIGQAAPLTDFAAAD
FT                   GVEFRNGLIMACDEINALGGILGRPLEPHFEDTKQMGDATNVQAVQRLIDRYGVHAVIN
FT                   GYNTGSGSAVQDAIADAGIIYMHNDTSSGHGVLIGSDPERYFGSFQTDPSETWYGSGLL
FT                   KFLSSLTDGGTFAPANRKLAIILSAGTYSSNIANVVREGAAELGWEVSLYETVNVPISE
FT                   WGPTLSKLRQDPPGVIVVTHYFPADLAQFMVQFMTNPTPSLIYMQYGPSVKSFRDIAGP
FT                   AAAGVVFSTVIGALQDEIGLDFEARYKARFGDDAGHNSGVQSYNAAWIWAAAAALAGGS
FT                   GAPGEEEQNRKVAERIRAMIHRGPNGTTRFMPGEQAAASYPGGTDDPSLGMPHQFLQIQ
FT                   DHTAEPVLIAPWPYAKAGFITPPWIRG"
FT   sig_peptide     233971..234042
FT                   /locus_tag="Pden_3054"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.832 at
FT                   residue 24"
FT   gene            235254..236066
FT                   /locus_tag="Pden_3055"
FT   CDS_pept        235254..236066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3055"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sil:SPO2533 branched-chain amino acid ABC
FT                   transporter, ATP-binding protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3055"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71136"
FT                   /db_xref="GOA:A1B6J2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6J2"
FT                   /protein_id="ABL71136.1"
FT                   /translation="MFQVRETPLLSCRNVTKKFGSLAAVSELSFDLAAGEVLGIGGPNG
FT                   AGKTTLFEMISGQTAVTSGTIALEGRDITGLSPVGRCHAGLARVFQLNTGFDSLSVREN
FT                   VLVAAYYGRAPRRIPGFRVPSEVSDQVQDALCRVGLEASADRAAAKLPVIDRKLLMIAG
FT                   ALAMSPKLLLLDEPVGGLTQREIDQVADVVGQVAADGVTVVLIEHVMRFLVQLSTRVMI
FT                   LHHGRKLYEGDAAGISRDPDVVEVYLGQSAGKDVARLAADRTEARHAG"
FT   gene            236056..236769
FT                   /locus_tag="Pden_3056"
FT   CDS_pept        236056..236769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3056"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sil:SPO2532 branched-chain amino acid ABC
FT                   transporter, ATP-binding protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3056"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71137"
FT                   /db_xref="GOA:A1B6J3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6J3"
FT                   /protein_id="ABL71137.1"
FT                   /translation="MPDELVISHLTAGYGHQSVLQDLSLRAEAGRLTALIGPNGHGKTT
FT                   LLRAISGLIRPKSGEIRLGAERISGLGAETIVARGIVHVPQGDLLFPDMTVLENLRMGA
FT                   FLPAAARQEKSVLEEVFTLLPKLRDRQSQIARTLSGGERRMVGIGRGLMASGRVLMLDE
FT                   PSLGLAPIVIEQIYEVIAGLRRAGRSILLVEENAMRAAVIADQVHLLDHGTLAWSGTGA
FT                   ELSGRSELLETYLGV"
FT   gene            236773..237651
FT                   /locus_tag="Pden_3057"
FT   CDS_pept        236773..237651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3057"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG: sil:SPO2531
FT                   branched-chain amino acid ABC transporter, permease
FT                   protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3057"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71138"
FT                   /db_xref="GOA:A1B6J4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6J4"
FT                   /protein_id="ABL71138.1"
FT                   /translation="MDVLLQILASGLTLGAVYAISTVGLALVFGAMNMLNMSHGALMAL
FT                   GGYMAWFMVTGFGLPPVAGMLAAVLVCAAVGVLIYLLIAKPMLQSEGFETRIFIATIGF
FT                   GAMLESVILMAFGPQPKPQPLAVQGGFSLAGVHLPIQNLLILVLSMLLMAALALLLQKS
FT                   RIGRAIRATAQNRDAARLMGVRIGVVYALVLGISGGLAAISGITVSSLSSLLPNMGGDP
FT                   MLKAFIICVVAGLGRVPGSVIAALFIGLFEAVVQYTIGVRFSFALLLLLVIVVLIWKPQ
FT                   GVFGRQQGVRL"
FT   gene            237648..238664
FT                   /locus_tag="Pden_3058"
FT   CDS_pept        237648..238664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3058"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG: sil:SPO2530
FT                   branched-chain amino acid ABC transporter, permease
FT                   protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3058"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71139"
FT                   /db_xref="GOA:A1B6J5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6J5"
FT                   /protein_id="ABL71139.1"
FT                   /translation="MTAMRRDLLLCGLFACVALFWPMISGMRYSITQTTFFFIWATVVV
FT                   QWNLVFGIGGIFSLAQVAIFAIGAYVTAMLGYYLGTSMLLAMPAGAVVAVVASIILGIA
FT                   CLRLYGPYVALLTICVSQVLYVLIVNDTDCFTNPPAGCMPLMGGVRGFSRFGDLGFRDW
FT                   LGAGFYVGNYYVGLLLLSAAILFSIMIIHSPMGLAFRALRDNPVYAAARGVDRFRYQLW
FT                   IFGLSAFFTGLAGAFYAVNTGVVGPVVFSFQHLLFLLSMIIVGGIGTVWGPVIGAAVLM
FT                   LADEAMRELGDFRDIGMGLILVACVVLMPRGLTGLFHDISTRLAKSSGTEGEKSCQR"
FT   sig_peptide     237648..237740
FT                   /locus_tag="Pden_3058"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.658 at
FT                   residue 31"
FT   gene            238652..240073
FT                   /locus_tag="Pden_3059"
FT   CDS_pept        238652..240073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3059"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: bxe:Bxe_B1011 putative indole
FT                   acetamide hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3059"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71140"
FT                   /db_xref="GOA:A1B6J6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6J6"
FT                   /protein_id="ABL71140.1"
FT                   /translation="MSALKPVTMTEQLRQLRSGETTAEAMMTRAIRRAGDLGHLNAFLT
FT                   VEPDLALQQARAVDRARTEGAQMPILAGLPIGVKDNIDVEGWVTSGATPALAQLRAKAT
FT                   APVLQKLLQSQAVLLGKTNLHELAFGVTNTNFTPIPAVRNPHDPARISGGSSGGTAAAI
FT                   AAGIVSAGLGTDTSGSVRIPAALCGIAGLRPSVGAGGTERRYSSQGVLPISHTNDTPGP
FT                   MAVSVEDLALLDAVITGTDPVTAKSLKGVRLGVPDCFWIDLDPDVERVCRELCGKLAKA
FT                   GAELVSVSLPRLRDVWRQVSAPVVLHEPREDIPVWLAANGRSDISIMDIFRQIVNPDVR
FT                   AAFEVVTSESSDKNYRDAIQNYRPELCRIYDGAFQKNGLAALIFPTVPIPATYIDIESA
FT                   FGKVKINGEDREIFDTLVRNTDPGANAGLPGLSIPVGWTQSGLPVGIEIDGPVGSDRDV
FT                   LGIGVSIEREISNQV"
FT   gene            complement(240368..240727)
FT                   /locus_tag="Pden_3060"
FT   CDS_pept        complement(240368..240727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3060"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gox:GOX2722 truncated transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3060"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71141"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6J7"
FT                   /protein_id="ABL71141.1"
FT                   /translation="MRTEITAGQTSDYLGFDLGMADNLPTPSVLLADRGYDADSIRKSM
FT                   GKRDVLPVIPMRKSRKKRIAVDRSLYRLRNLVERCFNKLKNARRVATRYDKTAESFLGF
FT                   IDITPIRLWVRHLST"
FT   gene            240832..242865
FT                   /locus_tag="Pden_3061"
FT   CDS_pept        240832..242865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3061"
FT                   /product="outer membrane autotransporter barrel domain"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain; PFAM: Autotransporter beta- domain protein; KEGG:
FT                   bbr:BB0916 autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3061"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71142"
FT                   /db_xref="GOA:A1B6J8"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6J8"
FT                   /protein_id="ABL71142.1"
FT                   /translation="MMGADHGAIDHLQCMRDRGTIELVGMGSIENSSRVIVDGALDLEN
FT                   KGNEIAFWGVSDAYNDAKIRNLAGSGSVFIYDSDLVLTAAQDTFSGTISSVDSEGRHLK
FT                   GGLTVQGGVQTLSGANVYFGATKVDAGAGLVLTSTGSLASDVLVSGGFVNDGDVAGDTI
FT                   VQDGGMTGGSGSYSALTVLGGGTVATNGKTPLTVGSEFTQKAGSTLVFAPVENGIQPAI
FT                   AVGGRAVIEDGASITLDRVTTGRLAVGREYALVTAAGGLVGNYGSLTGDLVTDAPFLSF
FT                   ALDKTSSGVALGVERSDIVFAEVAHSANQIAVANELEALGSGNELHDEVAYMTAAEASD
FT                   LPAAFDSLSGEIHTAMLGAVAEERHFLRDAVNGRLRAAFGTVGAYKGGVQALTAYGPVS
FT                   AEATTDGPVYWGHAFGGRGEADGDGNAARRDSRTNGVVLGYDAPVQNWRLGGVLAMSDS
FT                   SYGLDGRASSGSGRGIHLGVYAGTQWGQTALRSGLVYSTLRLKANRSTSLGTINERLSS
FT                   KYNGHVWQAFAEVGHRLDHGTMALEPYAGLAHVWMRTDSFAENGGETALAGAEGKMDTT
FT                   FATIGVRAATTIEAATHKLTVSSGIGWRHAFGDARPELAMAFAGGTGFNVAAAPIARNA
FT                   AVLDMGVDMELGRNTNLRLDYQGQLATDAREHRLGATLGMQF"
FT   gene            242895..243410
FT                   /locus_tag="Pden_3062"
FT   CDS_pept        242895..243410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3062"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr4672 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3062"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71143"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6J9"
FT                   /protein_id="ABL71143.1"
FT                   /translation="MASGYITIRGGLYSLPLAALLAGLSALPVFATEKHALGFDVAISL
FT                   SSKAEAALKSTHEGISLSATYYGEPHPGDEKHTNAMGMVDLGAEDINLPDGARTVHVTG
FT                   KTVSADRLRLISGGPMVNVNLFSSRKSHDDNILACDFIDGAVSSLRSGPVYLRCGLITE
FT                   NPETEVKP"
FT   sig_peptide     242895..242990
FT                   /locus_tag="Pden_3062"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.998 at
FT                   residue 32"
FT   gene            complement(243469..243720)
FT                   /locus_tag="Pden_3063"
FT   CDS_pept        complement(243469..243720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3063"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71144"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6K0"
FT                   /protein_id="ABL71144.1"
FT                   /translation="MATAYTQVSSIAERRVAAIRMPRTIRTERPVIGIIGIVHQKADTM
FT                   TAGISIRPGIVAGRQRANCKQQNKKPVAHNIIVSCYYY"
FT   gene            243789..245771
FT                   /locus_tag="Pden_3064"
FT   CDS_pept        243789..245771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3064"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: zmo:ZMO0213 autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3064"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71145"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6K1"
FT                   /protein_id="ABL71145.1"
FT                   /translation="MPGAYFTQQWNGVGMALGALIRSTRTEGCVILRGRSVLVCAVSGL
FT                   ALMTFSFSAGADPVQPIGIPLKHVPSDDDATDFNSLGIMVGVNDAHPRLYQFDTGSDLF
FT                   VGQFDEAMSDVQPLAGHKPDLYAYGDGSYGYWMQEIQFGSIAYYDPDAPDKPVAVIPGK
FT                   HVAGRIIDWVYSQGSDGYKNHKVSATPIGHSDGVAYYADMEVRDRIIHDQPSDHPPFYG
FT                   TFGAGNFTDDKTYISAPASQTKTGYVIAANANMGDSKTPGRAPCLSLHLTPQIRAQFTA
FT                   LMPWGKLDYEFSMRQFPGSGANASNVHDGNYRYTISVPVGKKKRAIDFRGPILFDTGTP
FT                   EFIYVDSDGMLAKFRSKGYRLEKYGDDTVDIKFYGFDDKLNDLEYDDVDISRLSDEGSG
FT                   NSLTIGLPFFQSNSMMFDLENRITAFTPYFVTASGFSTDAGVNIPHLGVVNGDVGSVGW
FT                   VGLAGNLSGQGDFTIEKDSNVRMTAINTYTGATRIAKDGYLHLAGLGSIEKSAHVFNEG
FT                   NLFIDQKGAYMTQWGVDKSFGDAVIRDISGGGDIVLGSRRLVVTAATGTIGGSITDYDD
FT                   NGKNLGGGLVLAGGKLTIAGDNDYSGLTEVASGAEMHVTGQLAGDVSVHGKLSVDGQVS
FT                   GTVTVHEGGELSGNGAISAVHRVSR"
FT   gene            complement(246211..246522)
FT                   /locus_tag="Pden_3065"
FT   CDS_pept        complement(246211..246522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3065"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   rsp:RSP_3809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3065"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71146"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6K2"
FT                   /protein_id="ABL71146.1"
FT                   /translation="MAIRVQEAASLRLDEIYRYTRDRWGAEQADRYITDLFAAFDQIER
FT                   HGVVSRPIPAEFGVEGFYFRHAHHFVYWRRLSNGDVGIVTILHERMHQMDRFRDDVPK"
FT   gene            complement(246527..246793)
FT                   /locus_tag="Pden_3066"
FT   CDS_pept        complement(246527..246793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3066"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_3810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3066"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71147"
FT                   /db_xref="GOA:A1B6K3"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6K3"
FT                   /protein_id="ABL71147.1"
FT                   /translation="MEATMSQTTTMTVRISGALSEFVASNVGENGAYENISEYVRDLIR
FT                   RDKERAEREAFDRLKAELTRAFAAPEESYRPLTAAEVIARNRG"
FT   gene            247092..247268
FT                   /locus_tag="Pden_3067"
FT   CDS_pept        247092..247268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_0525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3067"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71148"
FT                   /db_xref="InterPro:IPR018754"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6K4"
FT                   /protein_id="ABL71148.1"
FT                   /translation="MSGASYREIAGAIYGADRVRAEAWKTSALRDAVMGFVRDARAMIG
FT                   GGYRRLLRRRRRK"
FT   gene            247372..248271
FT                   /locus_tag="Pden_3068"
FT   CDS_pept        247372..248271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3068"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: sit:TM1040_2078 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3068"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71149"
FT                   /db_xref="GOA:A1B6K5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6K5"
FT                   /protein_id="ABL71149.1"
FT                   /translation="MTNTPDLLRLIATVFIAVTCVVIGDTAGKLLTGGGVDPFIVAWSR
FT                   FLLAALMLLPFSGLTRQELPALLDWRVLLRAGFIVCGICCILTALKTEPIANVFGAFFV
FT                   GPVVSYVLAILFLGERPSAQRSLLLGLGFAGVMLVVKPGFGSSAGMAFALAAGTFYGAY
FT                   LVMTRTLAGAFRPRFLLISQLLIGAVVLTPFGLQSDFPVPDMLLLALLLVSAVGSALGN
FT                   FLLVMASRKAEASLIAPLVYSQLISATALGIVVFGDWPDLVSLAGLVLIAISGLGSLLV
FT                   HQRAGRGRLSTPPYPRTP"
FT   gene            248442..248864
FT                   /locus_tag="Pden_3069"
FT   CDS_pept        248442..248864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3069"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="KEGG: bmb:BruAb1_1812 transcriptional regulator,
FT                   LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3069"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71150"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6K6"
FT                   /protein_id="ABL71150.1"
FT                   /translation="MIRFGLYASEDYVRRNGYPDVPEDLHRHQVIGWTEDLTYLAMANW
FT                   LASHCPGVRPSLRLTSFAAQAEAVRQGAGWAVLPDFIAVPAGFAPGMPDLFRSESELWL
FT                   LTHAQSRALQRVNLVRDRVIVAIREELNQLQPQHSA"
FT   gene            complement(248809..249432)
FT                   /locus_tag="Pden_3070"
FT   CDS_pept        complement(248809..249432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3070"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71151"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6K7"
FT                   /protein_id="ABL71151.1"
FT                   /translation="MSQQEALKVLARLARYLHRRRTCPHQIAHRLMRGIRHPDRRQLIG
FT                   PVELGQHHGIAAIGLHPFTRLHRDQGRRHHDAIVPQLDELTIEAIAAGTRLIAEMQPLP
FT                   AGRQLLSQFADLISTMQHRPPVAEPLKNALRPCSVMGSLSAQPLCSWCCGYLHPLSQPS
FT                   PDRPDPQCREIRYRESRDSVSAPRIGLTPSVAVVAGSIPPLSRR"
FT   gene            complement(249529..252093)
FT                   /locus_tag="Pden_3071"
FT   CDS_pept        complement(249529..252093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3071"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /note="PFAM: aconitate hydratase domain protein; KEGG:
FT                   pol:Bpro_3871 aconitate hydratase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3071"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71152"
FT                   /db_xref="GOA:A1B6K8"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6K8"
FT                   /protein_id="ABL71152.1"
FT                   /translation="MPFASTIRGQKIIDLPAAAGADLIRLPHIHRLLLENVLRNAPDPQ
FT                   AARAAILAWLETGRSEAEIPFLPGRVLMHDTTCGPALVDIAAMRSALAEAGHDPQLLNP
FT                   VLPVDVSTDHSLAVDAYAAPGAMARNIQNEYRRNAERYRFMKWATNSLSNFRVHPPGTG
FT                   IMHTLNLERLATVVTERDGWIMPDTLIGTDSHTPMINGIGVLAWGVGGIEAESVMFGMP
FT                   VMLRVPEVVGVRLTGRLREGVTATDLALTVTETLRRIDLADRFVEFFGPGVSALSAGDR
FT                   AVVANMTPEFGGNSGFFPVDQATIAYLHQTGRTPAHCALVEEYCRRQSLWFDPSQSPVF
FT                   TEVVALDLGAVEVSVAGPRRPQDRIPASATAQATAAMRGHAPLPAPPGQAPDGAVAIAA
FT                   ITSCTNTSDPRLLVAAGLVARKARGLGLRPPAHVKTSLAPGSPTAQRYLERAGLLEDLE
FT                   AVGFGIVGYGCTTCIGNSGPLPDTAVEAQAAGRLQVAVLSGNRNFPGRVHPQLEAGFLA
FT                   SPPLVVAFALAGDIERDILHDEIAPGVGLADLWPSGAEIDAALARAQDADDYAAAYDQA
FT                   EASGLWRDLDAPDAPLFPWDPASTYIRRPPFAGFAGTRPRQIVAAPILVLGDDITTDHI
FT                   SPAGAIPADSEAGRYLIERSERPDDLNVFSSRRGNWQAMLRGLFTNKSVRNLLAEDIPP
FT                   GSTILPDGRILPLWRAAEHYRESSTPVVIVAGKRYGMGSSRDWAAKGAALLGTRAVLAT
FT                   SFERIHRSNLIGMGILPLRLPAGISPQSLALTVSDRIGITLDPSRLQPRAPVAVAIHRA
FT                   SGTVEEFDATAAIETSIEVETLAKDGLMPLILDRAARAEAAN"
FT   gene            complement(252149..253021)
FT                   /locus_tag="Pden_3072"
FT   CDS_pept        complement(252149..253021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3072"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; Helix-turn-helix, type 11 domain protein; KEGG:
FT                   rso:RS05438 probable transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3072"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71153"
FT                   /db_xref="GOA:A1B6K9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6K9"
FT                   /protein_id="ABL71153.1"
FT                   /translation="MARVSLSPQIIARIVDHARAQNMQAGQHLPAQLLADSFKVSRQPI
FT                   VSALKKLEQMGIVQSEPNRGYFLACNADEIPEMDTDAAADDALYDRIAADCLARRLPDR
FT                   LSENELMRLYGVARGRLLRVLHQIADEGWIERLPGNGWEFREILTSRKAYSEAYQFRAA
FT                   IEMQALLLPSFRIDQAAFADARRHQQELLASYESESRQKVFGTNIEFHEMLMTCASNEF
FT                   FLDAVRRVNRVRRLMEYSITHDRSRLPQQCREHLQILDLIEQRDMQAAATFLYSHIREA
FT                   GNIKAALFE"
FT   gene            complement(253108..254607)
FT                   /locus_tag="Pden_3073"
FT   CDS_pept        complement(253108..254607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3073"
FT                   /product="protein of unknown function DUF112,
FT                   transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112,
FT                   transmembrane; KEGG: bja:blr3163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3073"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71154"
FT                   /db_xref="GOA:A1B6L0"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6L0"
FT                   /protein_id="ABL71154.1"
FT                   /translation="MDSLIHLMHGFGTALDPMNLMFAAIGVLLGTAVGVLPGIGPALTV
FT                   ALLLPITFKLDPGGSLIMFAGIYYGGMYGGSTTAILLNTPGESASVVTALEGNQMARRG
FT                   RGGPALATAAIGSFVAALIATAGLAFFAPILVKVAVKFGPWDYFGLMLIAFVTVSATFG
FT                   SSPLRGLTSLGIGLWLGLIGIDQLTGQTRLAFGVPNLLDGIEVTTLAVGLFALGECLFV
FT                   ASRHLFNDEKPMAIKGSIWMSREDWRRSWKPWLRGTAVGFPIGALPAGGAEIPTFLSYT
FT                   MERKLAEKPEEFGQGAIEGVAGPEAANNASAAGTLVPLLTLGLPTSATAAVMLAGFQQY
FT                   NLQPGPLLFVQHPALVWGLVASLFIANIMLLVLNLPLVGLWVRLLKIPLPWLYAGILVF
FT                   ACMGTIAANPSVVELMLLVGFGLLGFVMRRYDYPVAPVVVGLILGPLADSQLRRALQMS
FT                   LGDPMILLQHPGSATMIAIATLALVAPFLFKGLARFRQDED"
FT   gene            complement(254618..255088)
FT                   /locus_tag="Pden_3074"
FT   CDS_pept        complement(254618..255088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3074"
FT                   /product="putative tricarboxylic transport membrane
FT                   protein"
FT                   /note="KEGG: bja:blr3162 putative tricarboxylic transport
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3074"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71155"
FT                   /db_xref="GOA:A1B6L1"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6L1"
FT                   /protein_id="ABL71155.1"
FT                   /translation="MSTPTASSLHRPTLVIGAALLALAFVTWRDASTMQIRAGYGMGAD
FT                   AASYFVAAFLALMGAGHILAAFRWQGDASPSDWKAVGWVALGLGSLVAALWFGAGFILG
FT                   STLLFAFTARAFGRKAFPADLALGFVLATVIFLLFNKLLTLALPMGPFERLF"
FT   sig_peptide     complement(255014..255088)
FT                   /locus_tag="Pden_3074"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.723) with cleavage site probability 0.453 at
FT                   residue 25"
FT   gene            complement(255140..256111)
FT                   /locus_tag="Pden_3075"
FT   CDS_pept        complement(255140..256111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3075"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   bja:blr3161 putative tricarboxylic transport membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3075"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71156"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6L2"
FT                   /protein_id="ABL71156.1"
FT                   /translation="MTYLHSGLAAAWMMAAAAVLPATSVQAQDLELTITAPAGAGGGWD
FT                   AAARSLQEVMMATGKARSVQVVNVPGAGGTVGLAQFVQGAKGSPDQMLVGGITMVGAII
FT                   TNKAPHDLTKVTPIARLTGDPLVIVVPASSPYQTMADLMEGIRQDVERTIWAGGSAGGA
FT                   DHILAALVTQAAGIDPAKVNYIAYSGGGESLAAMLGGQVTAGVSGYGEWQGQIESGDLR
FT                   ALAISYPEPIEGIAAQPLKAQGIDIELVNWRGIFAGPDISAEDKAVLEKAVGKTVQSPE
FT                   WQELIKARGWSDYYAPSAEFAGFLTSETGRVHSILNSIGLAD"
FT   sig_peptide     complement(256028..256111)
FT                   /locus_tag="Pden_3075"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 28"
FT   gene            256282..256695
FT                   /locus_tag="Pden_3076"
FT   CDS_pept        256282..256695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3076"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_0306 CoA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3076"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71157"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6L3"
FT                   /protein_id="ABL71157.1"
FT                   /translation="MADICCLAMTGKKPDPTEALYVQILIGLLISNGPGSITAQGAKGA
FT                   VSADGPQTPDRVQINKAMVGFLTHSGYSHGGNGFEGMAFLLDQFRDKGLKDPTDPNHGL
FT                   DLTAMARDFALAYKRDKATAKELGTEVRALPGV"
FT   gene            256692..259682
FT                   /locus_tag="Pden_3077"
FT   CDS_pept        256692..259682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3077"
FT                   /product="gene transfer agent (GTA) like protein"
FT                   /note="KEGG: nwi:Nwi_0792 gene transfer agent (GTA) like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3077"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71158"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025195"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6L4"
FT                   /protein_id="ABL71158.1"
FT                   /translation="MNRDDQDRPVYGGTPSDFAVVQAIQEMKARRLRVTFYPFILMDVP
FT                   PGNTLPNPYSDNAAETGQPAFPWRGRITCSPAAGFAGSVDKTPTAATQVAALFGGATPA
FT                   NFSVSGETVNWTGPAGDWGLRRMILHYAHLCAAAGGVDAFLIGSEMRGLTTIRSGASSY
FT                   PAVQAFRDLAAAVRAILGPGTKISYAADWSEYFGHQPGDGSGDMFFHLDPLWADPEIDF
FT                   VGIDNYMPLSDWRDGFEHADAADGWPAIYDRAYLQAHIAGGEGFDWFYSSAADRTAQVR
FT                   TPITDGAHDKPWVFRYKDLLAWWSNPHYNRPGGVESGTPTAWVPQSKPIWFTELGCPAI
FT                   DRGTNQPNVFFDPKSSESFTPYFSRGWRDDAIQRAYLEATYLWWGQGANNPLSTVYGGR
FT                   MVHVPECAAWTWDARPYPFFPALTGVWTDGPNWRLGHWLTGRLGAVSLAALVRHLCLRV
FT                   GLPESRIDVTGLWGAVEGFVIGALESPRASITTLARHFGFDAVETEDVIRFVMRGRASI
FT                   ATVAPDDLVATREGDVLELTRGQETELPQALKWQLARADEDYDAALVEARRITVDTTRI
FT                   ASESFPMAVPPEEAERRCRRALMEAWVGRETAAFRLPPSRLALDPADVIRLAHDGREIE
FT                   FRLVSVADAEARGIEAVRQDRATYDLPPGDPRAASLTRAVVFGAPDAVLMDLPQLTEDQ
FT                   PAHRPLVGAHAVPWPGEMAVFRSPSTDGFELLTSFGARARLGALVSDFYAGPTSRFDLG
FT                   NALVIDLLTGTLESVTDLTLFGGANALAVESAPGAWEIVQAGVAELLAPGRYRLTRLLR
FT                   GQRGTEGAMGNPTPAGARMAVLDASLKPLPIAEADLGIPWNWRIGPASRPVSDETYVAQ
FT                   SFTPVGMGLRPFSVAHVEQPWRTPRTPADLTIRWTRRSRVLSADNWGAVEVPLAEEVEA
FT                   YQVEILDGAAVKRVLGTGTTNALYTAAQQTADWGAPLGPGNTLTIRIFQLSALVGRGAA
FT                   QIVTLTF"
FT   gene            259693..260769
FT                   /locus_tag="Pden_3078"
FT   CDS_pept        259693..260769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3078"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rde:RD1_0477 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3078"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71159"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021251"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6L5"
FT                   /protein_id="ABL71159.1"
FT                   /translation="MSDATTHLLLPYILAAQAQKHVTHNEALRLLDGLVQLSVLDRDLT
FT                   APPGSPADGDRYIVASGAIGAWTGWDLNVALWTDGAWLRLPPRTGWRAWVEDEGLLLVY
FT                   DGAGWVGTTPAALQNLALLGLGTTADPANPFSAKLNAALWTAKTVAEGGTGDLFYTMNK
FT                   EAAGRDLGLTFQTGYVTKALMGLFGSDRFRLAVSADGSTFFDGLIVDNATGIVDQPRLP
FT                   RFKGHTNYDNYVAVDTWTKIGINNTDYNDQSAFDAGNNHFVAPAAGTYLFGATLLYKVN
FT                   ASTNARMRGRLVLNGSTEIWGSRGEVSGAHASEATALWLQTMVPLAQGDTVELQGTFRA
FT                   ADGYFAADHTSFWGAKIG"
FT   gene            261211..261627
FT                   /locus_tag="Pden_3079"
FT   CDS_pept        261211..261627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3079"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   dra:DR1927 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3079"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71160"
FT                   /db_xref="GOA:A1B6L6"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6L6"
FT                   /protein_id="ABL71160.1"
FT                   /translation="MHYDTGKHCVFYHRYHIVWSTKYRYKVRIGPLRLRVRDICRQVCR
FT                   ENGVDILRGVLSSDHVHMFVSVPPRLAISDLVRKMKGRSSYRVQREFPQIRKRYWGCRF
FT                   WGRGYFSTTNGAITEDIVLQYLENHIADPTGASR"
FT   gene            complement(261632..262105)
FT                   /locus_tag="Pden_3080"
FT   CDS_pept        complement(261632..262105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sil:SPO2736 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3080"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71161"
FT                   /db_xref="InterPro:IPR025579"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6L7"
FT                   /protein_id="ABL71161.1"
FT                   /translation="MDEFVDQTKTLVGALGWDLFREMRGRIADLATIAPSVPALSPSPG
FT                   LLFFFRGAGFAAEMELGASGDFVVLAGSRARVDTAATIPRGTSALRKTLLDSGVLKQEE
FT                   DFLDFTSDYSFSSASAAAAAICGSSVNGRNSWKLPDGRTLLIGRRTKARYQKH"
FT   gene            complement(262396..263058)
FT                   /locus_tag="Pden_3081"
FT   CDS_pept        complement(262396..263058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3081"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71162"
FT                   /db_xref="InterPro:IPR021381"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6L8"
FT                   /protein_id="ABL71162.1"
FT                   /translation="MLRKKSASLVRRDLIARYAIFALLGAGINIAAAAPVMAEATVECH
FT                   SRNHKYDECWAGPLKKPQLIHQISNASCILNKTWGYNPKSQYIWVAQGCAGVFADVAGY
FT                   HHGRGGGHDANARAYDDHGHDVGAVVGAAVIGALVGSMTSDEHNHRGHAHTTTNNYYQV
FT                   NDYSGCHGIGCYVDNPDADDEIDPRPQFDAQGEPNFDEDGNYQGCHGMGCLVDDPDE"
FT   sig_peptide     complement(262942..263058)
FT                   /locus_tag="Pden_3081"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.878 at
FT                   residue 39"
FT   gene            complement(263530..267024)
FT                   /locus_tag="Pden_3082"
FT   CDS_pept        complement(263530..267024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3082"
FT                   /product="outer membrane autotransporter barrel domain"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain; PFAM: Autotransporter beta- domain protein; KEGG:
FT                   zmo:ZMO0213 autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3082"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71163"
FT                   /db_xref="GOA:A1B6L9"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6L9"
FT                   /protein_id="ABL71163.1"
FT                   /translation="MVTCNTIGNRKFLLRRLGGSTAGLALLVGLGLASSPALSDPRSVP
FT                   LDYLYVKDDKGNDELSRITIWVSTNDGQRRQMLFDTGSDSANMQLGSDVSGVKPTPGTE
FT                   PRGYFYGDGTYGYLLQQVDVDDIAYHAADGSESFTLPVAGQSTYQVARIVDVIYTADYT
FT                   GPEKPMLSADPVYVVTNEDGSKTAYYADLNARKQMAQDKPIDDGGTLWGTFGAGDYLGR
FT                   EWASTSGLIGRATKTGYVIAANGNTESGKQGLTPGCSPCLIVDVNSAVRAQFTSVMPWG
FT                   DKNGDDAKGTLPNFPGSGAPASAEFEGNYTLAFGDDDAAPSLTKVATLLDTGTPGGGQI
FT                   TISTARLNALVASGVRVDIDKDGNKTIPSLNLVAGEGMPVGLSNIDVVEIEGNADTPVQ
FT                   FIAGMDFFVSQSVMYDLENQSTAYTPYFVSANNFTTDTPAVDEIGLSRVTAEMGSPFPM
FT                   KDDDGTEYTVGYFGAAGVISGAGDLTVAKHAQLRLSNANTYTGQTVIETDGKLELAGIG
FT                   SIETSSRVVADGTLDIGDKGNRIAFWGVSDAYNDARIRSLSGSGTVLLYDRNLVLTAAQ
FT                   DSFRGTITDLDAENTHHGGGLIVQGGVQTLAGNNQYTGATRINTGAGLVLTSKGSLASK
FT                   VLVSGGFANDGTVNDHTTVQNGGTAGGTGTFHGLTVADGGAVATGGAVPLKVEGSFTQQ
FT                   AGSTLVFGPVAGGAQPGIAVSDQALIENGASVTLDRATAGRLSLGREYLLLDATGGVSG
FT                   GYNMLAGDLVTDAPFLSFALNNSPANVVLEVRRSDIAFADVAQSANQASSAFGLESLGS
FT                   GNPLYDEALYLGASEAASAFDSVSGEIHASMQGALIDESHFLRDAVNGRLRAAFGTVGA
FT                   SKSGVMALTADGAVDAVATIDGPVYWGHAFGARGRTDGDGNAAQLDRRTHGLVLGYDAP
FT                   VEDWRLGGVLAMSDSSYDVDDRVSSGSGNGIHLGAYAGTEWGQTALRAGLTYSDYRLKT
FT                   DRHAAIGEMAAPLSSKYNGHVWQAFAEVGHRVDHGNMALEPYAGLAHVRLRTDSFAERG
FT                   GSMALGGAEGVMNTTFTMIGLRAATTIRSAEHDLAVSGGIGWRHAFGDVDPELAMAFAG
FT                   GANFDIAGAAIARNAAVLDLGVDMNLGKKAIMRLDYQGQLASDAREHRLGATFSMRF"
FT   sig_peptide     complement(266905..267024)
FT                   /locus_tag="Pden_3082"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 40"
FT   gene            267354..267965
FT                   /locus_tag="Pden_3083"
FT   CDS_pept        267354..267965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3083"
FT                   /product="putative outer membrane protein"
FT                   /note="KEGG: rsp:RSP_2718 possible outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3083"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71164"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6M0"
FT                   /protein_id="ABL71164.1"
FT                   /translation="MMKRLGVMSIAALAIGGAANAGSYTAPVIEAPVIAPAAPALSHSN
FT                   TWTGFYAGMQMSYSDFSVNRDGVDDATGGVYGIHAGYNHQLHNNMVIGGEITFDHSSAD
FT                   NDVWQVERLMTVRAKVGYAHNNWLVYGLAGYAHVRTEGADRAHGKSGGAVFGIGADYAV
FT                   SDKWLVGGSWEGYRFSDFKNDPDNMEVDGGSVRFRVSYRF"
FT   sig_peptide     267354..267419
FT                   /locus_tag="Pden_3083"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.973 at
FT                   residue 22"
FT   gene            268005..268373
FT                   /locus_tag="Pden_3084"
FT   CDS_pept        268005..268373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3084"
FT                   /product="lipoprotein, putative"
FT                   /note="KEGG: nwi:Nwi_1490 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3084"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71165"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6M1"
FT                   /protein_id="ABL71165.1"
FT                   /translation="MKLKMLSAIGVACTLAACAENPDNIRAGYTSAATYQNMSCQQLAS
FT                   EAITVSNRAHDAANVQRRHQTRDEVAMAAGLVVFWPALLFVHGNDQTTSEVAQLRGQMQ
FT                   AIEQVSAAKNCGMVFQRT"
FT   sig_peptide     268005..268064
FT                   /locus_tag="Pden_3084"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            268564..268971
FT                   /locus_tag="Pden_3085"
FT   CDS_pept        268564..268971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3085"
FT                   /product="protein of unknown function DUF1311"
FT                   /note="PFAM: protein of unknown function DUF1311; KEGG:
FT                   pfo:Pfl_3894 protein of unknown function DUF1311"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3085"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71166"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6M2"
FT                   /protein_id="ABL71166.1"
FT                   /translation="MKHIVLAAIFCTLSLSAAQADQCMDKAVDQASMNRCAAQAYEKSD
FT                   ADLNKYFHEIRQRLADDVDARHLLRDSQRAWITFRDAECAFAASATAGGSAYPMAHDLC
FT                   LADLTQKRAYELRQYLECEEGDMTCPVPFAD"
FT   sig_peptide     268564..268626
FT                   /locus_tag="Pden_3085"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.738 at
FT                   residue 21"
FT   gene            268991..269851
FT                   /locus_tag="Pden_3086"
FT   CDS_pept        268991..269851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sme:SMb21025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3086"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71167"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6M3"
FT                   /protein_id="ABL71167.1"
FT                   /translation="MRMTACFTSIVIVLAATAAPALAEGVDPCAGIDTNLTDKRAREYA
FT                   HLIVDAFSKDLKPSERFKPSDVEVESFLGSGHWSAVNASIPTADMGMFFFQEVGGKKQF
FT                   KDVWGGIAEASEVPQVIKWAEDLGAPHNLATCFADQVSFDDSADSPFGFTVDLIFSTKA
FT                   EERLTALHEEVVVSASYYGDPSEKGKEFSDDVGRFDLGTETVQVPASPGIAKISGNQVG
FT                   ESDLEWIEGRPNVNVNVFTARISGDDNLISCDFIDGPLDDVIQSMPVALHCTLIEEEVD
FT                   AELKP"
FT   sig_peptide     268991..269062
FT                   /locus_tag="Pden_3086"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            270066..271148
FT                   /locus_tag="Pden_3087"
FT   CDS_pept        270066..271148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3087"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; SMART: ionotropic glutamate receptor; KEGG:
FT                   gbe:GbCGDNIH1_1769 glutamate-gated potassium channel; TC
FT                   3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3087"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71168"
FT                   /db_xref="GOA:A1B6M4"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6M4"
FT                   /protein_id="ABL71168.1"
FT                   /translation="MTRILMPVVMSLLLALLAARSDAQDAPPEELVVGVYVSPPFVEEH
FT                   DDGNYSGMAIDLWETVADRMDLAFRYATYPTFGSLVRATASGEVDAAVTNLTITRERAE
FT                   LIAFTQPWYDAGLRIMVPSQGGGGFRGMLNGLQNAGHLRAYIFLLSMILIATVGLSLFD
FT                   RRFDPDHPRRWRESIAESFYQVMLIITSGRTARKNLFGWVGRIWQALWLIVGVAVIAYI
FT                   TSSVTSVMTTVSLTQGISALSDLPGNTVGVLSGSVAEQYMRDMGIATRSYVNIDASVVA
FT                   LREGRLDAVVGDAPILEHYVLTHQKDNLAVVGNLFHPDKYGFAFPHESNLTTPTTLELL
FT                   DLQEDGTLGNLRLEYFGSRN"
FT   sig_peptide     270066..270137
FT                   /locus_tag="Pden_3087"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 24"
FT   gene            complement(271163..271765)
FT                   /locus_tag="Pden_3088"
FT   CDS_pept        complement(271163..271765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mll4938 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3088"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71169"
FT                   /db_xref="GOA:A1B6M5"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6M5"
FT                   /protein_id="ABL71169.1"
FT                   /translation="MNDIHGTINGPEVFTHVRIILGMVLGLSVSRLITGMTRFIQHPGR
FT                   ERIYLPHFTWALFLVLFIIHFWWFEFALAHRQDWSFNIYIFLIFYAFLFVAMSAVIFPD
FT                   KMDEYLGFEDYFKKRRRSFYILLLMLLTVDVVDTLIKGGDYYYHRYGWYYPIRQAILIA
FT                   GTLAALAWRSDRYHAIFAVFAIIFEAIWIISLFETIG"
FT   gene            complement(271811..272704)
FT                   /locus_tag="Pden_3089"
FT   CDS_pept        complement(271811..272704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3089"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: mes:Meso_3689 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3089"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71170"
FT                   /db_xref="GOA:A1B6M6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6M6"
FT                   /protein_id="ABL71170.1"
FT                   /translation="MKIESRQNSSDCLPPRAIDIFPPQWGRKYYSPYVDLMLTQTREGK
FT                   IEFAASSNFILVLLTPQARRKTMLSSSRRQEYSASPGTVELVPAGENYTAEWSEPKENI
FT                   LLSVTPEKLNNLSIREYDLELSDPPLFKVGDVDPIAHKIAMLLRNGIINDGDNHLYLES
FT                   LSMALLSHLIRRMTNADNRVDHNPKRGGLASHIRRRVVEHIHENIHRRITISELSDISG
FT                   MSCGHFSRSFGVEMGVSPHQYVMKLRAERAMSSIANTDSHISQIANAHGFSSQSHMMVV
FT                   MKKFFGTTPGELRRKR"
FT   gene            complement(273007..273519)
FT                   /locus_tag="Pden_3090"
FT   CDS_pept        complement(273007..273519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3090"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71171"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6M7"
FT                   /protein_id="ABL71171.1"
FT                   /translation="MIRRGDSHRRATDRAGGSMDARARLDELKDPRATCTVSCSWSSPG
FT                   VSGLPCSGPSSTVRATARPRPGSRCLAHFPVSTLQLLVTDREFVGTECVKFLNNGIIKF
FT                   AIRLHEDRFAKGETQFDRVTIEDGCDLTLFAWRTTLMLDLSWKQHATCQEKVSAIGLLF
FT                   AILGAVG"
FT   gene            complement(273579..274733)
FT                   /locus_tag="Pden_3091"
FT   CDS_pept        complement(273579..274733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3091"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   sit:TM1040_3585 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3091"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71172"
FT                   /db_xref="GOA:A1B6M8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6M8"
FT                   /protein_id="ABL71172.1"
FT                   /translation="MPKLTKRIVDAAEAQAAEYFVWDNDIPGFGLRVLPSGRKGYVVQY
FT                   RAGRRSRRISLGPATVLTCEQARNRAISIVAAARNGEDPAAERDAGRKTITVRELAERF
FT                   DREHIAIRVKASTAGEYRRNLRRFILPALGQLTVTGITRADVAKFHHDLRHIPYQANRC
FT                   LEVVSKMFGYAEMWGLRPDGTNPRKHIRKYPEEKRERFLSAAELRRIGEVLREMETEGI
FT                   ELTSAILAARLLILTGCRLNEIMTLQWDHVDLEGRALRLPDSKTGAKIVHLGQPVVELL
FT                   RDAPRIKGNPWVIPGTLPGKRLSDLQPFWQRVRARAGVKDVRIHDLRHTFASTAVAAGQ
FT                   GLPMIGKLLGHTQAQTTARYAHLAAEPVKMAADAVAQNLRQSLG"
FT   gene            274853..276391
FT                   /locus_tag="Pden_3092"
FT   CDS_pept        274853..276391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpe:RPE_2955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3092"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71173"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6M9"
FT                   /protein_id="ABL71173.1"
FT                   /translation="MQSWAERMVRTNQNAGSGLSTALLRSAKRNGIPMASKSTLNAKNL
FT                   ETLGAERLAQLLIEISTGDAAAKRQLRLALAGAEGPREAAREITKRLTSIAKARTFVNW
FT                   QNRKPLVKDLQTQRSAIMEQIAPHDPGEALALLWRFMGLATPVFERCDDSSGTVIDIFH
FT                   QACADLGEVAKAAGAAPEALARQVLDALQDNGFGQYDGLIAMIAPALGPEGVAHLKTLV
FT                   EELGRTPVPVPPKSEWQAVGWGSGGTRYAHEMEERARQSTVEMALKDIADVQGDVDGFI
FT                   AQYDPKTRKVPKIAAEIAQRLLAAGRAGDALGFIERAEVDKARWIPPEWQDARLAVLEA
FT                   LDRKDEAQAFRWACFERDLSGEHLRAYLKRLPDFDDIEAEERAMAHAAGHPDLLAALAF
FT                   FLNWPSLGHAARMLIDRQDEVDGDHYEFLAPAAETLAEKHPLAATVALRAMIDFTLIQG
FT                   RQKRYGYAAQHLATCADLAGRIEDFGLVEPHPAYAARLKTEHGKKTGFWSRMDG"
FT   gene            276953..278287
FT                   /locus_tag="Pden_3093"
FT   CDS_pept        276953..278287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3093"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: rsp:RSP_0491 hydrogen uptake histidine-kinase;
FT                   TIGRFAM: PAS sensor protein; PFAM: ATP-binding region,
FT                   ATPase domain protein domain protein; histidine kinase A
FT                   domain protein domain protein; PAS fold-4 domain protein;
FT                   PAS fold domain protein; SMART: PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3093"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71174"
FT                   /db_xref="GOA:A1B6N0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6N0"
FT                   /protein_id="ABL71174.1"
FT                   /translation="MPRAMDAKDDRAGAALTDAAWSDVLIAVDRTYAELIEHQERLEAQ
FT                   NRELEALRQFLSSVITSVSDVLIVLDRDGRVDEVNASTCVCTGLPVAALVGRSVADLVR
FT                   EEDRAGLSALIAEIARTRAPGRMELSLVSSREPAPVEAVLSPRLDDRGRIEGLVLTGRP
FT                   VGELRRAYAQLERSHAEMKAAQAQLVHGEKLASLGRLLAGVAHELNNPISFVYANAHAL
FT                   ERYAAKFETYFERVQAGADRDELVRLREELRLDRELRNLREAVQGAREGAERVRDIVED
FT                   LRRLSSDGGGEMAAFDLVEIARTAAFWIMRGAGHSTVPEIHAEGPVMVLGHTGHIQQVV
FT                   MNLVQNALDAVSETAAPQIALRIMREEGRGVLDIHDNGPGIDEATAAMIFDPFFTTKPV
FT                   GKGTGLGLSISLKIAEDHGGRLSYSPASGGGALFRLELPLAGDGA"
FT   gene            278284..279273
FT                   /locus_tag="Pden_3094"
FT   CDS_pept        278284..279273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3094"
FT                   /product="NADH ubiquinone oxidoreductase, 20 kDa subunit"
FT                   /note="PFAM: NADH ubiquinone oxidoreductase, 20 kDa
FT                   subunit; KEGG: rsp:RSP_0492 hydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3094"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71175"
FT                   /db_xref="GOA:A1B6N1"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6N1"
FT                   /protein_id="ABL71175.1"
FT                   /translation="MNILWLQSAGCGGCTMSLLCAEGPNVFDLLAGAGLTFLWHPALSL
FT                   ESGTEVRGILAGLVSGEVPLDILCVEGAIARGPRGTGRYQILSGTGRPLLDWLRDLAPL
FT                   AAHVVAVGTCATYGGVTTAGGNPSDAVGVQYDGAHPGGALPATFRARAGLPVINIAGCP
FT                   THPDWVTETLLMLVAGRLGASDLDALGRPRFYADHLVHHACPKNEFYEYKASARALSEM
FT                   GCMMEHLGCIGTQAVGDCNIRPWNGQGSCTRGGYPCINCTAPEFEEPRHLFTATPKIAG
FT                   IPVGLPTDMPKAWFMALASLSKAATPERIAKNAVADRIVTPPTLRKPR"
FT   sig_peptide     278284..278349
FT                   /locus_tag="Pden_3094"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.733) with cleavage site probability 0.702 at
FT                   residue 22"
FT   gene            279291..280724
FT                   /locus_tag="Pden_3095"
FT   CDS_pept        279291..280724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3095"
FT                   /product="nickel-dependent hydrogenase, large subunit"
FT                   /note="PFAM: nickel-dependent hydrogenase, large subunit;
FT                   KEGG: rsp:RSP_0493 hydrogenase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3095"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71176"
FT                   /db_xref="GOA:A1B6N2"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6N2"
FT                   /protein_id="ABL71176.1"
FT                   /translation="MGQGQLIVGPFNRVEGDLEIRLDIAEGRVSAARINSPLYRGFERM
FT                   LPGKDPRDALTIVPRICGICSISQSAAAARALAMAVGEVPEPQGERMAALIHAVENVSD
FT                   HLTHFNLFFMPDFTRPQYQARGWYDRAVARFTAMEGSALKRAVEARAGLMHVLGLMAGK
FT                   WPHTLAIQPGGVTRAPSERDRLRILASLTAFRRYLEDTVFGAAVEDFAALSSVPALMGW
FT                   QGGDAGLFLRIAADLNLADLGCGSGRYLSFGAYPLEGGHGFAPGIWDGGAQPLDIAAIS
FT                   EDLSHSWMLGPAAHPAQGVTDPDEDMRDTAYSWCKAPRLAGRTMETGALARQVIDGHPL
FT                   ALDLVRDGGGGVLARVAGRLLELARSQVLMEDLARGIVPEARFMAGPLKISDGIGEGLV
FT                   EAARGALGHWLRIEGGRIASYQIVAPTTWNFSPRDAGGVPGPVEAALEGLVVQPGETTP
FT                   LSVQHVVRSFDPCMVCTVH"
FT   gene            280745..282994
FT                   /locus_tag="Pden_3096"
FT   CDS_pept        280745..282994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3096"
FT                   /product="(NiFe) hydrogenase maturation protein HypF"
FT                   /note="TIGRFAM: [NiFe] hydrogenase maturation protein HypF;
FT                   PFAM: acylphosphatase; SUA5/yciO/yrdC, N-terminal domain;
FT                   zinc finger, HypF domain protein; KEGG: rsp:RSP_0494
FT                   hydrogenase maturation factor F"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3096"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71177"
FT                   /db_xref="GOA:A1B6N3"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6N3"
FT                   /protein_id="ABL71177.1"
FT                   /translation="MTLPTMEQGFAIRVRGQVQGVGFRPFVWRLARAAGLRGEVLNDAE
FT                   GVLIRLVAQDCGDFIAALRADRPPLARIDAIEAVPQVFAAMPEGFSIVASTGTGAETRV
FT                   TPDAATCPECRAEVFAPGRRQGYAFTNCTHCGPRYTILRELPYDRARTTMAGFDLCPDC
FT                   AAEYADPADRRFHAQPIACPACGPNLWYEAGGKEVAGDPVALAVAALKAGQVVAVKGLG
FT                   GFHLACDAADARAVALLRARKRRPSKPFALMGTEAMICAHATPSEACWRLLRDPAAPVV
FT                   LVPARGTLPEDVAPGMRALGVMLPYTPLHHLLIAAFGGMLVMTSGNLSGAPQVTGNDEA
FT                   RKALARFADGFLMHNREIARRLDDGVERADPPMVIRRARGRVPGTLPLPPGFDGAPRVL
FT                   AFGGQMKAAICLTKNGQAMVSQHLGDLDDAETALEYDRTLRDLAALFDHAPELAACDPH
FT                   PGYRATIAAEGAGLPLIRVWHHHAHLASCLGDNLWPLDGGRVAGIVMDGLGLGPEGAIW
FT                   GGEVLLGDYTGFERVAHLAPAPLPGGDSASREPWRNALARLDQAGLSAVADRLFPAAPR
FT                   ALLRQAARAGVNAPQSSSAGRLFDAFAALAGFAGAQSYEGEAAMRLEAMACPASPYPFD
FT                   CRDGGVIDPAPMFRAAATDLAAGRDPGEMAGAFHAGLARAFCAPARALVQSGRAQAVAL
FT                   SGGVLQNAFFLRECLAALDGLPVLLHRQIPANDGGLAFGQALVAAAQHMAAAKSL"
FT   gene            283197..284282
FT                   /locus_tag="Pden_3097"
FT   CDS_pept        283197..284282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3097"
FT                   /product="hydrogenase (NiFe) small subunit HydA"
FT                   /EC_number="1.12.99.6"
FT                   /note="KEGG: rsp:RSP_0495 hydrogenase protein small
FT                   subunit; TIGRFAM: hydrogenase (NiFe) small subunit HydA;
FT                   PFAM: NADH ubiquinone oxidoreductase, 20 kDa subunit;
FT                   Nickel-iron dehydrogenase small subunit, N-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3097"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71178"
FT                   /db_xref="GOA:A1B6N4"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6N4"
FT                   /protein_id="ABL71178.1"
FT                   /translation="MSQIETFYDVMRRQGITRRSFMKYCSLTAAALGLGPAFVPKIAHA
FT                   METKPRTPVIWVHGLECTCCSESFIRSAHPLAKDVVLSMISLDYDDTLMAAAGHAAEAA
FT                   FKDTIQKYKGQYILAVEGNPPLNEDGMYCITGGKPFVEKLRHAARDAKAIISWGACASY
FT                   GCVQAAAPNPTRATPVHKVILDKPIIKVPGCPPIAEVMTGVITYMLTFDRMPELDRQGR
FT                   PKMFYSQRIHDKCYRRPHFDAGQFVEHWDDENAKKGYCLYKMGCKGPTTYNACSTVRWN
FT                   EGVSFPIQSGHGCIGCSEDGFWDQGSFYDRLTNIKAFGVEANADKLGGIAAGAVGGAVA
FT                   VHAAISALKRAQKKTQDKVEA"
FT   sig_peptide     283197..283334
FT                   /locus_tag="Pden_3097"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.754) with cleavage site probability 0.754 at
FT                   residue 46"
FT   gene            284286..286079
FT                   /locus_tag="Pden_3098"
FT   CDS_pept        284286..286079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3098"
FT                   /product="nickel-dependent hydrogenase, large subunit"
FT                   /note="PFAM: nickel-dependent hydrogenase, large subunit;
FT                   KEGG: rsp:RSP_0496 hydrogenase protein large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3098"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71179"
FT                   /db_xref="GOA:A1B6N5"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6N5"
FT                   /protein_id="ABL71179.1"
FT                   /translation="MTINTPNGYTLDNSGRRIVVDPVTRIEGHMRCEVNVDDQGVIRNA
FT                   VSTGTMWRGLEVILKGRDPRDAWAFVERICGVCTGTHALTSVRAVEDALGIMIPDNANS
FT                   IRNMMQLALEIHDHIVHFYHLHALDWVNPVNALRADPKATSELQQMVSPSHPMSSPGYF
FT                   RDVQNRLKKFVESGQLGLFKNGYWDNPAYLLPPEADLMATTHYLEALDLQKEIVKVHTI
FT                   FGGKNPHPNWLVGGVPCPINIDGTGSVGAINMERLNLVSSIIDLCDEFNKNVYIPDVIA
FT                   IGGFYKSWLYGGGLSSQAVMAYGDIPENPNDFSPEQLHLPRGAIINGNLNEVHDVDPRD
FT                   PEQVQEFVDHSWYSYGDPGRGLHPWDGETNPKFELGPNHKGTKTRIEQLDESAKYSWIK
FT                   APRWRGHAMEVGPLARYIIGYAKGHEDIKNQVDGLLRTMDLPFEALFSTLGRTAARALE
FT                   SEYCGRLQRHFFDKMVRNIKNGDQSTANVEKWDPSTWPKEAKGVGMTEAPRGALGHWIR
FT                   IKDGRIENYQCVVPTTWNGSPRDSQGNIGAFEASLMNTPMERPDEPVEILRTLHSFDPC
FT                   LACSTHVMSPDGDELAAVKIR"
FT   gene            286095..286679
FT                   /locus_tag="Pden_3099"
FT   CDS_pept        286095..286679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3099"
FT                   /product="HupE/UreJ protein"
FT                   /note="PFAM: HupE/UreJ protein; KEGG: rsp:RSP_0497
FT                   HupE/UreJ accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3099"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71180"
FT                   /db_xref="GOA:A1B6N6"
FT                   /db_xref="InterPro:IPR007038"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6N6"
FT                   /protein_id="ABL71180.1"
FT                   /translation="MKKLMLAALAALMGSPVLAHTGVGETSGFTAGLSHPIFGPDHLLA
FT                   MLAVGLWSGFVLPHRFWLGAATFMGAMAVGALISWAGIPIPMVESWIVLSVVAFGLLTA
FT                   FSRRGQSDQITFASLAAIALFAICHGHAHATEAHGNAAAYMIGFLISTAALHIVGIFIA
FT                   RTISNATAARMVQAATGTGIAVAGLALMAAG"
FT   sig_peptide     286095..286154
FT                   /locus_tag="Pden_3099"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 20"
FT   gene            286684..287430
FT                   /locus_tag="Pden_3100"
FT   CDS_pept        286684..287430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3100"
FT                   /product="Ni/Fe-hydrogenase, b-type cytochrome subunit"
FT                   /note="TIGRFAM: Ni/Fe-hydrogenase, b-type cytochrome
FT                   subunit; PFAM: cytochrome B561; KEGG: aeh:Mlg_2027
FT                   Ni/Fe-hydrogenase, b-type cytochrome subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3100"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71181"
FT                   /db_xref="GOA:A1B6N7"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6N7"
FT                   /protein_id="ABL71181.1"
FT                   /translation="MSDIHPGDDHIFEGRPLGAPHQVTRQTSVYVYEAPVRIWHWINAA
FT                   CIMVLCVTGWLIGSPPPSMQIAEAYDQFVFGYIRFAHFAAAMILTVGFFGRIYWALIGN
FT                   HHAKQLFYVPIFSRRFWGELLFELRWYFFLEKEPKKYVGHNPLAQLAMFLFMTVGLTFM
FT                   IVTGFALYAEGAGKDSMFYAVFGWVQDLVQNTQRLHTLHHIGMWWIVIFMIIHIYVAIR
FT                   EDIMSRQSMVSTMISGHRTFKDDRPD"
FT   gene            287636..288304
FT                   /locus_tag="Pden_3101"
FT   CDS_pept        287636..288304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3101"
FT                   /product="Hydrogenase 1 maturation peptidase HyaD, Aspartic
FT                   peptidase, MEROPS family A31"
FT                   /note="TIGRFAM: hydrogenase maturation protease;
FT                   hydrogenase expression/formation protein; hydrogenase
FT                   maturation peptidase superfamily; PFAM: peptidase M52,
FT                   hydrogen uptake protein; KEGG: rsp:RSP_0499 HycI,
FT                   hydrogenase maturation protease"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3101"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71182"
FT                   /db_xref="GOA:A1B6N8"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004419"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6N8"
FT                   /protein_id="ABL71182.1"
FT                   /translation="MTAPPASNASGSSGRGQMPAEAPANILVLGIGNVLWADEGFGVRC
FT                   VEEMAARHALPERVRLLDGGTQGLYLLPFLEEADALIVFDAVDYGLPPGTLKLVEGAEV
FT                   PAFLGAKKMSLHQTGFQEVIATAQLLGRCPAQLMLIGCQPVELEDYGGGLRPEVAAQIG
FT                   PAIEIALAKLAEWCVQAGEGATSGQLADPAIRREAYETGRPAASDACREGDARFFPGAG
FT                   "
FT   gene            288304..288615
FT                   /locus_tag="Pden_3102"
FT   CDS_pept        288304..288615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3102"
FT                   /product="hydrogenase expression/formation protein
FT                   (HUPF/HYPC)"
FT                   /note="PFAM: hydrogenase expression/formation protein
FT                   (HUPF/HYPC); KEGG: rsp:RSP_0500 putative HupF/HypC
FT                   hydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3102"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71183"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6N9"
FT                   /protein_id="ABL71183.1"
FT                   /translation="MCMGIPMRLAQVDGIAGQSEGGDLIDLSLTADAQAGDWVLTFLGT
FT                   AHEVIDADRAARIAAALQGLRAVMAGGDASGAFADLEGRTPALPSHLQAALAAGRKTG"
FT   gene            288619..289038
FT                   /locus_tag="Pden_3103"
FT   CDS_pept        288619..289038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3103"
FT                   /product="hydrogenase-1 expression HyaE"
FT                   /note="PFAM: hydrogenase-1 expression HyaE; KEGG:
FT                   rsp:RSP_0501 HupG hydrogenase expression/formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3103"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71184"
FT                   /db_xref="InterPro:IPR010893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6P0"
FT                   /protein_id="ABL71184.1"
FT                   /translation="MHDHSHDILHSPGGGALHPLLARLEAEFGWPRLHSLHDVAEFTAS
FT                   PGLHCLFVPGDPARNLETVDAAVILPELRMAFQNAFDCAVVGDAIEATVRETHRALKTP
FT                   GFLFFRDGSYLGSIEKIRDWDDYIARTSHILSLPG"
FT   gene            289051..289884
FT                   /locus_tag="Pden_3104"
FT   CDS_pept        289051..289884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3104"
FT                   /product="HupH hydrogenase expression protein"
FT                   /note="PFAM: HupH hydrogenase expression protein; KEGG:
FT                   rsp:RSP_0502 HupH hydrogenase expression/formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3104"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71185"
FT                   /db_xref="InterPro:IPR006894"
FT                   /db_xref="InterPro:IPR038527"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6P1"
FT                   /protein_id="ABL71185.1"
FT                   /translation="MAQNFHLPPVGFGPGSQPDDGEGLEWLPLPSGMRTYDMHLPEVGN
FT                   VASLAPALAMLAEIAAACDRVAQGAAPVSFDLSALDAANRALMAETLGQGEVSLRARGV
FT                   PAVAVQESVFAGVWVLKAEGIDRVEVAPVPQLALTRAFHAQRPAIGALAPRAPGVVNAP
FT                   ALLAELMDKSLSWRGPGDLHVVNLTLIPHTEEDLLWLDQALGEGSVTILSRGYGNCRIT
FT                   ATAQDRLWRVQFFNSMDVLILDTFEVTAMPEVVLAAPEDLADSAGRIREVLGAIR"
FT   gene            289881..290732
FT                   /locus_tag="Pden_3105"
FT   CDS_pept        289881..290732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3105"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   rsp:RSP_0503 HupJ, contains rubredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3105"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71186"
FT                   /db_xref="GOA:A1B6P2"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR023994"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="InterPro:IPR038530"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6P2"
FT                   /protein_id="ABL71186.1"
FT                   /translation="MSVETARGGFEGSYLGANDRISPQAIMECKICWTSYDPAEGDEYR
FT                   QVLPGTPFAALPADWKCPGCDAPKQQFIVREDPGSDEMRIAAEIERRCARLVADFREVF
FT                   NAKMRDVPIINQALHVEAMAFRPWQGGFLGVLIAPWFMNLIWLPGEDQDWSALKAGEKE
FT                   VVAFPSGEYEFIHNSREMTGPYKACSLFSPMADFTSQLQAVEVARAVMVELFKPENRDG
FT                   TDRAAEIRAAREAELAPPSEAGPASDAPIPNPRPTRRALLTGGLAAAPAEGDDPEISGG
FT                   VE"
FT   gene            290729..291631
FT                   /locus_tag="Pden_3106"
FT   CDS_pept        290729..291631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3106"
FT                   /product="HupK"
FT                   /note="KEGG: rsp:RSP_0504 HupK"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3106"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71187"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6P3"
FT                   /protein_id="ABL71187.1"
FT                   /translation="MISASVSFRLLPRDGGLALAPGAQAGLAVDALMTGRRVDEVRQML
FT                   PALFGLCRSVQEWAMALALGLPLPPLDDLRRDMIRDHLARLCLHLPPQLGLAPLALPQG
FT                   WQAGGRALRVALFGQDGLPGPGDLAAWSAGPAPLARLVAAVQGHFAPGEAVSDLPAMTD
FT                   PFGDGLVENSLATRHAGHPLLMAVRGAYGHGPLVHLLARLVDLDALSRGAFPPPRRMAQ
FT                   GAALVPCSRGFCALELRAAGGIVTRFSRRTPTDHLLMSGGLLAASLATLPPDKADRAPL
FT                   LAMILDPCIPLHLEAGPHA"
FT   gene            291624..291965
FT                   /locus_tag="Pden_3107"
FT   CDS_pept        291624..291965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3107"
FT                   /product="hydrogenase nickel insertion protein HypA"
FT                   /note="TIGRFAM: hydrogenase nickel insertion protein HypA;
FT                   PFAM: hydrogenase expression/synthesis, HypA; KEGG:
FT                   rsp:RSP_0505 hydrogenase expression/synthesis, HypA family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3107"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71188"
FT                   /db_xref="GOA:A1B6P4"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="InterPro:IPR020538"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1B6P4"
FT                   /protein_id="ABL71188.1"
FT                   /translation="MHEMSLCEGIRGIVEDQARRHGFSRVTRMRLEIGRFAGVEKAALS
FT                   FAFDVVMRGSPAEGAVLEMIDLPGRAMCFDCAEQVELDDRLSPCPLCGGGRLMPETGDE
FT                   MRIRDMEVI"
FT   gene            291965..292885
FT                   /locus_tag="Pden_3108"
FT   CDS_pept        291965..292885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3108"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /note="TIGRFAM: hydrogenase accessory protein HypB; PFAM:
FT                   cobalamin synthesis protein, P47K; KEGG: rsp:RSP_0506
FT                   NI2+-binding GTPase protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3108"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71189"
FT                   /db_xref="GOA:A1B6P5"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6P5"
FT                   /protein_id="ABL71189.1"
FT                   /translation="MCGICGCGSTVTVDGREISHDEAHRLGLAHEHAQDHSHGHGHSHA
FT                   ANGHAHDHGSGDHHHHHHDHAPGHGHHHDYGAGAAGLSVPGLTQQRLIEVETSLLARND
FT                   GLAAGNRRVLSALRAFAVNLVSSPGSGKTTLLCRTISMLEGQPLAVIEGDQQTENDADR
FT                   IRATGARAVQVNTGKGCHLDAQMVGGAMDALRLEPASLLFIENVGNLVCPAAFDLGEDA
FT                   KVAILSVTEGEDKPLKYPDMFTAARLAILNKIDLAPHCDADPEVYEANLRRVNPGIDIL
FT                   RLSARTGEGMQAWIDWLRAGLATKS"
FT   gene            292889..294370
FT                   /locus_tag="Pden_3109"
FT   CDS_pept        292889..294370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3109"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor,
FT                   interaction domain-containing protein; helix-turn-helix,
FT                   Fis-type; KEGG: rsp:RSP_0507 HupR response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3109"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71190"
FT                   /db_xref="GOA:A1B6P6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6P6"
FT                   /protein_id="ABL71190.1"
FT                   /translation="MPTPRPFVLLVDDEPHSLSAMRMALEDEFEILTAPDAAAAARLME
FT                   EEWVQVVVCDQRMPGQTGVEFLTGLRERWPETVRLLITGYTDPSAIVDAINLAGIHQFI
FT                   AKPWHPDQLLMAVRNAAQLFHLARENERLALEMRRLASTSETRLEKRRRALRQGQGFDS
FT                   VLRAPNSPMNATVDAARHYAAFDVPVLLTGEQGTGKEQLAQAMHLASLRADRPFYALDL
FT                   TGMPDELVMVELLGARRGAVAGGTSRIGLIQKADRGTLYLSGIETITPELQLVLLRILS
FT                   GRGFTPVGGQETLTSNLRLIAGAGTDLAALVTEGRFRADLYYALAVAEIAVPPLRARRG
FT                   DIAMLAQHMLAELAARHGKLVHGFDGPALEFLESYDWPGNLRELSNEITRMLILAQDSV
FT                   LGADLISRPILQGPPGEDGAGRLTQAVLAGVGSLKERVELIEMRILRETLTRHRWNKSR
FT                   AAAELGVSRVGLRAKLDRYGVKDPAERQATPEEEE"
FT   gene            294373..294657
FT                   /locus_tag="Pden_3110"
FT   CDS_pept        294373..294657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3110"
FT                   /product="hydrogenase assembly chaperone hypC/hupF"
FT                   /note="TIGRFAM: hydrogenase assembly chaperone hypC/hupF;
FT                   PFAM: hydrogenase expression/formation protein (HUPF/HYPC);
FT                   KEGG: rsp:RSP_0508 hydrogenase expression/formation protein
FT                   HypC"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3110"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71191"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6P7"
FT                   /protein_id="ABL71191.1"
FT                   /translation="MCLGIPGRIIAMTDPARMMAMAEVSGVRREVNIACVAEGPPEGLI
FT                   GRWVLIHVGFAMSLIDEDEAARTLAALHELGEAQEALEQMAEADREMAR"
FT   gene            294654..295790
FT                   /locus_tag="Pden_3111"
FT   CDS_pept        294654..295790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3111"
FT                   /product="hydrogenase expression/formation protein HypD"
FT                   /note="TIGRFAM: hydrogenase expression/formation protein
FT                   HypD; PFAM: hydrogenase formation HypD protein; KEGG:
FT                   rsp:RSP_0509 hydrogenase isoenzyme formation protein HypD"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3111"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71192"
FT                   /db_xref="GOA:A1B6P8"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6P8"
FT                   /protein_id="ABL71192.1"
FT                   /translation="MKFASEFRDPKAARALLAAIARRAEQIGASREKPVHIMEICGGHT
FT                   HSIFRYGLDKLVHEGVEFIHGPGCPVCVLPRARIDESIQIARRPGVIFTTFGDAMRVPG
FT                   RSQSLLQARAAGADIRMVYSPLDALALARKYPERDVVFFGLGFETTTPSTALAIQQAAR
FT                   EGLGNFSVFCNHITVPEPIHALLKDPHMVLDGFIGPGHVSMVIGVHPYDFIARDFQKPL
FT                   VVAGFEPTDLLQSVLIVLDQIAEGRAEVENQYARVVPEEGNPVSLAAIADVYERRPSFE
FT                   WRGLGEIDASGLRIRPKYAAFDAEEKFGIGYAVARNPAPEPEGCACGAVMTGRVKPTAC
FT                   PHFGKGCTPEMPLGALMVSSEGACAAYWQYGGARVAAE"
FT   gene            295803..296858
FT                   /locus_tag="Pden_3112"
FT   CDS_pept        295803..296858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3112"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /note="TIGRFAM: hydrogenase expression/formation protein
FT                   HypE; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: rsp:RSP_0510
FT                   hydrogenase expression/formation protein HypE"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3112"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71193"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6P9"
FT                   /protein_id="ABL71193.1"
FT                   /translation="MNAMAFGTLRDSHVTLSHGGGGKAMADLIETVFFPAFGPGSGEDQ
FT                   ARLTADALCEPGARLALTTDSFVVTPLEFPGGDIGKLAVCGTVNDLAVGGARPLWLSAA
FT                   FIIEEGCEIALLQRVVASMAREAALAGVRIVTGDTKVVGRGSADGVFVTTSGVGVIPAG
FT                   RDLVAARIRPGDVVLVNGVLGDHGAAILAARGDLALSTDLVSDCQGLGHLMEAVLAAAP
FT                   GTRAARDATRGGLAAALNEMALAAGCGIEIREDALPLRPEVRGVCEILGLDPLYLANEG
FT                   TLVLFVPEAEAEAALCAMRSRPEGQGAAIIGRAVAASEGGAHTARVQMVTSFGGRRIVD
FT                   RLVGEQLPRIC"
FT   gene            297085..297600
FT                   /locus_tag="Pden_3113"
FT   CDS_pept        297085..297600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3113"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71194"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Q0"
FT                   /protein_id="ABL71194.1"
FT                   /translation="MQGNSEHSIGLNVSKNNHVIAVAEGGRGVYGCIWTSPDCNGLVGS
FT                   GSELAIADVYPASVNGPILRRREPRWISARFLLNAPVTSASAVPVWGSCIAAIDNVTND
FT                   RFGPGRCVGYNVAARCCRERTGLPPSVHGEAHPPTADHAGLRVVAEGAGDAGRTRRRMS
FT                   ARVTTPVI"
FT   gene            complement(297507..298544)
FT                   /locus_tag="Pden_3114"
FT   CDS_pept        complement(297507..298544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3114"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; KEGG: rha:RHA1_ro03326 possible CBS
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3114"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71195"
FT                   /db_xref="GOA:A1B6Q1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Q1"
FT                   /protein_id="ABL71195.1"
FT                   /translation="MMTNPLFVTLATIALIILSAFFVIIEFALLGARRHRLEERAPTSP
FT                   SARAALRGMNDLTLMLAGAQLGITITTFVLGAITKPAVHYALGPLLLEWGAPGWIAESA
FT                   SFFLSLLLVTFLHLVVGEMAPKSWAIANPERSAMAVGVLARAYIWPLRPVLHWINVIAN
FT                   RLVRASGVEPVESAAVGGQDAATIRQLVEHSADVGTLEPGLRRQLSGLIDLGTMPVESI
FT                   ISAGQTVTRVKPEATVAKVRDIASRTAHMRLLTNGGGAPRVIHVRDLLLKPDTAPAASV
FT                   ARPAFTLKAGTPIYEALASMRSASVQLAVVMNGDQITGVVTLADILRRVLPASPAPSAT
FT                   TRSPA"
FT   sig_peptide     complement(298458..298544)
FT                   /locus_tag="Pden_3114"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.670) with cleavage site probability 0.502 at
FT                   residue 29"
FT   gene            complement(298541..299911)
FT                   /locus_tag="Pden_3115"
FT   CDS_pept        complement(298541..299911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3115"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: nfa:nfa28250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3115"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71196"
FT                   /db_xref="GOA:A1B6Q2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Q2"
FT                   /protein_id="ABL71196.1"
FT                   /translation="MLEPLLLLLAGLLVILVIIAAGAYFVAQEFAYMAVDRTRLAAQAA
FT                   SGDLAAKRALAVTKRTSFMLSGAQLGITVTGLMVGYVAEPLVGKSLGMLLGGVGIPESI
FT                   GISVGTILALLFATIVQMIFGELYPKNLAIANSEPMAKALAASTTTYLSLFGWLITFFD
FT                   KAANLFLRLLRIEPVHDLDVSASAKDLPHIIADSRESGDLPVELSLMMDRILDFPHRDA
FT                   EHAMVPRAQADWVDPDTTIAELREMMAHGHTRYPVIDDDDVPVGVVHLADILPKVNAEQ
FT                   LEATAATVMRPVAIVPTLMPLPAALETLVKSGNKMVCVIDEYGGFSGVLTIEDIAMEVV
FT                   GEITDEFDKNAIQPLREEDEGVWVMEGDVHLDEVERAVNHDLPRGDFETISGLLIAQLG
FT                   RLPTKADTILVDLPADGADVVSDAPLRRRLEVNVLRIARHVPTLVRVKLVDEQEQDQ"
FT   sig_peptide     complement(299831..299911)
FT                   /locus_tag="Pden_3115"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.327 at
FT                   residue 27"
FT   gene            complement(300689..301594)
FT                   /locus_tag="Pden_3116"
FT   CDS_pept        complement(300689..301594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3116"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bxe:Bxe_C1385 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3116"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71197"
FT                   /db_xref="GOA:A1B6Q3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Q3"
FT                   /protein_id="ABL71197.1"
FT                   /translation="MSDPLAQVIELLRPQAVFSKGITAAGHWAVEYTEFGRPAFAAMTM
FT                   GRCRLSVEGEEPVTVEAGDFVLLPATPRFGMSSLNPGPLRRIDARTDPAKHEVRHGRQD
FT                   GPPEMRQFGGWFTFAAPDAALLVTLLPRMIHLRGVPRLTQLVHMLGEEAARDDAGRDLI
FT                   LARLVEILLIEALRAAPEGAAAPGLLRGLSDPRIASALRSLHGDITRTWTVPDLAETAG
FT                   MSRSAFFERFTRLVGRRPMEYLTIWRMAVARDLLRRGSLALEEVAARVGYGSASTFSTA
FT                   FSRHTGQPPGRYAKAVLAEG"
FT   gene            301647..302417
FT                   /locus_tag="Pden_3117"
FT   CDS_pept        301647..302417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3117"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mmc:Mmcs_1038 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3117"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71198"
FT                   /db_xref="GOA:A1B6Q4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Q4"
FT                   /protein_id="ABL71198.1"
FT                   /translation="MHATFLLSTQEIIMNTVLITGTSSGYGLETARYFHAQGWQAIATM
FT                   RTPRDGLLPEGLRILPLDVTDPASIAATIEAAGPIDVLVNNAGIGLVGAFEAAPMDYVR
FT                   KLFDTNTFGTMAMVQAVIPQMRARRSGVIVNVTSSVTLAPMPLAAAYTASKQAIEGFTG
FT                   SLAHELAAFGVRAKLVEPGYAPTTRFSQNIDFAIEDMIPEAYADFAAPIFAAFASPALT
FT                   TRETDVAEAVFLAANDTSDRLRYPAGPDAVALAA"
FT   gene            complement(302450..303199)
FT                   /locus_tag="Pden_3118"
FT   CDS_pept        complement(302450..303199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3118"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="KEGG: bja:bll4871 methionin aminopeptidase; TIGRFAM:
FT                   methionine aminopeptidase, type I; PFAM: peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3118"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71199"
FT                   /db_xref="GOA:A1B6Q5"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Q5"
FT                   /protein_id="ABL71199.1"
FT                   /translation="MTITNQDELDGLKEIGRIVANTMQAMAKAMEPGMTTRELDEIGRA
FT                   LLEREGALSAPQSTYDFPGATCISVNEEIAHGIPGDRVIAADDLVNIDVSASKNGYFAD
FT                   TGATYRVAPVRPSLDRLCRDGRQAMQIGIAQVGSGRPLAGIGRAIGKFAERRGYTLIRN
FT                   LASHGIGRALHEEPAEIPTWPARGEKRRIHRGLVLTVEPFLSRGGLWATEADDGWTLYS
FT                   EPRAPVVQYEHTVVATDRGAMVVTLPG"
FT   gene            303258..303755
FT                   /locus_tag="Pden_3119"
FT   CDS_pept        303258..303755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3119"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="PFAM: protein of unknown function UPF0074;
FT                   Helix-turn-helix, type 11 domain protein; KEGG:
FT                   rpb:RPB_3952 transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3119"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71200"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Q6"
FT                   /protein_id="ABL71200.1"
FT                   /translation="MSRITVLTAAPNRNIYSYMKRDSRLSSVLHALLHMAEQDGPVTSE
FT                   ALGRCLGTNPVVVRRTMGLLREAGLVTAERGHAGGWRISADLAAVSLRRLHEALGEPAI
FT                   FAIGNRNETPECLVEQSVNAALEGAFAEAEALLLERFAEVTLADLAEDFARRHAQRRAA
FT                   KE"
FT   gene            303759..304643
FT                   /locus_tag="Pden_3120"
FT   CDS_pept        303759..304643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3120"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: rpb:RPB_3951 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3120"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71201"
FT                   /db_xref="GOA:A1B6Q7"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Q7"
FT                   /protein_id="ABL71201.1"
FT                   /translation="MQDVIVIGGSYAGMAAALQLARARRKVLVIDAGQRRNRFASYSHG
FT                   FLGQDGVDPARIWAEACRQLLAYPTVTWVEGSASTIAGGKDEFRVSTAAGDTFAGRRIL
FT                   LATGVADRLPDIPGLADRWGRTVFHCPYCHGYELDQGRIGVIATGAMSLHQAQLLPEWG
FT                   EVTFLTNGALTLEPEQRDDLRSRGVAIEETPVARIAGEAEVELRDGRVLPFAGLFTATG
FT                   TEPASPLAEAAGCELIETPMGRQIVTDETKETSLPGIFACGDVARAPHSVSLAVGDGAW
FT                   AGAQLHRSLVWPE"
FT   gene            304640..305311
FT                   /locus_tag="Pden_3121"
FT   CDS_pept        304640..305311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3121"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: rpb:RPB_3655 SAM binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3121"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71202"
FT                   /db_xref="GOA:A1B6Q8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Q8"
FT                   /protein_id="ABL71202.1"
FT                   /translation="MSGAAHPGDGASYAGRVARHVPGLKDLHRMAGLLLAERVPETGRV
FT                   LVLGAGGGLELRGFAAAHPGWRFDGVDPSPQMTAQALDILGPEGGRVTFHQGYIDDAPE
FT                   GPFDGATCLLTLHFLPREERLRTLRQLHRRLRPGAPFAMAHHSFPQADGQQDLWLRRNA
FT                   AWLVSGGVPEAQAMAGMATMKERLPVLTPEEDAALLAAAGFREVQLFYAALTFKGWIAR
FT                   A"
FT   gene            complement(305322..306503)
FT                   /locus_tag="Pden_3122"
FT   CDS_pept        complement(305322..306503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3122"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   sit:TM1040_3585 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3122"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71203"
FT                   /db_xref="GOA:A1B6Q9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Q9"
FT                   /protein_id="ABL71203.1"
FT                   /translation="MTKITKRSVDAAAPAEQEFFLWDEELKGFGLRVYPSGRKMYLAQY
FT                   RAGGRSRRVNIGLHGAMTPEMARTEAMKYLSDVRLGADPAGERDRRKASPTIKEFSKRF
FT                   LSDHVALHCKASTYGEYERSIDLFINPRFGSHRIIDITRADVVGLHQSMRHIPYQANRT
FT                   LGVLSVMFTVAHAWGVRTDGVNPCWKVKRYREEKRERYLTPDELARLGKVLDCATEEPE
FT                   AANCIRLLLLTGCRLSEIQTLKWRYVDYRNGLLRLPDSKTGAKLVPIGKAAIKVLKTIP
FT                   KIDGNPYVITGRMEGQHLTDMQKPWRRLRKRAGLDDLRIHDLRHSFASDALQLGQDLTM
FT                   IGRLLGHTQVQTTARYAHLKTDPVRSAADAVSDAVAQALAQPVTEDGDEIAAA"
FT   gene            complement(306693..308351)
FT                   /locus_tag="Pden_3123"
FT   CDS_pept        complement(306693..308351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3123"
FT                   /product="Recombinase"
FT                   /note="PFAM: Resolvase, N-terminal domain; Recombinase;
FT                   KEGG: nha:Nham_3864 recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3123"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71204"
FT                   /db_xref="GOA:A1B6R0"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6R0"
FT                   /protein_id="ABL71204.1"
FT                   /translation="MKVAIYARYSSDQQRDASITDQFRMCRLRAEKEGWRVVEEYSDHS
FT                   ISGASMIQRPGIQALVMDSTRGRFDLVLAEALDRISRDQEDIAGIYKRMRYADVKMFTL
FT                   SEGEISELHVGLKGTMNALFLKDLADKTRRGQRGRVEAGKSGGGNSYGYDVVKKFDGDG
FT                   EPSRGDRTINAAQAEVVRRIFRDYAAGKSAKAIAMALNKDGIPAPSGGDWGFSTINGNP
FT                   KRGNGILNNEMYVGRIVWNRQRFIKDPDTGKRQARPNPEEDWVIQEVPELRILDDDLWN
FT                   AVKARQKTNTVARDARGIADVRKVNHRRRPKYLFSGLTKCACCGGGYSAISKELIGCST
FT                   ARNKGTCDNRMNIRRDELESRVLNALRTRLVDPDLFAEFCDAYTRETNRLRMESGAGID
FT                   KAEAELKRIAREEEKLMDLYMRDAISIEAVKERGDKLRARKAELQDFLASTDEPPPLLH
FT                   PSMALQYRARVQQLYETLQSDDETQRIEAAEIIRSLIDRIVLTPGEDRIEIDVQGDLAG
FT                   ILTLSAQRKNPAADAAGAQVKMVAGVGFEPTTFRL"
FT   gene            complement(308371..308598)
FT                   /locus_tag="Pden_3124"
FT   CDS_pept        complement(308371..308598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3124"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71205"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6R1"
FT                   /protein_id="ABL71205.1"
FT                   /translation="MLAIMTLPASRTQATMTRSEREALLDALLLGEPELGFTPRGNPDP
FT                   RLVRLVRLLGRQAARGNFEAQGKTREPGAS"
FT   gene            complement(308737..309381)
FT                   /locus_tag="Pden_3125"
FT   CDS_pept        complement(308737..309381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3125"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rde:RD1_1995 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3125"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71206"
FT                   /db_xref="GOA:A1B6R2"
FT                   /db_xref="InterPro:IPR008901"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6R2"
FT                   /protein_id="ABL71206.1"
FT                   /translation="MTWLSPVDAYCERTGPDYWSEPINALTNMAFLIAALVLWPRLRGP
FT                   EMAMGRALAAVLFVIGLGSWLFHTHANRLTGLMDVLPIVGFILLYVFAATRDYFGARPW
FT                   IAALVTAGFIPYAAATVPVFAMIPGLGSSASYAPVPLLILIYALLLRRRLPETARGLAV
FT                   GAGILIVSLTFRTLDQPLCGALPFGTHFLWHVLNAVMLGWMIEVWRRHRSR"
FT   gene            complement(309663..310022)
FT                   /locus_tag="Pden_3126"
FT   CDS_pept        complement(309663..310022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3126"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71207"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6R3"
FT                   /protein_id="ABL71207.1"
FT                   /translation="MGHHDRLCLKWRREGSAQGQQYVFASLAANAGSHLWCRDRVCGIV
FT                   DGLSLLSVTLVNVWSTHECVPLRTLIRPNPVRSVESSLHRRHFKGLPVILLKSNGSKGS
FT                   VDSAHNLKSAGPYLV"
FT   gene            complement(310237..310989)
FT                   /locus_tag="Pden_3127"
FT   CDS_pept        complement(310237..310989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3127"
FT                   /product="Peptidase C24, Calicivirus polyprotein ORF 1"
FT                   /note="PFAM: Peptidase C24, Calicivirus polyprotein ORF 1;
FT                   KEGG: rpd:RPD_2286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3127"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71208"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6R4"
FT                   /protein_id="ABL71208.1"
FT                   /translation="MEESDVQRIVRLTSLACAFITVETPEGDQGIGTAFHIGEGVYLTA
FT                   RHVIEGNRVLSVVPHTRGILFKKDLRKFVPTNSMMNGEIPTWSLNHSSPKIADGPYYHE
FT                   NANIDVAAFRLRGIDINTPHLVLGGHYDDWINDEYWMLSKATAFGYPPIPLTNGPVLVA
FT                   ASVEINAVIDTRLDRYVRFVVSGAPRGGFSGGPVFHEWGFVLGMTIESLERQGAKHEGG
FT                   FFTVLSIESLRECLENHGLLPEYQRIDS"
FT   gene            complement(311064..312305)
FT                   /locus_tag="Pden_3128"
FT   CDS_pept        complement(311064..312305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nar:Saro_2202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3128"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71209"
FT                   /db_xref="GOA:A1B6R5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6R5"
FT                   /protein_id="ABL71209.1"
FT                   /translation="MKTLKVALISLRDVLVRKKLEKEPLVEAIKLLQFLAKSGVQIAMV
FT                   SNSNWVMTDTQKPFTDFLQEAAGLKIPLHIKGVDFRAKQDSGAMADVLKKYGATPQEAV
FT                   YIGSTDEDMQATRNSGVLFLNAKWYADNSPYGFEFASALDIARFIDCCCLRPKDWFWKH
FT                   EFDGFRVLSIAPLAEVSKRYPEGAKYSTDAKAAAKFSRGDLRYWGLLMASRIHFSGIGA
FT                   EVDYVCPYPGHRTDSPKGLLTNALKIVAGSLKAQYLDDLLVRHASAEKSQAIRNSGRQP
FT                   TPENQLKTTRLRKDPVRTGKLALRYKSPPLRAGKKVLIVDDICTQGHSFEAARLFVQST
FT                   GADAIGISWLKTPGNDYSRVSFVDPAIKSPYLPYSPVKVRTIPHSFNAGIVNNLAAQEI
FT                   GDAFQAYGTWVWPT"
FT   gene            complement(312313..313308)
FT                   /locus_tag="Pden_3129"
FT   CDS_pept        complement(312313..313308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3129"
FT                   /product="SMF family protein"
FT                   /note="PFAM: SMF family protein; KEGG: nar:Saro_2201 smf
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3129"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71210"
FT                   /db_xref="GOA:A1B6R6"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6R6"
FT                   /protein_id="ABL71210.1"
FT                   /translation="MPEQKNPPTYRLAYLEQEIISFLALSSIKGVGFETLRKISERGIA
FT                   YAEVIDLQNKNDVSTILRSAGARLSDETAAPWGSTRERALSRGYELLDRLTKIDGKVIF
FT                   HSDKEYPSQLLDLPDAPRWLFVQGNSEVLRGPSIAVVGSREPSDDGIWLSRYVGFNLSE
FT                   WSCPTVSGLAVGIDQEIHSASLRAGVPTISFLGTGIFSDYPRNSEKLRDAIAKSGGAIV
FT                   TEYLPADTYSSKNFVKRNRLQAALAAALIPVEWAAKSGTAHTVRYAASLSRPIACLRLP
FT                   FGKVPDWVNTEIAKKASVFTVPQQQLEFVQFVLASVRSRPERQRQQLSLF"
FT   gene            313398..313784
FT                   /locus_tag="Pden_3130"
FT   CDS_pept        313398..313784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3130"
FT                   /product="phage integrase"
FT                   /note="KEGG: nwi:Nwi_0831 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3130"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71211"
FT                   /db_xref="GOA:A1B6R7"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6R7"
FT                   /protein_id="ABL71211.1"
FT                   /translation="MTCAPNSAQGFHGRIEHARERFLSPEELTRLAAVLDAAEDQRAVA
FT                   IIRMGMLTGARVGEVRTARFEQFNLDFAIWSKFASTTKQRKTHRVPISQDVAAIVRLRQ
FT                   QVVSYCGACRPAALEYAGVSIRTR"
FT   gene            complement(314148..315512)
FT                   /locus_tag="Pden_3131"
FT   CDS_pept        complement(314148..315512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3131"
FT                   /product="chromate transporter, chromate ion transporter
FT                   (CHR) family"
FT                   /note="TIGRFAM: chromate transporter, chromate ion
FT                   transporter (CHR) family; PFAM: Chromate transporter; KEGG:
FT                   sme:SMc00808 putative chromate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3131"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71212"
FT                   /db_xref="GOA:A1B6R8"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6R8"
FT                   /protein_id="ABL71212.1"
FT                   /translation="MKRRDGFPTLGQATGVWARIAALSFGGPAGQIAVMHRILVEERKW
FT                   LGDARFLHALNFCMLLPGPEAQQMATYIGWLMHGVRGALIAGMLFILPGFIAMMVLSWV
FT                   YALYGDVPVVTALFFGLKAAVLAIVLQAVFRIGKRALKNKVMLGLAAASFLAIFLFDAP
FT                   FPVIVALAAAIGWIGAKAGIAAFRGGGGHGSSGGAHVSDADTILGEDLDLPPSARRNAF
FT                   RAGWAAVALWLLPVLLLLALVPGSVFTDIALYFSKLAVLTFGGAYAVLAWVAQEAVGSY
FT                   GWLQPGEMLDGLGMAETMPGPLIKVLQFVGFMGAMREAGWAMPLLAATLGGVLTTWVTF
FT                   APCFAWILLGAPFMEGLRENRALAAALASVTAAVVGVILNLAIWFAIHVVWREVEPFDW
FT                   GPVSTSVPVLETLDGWAMALSALAILAVFRLKLGIGLVLGGAALAGLGLHMAGAI"
FT   gene            complement(315509..316354)
FT                   /locus_tag="Pden_3132"
FT   CDS_pept        complement(315509..316354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3132"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: mlo:mlr5406
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3132"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71213"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR018634"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6R9"
FT                   /protein_id="ABL71213.1"
FT                   /translation="MPAPDAITCDKLAKLIGTARCPVVLDLRRADARDTEPRLIPSARW
FT                   LAEDEIAPAALSELARSLDRPVVVLCAEGHGRSQGVAAWLRHEGVAAEYLEGGMAAWLA
FT                   AGLPLVTTTRITGHDPQGRSLWVTRARPKIDRIACPWLIRRFIDPRAVFLFVAPAEVPA
FT                   VAERFGAMPFDVEGVFWSHRGEDCTFDTLLKETRLSIPALDRLALIVRGADTARLDLAP
FT                   EAAGLLAASLGLSRMYSDDLEQLDAGLQLYDAFYRWARDATDEIHNWPTNARGTGRSAT
FT                   "
FT   gene            complement(316569..317276)
FT                   /locus_tag="Pden_3133"
FT   CDS_pept        complement(316569..317276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3133"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   rsp:RSP_2731 arsenical resistance protein, ArsH"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3133"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71214"
FT                   /db_xref="GOA:A1B6S0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6S0"
FT                   /protein_id="ABL71214.1"
FT                   /translation="MIPDLPNLSPGAVHQPDLPPVPRATHPPRILLLYGSLRERSYSRF
FT                   ATLEAERLLRHFGCETRVFHANGLPLPEDADPSHPKVQELRDLCLWSEGQVWTSPERHG
FT                   AMTGVMKSQIDWIPLSMGAIRPTQGRTLAVMQVSGGSQSFNAVNQMRVLGRWMRMLTIP
FT                   NQSSVARAYQEFDEAGRMRPSSYYDRIVDVMEELVKFTLATRDLSAFLTDRYSERKEAA
FT                   AKLEERVNLKAAT"
FT   gene            complement(317273..318346)
FT                   /locus_tag="Pden_3134"
FT   CDS_pept        complement(317273..318346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3134"
FT                   /product="arsenical-resistance protein"
FT                   /note="TIGRFAM: arsenical-resistance protein; PFAM: Bile
FT                   acid:sodium symporter; KEGG: sal:Sala_2405
FT                   arsenical-resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3134"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71215"
FT                   /db_xref="GOA:A1B6S1"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6S1"
FT                   /protein_id="ABL71215.1"
FT                   /translation="MTPDRPARRLSFLDRYLTLWIFAAMAIGILLGTLFSGLPDALNAM
FT                   AVGSTNIPIAIGLILMMYPPLAKVRYEDLPRVFADKRVLMLSLVQNWLIGPVLMFALAV
FT                   IFLRDQPEYMTGLILIGLARCIAMVLVWNQLARGDGQYVAGLVAFNSIFQILFFSTYAW
FT                   LFLTVLPPLFGLEGSVIEVGFRTVTEAVLIYLGIPFAAGFLTRHVLIARKGDAWYQNVF
FT                   LPRIGPITLAALLFTIVAMFSLKGGDVLRLPLDTIRIAIPLVLYFAIQFVVSFAMGRLI
FT                   ARDYPRSTAIAFTAAGNNFELAIAVAIAAYGLASPVAFAAVIGPLVEVPVLILLVNAAL
FT                   WLGRRWFPAATPQEARA"
FT   sig_peptide     complement(318206..318346)
FT                   /locus_tag="Pden_3134"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.793) with cleavage site probability 0.607 at
FT                   residue 47"
FT   gene            complement(318359..318784)
FT                   /locus_tag="Pden_3135"
FT   CDS_pept        complement(318359..318784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3135"
FT                   /product="arsenate reductase"
FT                   /note="TIGRFAM: arsenate reductase; PFAM: arsenate
FT                   reductase and related; KEGG: sal:Sala_2539 arsenate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3135"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71216"
FT                   /db_xref="GOA:A1B6S2"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6S2"
FT                   /protein_id="ABL71216.1"
FT                   /translation="MDVVIYHNPDCSTSRNVLAMIRNAGIEPHVVEYLKTPPSRAMLER
FT                   LIARMGIAPRELLREKGTPYAELGLDDPALTDAALIEAMLAHPVLINRPIVVSPRGVRL
FT                   CRPSEQVLDLLPPQQAAFSKEDGEQVVDAQGNRIRPA"
FT   gene            complement(318787..319146)
FT                   /locus_tag="Pden_3136"
FT   CDS_pept        complement(318787..319146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3136"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: nwi:Nwi_3123
FT                   transcriptional regulatory protein, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3136"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71217"
FT                   /db_xref="GOA:A1B6S3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6S3"
FT                   /protein_id="ABL71217.1"
FT                   /translation="MEEQHALVGFAALSQETRLRIVRLLVKAGPEGMAAGAIGEALGGA
FT                   STSRLSFHLTHLEHAGLIRSRREGRFIIYSAVFATLAGLIAFLMRDCCDGHPDICAPVA
FT                   AALDCACDPTLTREA"
FT   gene            complement(319199..319678)
FT                   /locus_tag="Pden_3137"
FT   CDS_pept        complement(319199..319678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3137"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71218"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6S4"
FT                   /protein_id="ABL71218.1"
FT                   /translation="MVSRLPHWVIFRIVVALLRDCRRLALLGLTGLPLGSRASFFGPVP
FT                   TMGSSMAPPGDPARMNKTWGRRDGIAPSGSKLSCKLVIWLERMSLRSRGSLSAASVVTD
FT                   RRGPRPRDTMMSRQLFPPRVQDMGNETLQMLNCVRFKVDLPRIPRTAVVETHLLA"
FT   gene            complement(320014..320844)
FT                   /locus_tag="Pden_3138"
FT   CDS_pept        complement(320014..320844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3138"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71219"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6S5"
FT                   /protein_id="ABL71219.1"
FT                   /translation="MIALLGPAGPSITPDRSSDRPCRSRREPACRARSRPFSDAGALLH
FT                   HAAARVVSRGCWRCLRNPRSGSPCCRTKKFEQAWLIWGVRGLQAIGDIRLSTNLRKARE
FT                   RNLGDDEAVLQRQDEVSAVDGRYDEFCVSRLLRFLFRRGIGSFRCRVDPVGPFDQQSRC
FT                   AEISVPVALLGGESEVFPQIRRHEQAGPLGGQKEHLQQVLYGGFVLIRAFDCHLPAFHR
FT                   LLPGASCQAIAGCPKGRRPDTRFASVSARLTVSMAGACRVTSPGTARTARTCKI"
FT   gene            320864..321223
FT                   /locus_tag="Pden_3139"
FT   CDS_pept        320864..321223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3139"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71220"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6S6"
FT                   /protein_id="ABL71220.1"
FT                   /translation="MVSLVENSDRDIRERLSDIELRLSELELQGLQGGVYSNPGGKEQS
FT                   LRDVLAWLERMTPVVRRLYWAIKEAAPQFDGPDRKALDQAVGALDAWQSAHSRLHETIA
FT                   ETNARELGGKEQHES"
FT   gene            321481..321687
FT                   /locus_tag="Pden_3140"
FT   CDS_pept        321481..321687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3140"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; SMART: Cold
FT                   shock protein; KEGG: rsp:RSP_3621 cold-shock DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3140"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71221"
FT                   /db_xref="GOA:A1B6S7"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6S7"
FT                   /protein_id="ABL71221.1"
FT                   /translation="MANGTVKWFNSNKGFGFIAPETGSKDVFIHISALERAGIHHLNDG
FT                   QAIAYDIERDRNGRESATNLVLS"
FT   gene            321760..322095
FT                   /locus_tag="Pden_3141"
FT   CDS_pept        321760..322095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_3622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3141"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71222"
FT                   /db_xref="InterPro:IPR010385"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6S8"
FT                   /protein_id="ABL71222.1"
FT                   /translation="MRCPPFRPFRQKSFIMEIHWGTPLSFVISSAGEVQKFSTIEQARY
FT                   WLRRRWPVSNTAQHHALEQLDAALHCLVSVGSARRAFIAAAKAAGFVPETSIAQSARPL
FT                   SACMATI"
FT   gene            complement(322388..322627)
FT                   /locus_tag="Pden_3142"
FT   CDS_pept        complement(322388..322627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3142"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71223"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6S9"
FT                   /protein_id="ABL71223.1"
FT                   /translation="MDLSLAECSNPARSVQKQTEAERRQDAERSNVAPPVCAFAPDKAK
FT                   HSCIAFVRCLNQWSQTWLFSTWPDKNSRNRSKTD"
FT   gene            322642..322848
FT                   /locus_tag="Pden_3143"
FT   CDS_pept        322642..322848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3143"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; SMART: Cold
FT                   shock protein; KEGG: sil:SPO3625 cold shock protein CspA"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3143"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71224"
FT                   /db_xref="GOA:A1B6T0"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6T0"
FT                   /protein_id="ABL71224.1"
FT                   /translation="MANGTVKWFNAAKGFGFIAPEHGGKDVFLHISALERAGLNSVADG
FT                   QAVTFEIESGRDGRESASRLALA"
FT   gene            322903..323103
FT                   /locus_tag="Pden_3144"
FT   CDS_pept        322903..323103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3144"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71225"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6T1"
FT                   /protein_id="ABL71225.1"
FT                   /translation="MLAKARNLFRDPAPLTAMDRTTSEAKLIVDEQARKRSELTASLKA
FT                   ARLAKEAADAATGVPAKKRKK"
FT   gene            323419..323967
FT                   /locus_tag="Pden_3145"
FT   CDS_pept        323419..323967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3145"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   ret:RHE_CH01244 probable molecular chaperone small heat
FT                   shock protein, HSP20 family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3145"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71226"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6T2"
FT                   /protein_id="ABL71226.1"
FT                   /translation="MPGRMQRHPTAKDLYPCCSTEDVAMRTTFDFSPLYRSSIGFDRML
FT                   SALEAASRIETIDNWPPYDIARTGEDDYCITMAVAGFSPDELAITQERTVLTVTGRKAG
FT                   EDKGEYLHRGIAERSFRRRFQLADHVKVTGAELLNGLLTIDLRHEIPEEMKPRRIEIAP
FT                   AQTLPKSEPQQVETGKQAA"
FT   gene            324049..324552
FT                   /locus_tag="Pden_3146"
FT   CDS_pept        324049..324552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3146"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   ret:RHE_CH01245 probable molecular chaperone small heat
FT                   shock protein, HSP20 family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3146"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71227"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6T3"
FT                   /protein_id="ABL71227.1"
FT                   /translation="MNVRDLIPWNRNGGNQLPTAFRDGDRDPFLSLHREVNRLFDDVFR
FT                   GFGLPAVGTVPAFGGGWPSVEISDNEKEIRVTAEVPGLDEKDIEVLLDDGVLTLKGEKR
FT                   SEVEDKDRQFSERFYGRFERRIPLGAEIREDEVDAHFRNGVLTVTLPKTEKAQSQVKRI
FT                   AIKG"
FT   gene            324652..325017
FT                   /locus_tag="Pden_3147"
FT   CDS_pept        324652..325017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH01246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3147"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71228"
FT                   /db_xref="GOA:A1B6T4"
FT                   /db_xref="InterPro:IPR005530"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6T4"
FT                   /protein_id="ABL71228.1"
FT                   /translation="MLKSLSLDRRTAFDIANVVAGLGLLLSPWYLGFAAETAAAWNAWL
FT                   VGAAMTLIALAALFAFHRLEEWANAALGLWAVIAPWVLGFATLAAAMWVHVIAGLVVAI
FT                   LAGVSLWSGGDRPYSTA"
FT   gene            325116..326492
FT                   /locus_tag="Pden_3148"
FT   CDS_pept        325116..326492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3148"
FT                   /product="protease Do"
FT                   /note="TIGRFAM: protease Do; PFAM: peptidase S1 and S6,
FT                   chymotrypsin/Hap; PDZ/DHR/GLGF domain protein; KEGG:
FT                   nmu:Nmul_A0510 peptidase S1C, Do"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3148"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71229"
FT                   /db_xref="GOA:A1B6T5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6T5"
FT                   /protein_id="ABL71229.1"
FT                   /translation="MSMKIPRLRAAVITLCTILALVAPPQAAVGQPMPEAGGGIPTIAP
FT                   MLSRVTPAVVNIAVVSETPVVSNPLYNDPYFRRFFDLRDPPMRRQMSAGSGVIVDAENG
FT                   YVLTNHHVVAEASAISVTLKDGRQFRAELVGADQATEIALLRIEAEDLVALEIGDSDRL
FT                   QVGDFVAAIGNPFGLGQTVTSGIVSALGRSGISREGYEDFIQTDASINPGNSGGALVTL
FT                   DGRLVGINTAILTPAGGNIGIGFAVPSNMAVAVMRQLIEHGEVRRGRLGIGMHDLTPDL
FT                   AEALELGGIHGAVIANVEPGSPAEKAGLKAGDVVTAVDGAPVQGATHLRNRLGLTPVGS
FT                   TIRLTVRREGDAREVDLTITADATSSGDFAGTPLDGARLRNASAEEARRAGGAGIMVDS
FT                   VEPDSLAAWIGLRRGDMIVAVNRTPVSSVADLRDMLAGHRAVAALELIRDGSRLFIVAR
FT                   "
FT   sig_peptide     325116..325199
FT                   /locus_tag="Pden_3148"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.647 at
FT                   residue 28"
FT   gene            complement(326590..327381)
FT                   /locus_tag="Pden_3149"
FT   CDS_pept        complement(326590..327381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3149"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG: mxa:MXAN_4531
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3149"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71230"
FT                   /db_xref="GOA:A1B6T6"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6T6"
FT                   /protein_id="ABL71230.1"
FT                   /translation="MMTNPEPTGLTERQVQSFIEDGFVRIDGAFPTDLARQCRDELWAA
FT                   AGLSPDRPEGWTRPVIRIAAMSTPAFVQAANTPLLRRAYDRLAGPGRWLAPQGLGSFPI
FT                   RFPSPIAPGDDGWHVDMSFGDSPDFMEWRVNVKSSGRALLMLFLFSDVGPGDAPTRIRR
FT                   GSHATIARELLPHGAAGATLRQLSANGYASTETCPEVLATGAAGTVYLCHPFLVHAAQP
FT                   HRGTRPRFMAQPPLLPKGEFDPALPPSPVQLAIRRACGLAF"
FT   gene            complement(327688..328374)
FT                   /locus_tag="Pden_3150"
FT   CDS_pept        complement(327688..328374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3150"
FT                   /product="protein of unknown function DUF899, thioredoxin
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF899,
FT                   thioredoxin family protein; KEGG: pfo:Pfl_1441 protein of
FT                   unknown function DUF899, thioredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3150"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71231"
FT                   /db_xref="InterPro:IPR010296"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6T7"
FT                   /protein_id="ABL71231.1"
FT                   /translation="MTQAIVSRDEWLDARKALLARERDMTHQLDALRAERRRMPWVRID
FT                   KPYRFDGPDGEMTLGDLFGTRSQLAVYHFMLTPGSEHLCSGCSFVADHVDAARQHFEQA
FT                   DLAFAAVSRAPVPQIEEVLRRMGWRFPWLSSGDGDFNYDFGVSFTEEDRAAGRAIYNYG
FT                   TVIRNSPDMFGVSIFVRQDGALFHSYSTYHRGVELLMGAFNWLDLTPKGRNENGAMSWL
FT                   RLHDEY"
FT   gene            328642..329901
FT                   /locus_tag="Pden_3151"
FT   CDS_pept        328642..329901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3151"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /note="PFAM: Tetratricopeptide TPR_4; KEGG: mes:Meso_0992
FT                   tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3151"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71232"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6T8"
FT                   /protein_id="ABL71232.1"
FT                   /translation="MKQSRTGRHPGVSNKHDGIAAAAQALAAGDALTALKRVALRDDPP
FT                   ALALRGIAMAQLGDLDRARDLLRRAARGLGADPLARARCRLAAAEIALVTRDLGGLERA
FT                   LGTARGALAAQGDWANAAHAGYLQARLLLLTGRLDQAEAVLETLDAAALPPASRPGCWL
FT                   VAAGIAMRRIRAGDARAALDRAARAAHQTGIAALAAEVAQARAAFDAPAGRLIESGRET
FT                   LLDLAGVEALLGADLLLVDACRNLLRGGATLVPLAGRPVLMALLRALAEAWPGDAPRET
FT                   LLARAFRARHADESHRARLRVEIGRLREHLSPLAGIKATGRGFVLEPCGGRRIAVLAPP
FT                   VEGDHAGLLALLADGEAWSSSALALALDVSPRSVQRGLKALERAGRVEWLGHGRARRWV
FT                   ARSVPGFPTGLLLPAPVPMR"
FT   gene            329911..330552
FT                   /locus_tag="Pden_3152"
FT   CDS_pept        329911..330552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3152"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_0991 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3152"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71233"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6T9"
FT                   /protein_id="ABL71233.1"
FT                   /translation="MKRMAEIIREYGPFPGIEEVHGVSFDGRQVWFASGERLNALDPDS
FT                   GELLGALKIPADAGTAFDGRHLFQIAGPVIRKIDPESGAVLATIPAPEGGNSGLAWAEG
FT                   SLWVGQHRGRRIHQVDPETGKVLRSIDCDRFVTGVTWADGALWHGTWQGEESDIRRIDP
FT                   ATGAVLERLEMPPGTGVSGLESDGGARFFCGGGSSGKLRVVLRKADQDAT"
FT   gene            330661..331068
FT                   /locus_tag="Pden_3153"
FT   CDS_pept        330661..331068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3153"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: pol:Bpro_3707 cupin 2, conserved barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3153"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71234"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6U0"
FT                   /protein_id="ABL71234.1"
FT                   /translation="MSDEHAGKSVLHLPPGAGRCYELGRMTAVFKADEDETAARCSVSE
FT                   WWLEPGADGPGAHAHEVNDEIFYVIAGTVSFLAGEDWLDAPQGTFLRIPAGVTHDFRNR
FT                   TAERVGLLNVFIPGGFERDMPAIADWFRDNP"
FT   gene            331073..331906
FT                   /locus_tag="Pden_3154"
FT   CDS_pept        331073..331906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3154"
FT                   /product="Aminoglycoside N(3')-acetyltransferase"
FT                   /EC_number="2.3.1.81"
FT                   /note="PFAM: aminoglycoside 3-N-acetyltransferase; KEGG:
FT                   gvi:gll0484 aminoglycoside N3'-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3154"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71235"
FT                   /db_xref="GOA:A1B6U1"
FT                   /db_xref="InterPro:IPR003679"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6U1"
FT                   /protein_id="ABL71235.1"
FT                   /translation="MRGKASITADLRRLGLKPGDLVMVHASLKALGPVEGGAAGVVQAL
FT                   LDALRPGGTVMGYASWDRSPYEETLNGARMDEALRRDWPAFDPRTAGTYRGFGLLNQFL
FT                   ADLPEARRSAHPDASMVAVGPLAGTLDEPHRLGQALREGSPLERFVRLGGKTLLLGAPL
FT                   DAVTVLHYAEAVADIPGKRRVSYEMPMPGPDGRTIWEAATDFDSNGILDCFAVEGQPDA
FT                   VETIARAYVATGRYREGMVGAARCHLFDAQDIVAFGVDWLERQFGSVPESGEDQT"
FT   gene            331919..332353
FT                   /locus_tag="Pden_3155"
FT   CDS_pept        331919..332353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3155"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: gvi:glr1626 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3155"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71236"
FT                   /db_xref="GOA:A1B6U2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6U2"
FT                   /protein_id="ABL71236.1"
FT                   /translation="MAPRISNRIASFVDALPLAPGQRVLEIGCGPGVAARAVSRRVGNG
FT                   FVLAIDRSAKAIESAVAGSRAEIATGRLRFLQAAIEDFELPPNEEPFDIAFAIRVGALD
FT                   GRHPDIEQRALERLRAALKPTGRLFIDTGHPLREIKLIRR"
FT   gene            332449..332766
FT                   /locus_tag="Pden_3156"
FT   CDS_pept        332449..332766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3156"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: jan:Jann_4229 histone-like
FT                   nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3156"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71237"
FT                   /db_xref="GOA:A1B6U3"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6U3"
FT                   /protein_id="ABL71237.1"
FT                   /translation="MTDIDLNALSLAELKQLEKNLTKAIASFEDRRKAEARAAAEAVAK
FT                   EHGFSLGELAEMTPAQKRAAVAPKYRHPENPEITWSGRGRKPAWIAGALEAGKSLEDFA
FT                   I"
FT   gene            332782..333399
FT                   /locus_tag="Pden_3157"
FT   CDS_pept        332782..333399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3157"
FT                   /product="plasmid pRiA4b ORF-3 family protein"
FT                   /note="PFAM: plasmid pRiA4b ORF-3 family protein; KEGG:
FT                   sme:SMa0896 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3157"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71238"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6U4"
FT                   /protein_id="ABL71238.1"
FT                   /translation="MFQPPNAVRLHVSLAEIEPEIWRRLVVPCDWTLDRLHPVLQAAFG
FT                   WTDSHLHEFRIGGLRYGDPALLDDGFGGPRVFDSTEVRLQDFVGHDVGFTYAYDFGDDW
FT                   QHLIRIEDWSALDPAPRHALCLEGARARPPEDVGGPWGYKDFLGIIRDPTHEEHRSTLR
FT                   WAGGRFDPEWFDLDLINKDLRNALRANVRRRLHQPRPKAPKD"
FT   gene            333475..333834
FT                   /locus_tag="Pden_3158"
FT   CDS_pept        333475..333834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3158"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71239"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6U5"
FT                   /protein_id="ABL71239.1"
FT                   /translation="MTEIATHPRIKLSKLRDIGWSLWDPIGLLDPESPAGRWDDEANLS
FT                   FADEYDSYLVAAASQLRRGTSPDEVVAFLVEIETEHMGMGDNQSARSRAEAVVDATLAD
FT                   ETIWTWPDAQGRFRV"
FT   gene            333864..334322
FT                   /locus_tag="Pden_3159"
FT   CDS_pept        333864..334322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3159"
FT                   /product="Gentamicin 3'-N-acetyltransferase"
FT                   /EC_number="2.3.1.60"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sal:Sala_0626 gentamicin 3'-N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3159"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71240"
FT                   /db_xref="GOA:A1B6U6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6U6"
FT                   /protein_id="ABL71240.1"
FT                   /translation="MSVSIRCLDRSDVSVLRQMNALFGDAFDDPDTYLGEPPDDAYLSG
FT                   LLAGDHLIALAAMDGAVVVGGLIAYELEKFERARSEIYIYDLAVAETHRRQGIATALIG
FT                   ALQRIAAERGAWVVYVQADYGDEPAIALYTGLGKREDVLHFDIPVDAG"
FT   gene            complement(334803..335831)
FT                   /locus_tag="Pden_3160"
FT   CDS_pept        complement(334803..335831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3160"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: nha:Nham_3955
FT                   transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3160"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71241"
FT                   /db_xref="GOA:A1B0T4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1B0T4"
FT                   /protein_id="ABL71241.1"
FT                   /translation="MNNATIIGIDLAKRVFHAHGAHIDGSVAFRKRLTRAQMLPFLSAQ
FT                   PRCVVVMEACASAHEWGRAIQQLGHDVRLIPPSYVKPYVKRQKNDTADAEAIAEAGSRP
FT                   TMRFVAVKTEEQQARSMVFRTRDLLVRQRTQLINALRGHLAEHGLVVPQGPAHLKSLAK
FT                   ALDATDVAIPQLVRDIGRIYLEQIEQLNAKIADLEKTLRREAQFGEEIRRLQTMPGIGP
FT                   ITAMAVEVFAPPMQTFKRGRDFAAWLGLVPVQHSTGGKQRLGRTSKMGQRDIRRLLIIG
FT                   AMAVIRWASRRGARPGSWLSRMMDRKPLMLVAVALANKMARAIWAMQTKREDYRDPGLA
FT                   AA"
FT   gene            335940..336263
FT                   /locus_tag="Pden_3161"
FT   CDS_pept        335940..336263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3161"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   nwi:Nwi_2119 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3161"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71242"
FT                   /db_xref="GOA:A1B6U8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6U8"
FT                   /protein_id="ABL71242.1"
FT                   /translation="MSKTTNKFSPEVRERAVRLVLDNEGQHASRWQAVMSIAAKIGCTP
FT                   QTLNDWVKKAEVDSGKRAGIPTEMAEKMKALERENRELRQANEILRKASAYFAMAELDR
FT                   RPK"
FT   gene            336263..337168
FT                   /locus_tag="Pden_3162"
FT   CDS_pept        336263..337168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3162"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   nwi:Nwi_2120 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3162"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71243"
FT                   /db_xref="GOA:A1B6U9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6U9"
FT                   /protein_id="ABL71243.1"
FT                   /translation="MVGFIDAHRDAHGVEPICDVLPIAPATYYDHLAKRADPARLSDRA
FT                   KRDEALRPEIRRVFEDNWSVYGLRKVWHQLRREGFDIACCTVARLMKDMGIQGIVRGKP
FT                   HKTTIPDKKQPCPLDKVNRQFRVPAPNMLWVSDFTYVATWKGFVYVAFVIDAYARKIVG
FT                   WRVSTSAYAGFVLDALEQAVHDRRPVKGMGLVHHSDRGSQYLSIKYTERLAEAGIEPSV
FT                   GSVGDSYDNALAETINGLFKAEVIHRRGPWRSFEAVEYATLEWVDWFNNRRLLEPIGNI
FT                   PPAEAEANFYAALETEAMAA"
FT   gene            337267..337683
FT                   /locus_tag="Pden_3163"
FT   CDS_pept        337267..337683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_3831 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3163"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71244"
FT                   /db_xref="GOA:A1B6V0"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6V0"
FT                   /protein_id="ABL71244.1"
FT                   /translation="MTLILLAIMLTAVACVIAWYLAIYALPVMVAVETFRLIHATETGF
FT                   LLSAFAAATAALLSVGLVLAVLFKAKNPMLCLTARAVFVIPAMIAGYAIVHGVTHDAID
FT                   SAIALKLLCGTAGLITGSAALINLNGFGELAPQG"
FT   sig_peptide     337267..337359
FT                   /locus_tag="Pden_3163"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.879 at
FT                   residue 31"
FT   gene            338133..338810
FT                   /locus_tag="Pden_3164"
FT   CDS_pept        338133..338810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3164"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   ret:RHE_CH01977 probable DNA-methyltransferase protein
FT                   (hemagglutinin-associated protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3164"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71245"
FT                   /db_xref="GOA:A1B6V1"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6V1"
FT                   /protein_id="ABL71245.1"
FT                   /translation="MTGKTSTPRNLVINADCIEAMQAFGSGSVDFILTDPPYVTRFRDR
FT                   QGRTVANDDNARWLRPAFAQMHRVLKDGGFCVSFYGWNKVDLFVEAWKAAGFRIVGHLV
FT                   FRKRYASSARFLRYEHEQAYLLAKGDPESPARPVPDVLDFPYTGNKLHPTQKPVAALRR
FT                   LIGAFTKPGDLVLDPFSGSGSTLAAAHLLGRDWLGVELDVEHYQTAGKRMAALQERDRK
FT                   AAA"
FT   gene            338882..339184
FT                   /locus_tag="Pden_3165"
FT   CDS_pept        338882..339184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3165"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71246"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6V2"
FT                   /protein_id="ABL71246.1"
FT                   /translation="MRWIITKDYWGNCLGLGEDADGVPARGKPEDGDALPAEFRLYTAR
FT                   GRLLFEGRCGDIEADWWHGMEPLLYAWTTFRCRRLTWRPVGTGESWRPLRPWIRH"
FT   gene            339330..340253
FT                   /locus_tag="Pden_3166"
FT   CDS_pept        339330..340253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3166"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   rsp:RSP_1646 possible transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3166"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71247"
FT                   /db_xref="GOA:A1B6V3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6V3"
FT                   /protein_id="ABL71247.1"
FT                   /translation="MRTARMARRDPDGGRPPYRSPAGSRRRRERQNGVQTPSAVLGYGA
FT                   LAGHKLGLKQLGTGILNIDTGPLAAPFLVIALIYAAVGQAGASGYIAVMGLAGFAPLAM
FT                   KTTALSLNLMVAAIGTVLFLKAGRLSWRNVWPFAILGFPFSMLGGAVQLPESVYFPVVG
FT                   IVLILSALQMMRTAFHGRPSASGTVVTPPFGAALATGAVIGFVSGTTGTGGGVFLAPII
FT                   LSMNWGTARQTAATTAVYNLMNSAAALVGAYAAWDHIPAALPIWLAAVAIGGSVGAWIG
FT                   SRYLSDRWLRGILAFLLLVSGIKLIW"
FT   gene            341031..341438
FT                   /locus_tag="Pden_3167"
FT   CDS_pept        341031..341438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3167"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: nha:Nham_4669 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3167"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71248"
FT                   /db_xref="GOA:A1B6V4"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6V4"
FT                   /protein_id="ABL71248.1"
FT                   /translation="MQNIVILAGTIRQAPETRTTRTGTDVTRFKLVTSRPRYSEGRVVR
FT                   DEKGYRVEDAEWHRVVAFNGLGRTIRQYCESGTKVLVRGRIHYTKWQDAEGQDRYGCEI
FT                   VAETVDFLSRAPQTEIDEDEGRFIDEDDIPS"
FT   gene            341929..342132
FT                   /locus_tag="Pden_3168"
FT   CDS_pept        341929..342132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3168"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71249"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6V5"
FT                   /protein_id="ABL71249.1"
FT                   /translation="MHTATFEINIPSNPLASRINLEDIEMGMDADTGVKARASRHSMTL
FT                   TVRVAASDAADAAKWLQKMGLI"
FT   gene            342234..342449
FT                   /locus_tag="Pden_3169"
FT   CDS_pept        342234..342449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3169"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71250"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6V6"
FT                   /protein_id="ABL71250.1"
FT                   /translation="MNHHPSTVTELMAEAANALIRRDSHRLEELERIARGWMQTQDEEL
FT                   AQIILLQAMTEAADLLLDTPSEIESA"
FT   gene            342529..342795
FT                   /locus_tag="Pden_3170"
FT   CDS_pept        342529..342795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3170"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71251"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6V7"
FT                   /protein_id="ABL71251.1"
FT                   /translation="MTAAERTARRLANAATLATAFAEGRFRKVTVREAWGLGWDAEADE
FT                   PEVFAECGLHAILNADRTEIQMMADDDGECWTIQIASGEFCPA"
FT   gene            complement(342906..343163)
FT                   /locus_tag="Pden_3171"
FT   CDS_pept        complement(342906..343163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3171"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   ret:RHE_PA00165 putative transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3171"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71252"
FT                   /db_xref="GOA:A1B6V8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6V8"
FT                   /protein_id="ABL71252.1"
FT                   /translation="MEIREIFAHNLRAARQARGLSQEELAHRADIDRTYISSLERRVYG
FT                   ASIDVVDRLASVLEMEASDLLKRPTVGNRLPSAEPPKPDK"
FT   gene            343217..343663
FT                   /locus_tag="Pden_3172"
FT   CDS_pept        343217..343663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_0527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3172"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71253"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6V9"
FT                   /protein_id="ABL71253.1"
FT                   /translation="MGCRGFCLRCAGIRSCTKLLCLVNDAEQDPSRGTRLVVERGPAWN
FT                   SAAAGKHRDHRPDGRGDVTEKDYLEDVPTGPELTDYDRRHQKLYMRLHDSADDGADWRE
FT                   AVQILFGLDPEREPERARRIYDSHLARARWMKKDGYKLLLRDGR"
FT   gene            343788..344096
FT                   /locus_tag="Pden_3173"
FT   CDS_pept        343788..344096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_0526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3173"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71254"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6W0"
FT                   /protein_id="ABL71254.1"
FT                   /translation="MDMKPDLSKWRSSPSYDFVDEVAAPDLAWEWLRRNEDYQQDYRAV
FT                   ARQEAMDAPGILRFRNRWGLTFPGPARTVLRGYAGLLAAVLRDRQPRAGCATLRSAC"
FT   gene            344116..344568
FT                   /locus_tag="Pden_3174"
FT   CDS_pept        344116..344568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3174"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_0525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3174"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71255"
FT                   /db_xref="InterPro:IPR018754"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6W1"
FT                   /protein_id="ABL71255.1"
FT                   /translation="MRAADARADAAGTWFRYDIGDGRSLHLLRLAGVEEHGPLAIVIPL
FT                   DADGLDRIEAATRLLCFLMRRSVPPDRRLTERQRQRARQMLQAIDGRMSGASYRDIARA
FT                   IYGTDRVHAEAWKTSALRDAVMGFVRDARAMIGGGYRRLLRRRRRK"
FT   gene            344690..345589
FT                   /locus_tag="Pden_3175"
FT   CDS_pept        344690..345589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3175"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: sit:TM1040_2078 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3175"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71256"
FT                   /db_xref="GOA:A1B6W2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6W2"
FT                   /protein_id="ABL71256.1"
FT                   /translation="MTNTPDLLRLIATVFIAVTCVVIGDTAGKLLTGGGVDPFIVAWSR
FT                   FFLAALMLLPFSGLTRRELPALLDWRVLLRAGLIASGICCILTALKTEPIANVFGAFFV
FT                   GPVVSYVLAILFLGERPSAPRSLLLGLGFAGVMLVVKPGFGSSAGMGFALAAGTFYGAY
FT                   LVMTRTLAGRFRPRFLLISQLLIGAVVLTPFGLQADFPVPDVPLLVLLLISAVGSAVGN
FT                   FLLVMASRTAEASLIAPLVYSQLISATALGIVVFGEWPDLVSLAGLVLIAISGLGSLLV
FT                   HQRAGRGRLSTPPCPRTL"
FT   gene            complement(345773..346171)
FT                   /locus_tag="Pden_3176"
FT   CDS_pept        complement(345773..346171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3176"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc01177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3176"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71257"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6W3"
FT                   /protein_id="ABL71257.1"
FT                   /translation="MIGIDTNVLVRYLAQDDAAQAAIATEIVEGFTPEEPGFVSQVVLV
FT                   ETVWVLTRAYRMTREAMADAVEVLLRSRELIVEHTEAGYLALATYRATKADFADALIAH
FT                   GGRLEGCSETLTFDRGAASHAGMRLLGS"
FT   gene            complement(346168..346452)
FT                   /locus_tag="Pden_3177"
FT   CDS_pept        complement(346168..346452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3177"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: sme:SMc01176
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3177"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71258"
FT                   /db_xref="GOA:A1B6W4"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6W4"
FT                   /protein_id="ABL71258.1"
FT                   /translation="MSSLLVSLPTERTAPMPTATITSKGQITIPQKVRLDMGLTPGDRV
FT                   DFVRMDDGHYAVVPASHSIRALKGIVPRPDKPVSLEDMQAAILGEATGE"
FT   gene            346610..346891
FT                   /locus_tag="Pden_3178"
FT   CDS_pept        346610..346891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3178"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: mes:Meso_3841 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3178"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71259"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6W5"
FT                   /protein_id="ABL71259.1"
FT                   /translation="MKPDLTDLPPRFLRTPEAAYFLGLSGRTLEKHRSFGTGPVFHKLG
FT                   GRVVYAVDDLQAWAERGAVTSTSDPRGTVLPAKRHAVAPPAHAGRYRR"
FT   gene            346902..348014
FT                   /locus_tag="Pden_3179"
FT   CDS_pept        346902..348014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3179"
FT                   /product="replication protein A"
FT                   /note="KEGG: mes:Meso_3842 replication protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3179"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71260"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6W6"
FT                   /protein_id="ABL71260.1"
FT                   /translation="MRTSRRTRLSGERRRLSPFVVTGTGGEVRPRDQRDLMERPFFSLA
FT                   KTKRLTPIHYESGGVQVHVQGFPEHGMATIWDADVLIWAASQIVDAENAGLQTSRFLRF
FT                   TPYQLLTAIGRQTGARDYRLLKGTLARLQSTVIRTTIRHGEHWRRHQFSWIGEWEEMTT
FT                   AGGRVEGMEFVLPEWFYRGVLDRSLVLTIDPAYFRLKGGIERWLYRVARKHAGRQPSGW
FT                   CFDIPHLHAKSGSLVRLSDFALQIRRIAQRQSLPGYRLRIERRGDVEMLRIQPVSYPQR
FT                   LVDNCVNGIGTSDARNVDDIGTSHAGLSGLRTHGSQSSLWDSKGNPARNLSNLKDSNIV
FT                   EARRAVDNPRPGAHTVPHSRNRRGPEGGGE"
FT   gene            348011..348313
FT                   /locus_tag="Pden_3180"
FT   CDS_pept        348011..348313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3180"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71261"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6W7"
FT                   /protein_id="ABL71261.1"
FT                   /translation="MTPHALPLSQPGACFRFSQPYHDPLRAPTTSFTFQTRVGVEWPLP
FT                   SKLGAIRLASESSPESWIAAPLIVERDFPIFVDSNRKPVPILSCIARHHGGGGMQ"
FT   gene            348310..348798
FT                   /locus_tag="Pden_3181"
FT   CDS_pept        348310..348798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3181"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_2334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3181"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71262"
FT                   /db_xref="InterPro:IPR021263"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6W8"
FT                   /protein_id="ABL71262.1"
FT                   /translation="MNGAFMHVAHRLTFVDLIWQEKRIEHWLRFGRFCQEHRLDRRRRT
FT                   IGFAPGNVFAVVRWAGNDYGTVVSRLDILRAVGRGEAFQTLPFVKPGAEILLRISGWPK
FT                   VERVLQAVDAVEALGIDPCVVSPDHWRHVHNRMVAGEPFRTYTRAQHAAWLKRRRVGV"
FT   gene            348795..350282
FT                   /locus_tag="Pden_3182"
FT   CDS_pept        348795..350282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3182"
FT                   /product="C-5 cytosine-specific DNA methylase"
FT                   /note="PFAM: C-5 cytosine-specific DNA methylase; KEGG:
FT                   ngo:NGO1894 putative 5-methylcytosine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3182"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71263"
FT                   /db_xref="GOA:A1B6W9"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6W9"
FT                   /protein_id="ABL71263.1"
FT                   /translation="MSARRTHLSLPLRVLDLFSGAAGGWSLGLHRAGFVTVAACEIVAW
FT                   RRILYSENFPHVRLHEDVRTLTAARLVSDLGGLPEIIVGSPPCQDISSANTKGKGIEGE
FT                   RSGLYLEAVRLVGECRPRWFAFENSSVLRTRGADRLLDELEALGYACWPCVVGAADIGA
FT                   NHVRKRSWLIGCDPEQLADTRVAIPAGWIAAGGRIGGAEGDEGLGSFRSVPQPTLADAD
FT                   GLGRDEGRRRRRRGIDISAADDPGDAAEVRRASRWPGRSAEPVAGPQQPPCGHDGHADG
FT                   ECGTAGQRVAQAQGPDDLGSGPFRPQPDDRRSAAFRQAGAGNPADADEAGQPDGRLEPG
FT                   LRPSEVADHGCGDGRGDDGSGAGQMGRGAGAGGDLAEPWPDWNGGIAHHIRVDDGISAW
FT                   LARTHLALGSRKGTSAASLIVEAFGDAVVPQIPEAIGRAILRSEAALNAVLGGAPANDA
FT                   ANDDGQSIDAGRGNAAPNDNAVDEAASGSPTDHGGAP"
FT   gene            350279..350881
FT                   /locus_tag="Pden_3183"
FT   CDS_pept        350279..350881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3183"
FT                   /product="conjugation peptidase TraF, Serine peptidase,
FT                   MEROPS family S26C"
FT                   /note="KEGG: mes:Meso_3845 conjugal transfer protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3183"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71264"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6X0"
FT                   /protein_id="ABL71264.1"
FT                   /translation="MIRRTRTTYLAATAAAVMVIGAVSVTDITPRLIWNASASLPIGLY
FT                   RVEPPTTLTLGDLVAVDPPEPLAQFVTARGYVGPGVPLLKRVAALPGTRVCRTGATITV
FT                   QGEAIGEARERDRIGRPLPTWQGCQVVGTDEVFLMNREVGDSLDGRYFGPLPLASVTAR
FT                   IVPLWIDAAGDGRFRRPVAGTEGGSQNLSPTATEETK"
FT   sig_peptide     350279..350356
FT                   /locus_tag="Pden_3183"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.407 at
FT                   residue 26"
FT   gene            350878..351216
FT                   /locus_tag="Pden_3184"
FT   CDS_pept        350878..351216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3184"
FT                   /product="protein of unknown function DUF736"
FT                   /note="PFAM: protein of unknown function DUF736; KEGG:
FT                   mes:Meso_2332 protein of unknown function DUF736"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3184"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71265"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6X1"
FT                   /protein_id="ABL71265.1"
FT                   /translation="MMPQIGEFTRTQSGYEGRIRTVTLDLNLVFVPTHNADIEKAPDYR
FT                   IHLDGEDGPEIGAGWTQSGEKAGTYISVAIDDPAFVQPIRARLFQSDEQGRHWGLHWSR
FT                   PRKRDERD"
FT   gene            351220..352026
FT                   /locus_tag="Pden_3185"
FT   CDS_pept        351220..352026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3185"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   mes:Meso_0517 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3185"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71266"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6X2"
FT                   /protein_id="ABL71266.1"
FT                   /translation="MPVSVKHRAGGQACAARQAAILLLSGLTFAAVPAAVPLAQTVQPD
FT                   VQEASDPFAAHVADASLRFGIPAHWIRAVRHVESRGNPQAVSPKGAMGLMQVMPETWAA
FT                   LRARHALGSDPFDPRDNILAGAAYLREMHDRYGSIAGMLAAYNAGPGRYDEHLVSGRAL
FT                   PAETRAYVAALAPMLGGEPLSGMSFAAAPPRDWREAPLFIGSPDAERVQPGGLFVRRSD
FT                   AEPAQSDGALAADPEPPAEPSDTAQSARAPQSDGLFVRRSDAGAVQ"
FT   sig_peptide     351220..351312
FT                   /locus_tag="Pden_3185"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.770) with cleavage site probability 0.621 at
FT                   residue 31"
FT   gene            352076..352657
FT                   /locus_tag="Pden_3186"
FT   CDS_pept        352076..352657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3186"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71267"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6X3"
FT                   /protein_id="ABL71267.1"
FT                   /translation="MKIAYADPPYIGCVHLYRDRPDYAGEVDHAALIDRLERDYDGWIL
FT                   HAAATPKSIATLAPLIEPTGARWMAWVKGFAAFKRNVPVAWAWEPVIVKAARKPVVSKR
FT                   LVLRDWLQESITLRRGLTGAKPEAVCHWAFEMVAARPEDSLDDLFPGTGAVTAAWHSWQ
FT                   RKFALPGDPLPDLGPSDRARRGRALPRGPS"
FT   gene            352908..354701
FT                   /locus_tag="Pden_3187"
FT   CDS_pept        352908..354701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_3848 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3187"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71268"
FT                   /db_xref="InterPro:IPR021795"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6X4"
FT                   /protein_id="ABL71268.1"
FT                   /translation="MSADDHEFRIRPGRPRSTPAPRSGSFVNQVLRAARKAGPVRAWSS
FT                   KSKGFPRPGHSTFGRGRAGFGRSRLFSPQRRVVVKARVVRHRGRSFRSAPMTAHLSYLK
FT                   REGVSRDDSDGLMFDATSDDADDSAFAERCQDDRHHFRFIVSPEDASDMTDLRAFTRDL
FT                   VRQMEADLGTKLDWIAADHWNTDNPHVHLLVRGVDDGGKDLVISRDYISYGLRSRAEDL
FT                   VSIELGPRQEHEIRSALEREVTAERWTRLDAAIRRQADDLGFIDLRPDAPIRGEPTGRS
FT                   PEPRRLMIGRLQHLEKMGLATLAGPGEWMLGLEAETTLRDLGRRGDIVSRMHRAFAARD
FT                   EERGVLDYVTDSGQDGASVIGRLVDLGLHDELTGEAYAVIDGTDGRAHHIRLRGIEAFD
FT                   QAPPLGGIVELRRFGGPEDPNPTLRLAHRSDLDLQAQIAAPGATWLDYRLVERKPMPLA
FT                   MGGFGKEVREAMDARAEHLVGEGLARREGGRILVRRHLLATLRRRELDAVGADLARKTG
FT                   LPHVQARPGDHVAGTCGRRMSLSSGRFAVIEGSGPGGGLGFQLVPWSRDLEGQLGRHVS
FT                   GVAKPGGGIDWSLGRRRDLGL"
FT   gene            354719..356728
FT                   /locus_tag="Pden_3188"
FT   CDS_pept        354719..356728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3188"
FT                   /product="TRAG family protein"
FT                   /note="PFAM: TRAG family protein; KEGG: mes:Meso_0515 TraG
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3188"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71269"
FT                   /db_xref="GOA:A1B6X5"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6X5"
FT                   /protein_id="ABL71269.1"
FT                   /translation="MSGTKILWGQIAVVFLIVLISVWSGTQWAAWRLGFQPQLGPAWFE
FT                   LWGIPIYYPPALFWWWYFYDAYAPRIFAEGGVIAASGGFLAIGVAITLSVMRAREAADV
FT                   DTYGSARWAARPEIERAGLLGPDGVVLGKLGEDYLRHDGPEHVLCFAPTRSGKGVGLVV
FT                   PTLLTWPGSTIVHDIKGENWQLTAGFRARHGRVLLFDPTNAASAAYNPLQEVRRGEWEV
FT                   RDVQNIADILVDPEGSLEKRNHWEKTSHALLVGVILHVLYAEEDKTLARVAAFLSDPRR
FT                   SIEATLAAMMKTPHLGEAGPHPVIASAARELLNKSENERSGVLSTAMSFLGLYRDPVVA
FT                   QVTSRCDWRIADLIAAEKPSTLYLVVPPSDISRTKPLIRLVLNQIGRRLTEDLHAKDRG
FT                   HRVLMLLDEFPALGRLDFFESALAFMAGYGLKAFLIAQSLNQIEKAYGPNNSILDNCHV
FT                   RVSFATNDERTAKRVSDALGTATEMKAMKNYAGHRLAPWLGHIMVSRSETARPLLTPGE
FT                   VMQLPPEDEIVMVAGTPPIRARKARYYTDPRFRERMLSPPDPREAVPSARADDWTGLTP
FT                   PKPDGLVEKTDVKKEEGRAKRQDKANSGLRREPELPEHVEIVHERKEPSPEDEFRHLLG
FT                   DDQEDAVRQRQALRRKMAGVARQTSMDPGDDIPM"
FT   sig_peptide     354719..354808
FT                   /locus_tag="Pden_3188"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.962 at
FT                   residue 30"
FT   gene            356759..357280
FT                   /locus_tag="Pden_3189"
FT   CDS_pept        356759..357280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_0514 helix-turn-helix protein, CopG"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3189"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71270"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6X6"
FT                   /protein_id="ABL71270.1"
FT                   /translation="MRQRLNVYFPPALLRQISDLADSRKVSRSAIVEAAVASFLSPDDA
FT                   DRREAAFARRLDRMSRQIMRLERDVGLCAETLALFVRFWLTVTPPIPAEGYAAAQAKGR
FT                   ERFEGFVETLGRRLQSGESFLREIPEDVAGAGEDPAKPGPATDDQGIAPRDAVPAEEAK
FT                   RQEASDWRGR"
FT   gene            complement(357306..357827)
FT                   /locus_tag="Pden_3190"
FT   CDS_pept        complement(357306..357827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3190"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_3433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3190"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71271"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6X7"
FT                   /protein_id="ABL71271.1"
FT                   /translation="MTGSPGSGKSSLIDAMSRRGFRSMPEAGRAVIRDQVRIGGSALPW
FT                   SDRAMFAELMLGWELRSYREARAMNGPVLMDRGIPDVVGYLTLCGLPVPDHIETAARLH
FT                   RYNKQVFLAPYWEAIFIQDAERKQDLKEARATGRIMAETYDRLGYQLVELPLAGIEERA
FT                   DFVVDCLKAV"
FT   gene            complement(357824..358063)
FT                   /locus_tag="Pden_3191"
FT   CDS_pept        complement(357824..358063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3191"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71272"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6X8"
FT                   /protein_id="ABL71272.1"
FT                   /translation="MGRGRLGPRSGVERPFVTYQISDPKRFHLGMQRGHCRHLFLWLAL
FT                   PQRDEPARLTSGSSVHFPIIEKFEVGTCVIICSS"
FT   gene            complement(358045..358470)
FT                   /locus_tag="Pden_3192"
FT   CDS_pept        complement(358045..358470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3192"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG: plu:plu3057
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3192"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71273"
FT                   /db_xref="GOA:A1B6X9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6X9"
FT                   /protein_id="ABL71273.1"
FT                   /translation="MILLDTNVVSEPMREAPNPGVIGWIDDQAIETLHLSAITVAEVRF
FT                   GIAVLPDGKRKARLQSRFETEILPLFADRILPFDLAASEAFAALMAHARDKSAAIGKAD
FT                   GYIAAIAAAHRLTVATRDTAPFLAAGVTVIDPWDEAG"
FT   gene            complement(358467..358730)
FT                   /locus_tag="Pden_3193"
FT   CDS_pept        complement(358467..358730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3193"
FT                   /product="putative plasmid stabilization protein"
FT                   /note="KEGG: ret:RHE_PE00297 putative plasmid stabilization
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3193"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71274"
FT                   /db_xref="GOA:A1B6Y0"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Y0"
FT                   /protein_id="ABL71274.1"
FT                   /translation="MPAITIRNLSAETHRALKMRAAQHGRSTEAEVRDILEQAARPQHR
FT                   VRLGSLLAEIGREARMTKEEHALFETAIRRDRAPAQPIDFGE"
FT   gene            359010..360014
FT                   /locus_tag="Pden_3194"
FT   CDS_pept        359010..360014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3194"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   mes:Meso_2324 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3194"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71275"
FT                   /db_xref="GOA:A1B6Y1"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014149"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Y1"
FT                   /protein_id="ABL71275.1"
FT                   /translation="MAGSDHIEARVERGARMLRTALGPAISALLRDPDIVEVMLNPDGR
FT                   IWVDRLRDGLADTNQVLSASDGERIIRLVAHHVGAEVHAHNPRVSAELPETGERFEGLL
FT                   PPVVAAPAFAIRKPAVAVFNLDDYVDTGIMTRMQAEALRLAVATRANILVSGGTSTGKT
FT                   TLTNALLAEVAKTQDRVVIIEDTRELQCAAPNLVAMRTTDGVATLSDLVRSSLRLRPDR
FT                   IPIGEVRGAEALDLLKAWGTGHPGGIGTIHAGSGIGALRRLEQLIQEAVITVPRALIAE
FT                   TVDIVAVLSGRGSARRLAELVRVEGLGPDGDYRIASVISDTDTYIAEKAGEPE"
FT   gene            360011..360343
FT                   /locus_tag="Pden_3195"
FT   CDS_pept        360011..360343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3195"
FT                   /product="Conjugal transfer protein TrbC"
FT                   /note="PFAM: Conjugal transfer protein TrbC; KEGG:
FT                   mes:Meso_0508 conjugal transfer protein TrbC"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3195"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71276"
FT                   /db_xref="GOA:A1B6Y2"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Y2"
FT                   /protein_id="ABL71276.1"
FT                   /translation="MIRHALRIRHHVATAATTLYVSLFMAPAAHAAGSSMPWEAPLQSI
FT                   LDSVEGPVAKIVAVIIIIVTGLTLAFGDTGGGFRRLIQIVFGISIAFAASSFFLSFFSF
FT                   GGGALV"
FT   sig_peptide     360011..360106
FT                   /locus_tag="Pden_3195"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 32"
FT   gene            360343..360624
FT                   /locus_tag="Pden_3196"
FT   CDS_pept        360343..360624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3196"
FT                   /product="conjugal transfer protein TrbB"
FT                   /note="KEGG: mes:Meso_2322 conjugal transfer protein TrbB"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3196"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71277"
FT                   /db_xref="GOA:A1B6Y3"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="InterPro:IPR016704"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Y3"
FT                   /protein_id="ABL71277.1"
FT                   /translation="MSAGFEQLSEVPGFSVPVHRALNEPILLGGAPRSIAILNGTLAGA
FT                   VGLGLQLWLAGILIWAVGHLATVWAAKRDPLFVEVGRRHLRLPGHLAV"
FT   gene            360637..363270
FT                   /locus_tag="Pden_3197"
FT   CDS_pept        360637..363270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3197"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: mes:Meso_2321 ATPas"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3197"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71278"
FT                   /db_xref="GOA:A1B6Y4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Y4"
FT                   /protein_id="ABL71278.1"
FT                   /translation="MMNLAEYRGSASRLADFLPWAALVTPGVVLNKDGSFQRTARFRGP
FT                   DLDSAVAAELVAVAGRLNNAFRRLGSGWAIFVEAQRSEAATYPDSTFPDAASALVDAER
FT                   KADFEQAGSHFVSDYFLTLLWLPPAEEAARAESWLYEGRETSGVNPWELLRGFTDRGDR
FT                   VLALLDGFMPECAWLDDGETLTYLHSTISTNRQRVRVPEVPMHLDALLADQPLTGGLEP
FT                   RLGDAHLRVLTITGFPTATTPGILDELNRIAFPYRWSTRAILIDKPDATRLLTRIRRQW
FT                   FAKRKSIAAILKEVMTSEPSALVDTDAANKAADADLALQELGADVAGMAYVTATVTVWD
FT                   ADPRLADEKLRLVEKIVQGRDFTAMIETVNAVDAWLGSLPGHAYANVRQPPVSTLNLAH
FT                   MIPLSAVWAGEAKDAHFDAPPLFYGKTEGATPFRFSLHVGDVGHTLVVGPTGAGKSVLL
FT                   ALMALQFRRYSRAQVFAFDFGGSIRAAALAMGGDWHDLGGGLSDGDEASVALQPLARIH
FT                   ETAERGWAADWIAAILRREGIAVTPEVKDHLWTALTSLASAPVGERSVTGFAVLLQSNG
FT                   LKQALRPYCIGGPSGRLLDAEAEHLGSAPVQAFEIEGLVGTGAAPAVLSYLFHRIGDRL
FT                   DGRPTLLIIDEGWLALDDEGFSGQLREWLKTLRKKNASVVFATQSLSDIDHSAIASAII
FT                   ESCPTRLLLPNERAIEPQITAIYRRFGLNDRQIEILARATPKRDYYCQSRRGNRLFELG
FT                   LSEIGLALCAASAKSDQARIAAIESEHGREGFLAAWLHDRGVDWAAGLIPDLADLAPEE
FT                   DGMPASKQSNSEAALSDGEMNLADGGFPDPEDGPAGDEIEPGDAEAASIPAEAGPEPNA
FT                   DKEIEP"
FT   gene            363267..364064
FT                   /locus_tag="Pden_3198"
FT   CDS_pept        363267..364064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3198"
FT                   /product="conjugal transfer protein TrbJ"
FT                   /note="KEGG: mes:Meso_3855 conjugal transfer protein TrbJ"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3198"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71279"
FT                   /db_xref="InterPro:IPR014147"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Y5"
FT                   /protein_id="ABL71279.1"
FT                   /translation="MTRNTTAIPHPVRRIASTTALAVALAIPLALAPVLTTPAHAFFGG
FT                   FGRIVYDPTNHAENLLTAARSLEQINNQIASLQNEAQMLINQARDLASLPHSSLQQLQQ
FT                   NVTRTQQLLDEAQNIAFEVQEVDQAFEREYGTPDLSTSEQQLLADARTRWSNTMGGLQD
FT                   AMRVQSGVTNNIEAQRAEMAALVEQSQNADGALQASQAGNQLLALQSQQLSDLTALLAA
FT                   TGRAEALSEAERSAAAEQGRIQRERFLTPGAGYQPGNARMFND"
FT   sig_peptide     363267..363392
FT                   /locus_tag="Pden_3198"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.980 at
FT                   residue 42"
FT   gene            364085..364372
FT                   /locus_tag="Pden_3199"
FT   CDS_pept        364085..364372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_2319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3199"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71280"
FT                   /db_xref="InterPro:IPR027587"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYC4"
FT                   /protein_id="ABL71280.1"
FT                   /translation="MEGKAMVRLIAILFLAIVMTVTLIRMERAGDLPPLPGRQSQSQPE
FT                   DPLREGQRRCQRMGAAAAEDAECLRIWAETRDRFLGRTPAQSAATSSSEE"
FT   gene            364380..365702
FT                   /locus_tag="Pden_3200"
FT   CDS_pept        364380..365702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3200"
FT                   /product="TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /note="PFAM: TrbL/VirB6 plasmid conjugal transfer protein;
FT                   KEGG: mes:Meso_0503 TrbL/VirB6 plasmid conjugal transfer
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3200"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71281"
FT                   /db_xref="GOA:A1B6Y7"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="InterPro:IPR014150"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Y7"
FT                   /protein_id="ABL71281.1"
FT                   /translation="MGGSGVIDNFLAVFTSYIDSGFGLLGGEVAFIATTLIVIDVTLAA
FT                   LFWAWGAEDDILARLVKKTIFVGVFAWLITNWNSLARIVFDSFAGLGLMASGTGFTAAD
FT                   LMRPGRVAQTGLDAGRPLLESISDLMGWVAVFENLIQILCLFFAWALVILAFFILAVQL
FT                   FVTLIEFKLTTLAGFVLIPFGLFGKTAFMAERVLGNVVSSGIKVLVLAVIIGIGSTLFS
FT                   QFTTGFGGVAPTVDDAMAIVLAALSLLGLGIFGPGIATGLVSGGPQLGAGAVAGTGLAV
FT                   GGAALAAGGAAVLGAKGVAATARGGAATAGAASAAYTLNSAGQSGIGGAVSGAAGVGKG
FT                   AGIAAMTPLRRAAASLKASRDAGVKAAFTSTGGSTTQGTLGGPAAGVGGVAPTSGNAPA
FT                   WAQRLRGQSLARGATVTAHAVRASDSHGPGASVSLSESDKP"
FT   gene            365699..366388
FT                   /locus_tag="Pden_3201"
FT   CDS_pept        365699..366388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3201"
FT                   /product="Conjugal transfer protein"
FT                   /note="PFAM: Conjugal transfer protein; KEGG: mes:Meso_0502
FT                   conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3201"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71282"
FT                   /db_xref="GOA:A1B6Y8"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR035658"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Y8"
FT                   /protein_id="ABL71282.1"
FT                   /translation="MNPFRRSTTHYGETPEPETPYQKAAQVWDERIGSARVQARNWRLM
FT                   AFACLFLAAGFAGALVWQSARGTVVPWVVQVDDLGQAQTVAAATADYRPTDPQIAWHLG
FT                   RFIEQVRSIPADPVILRQNWLQAYDWTTDRGAAALNDHARGNDPFSKLGERQISVEVSS
FT                   VIRASPDSFRVAWTEKRYENGQLSTTERWTAILTIGIQTPRTAEALRANPLGIYVNAIS
FT                   WSREMSQ"
FT   gene            366385..367428
FT                   /locus_tag="Pden_3202"
FT   CDS_pept        366385..367428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3202"
FT                   /product="Conjugal transfer protein TrbG/VirB9/CagX"
FT                   /note="PFAM: Conjugal transfer protein TrbG/VirB9/CagX;
FT                   KEGG: mes:Meso_0501 conjugal transfer protein
FT                   TrbG/VirB9/CagX"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3202"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71283"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014142"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Y9"
FT                   /protein_id="ABL71283.1"
FT                   /translation="MTAIRFERLVGDRTGSLSKSAILPVVVLAMTTLAGCATTKTPQFS
FT                   YDDHVPPLPSPPAAVADPAPEPLHVPPDWTPAKGGNAAESPAGQVTNANLAARVEPRRE
FT                   GYYNAIQVYPWSEGALYQIYAAPGQITDIALEPGERLTSTGPIAAGDTARWIIGDTESG
FT                   SGASRRVHVLVKPTRPEISTNLVIATDRRRYMLELRADEETWMPAVSWHYPESASAAAQ
FT                   RRAAPAAPVIPGKAARNHRYGLQVLGASPPWRPVSVFDDGRRVHVVFPPGIAQGEMPPL
FT                   FVIGPDGAPEIVNSRVHGNVLIVDRLFGVAELRLGSGKRQQVVRIIRMEQTRAAIQPTR
FT                   APTKGSS"
FT   gene            367428..368594
FT                   /locus_tag="Pden_3203"
FT   CDS_pept        367428..368594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3203"
FT                   /product="conjugation TrbI family protein"
FT                   /note="PFAM: conjugation TrbI family protein; KEGG:
FT                   mes:Meso_0500 conjugation TrbI-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3203"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71284"
FT                   /db_xref="GOA:A1B6Z0"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Z0"
FT                   /protein_id="ABL71284.1"
FT                   /translation="MSDRDTAAAPLRLRAEPPRVTRLSRKVLAGLGGIAALGIGAALIF
FT                   ALQTRDVERGGEELFSTENRATADGLAELPRDYAGPVLGPALPGDLGKPILNARNRGEP
FT                   VPAPGTPTVTAPAMDAAEQQRLAEEEAARLSGVFFQGGPRSAGGSDMGAGPAGQTPGAL
FT                   GTMGQPGAAATQDRHAAFLGGAADRITVAPDRVEAPASPYLLQAGSVIPAALITGIRSD
FT                   LPGQIIAQVTQPVYDSPTGSILLIPQGTRVIGEYDASVTFGQRRVLLVWNRLIFPDGRS
FT                   LVLERLPGADASGYAGLEDGVDYHWGELIKAAGLSTLLAVGTELTAGDDDDRLVRAIRD
FT                   GAQDTVDQAGQQIVQRQLLVAPTLTIRPGFPVRILVGRDLVFENAGER"
FT   gene            368591..368845
FT                   /locus_tag="Pden_3204"
FT   CDS_pept        368591..368845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3204"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpc:RPC_3531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3204"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71285"
FT                   /db_xref="InterPro:IPR018733"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Z1"
FT                   /protein_id="ABL71285.1"
FT                   /translation="MMTKLKLGPLADDTPVKLAVELPASLHRDLVLYGELLGRIGPGGT
FT                   GAAVPPQKLVVPMLERFLASDRGFAKAQRNVSAGRQLGD"
FT   gene            complement(368847..369791)
FT                   /locus_tag="Pden_3205"
FT   CDS_pept        complement(368847..369791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3205"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: mes:Meso_3862 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3205"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71286"
FT                   /db_xref="GOA:A1B6Z2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Z2"
FT                   /protein_id="ABL71286.1"
FT                   /translation="MTNSHRNRAGAGRKDIVIELRHLRYVIAAVEHGSFSAAAGELGVR
FT                   ESAISRRIRDLEDEIGAALFIRHKRGVTLTDAGKRFLPHARRVFSELDLAIKDVGAAGR
FT                   VEHGVLRIGIFASLASGFLADLLRRYNGDHPGVRCVIVEGVPSDHIAAVRQHCMDVAFL
FT                   TGTPEAAECDVEVFWKERVFVALPKDDDLTVRKRIAWSELRDRHFVVSEAGPGPEIHDY
FT                   LVRHLSELGHHPSVERCPVSRDTLMQLVALGNGLTLTSEATTGVNFPGVIFRPLATEPL
FT                   PFCAVWSPRNDNPALRRLLILARTLSAQASKAQ"
FT   gene            complement(369824..370534)
FT                   /locus_tag="Pden_3206"
FT   CDS_pept        complement(369824..370534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3206"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; Helix-turn-helix, type 11 domain protein; KEGG:
FT                   bxe:Bxe_C0266 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3206"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71287"
FT                   /db_xref="GOA:A1B6Z3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Z3"
FT                   /protein_id="ABL71287.1"
FT                   /translation="MPRSKSEYVAQRLLDRIITDNLASGSYLGTEAELLQQFNVSRPTL
FT                   RESLRILETQGVIELRPGPGGGIMITRPGTDIVAHGLSVYLRVHGIPDTTMHRALIALQ
FT                   PALIAQAAEMGSADDFDALDAVVEKMRLTSDLRELRQELRHFYLLIARATQNQILDIFW
FT                   STLDKLSGGPASTLEGEKITAAGRQRIVALHGEMVSACRAKDPSTASALLNALLSAPSP
FT                   SQTQSRRRQARSEA"
FT   gene            complement(370806..372089)
FT                   /locus_tag="Pden_3207"
FT   CDS_pept        complement(370806..372089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3207"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: rpd:RPD_0611 TRAP
FT                   dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3207"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71288"
FT                   /db_xref="GOA:A1B6Z4"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Z4"
FT                   /protein_id="ABL71288.1"
FT                   /translation="MAATFGLGVLVLLLLIALAVPIGFALGLGGVLSLGMLVPTGTIEA
FT                   LMSKVVRDTSASYVFLTIPMFVLMAEFLSVGRVAEDLFLSCNRVLRKIRGGMAMAVIVA
FT                   GAIHAAVTGSSTASAASLSRASYPAMRRAGYDPGFAVGTAAIAGTLAVMIPPSTAFILY
FT                   SLMTDTSVGKLFIAGIIPGAITAVGYIVTISLVLKYRPHLGPKPGAEVEAAKHRTSGRV
FT                   WPVVLLIAVVVGALYAGIATPTEVAAIGAAGALLVSLSTKRMTRHGFLDAVGTTLRITT
FT                   MIITIIFGAHLFGYFISFSQITTMMLQWIADSGISPTMVMLLVVFVYLLLGMVMDQAAI
FT                   IILTAPISTALMVGLGYDPIWWGVIIIKTAEIGLVSPPLGLVTFVVSATSKVDLRRSFI
FT                   GVLPYLVMEIIILTLLLAFPQLSLVLTG"
FT   sig_peptide     complement(372030..372089)
FT                   /locus_tag="Pden_3207"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.374 at
FT                   residue 20"
FT   gene            complement(372102..372653)
FT                   /locus_tag="Pden_3208"
FT   CDS_pept        complement(372102..372653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3208"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpd:RPD_0610 tripartite ATP-independent
FT                   periplasmic transporter, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3208"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71289"
FT                   /db_xref="GOA:A1B6Z5"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Z5"
FT                   /protein_id="ABL71289.1"
FT                   /translation="MIGTEAGEQNAIYRSVDRVVSVLENICAILAGIILLFMMVIVSLD
FT                   AIFRYLFHAPIAFQYTLTEDYLMVAVVSLALSWGFRTGGFIRITGITNMLPGWMQAFVF
FT                   RLGLVLGFLYVFALAWTSGGAFQKVWTTGEVRIGVIDWPVYLSWIWVPLGCGLLAIRVL
FT                   LTAFAPAAEICADPHAESEI"
FT   gene            complement(372650..373663)
FT                   /locus_tag="Pden_3209"
FT   CDS_pept        complement(372650..373663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3209"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: bja:bll6794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3209"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71290"
FT                   /db_xref="GOA:A1B6Z6"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Z6"
FT                   /protein_id="ABL71290.1"
FT                   /translation="MNFIKWTGLIAATAAGLAGGSAYAESFNVAHGYPPTHPVVAQGIV
FT                   PWMACVEEKTGNAITFIHFPSGQITSHNAAIDSVNSGVTDIAAIITGYVSSQMPLNGIP
FT                   LLPDMGTEAVDMVAAYRKAGDAGAAIAQEFTANKLHPLLFNLQPAYQVMSSGAPADTLA
FT                   KFSGLKARVSAGSPSLMATALGAIPVEMSTSDMYIAMQRGTVDAAFIAMASGKTYGLPE
FT                   LVKSVSTNGSFGSGAAVLSINLDKYNALSDEFKAAFDDCGRQVEVDLALYMDKENVALQ
FT                   TEFAESGITLFEFAPEELEAISSKLSVVADDYIKRLEDRGIAARETFDAYREGLAQ"
FT   sig_peptide     complement(373589..373663)
FT                   /locus_tag="Pden_3209"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            374073..375254
FT                   /locus_tag="Pden_3210"
FT   CDS_pept        374073..375254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3210"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   bbr:BB0636 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3210"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71291"
FT                   /db_xref="GOA:A1B6Z7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Z7"
FT                   /protein_id="ABL71291.1"
FT                   /translation="MKVKGSFLHDEPALRVSFGWDVHGNLIKDMDRAGLSRAVVVCGRS
FT                   LAKSGSELELLREALGPRLAGIHPGARPHSPVPQVIETSRFLRDAGADAVIAVGGGSAI
FT                   VTARAASILLAEGEDVAALATSVTAEGRMISPRLMAPKLPQFVIPTTPTTAIVKAGSAI
FT                   YDEVADKRRALFDPKTRSQAVYVHPALLAPVPKQVFVSAGLNTLCMAVEGLIATKGDPL
FT                   ADAQLTHALRLAADGLAQLNGPEAGQARADLIFAAILCGRATDSTNGGLTTALGHAIGV
FT                   RHHVENGIVNAVVLPSVIEFNADAAASDLHKVERALGLARAGSARESALAIGRHLVALF
FT                   DALGVPRTLGELGVPAEARPELAQLVTEDWFLRGNPRPVRDATEVERVMTTLW"
FT   gene            375275..376708
FT                   /locus_tag="Pden_3211"
FT   CDS_pept        375275..376708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3211"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: rme:Rmet_1577
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3211"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71292"
FT                   /db_xref="GOA:A1B6Z8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Z8"
FT                   /protein_id="ABL71292.1"
FT                   /translation="MTAEEAEVKKTHNFVGGKWIPAQATGEIEVINPTTEEVFAVVPEG
FT                   TAGDVAPAVEAAATAFPGWSETTIEQRADMLRKFARLTEARAEELTFTGVSEVGQPAAA
FT                   ARVFQTQGAVGELDLMAEILPEMDWNIPEGKAVVRRVAGGVVGAITAWNGPLRSVISKA
FT                   GAAMAAGCTVVVKPSEVAPMTAYIFAEICEEAGLPPGVFNLVSGTGPVVGEAIVAHPAV
FT                   DIVSLTGSVRAGRRVMEVAAQDIKRVHLELGGKSANILFEDADIDHAISVGIEDAFRNA
FT                   GQVCGGLTRILVPRTLLAKVEEAAKAKAESFVIGDPFDPATTLGPVATAAARERIRGYI
FT                   NLGQRQGARMITGGAEPPMGLNRGFFVKPTVFSGDNSMRIAQEEIFGPVVVIIPFDGED
FT                   DAVRIANDSAYGLAGGLWCRDVERARAIARRIRTGRVRINGTPLEKRAPHGGFKHSGIG
FT                   REWGRYGIEEFLEYQSIIG"
FT   gene            376719..377762
FT                   /locus_tag="Pden_3212"
FT   CDS_pept        376719..377762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3212"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sma:SAV3314 putative NADP-dependent alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3212"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71293"
FT                   /db_xref="GOA:A1B6Z9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6Z9"
FT                   /protein_id="ABL71293.1"
FT                   /translation="MTLVKARCTCAAHAPFEPMIIERRELGPHDVMIDIAFAGICHTDI
FT                   HYAYDEFGRTTYPLVPGHEIAGVVSGIGSDVSRYQVGDRVGVGVMVDSCRNCPACKAGQ
FT                   EQYCTGKRIMTYNSVGRDGKPTYGGYSQKIVVDENYVVRIPESIPLDRAAPMFCAGVTV
FT                   YSPLRHWGAGPGKRVAILGFGGLGHLGVQIAHAMGAEVIVLDIAENKRDDAMRLGANEF
FT                   RLATDPRTFRDLAGRIDLIISTVPVDIDLDEYAGLLALDGTFVNTGVPAKPLSIDAINL
FT                   LNNRRSVAGTRSGGIAETQEMMDFCALHGIGAEVEIISADQIDEAYARVLRGDVKFRFV
FT                   IDTNTLQ"
FT   gene            377773..378576
FT                   /locus_tag="Pden_3213"
FT   CDS_pept        377773..378576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3213"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bxe:Bxe_C0603 putative enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3213"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71294"
FT                   /db_xref="GOA:A1B700"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1B700"
FT                   /protein_id="ABL71294.1"
FT                   /translation="MAQAKILTEREGAVLRVTLNDPATRNSLTPELVAGLHRALVAADE
FT                   DQTVSCVVLTGAGKGFCAGGNIKDMRDGNDPMFRGTPHEMQEGYRNGIQALPRLFNRLD
FT                   VPVIAAVNGSAIGAGCDLACMCDIRVGASDTKFAESFMRVGLVSGDGGAWYLPRVVGLP
FT                   RALEMALTCATLDAQEALAFGLVTHVVEPGALLDKAMDLAHAIAAHPPRSIRLNKRLLK
FT                   RSNEIDLEAALELAASYQAIVQNTADQKEAVSALLEKRAPAYVGR"
FT   gene            378583..378828
FT                   /locus_tag="Pden_3214"
FT   CDS_pept        378583..378828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3214"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71295"
FT                   /db_xref="UniProtKB/TrEMBL:A1B701"
FT                   /protein_id="ABL71295.1"
FT                   /translation="MGGGTMSHHHKEPGEGCGGADDFDCGWSMTSLLSRLALREVRPSA
FT                   TIVDFPDLSGRAVGLSRRRQQPRTADPRSQSAAGNT"
FT   gene            complement(378959..379333)
FT                   /locus_tag="Pden_3215"
FT   CDS_pept        complement(378959..379333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3215"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /EC_number="4.1.1.44"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   sai:Saci_1814 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3215"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71296"
FT                   /db_xref="GOA:A1B702"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A1B702"
FT                   /protein_id="ABL71296.1"
FT                   /translation="MDRIEAGRQVLRELMGEAFLEARDATRNDFNAAVQDYADDVCFGT
FT                   VWSRPGIDRKTRSILNIAMLTALGRPNQLRSHIEGAINNGCTKDELREILLHTAVYAGL
FT                   PAAVDAFRVAEEILRKKEML"
FT   gene            complement(379406..380335)
FT                   /locus_tag="Pden_3216"
FT   CDS_pept        complement(379406..380335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3216"
FT                   /product="tartronate semialdehyde reductase"
FT                   /EC_number="1.1.1.60"
FT                   /note="PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding; KEGG:
FT                   dar:Daro_3339 6-phosphogluconate dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3216"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71297"
FT                   /db_xref="GOA:A1B703"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1B703"
FT                   /protein_id="ABL71297.1"
FT                   /translation="MKVGFIGLGRMGRGMALNLQKAGHDMVVNDLSVDSAQEFLDAGAS
FT                   WAGTPRELAQQCGIVFTSLPTPADVKRVGLGPDGLVEGLAPDSVWVDLSTNSVDVVREL
FT                   SGFLAEKGAYFIDAPVSGGPAGAASRKLAIWCGGDEAVYHRCKPFLDAMADQPRYIGAI
FT                   GGGTIAKLVNNMASTAIISVLAEVLTMGVKAGLEPGPLWEAIRTGAAGRMRMYDNIGRR
FT                   FMQAKYDPASFALRLVHKDASLALQVGRDFGVPMRLCGLVESDIREALNRGWGERDSQS
FT                   YLALQQERAGVEPFRLSPEEVDRILADL"
FT   gene            complement(380455..380880)
FT                   /locus_tag="Pden_3217"
FT   CDS_pept        complement(380455..380880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3217"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: sme:SMc01911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3217"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71298"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1B704"
FT                   /protein_id="ABL71298.1"
FT                   /translation="MRITKAGTQPSQPAPAEYFTGTVRVDPVFATDAPARGKGANVTFE
FT                   PGARTHWHRHPLGQTLIVIQGKGLVQSWGGPVETVTAGDCIWFAPDEKHWHSAAPDTAM
FT                   SHLAIAGVLDGNSVEWLEPVGDDIYFATKRKQYKSSI"
FT   gene            complement(380901..381794)
FT                   /locus_tag="Pden_3218"
FT   CDS_pept        complement(380901..381794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3218"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bja:bll0351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3218"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71299"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1B705"
FT                   /protein_id="ABL71299.1"
FT                   /translation="MEAKVISLPETAFLDSAAIPRDDDVYQVWAVCYGSGQNQRVHDNF
FT                   IRRDMHDGPMPLDYFLWVVRNANRTILVDTGMRPEASVQRGRPIAFDPVEGLERIGIAA
FT                   DSISDIVITHLHWDHAGNIHRFANARLHLQETEIAFATGRCMCDALHRYPFDVEDVVTV
FT                   VRKTYADRVTFHCGDGDFLPGTSLHIFPGHSPGVQGVRVNTVRGPILLASDAAHYFANV
FT                   LHRKPFIVTVDTRDTLASYTKLMKVAGGMDRLVPGHDPKIRRYYPACIVNGVELIALHE
FT                   TPDPIDLAELGRFDDF"
FT   gene            complement(381847..382848)
FT                   /locus_tag="Pden_3219"
FT   CDS_pept        complement(381847..382848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3219"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: bja:bll6794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3219"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71300"
FT                   /db_xref="GOA:A1B706"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A1B706"
FT                   /protein_id="ABL71300.1"
FT                   /translation="MKTVAAVVATLLGTASFAHAETLVFAHGFQPAHVVFAHGVEPWME
FT                   CVAQKGEGRVTFTHFPGGQISTHPAAIDSLNSGVAQVSAVILSYVSEKMPLNGVTLLPD
FT                   MGNSSVEMVTAYRKALDEGGPLLEEYHQNQLQPILVNLLPPYQFLSGVGVVDTVEKFRN
FT                   LKASIGGGSQLMMAESMGTSPVYITAADMYVAMQRKTVDGTFLTLASAKPYSLTEVMNA
FT                   VSANGSFGSGASVISMDKATYDGLAPESRELLDDCGREAEMALARHGDAENERLKTELA
FT                   AMGIEVYEFSPETLTEISALMADVADHYVARIEQLGRPGSEALQSYRAALGR"
FT   sig_peptide     complement(382786..382848)
FT                   /locus_tag="Pden_3219"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 21"
FT   gene            complement(382965..383393)
FT                   /locus_tag="Pden_3220"
FT   CDS_pept        complement(382965..383393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3220"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   rha:RHA1_ro00319 possible thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3220"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71301"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1B707"
FT                   /protein_id="ABL71301.1"
FT                   /translation="MTDPTSRDTLEQNWQPIARPGFNELIGPIEFRDDPDGIRFRFLAE
FT                   AKHRNSRGVVHGGMLMSFADTALGTTIRKGRASRVQATVQLELHFVRPAPMDGFIEMHC
FT                   RIIRETRNLAFADGDILADGEIVAMARGVWKVLVSKSD"
FT   gene            complement(383452..384405)
FT                   /locus_tag="Pden_3221"
FT   CDS_pept        complement(383452..384405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3221"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   bbr:BB3965 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3221"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71302"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1B708"
FT                   /protein_id="ABL71302.1"
FT                   /translation="MRRFKKILATAVLSVLPIAAMSQGTYPERPITMIVPFAAGNSADI
FT                   LARVLADHVGRQLNTSIVIENRPGAESILGATTAARAQADGYTIMLASTSALAAAPALN
FT                   SNLPYDPVTDFAPITQISLQPYVIVVRPDHPAQDIGQLIQMAKDDPGRITFASSNTTTR
FT                   VASELFRSMAEIELTNIPYTGTDQAFLDVRNGQVTMMFAGSTSALPQIAQGTLRPLAVS
FT                   SADRWEELPDVPTLGEVVPGYEFSAWHALVAPAAAPDEVISVLNAAFHAAMNDPEIAAQ
FT                   VDVALFPTTPDELSATIQRDIDVWREIVEEAGLPVN"
FT   sig_peptide     complement(384337..384405)
FT                   /locus_tag="Pden_3221"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 23"
FT   gene            complement(384445..385959)
FT                   /locus_tag="Pden_3222"
FT   CDS_pept        complement(384445..385959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3222"
FT                   /product="protein of unknown function DUF112,
FT                   transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112,
FT                   transmembrane; KEGG: mes:Meso_2918 protein of unknown
FT                   function DUF112, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3222"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71303"
FT                   /db_xref="GOA:A1B709"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:A1B709"
FT                   /protein_id="ABL71303.1"
FT                   /translation="MENDLISSISIGLATALTWSNLGFCLGGVLLGMFVGVLPGIGAMT
FT                   AISMLMPLVYHLDPTSALIMLGGIWYGTAYGGSIASILLNLPGTPSTAVTCLDGYPMAR
FT                   QGRAGIALFMTTVASFFGASVGIVLMMLFSPVIVNVAFNFTSAEYFSLMVLGLIAASTI
FT                   SAESPVKGLAMVGIGILLGLVGMDLYASVPRFTLGFYELLEGISLVALALGIFGVAEII
FT                   ASARIDQSGTLMSKVTFRSMIPTQDDRRRSLMPMVRGSGVGAFFGILPGIGPSIASFLA
FT                   YAWERKVADEPQRFGHGAIEGIIAPEAANNAADQAAFIPTMTLGIPGSPTMALIIGVLI
FT                   IHGITPGPTLVTERPDLFWGLIMSFWIGNILLLIINIPLIGIWVRLLQVPYGYLYPAVV
FT                   MFMCIGAFTIHNNPFDVFSIMVFGLVGYGMRVLAFPVAPLILGFVLGPLMEEHFRRAMT
FT                   ISFGDPMVFLQRPVSAGILAITALFLLFSLVSFIRTKAAGTRARGG"
FT   gene            complement(385965..386414)
FT                   /locus_tag="Pden_3223"
FT   CDS_pept        complement(385965..386414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3223"
FT                   /product="protein of unknown function DUF1468"
FT                   /note="PFAM: protein of unknown function DUF1468; KEGG:
FT                   bpa:BPP0373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3223"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71304"
FT                   /db_xref="GOA:A1B710"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:A1B710"
FT                   /protein_id="ABL71304.1"
FT                   /translation="MQNRDFQDIAGGAILLMIGGYAALHSLAELSTGTVGRMGPGMFPT
FT                   IIGVFIAVMGLLIMVPAFFRSGQPISFDLRSTAMILLSILVFGLMIRPFGLVPAVIAQT
FT                   VVASLADGKRSWREIAMLCLLLCTLATLIFKLGFGLQVPIANWPW"
FT   gene            complement(386490..388244)
FT                   /locus_tag="Pden_3224"
FT   CDS_pept        complement(386490..388244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3224"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   abo:ABO_2098 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3224"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71305"
FT                   /db_xref="GOA:A1B711"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1B711"
FT                   /protein_id="ABL71305.1"
FT                   /translation="MATYTPPLEEYGFLLKEVFDFDQTMAALPAHDGTDAELALSVLEE
FT                   AGKFCTGILEPLNRSGDEEGCRLENGEVVTPRGTKEAYCAFVEAGWGALSGELEFGGQG
FT                   LPRVVQILLDEMLSSTHLSFGLFTGLTRGAAEALASHASDELRRTYLPRLISSEWSGVM
FT                   ALTEASAGTDLGLLTSRAEPVGDGSFRITGTKIFISSGDHDFGGNVIHLVLARLPDAPK
FT                   GVKGISLFLVPKFLVNPDGTLGERNAMAVGSLEHKMGIHAQPTCVMNYDGAIGWLVGEE
FT                   GRGLNAMFTMMNAERLFVGIQGLGISEIANQKAIAYAHDRKQGRSLDGTRSPVPIIEHP
FT                   DVRKLLLTGRSLTDASRGLAVWTAMQMDIAARHPDAQVRADAGDLVALLTPVIKAAFTD
FT                   FGFETAVASQQVLGGHGYIREWGMEQFVRDVRIAQIYEGTNGVQAMDLVTRKVTAKGGT
FT                   VAARFFAAIRADLSTPAGNSHSRLIREATEAALARLERVTAEVLAGQGNPATAGAAATD
FT                   YLRLFALTACGWMWARMVGAADPEVSETQRRRVGLANYFAARVLPQTIGLENMLLAGPD
FT                   TLMAVDLS"
FT   gene            complement(388262..390559)
FT                   /locus_tag="Pden_3225"
FT   CDS_pept        complement(388262..390559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3225"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD-binding; KEGG:
FT                   rru:Rru_A1309 acetoacetyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3225"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71306"
FT                   /db_xref="GOA:A1B712"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1B712"
FT                   /protein_id="ABL71306.1"
FT                   /translation="MITAIEKVAVLGAGVMGAGIAAHLANAGVRVVLLDVDKAAADAGI
FT                   RRARDEGGFMDPAFAARIATGSTVRDLSLLADADWIVEALPERLALKQSLYRQLQGIRK
FT                   PGSILSSNTSTIPLAALVGGMAGDFAADFLITHFFNPPRRMRLLELVAGPATRPEIVAL
FT                   ITDFCDRRLGKDVVSCRDTPGFIANRIGNYWMITAQNEAIRLGLDIEDADAIIGRPFGI
FT                   PATGIFGLMDLVGIDLVPTVIRSLQDALPPEDAINAYEAEPPIVGRLIAEGRTGRKAGA
FT                   GYFRRSAGRVQEVMDLKTGDYRAKRDGIPACVAETHGDPRKLMEHDSTGGEYALRVMQG
FT                   TLAYAASLAPKIADGPDAVDDAMRGGYGWSIGPFEMIDRLGPDWLAGVIAASGETLPPY
FT                   LALAAERGGFHSIRDRIRTALLPDGGTAPRRRTEGALSLGELTQSGKPFADNGCAALWD
FT                   IGEGVACLEIRTKMNTLSPPLLEAIDKALDAVGQNFRALVIGSDAPRFSAGADLSALLR
FT                   AVEAGGPDELLRTIHAGQRVFAAIKRAPFPVVGAATGIALGGGCELLLHCDAIQAHADL
FT                   QMGLVETKVGLVPGWGGCKELLLRTTAAPSGGRGPAAIAASVFDVIANARVSSSAFDAR
FT                   KLGYLRPSDNITMNLDRLLADARQCALELADGYAAPQAETLALAGPSGLSGLEAQIDSG
FT                   VLSGRMTAHDRQIGLALVGILTGGALADPIRPLSEDELLALEAEAFIELFYTPQTRDRI
FT                   DHMLATGKPLRN"
FT   sig_peptide     complement(390476..390559)
FT                   /locus_tag="Pden_3225"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.928 at
FT                   residue 28"
FT   gene            complement(390556..391677)
FT                   /locus_tag="Pden_3226"
FT   CDS_pept        complement(390556..391677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3226"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: rru:Rru_A1310 acetyl-CoA C-acyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferases; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3226"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71307"
FT                   /db_xref="GOA:A1B713"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1B713"
FT                   /protein_id="ABL71307.1"
FT                   /translation="MQGAYIVDYIRTPFTPARKGALAATRPDELAGGLLSTMVERSGFP
FT                   AEEIEDIILGCAFPEGEQGLNIARCAALHAGLPQTIAGSTVNRWCGSSMQAIQMAAGAI
FT                   AMGAGDAFLAGGVESMTRVPMMGFNPLPNPAWPSDRRMSLLNMGLTAEILADRYGITRA
FT                   EQDDYAAKSQSKALAAQSEGRLSDEIASSADTDKDGCPRQTSVEKLAGLQPVFRADGSV
FT                   TAGNSSPLTDGASLTLICSENFVKRHSLVPLARIVGYAVSGCAPEIMGIGPVEATRKAL
FT                   ARSAISAADLDVIEMNEAFAAQVLACCRELDIDPARLNPDGGAIALGHPLGATGARLAG
FT                   KAARLLVRGGGRYGLATQCIGGGQGIAMVLEAA"
FT   gene            complement(391797..393029)
FT                   /locus_tag="Pden_3227"
FT   CDS_pept        complement(391797..393029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3227"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: rha:RHA1_ro00763 probable formyl-CoA
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3227"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71308"
FT                   /db_xref="GOA:A1B714"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1B714"
FT                   /protein_id="ABL71308.1"
FT                   /translation="MTTTLSPSDAGAVVGEAPLSGVTVIDLSHVYNGPYATFLMALAGA
FT                   EVIKVEPHTGEHLRSRGDMGGAALPFAMLNSNKKPITLDLKSEQGKEILRKLVKKADIL
FT                   VENFAPGVMERLGLGSAALRQINPRLIYGSSSGYGKDGPYRNYPAMDLVMQAMSGVINS
FT                   TGHPDHPPVKSGAALCDFFAGIHLYSAIMTALFARERTGRGQTVEVSMQDATYCSLASN
FT                   YGMLNARGDAAPERTGNRHGGLGVSPYNAYPTKDGYVVVNSPGDRHFNAILDVIGRPEL
FT                   KEDPRLNSRGARVQNFQLVDELLETWTRDRTKNEVADQMLKAGVPCAPVRNLREVMNDE
FT                   NMHARGSLQWVDHPELGRVVLPHTPLNFEGVPRRPLEPSLPLGASNEEVIVGMLGYSKE
FT                   EFDRLVQQKIV"
FT   gene            complement(393111..394610)
FT                   /locus_tag="Pden_3228"
FT   CDS_pept        complement(393111..394610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3228"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG:
FT                   bur:Bcep18194_C7342 aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3228"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71309"
FT                   /db_xref="GOA:A1B715"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1B715"
FT                   /protein_id="ABL71309.1"
FT                   /translation="MNANLNSIRAKLEIRPGRLFIGGQWLDWDGARFDQINPNDNQIIG
FT                   TFAEAGQRGVDLAVAAARHAFDDGPWPTLPAQDRKRILQPIIERIYELEAELATLQTLD
FT                   NGMPYSFSRHSRASGKSCADILDHHAGWCDKITGETFPRHSSSSNLQYLTYRDPVGVVG
FT                   AILAWNVPLNMFAIKVGPALASGCTVVLKPSEYTNLAVTRLVEIFAESDLPPGVVNFVT
FT                   GGAETGAALAGHPGVDKVTFTGSAAVGERIVSVSGANMKRLSLELGGKSAGIVFPEARS
FT                   VASAATTMMGLCSTFLSGQVCTTPSRALVHRSIFDEFVHHASEQVKQVRFGDPFDPATT
FT                   SAPIISRAQVERIRNLIDSGIEQGARLAFGGEECDDIPGGGNWIAPALFLDVDPGMRIA
FT                   REEFFGPVLCAIPFDSEEEAIRLANDSEYGLAGCIFTTDIAQGMRVARSIRTGAIGING
FT                   YASVANAPMGGVKRSGLGREGGWASIDAFTEIKTVAINLDG"
FT   gene            394918..396066
FT                   /locus_tag="Pden_3229"
FT   CDS_pept        394918..396066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3229"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL2833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3229"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71310"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A1B716"
FT                   /protein_id="ABL71310.1"
FT                   /translation="MTAATEITQELAKATLSEEMLQNMRNLIGTDLRTDHCVNNEYATR
FT                   HAITRFCEGIGDDNPLWTDRDYAGESPYGGLIAPPSFIFACLASIQVGWPGLGGFHAET
FT                   KLDFYKPIREGDRILAKVTFDGFDGPKDSAFGGRSIKDYLRQEYFNQDDELVARFICSR
FT                   MRFERGEMQKRRESRKIELPHPWTPEQLEQIENDILSEEIRGSVPRYWEDVNVGDEMGS
FT                   LTKGPIGLTDEVAFVASGAAPIPRICAHKVALKRYRKHPKWAFRDPSTHALEPVYSVHY
FT                   NDYAARLQGAQAAYDVGIQRTCWQIHSLTNWMGDAGRLKVANSQYRAHVYLSDVLRLGG
FT                   RVTAKEIDADGDHVVRIETWAMNQRDQNCMPGEAVVALPTKG"
FT   gene            396188..397768
FT                   /locus_tag="Pden_3230"
FT   CDS_pept        396188..397768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3230"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmc:Mmcs_3946 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3230"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71311"
FT                   /db_xref="GOA:A1B717"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1B717"
FT                   /protein_id="ABL71311.1"
FT                   /translation="MTPESRQFWSKSIVTEAIGGIPYRIYADRPHRISELFSFASFWGD
FT                   RPYVIQGDRVLTFAGLRDASGSKALQLQRSGIAAGDRVMILGWNSPDWVVNFWAVVRLG
FT                   AVPVLGNAWWSPEEIEYAIYFTEPKLVLADDRCAGRVSQSLLTEAWGGEAGTGEAPDVT
FT                   VPDDENAPAVIIFTSGTEGRAKAVVLAHRSFIASMMMMMHITRRLPYDVSAPKSEICLH
FT                   TGPLFHIGGPHAMMRGVVSGNTLVFPSGRFSTSEALELIEKHRIERWTAVPTMLTRLLD
FT                   DEGIATRDLGSLRSIGMGGAPVHRELLDRVRKQLPGVDARVAIGYGLSENAGQATAASA
FT                   ENALRKPGSSGRPLPLVEISFKEREGLPDGEILLRSPTQMLGYFGNPNSPIDADGWLHT
FT                   GDLGKLDDEGLLWITGRCKDIIIRGGENIAPAAVERALTGISAVAEAAVLGIPHPDLGE
FT                   EVAAFVVIREDSEATAETLSAELRRTLASFAVPSRWHIQYEPLPTNQTGKVERKALLEL
FT                   LREGPQPEE"
FT   gene            397808..398662
FT                   /locus_tag="Pden_3231"
FT   CDS_pept        397808..398662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3231"
FT                   /product="putative transcriptional regulator, IclR family"
FT                   /note="KEGG: rha:RHA1_ro03060 probable transciptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3231"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71312"
FT                   /db_xref="GOA:A1B718"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B718"
FT                   /protein_id="ABL71312.1"
FT                   /translation="MIHLYDLYDREKGSYSRIAKRENRMKAPAAASDERTHNHHRTIDR
FT                   VVRILEEVVHRPGTTFGELARILEMPKSSLHGFVKGLLANGWLHEQQDGSQYRLFLGPG
FT                   VYSLILTSGQIRAGMVSNADLHELQEKVRAEVYLGVLVGDQLVYVAEAGSDPVAGFHPR
FT                   HIIRRELLQSAGGKALLASKAEGWLTDFLRRRPDAESDLISEFLSEVRDIRNSRVAKNY
FT                   TQNRTRYALASVLCNSAGKSVASVTVVGSAEDLLPRQEEIAAELLKHIDIWQRRDVQPR
FT                   EAI"
FT   gene            complement(398991..399803)
FT                   /locus_tag="Pden_3232"
FT   CDS_pept        complement(398991..399803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3232"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: mag:amb3346 signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3232"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71313"
FT                   /db_xref="GOA:A1B719"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1B719"
FT                   /protein_id="ABL71313.1"
FT                   /translation="MTAPITCPAARICPCMNRGIHTWSLRQTRSGSNLPPLPEEGTDDI
FT                   RQTTAAFNRMQTRLFRFIEDRTRMLAAIGHDLRTPLTSLRLRAEFVTDPEIQQRMLATI
FT                   DEIQAMTEATIAFARGEATIEETRTVDLNALIGSLCDDLAEMDQPVAYAEGKKMIYRCR
FT                   PDSLRRALRNIIENALRYGGEARVRLYRGSHSVDITVEDNGPGIPEDMHEQVFAPFCRI
FT                   ETSRNRETGGVGLGLAIARTIIRHHGGDIVFSNDNPCFRVTISLPTIL"
FT   gene            complement(400008..400685)
FT                   /locus_tag="Pden_3233"
FT   CDS_pept        complement(400008..400685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3233"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: nha:Nham_3955 transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3233"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71314"
FT                   /db_xref="GOA:A1B720"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1B720"
FT                   /protein_id="ABL71314.1"
FT                   /translation="MKEQVAGLYAQHLAEQTQLINALRGHLAEHGLVVPQGPAHLKSLA
FT                   KALDATDVAIPQLVRDIGRIYLEQIEQLNAKIADLEKTPRREAQFGEEIRRLQTMPGIG
FT                   PITAMAVEVFAPPMQTFKRGRDFAAWLGLVPVQHSTGGKQRLGRTSKMGQRDIRRLLII
FT                   GAMAVIRWASRRGARLGSWLSRMMDRKPLMLVAVALANKMARAIWAMQTKREDYRDPGL
FT                   AAA"
FT   gene            complement(400725..401084)
FT                   /locus_tag="Pden_3234"
FT   CDS_pept        complement(400725..401084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yps:YPTB1994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3234"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71315"
FT                   /db_xref="UniProtKB/TrEMBL:A1B721"
FT                   /protein_id="ABL71315.1"
FT                   /translation="MRPGGALQIITIRRKFCDKGQLGISGIESVWSNPLSALQRSNQMN
FT                   QRIIFKTSLMTAMMTLAASGVMAADYQQNPFTLTYEGAITENKPEQVNIHPVTYDLNGL
FT                   EISANVYTPAGYDPE"
FT   gene            401247..402308
FT                   /locus_tag="Pden_3235"
FT   CDS_pept        401247..402308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3235"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_3912 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3235"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71316"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1B722"
FT                   /protein_id="ABL71316.1"
FT                   /translation="MNFLGACMVSTGILAAASASAQQAEPLVISEQGSFFAGGSVVTTP
FT                   GTYNNNVPTAEGQSIHGDHLYTFYQIPQDAKSTPIVMLHGHMQSARSWETTPDGREGFQ
FT                   TLFLRKGYPVYLVDQPRRGRAGNSLEAATIEPTPLDQLFFDQFRLGIWPDYFEGVQVDQ
FT                   SPETLEQFLRWITPNTGPYDPNVVADAMSALVDRTGPAILFTHSQGGGPGWLTAIRNED
FT                   IRAIVSYEPGSGFVFPEGEVPETMPSAGGPLAAEAVPLEDFQKLTRFPILIYYGDNFPT
FT                   EPTERRGEDIWRVRLDMAKLWVEAVNRHGGDVTLVHLPEIGITGNTHFPFSDLNNVEIA
FT                   DHTAQFLAEKGLD"
FT   sig_peptide     401247..401312
FT                   /locus_tag="Pden_3235"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.574 at
FT                   residue 22"
FT   gene            402410..403183
FT                   /locus_tag="Pden_3236"
FT   CDS_pept        402410..403183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3236"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein;
FT                   KEGG: mes:Meso_3897 NmrA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3236"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71317"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1B723"
FT                   /protein_id="ABL71317.1"
FT                   /translation="MSKDSGVLLVVGATGSIGQRVVTAGLAHGYTVRALLRDASRAQDF
FT                   PANVQTVVGDMTRPETLAAAVDGVGAIVFTHGSYGNPAAAEAVDYGAVRNVLAALGNRT
FT                   ARIALMSTIGATDRRGSHDWKRRGERLVRASGFPYTIVRPAWFDHNRPDQLKLLMLQGD
FT                   KDLAGNPSDGVIARRQIAEVLVRSLSSEAALRKTFELHAETGPEEEDFDMVFAPLAADP
FT                   ADALDGAKDKANMPLADEPAQIRAELEAVRGRAAG"
FT   gene            complement(403185..404078)
FT                   /locus_tag="Pden_3237"
FT   CDS_pept        complement(403185..404078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3237"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: mes:Meso_3905 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3237"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71318"
FT                   /db_xref="GOA:A1B724"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B724"
FT                   /protein_id="ABL71318.1"
FT                   /translation="MSNENFNALATFATVARERSFTKAAAKLGISQSALSQSIRNLEER
FT                   LGIRLLTRTTRSVSPTEAGERLLTTISPKFDEIETALADLSAMRDKPAGTIRITTGEHP
FT                   AVSILQPALATFLPEYPDIKVELIVDYGLTDIVAQGYDAGVRLGEQLAKDMVAVRIGPE
FT                   MRMAVVASPTYFEHRPIPQTAEDLIAHNCISSRLPTYGGIFQWGLEKDGHEVKVRSEGQ
FT                   LVLNTLGLRVACALDGLGIAYLPEDQALPYIAEGRLIRVLEDWCPRFPGYHLYYPSRKH
FT                   PSPAFALLLDRLRYRE"
FT   gene            404224..404697
FT                   /locus_tag="Pden_3238"
FT   CDS_pept        404224..404697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_3908 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3238"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71319"
FT                   /db_xref="InterPro:IPR032033"
FT                   /db_xref="UniProtKB/TrEMBL:A1B725"
FT                   /protein_id="ABL71319.1"
FT                   /translation="MTFSLRRLALVAALGVTPFAAWWAAAEETRVTFPDLDALIHYTTV
FT                   TRGNVVEHMLTTQEAIDAVQAGQPIPAGTHVVLVDYRDGSDEVYRYLVMQKGEGWGDDF
FT                   DERRRTGDWQFQFYWGDRSINMDENTARCQRCHQSRASSDYMYTYNDLRRFGQ"
FT   sig_peptide     404224..404304
FT                   /locus_tag="Pden_3238"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.599 at
FT                   residue 27"
FT   gene            404744..405418
FT                   /locus_tag="Pden_3239"
FT   CDS_pept        404744..405418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3239"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_3907 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3239"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71320"
FT                   /db_xref="GOA:A1B726"
FT                   /db_xref="InterPro:IPR025517"
FT                   /db_xref="UniProtKB/TrEMBL:A1B726"
FT                   /protein_id="ABL71320.1"
FT                   /translation="MTIRIRILLDFLAVGLFVAGLAYWWQDNLTHEVIGTIFFALLIAH
FT                   NVFNRRWYGTVKKGRYDPPRTLNTIVIAGMAISMLILLGTSILISQDVFAALALDGAFA
FT                   VRAAHMFVAYWALVFLAVHLGTRWQMVMNVTRQALGIKGTSPLRTWTLRAATAIVAVKG
FT                   VLATLEMGLGTKLRFEYALDMWDFNESTLGFFANYLSIIGLYAALTCYGLTFLRERKRR
FT                   KA"
FT   gene            405618..406619
FT                   /locus_tag="Pden_3240"
FT   CDS_pept        405618..406619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3240"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71321"
FT                   /db_xref="GOA:A1B727"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1B727"
FT                   /protein_id="ABL71321.1"
FT                   /translation="MRRTFCLIPFLLALAPLAAAEERPAGEVAMIAEQSVEVLGEHLTA
FT                   DGRLADILDNPAFAGFAERILPWAGRRYDPAMPLGQMASLLPYHSAVDTGTVVAALNRM
FT                   IDDAGAGQTVFYDIYSEAERRADPAKAATGLFFYRGRPGAPFAVIAPGGGFSYVGSVHE
FT                   GFPYAEAISDLGLNAFVLTYRAGQGGQVATEDLAAAITWIFRNAEELGVGTDGYSLWGS
FT                   SAGARMAAYIGSHGPAAFGGANLPKPAAVVMAYTSHSDLAETEPPTFVVVGERDGIAPP
FT                   GNMERRIAALRRIGTPVEYHLFPNVGHGFGAGTGTSAEGWIAEAVRFWRQQL"
FT   sig_peptide     405618..405680
FT                   /locus_tag="Pden_3240"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.965 at
FT                   residue 21"
FT   gene            406649..407218
FT                   /locus_tag="Pden_3241"
FT   CDS_pept        406649..407218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3241"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /note="KEGG: mes:Meso_3899 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3241"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71322"
FT                   /db_xref="GOA:A1B728"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A1B728"
FT                   /protein_id="ABL71322.1"
FT                   /translation="MDRIRRAMLRFIPIWAVGLLAALSVGAAAAYEAGPGNLVVYFSRS
FT                   GNTRVIAGQIGRAMDAQVFEIIPATPYPEDYEETVAQATRERESGYEPPLESSVENIAD
FT                   YDTIWLGFPIWGGSVPPVIRSFLSGHDLSGKTLIPFITHGGYGTGNSLAVVAEHAPQAR
FT                   LVEPFVLEADQERRTLERVTDWLGQR"
FT   sig_peptide     406649..406741
FT                   /locus_tag="Pden_3241"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.756 at
FT                   residue 31"
FT   gene            407264..408247
FT                   /locus_tag="Pden_3242"
FT   CDS_pept        407264..408247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3242"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bur:Bcep18194_B2855
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3242"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71323"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A1B729"
FT                   /protein_id="ABL71323.1"
FT                   /translation="MKTRRLGSSGLEVSALGLGCMGLSYGYGQATGHGDAIRLIRTAHA
FT                   RGVTFFDTAEAYGPGLNEEIIGEALQPVREHVVIATKFGFRDGVPANGLDSRPERIRHV
FT                   ADAALKRLRTDHIDIFYQHRVDPNVPIEDVAGTVRDLIHEGKVRHFGLCEAGADTIRRA
FT                   QAVQPLAALQSEYSMWWREPETEILPLLDELGIGFVPFAPLGKGFLTGKIDQNATFAKD
FT                   DFRASVPRFSPEALKANQALVDVIASIASDKNVTPAQIALAWLLGQRPYIVPIPGTTKL
FT                   NRLDENIGAATVALSSDEMALIGQSLDAIAVRGDRYPASHQQFVNR"
FT   gene            408296..409462
FT                   /locus_tag="Pden_3243"
FT   CDS_pept        408296..409462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3243"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: mes:Meso_3904
FT                   twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3243"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71324"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A1B730"
FT                   /protein_id="ABL71324.1"
FT                   /translation="MTNEQKLKIGRRGFLGAAGGLAAAPLLVSTGSGVSAQEAAQGTGI
FT                   YATAPSLSGRRMLGTLEVSSIGLGVQNMHRTYQTTIPSRPEMINIIRTAHDRGVTFFDT
FT                   AEAYGPHECERILGEAVEPFRDEVVITSKFGWNIDLETGERLPGLNSKPDHIKLAVDGM
FT                   LKRLRTDRIDLLYQHRVDPEVPIEDVAGAVKDLVDEGKVLHWGLSEMGLGTLRRAHAEL
FT                   PVTAVQSEYSMLWRGPEDEVLSVCEELGIGFVPWSPLGVGFLTGAIDAGTRFAEGDIRG
FT                   VETRFAPENLPANLALVALLKDWAGRKQATAGQIALAWLLAQKPWIVPIPGTTQMAHML
FT                   ENIGAAAISFTPDEISELNMAVAAIELRGQRLPDAVLAFSNVEAPARN"
FT   sig_peptide     408296..408406
FT                   /locus_tag="Pden_3243"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.919 at
FT                   residue 37"
FT   gene            409473..410462
FT                   /locus_tag="Pden_3244"
FT   CDS_pept        409473..410462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3244"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bxe:Bxe_B1949
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3244"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71325"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A1B731"
FT                   /protein_id="ABL71325.1"
FT                   /translation="MKSRNLGNLEVSALGLGCMGMTGVYGPGVEKADMIRLIHDAHDRG
FT                   VTFFDTAEAYGPFANEELLGEALQPIRDKVVIATKFGFDIDLETGARNGGTNSRPERIK
FT                   AVADAALRRLRTDRIDLFYQHRVDPNVPIEDVAGAVKDLIAAGKVKHFGLSEAGVGTIR
FT                   RAHAVQPVTAVQSEYSLFWRGPEVELLPVLEELGIGFVPFSPLGAGFLTGKIDETTTFE
FT                   QGDFRNLVPRFSPEARKANMALVGVVKSVADRKGATPAQVTLAWLLAQKPWIVPIPGTT
FT                   KLHRLEENLGAVELELTATDLAEIDAEASKIEVQGERLPEAVLKMTGL"
FT   gene            410491..411477
FT                   /locus_tag="Pden_3245"
FT   CDS_pept        410491..411477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_3911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3245"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71326"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1B732"
FT                   /protein_id="ABL71326.1"
FT                   /translation="MNDTKISDFTPVYRGAITANESGKVNVHPVTYKLHGLDIAANVYT
FT                   PAGYDPSQKYPAIAVAHPNGGVKEQTAGLYAQHLAEQGYITITADASYQGASGGEPRSV
FT                   DKPSNRIEDIHGMADFITQYPGVDARRLGLFGICGGGGYSLAAAKTDKRFKSVATLSMF
FT                   NSGRVRRNGFADSALDSIQQRLRQASEARAQEVAGGKILYAGDADMTDEQIAALPFEMY
FT                   REGYMYYWRTHAHTGSTFKYTMSSLLDLMRWDATDQIELIDQPLLMIAGSKADSLHMSE
FT                   DAFPKATGTEDKELFLIEGASHIQTYWVPEYVAAAMGKLTPFFARTL"
FT   gene            411556..411753
FT                   /locus_tag="Pden_3246"
FT   CDS_pept        411556..411753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3246"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_3076 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3246"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71327"
FT                   /db_xref="UniProtKB/TrEMBL:A1B733"
FT                   /protein_id="ABL71327.1"
FT                   /translation="MGSMGEFEDGGTAEFEGYVEAPVGVIGHADRAEPLRDYCLGLMML
FT                   VARKSVEPLAAVTAPERVSA"
FT   gene            411867..412448
FT                   /locus_tag="Pden_3247"
FT   CDS_pept        411867..412448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3247"
FT                   /product="transposase"
FT                   /note="KEGG: mag:amb0411 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3247"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71328"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1B734"
FT                   /protein_id="ABL71328.1"
FT                   /translation="MTPVFPRRASIRPGSRGKQDNCQAAVSLSIANEKASLPIAWRRYL
FT                   PDHCAQDPVLRRKAKIPDNLVFQTRSQIALDQIRTAAAVRAPCGVVLADAGHGADGAFR
FT                   AGLSELGLYYVVGVQPTLSVWRPDEALLPSDAIAALNAAFHKAMTDPEIRLREDVELYP
FT                   TTPEELGATISRDIGVWREIVGTAEIPVNR"
FT   gene            complement(412476..413243)
FT                   /locus_tag="Pden_3248"
FT   CDS_pept        complement(412476..413243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3248"
FT                   /product="regulatory protein, IclR"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG:
FT                   rha:RHA1_ro06686 probable transciptional regulator, IclR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3248"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71329"
FT                   /db_xref="GOA:A1B735"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B735"
FT                   /protein_id="ABL71329.1"
FT                   /translation="MSTDVPPPIPAGRQRHVPQNHRTIDRVSDILEHVSGNPGMTFSEL
FT                   ARKVGGAKSSLHGFISGLLARGWLYQSEGRFYMGPAMYSLTMANGHEATRFLNNDDLRE
FT                   LHEHCCLPVYLGVQAGEALIYISVAGRDPIMSYESRTNIRRTMLNTAGGKVLLAFEDTN
FT                   RRDKFLAQRPAEERDLVEAFLSQYYAIIENGYAVNYRSNVDRYAIASCLRGSDGRPVAS
FT                   VTLVGKSAELRPREEELTRTLLDYCRKWSARLA"
FT   gene            413818..414078
FT                   /pseudo
FT                   /locus_tag="Pden_3249"
FT   gene            complement(414038..414535)
FT                   /locus_tag="Pden_3250"
FT   CDS_pept        complement(414038..414535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3250"
FT                   /product="protein of unknown function DUF1468"
FT                   /note="PFAM: protein of unknown function DUF1468; KEGG:
FT                   bpa:BPP0373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3250"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71330"
FT                   /db_xref="GOA:A1B736"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:A1B736"
FT                   /protein_id="ABL71330.1"
FT                   /translation="MPPGDINVLSKDYKDVLGGGLLFATGAYALGVALFDLPIGPLGRM
FT                   GPGMFPALAGGVVTTLGLGITLSALQRRGTPARVGLRSTVCLLGAILLFSLLIPRFGLV
FT                   PAVMVASLTAIHASDALRLPGKLLLAAGLALIAVLLFGYGFQLQVPLFDCCPRREKSRG
FT                   RR"
FT   gene            414737..415615
FT                   /locus_tag="Pden_3251"
FT   CDS_pept        414737..415615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3251"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; PGAP1 family
FT                   protein; KEGG: dar:Daro_3230 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3251"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71331"
FT                   /db_xref="GOA:A1B737"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1B737"
FT                   /protein_id="ABL71331.1"
FT                   /translation="MPDFTLSTVRRLRVRDLDICLREWGASDAPPLVLLHGIRDNSITF
FT                   QFLVDELEQDWHIFAPDLRGHGQTGRAGILWQQDLLADCSALLSRLFGDRPVPVLGHSM
FT                   GGNLALVLAGLRPAQVSKVVSLDALGPPPARASQTPVSELVLHLDLAERRGFRPERRYG
FT                   SVTQMAERLCAAHPRLSMARALWLARHSHRAEADGSLTWLHDINIPRSLSFLTAERDWI
FT                   DIFRRIRCPALYLASADTTRHLAQDGDAPILRRMAAIADGRWQRIPETSHNLHYEEPVL
FT                   IAALLEEFWRE"
FT   gene            415612..415989
FT                   /locus_tag="Pden_3252"
FT   CDS_pept        415612..415989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3252"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="SMART: regulatory protein, MerR; KEGG: rsp:RSP_2201
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3252"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71332"
FT                   /db_xref="GOA:A1B738"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A1B738"
FT                   /protein_id="ABL71332.1"
FT                   /translation="MNNSGLTLREICAQLDLTERAVRYYEYLELLRPHCVAGKGRYGPH
FT                   EIARLKLIRRGRRFGMRLEALPQWLELYNVAGERRQMEIWCEISTELRRNMIEQQARLS
FT                   ESLAGLDRADAEARTRLAGAV"
FT   gene            416027..417628
FT                   /locus_tag="Pden_3253"
FT   CDS_pept        416027..417628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3253"
FT                   /product="protein of unknown function DUF894, DitE"
FT                   /note="PFAM: protein of unknown function DUF894, DitE;
FT                   major facilitator superfamily MFS_1; KEGG: rsp:RSP_0945
FT                   major facilitator superfamily (MFS) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3253"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71333"
FT                   /db_xref="GOA:A1B739"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1B739"
FT                   /protein_id="ABL71333.1"
FT                   /translation="MSQTLAVFRNRTFRGLWLGTVASNMGGLVQQVGAAWLMATMTSSA
FT                   TMIALVQACVTLPIMLGSYPAGVLADCRDRRRIMQVAQIFMAVVSAALAVLAWMGQVTP
FT                   VVLLVFTALVGCGTALQFPAWQSSIGGLVVRDELPAAISANAMGTNLTRSLGPALGGAI
FT                   VAAAGSAMAFAVNALSYLAVIVALWRWRPARSENDLPAESLFPAMRAGVVYCLSSGDKL
FT                   GAIWRGFLFCLAAIGVQALLPALVRDEIAGGASIYGIMLGAFGAGAVGAALVSTRLRAR
FT                   YGLETTCRLGFVAFALAVAALAIAPGLGLGIAALLVCGAAWLTVLSLVNISIQVSTPKW
FT                   VLGRMMAIYMTAIFGGMTLGSWLWGYVSTLGGLHLALLLSAGLLLLGAAWGLWAPLVAA
FT                   EPDSILPAELPASPQPRVALGHDSGPVRISVEYVIPVEREGSFLTVMEARRRSRARSGV
FT                   SNWSLYHDVEAPSQWIETYGFATWGDYLRQRARKTRQDEAIIAQLHALHHGDHPPQVRR
FT                   IVGTRRPQTLRAPPLP"
FT   gene            417752..418432
FT                   /pseudo
FT                   /locus_tag="Pden_3254"
FT   gene            418832..419227
FT                   /locus_tag="Pden_3255"
FT   CDS_pept        418832..419227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3255"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: mes:Meso_2098 cupin 2, conserved barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3255"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71334"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1B740"
FT                   /protein_id="ABL71334.1"
FT                   /translation="MRIVKAGSQPSFIGPADHFTGRVRVDPVFSCEAPARAKGAKVTFE
FT                   PGARTHWHTHPLGQTLIVTQGCGHVQCWGGPVETVTEGDCIWFPPGEKHWHGASATTAM
FT                   THLAVSEPLDGVSVAWMEPVGDDDYPG"
FT   gene            419378..420307
FT                   /locus_tag="Pden_3256"
FT   CDS_pept        419378..420307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3256"
FT                   /product="tartronate semialdehyde reductase"
FT                   /EC_number="1.1.1.60"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase, NAD-binding;
FT                   KEGG: sth:STH938 3-hydroxyisobutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3256"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71335"
FT                   /db_xref="GOA:A1B741"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1B741"
FT                   /protein_id="ABL71335.1"
FT                   /translation="MKIGFIGLGKMGRGMAANLQTGGAALVVADLSRTAAEEFTVRGAT
FT                   WAETPADLARDCGIVFTSLPTPADVRNAGFGPRGLVEGMAPGTVWLDLSTNSVDVVRQI
FT                   HAELAPKGIHFIDAPVSGGPAGAASGQLAIWCGGEREVYDRCLPWLEKMADQPRYIGDI
FT                   GAGTIAKLVNNMASTAIISVLAEALSMGVKAGLEPGPLWEAIRTGAAGRMRMYDNIGRR
FT                   FMQAKYDPPSFALRLIHKDASLALQVGRDFGVPMRLCTLVESDIREALNRGWGERDSQS
FT                   YLALQQERAGIEPFRLSAEAVARIYAES"
FT   gene            420270..420716
FT                   /locus_tag="Pden_3257"
FT   CDS_pept        420270..420716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3257"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /EC_number="4.1.1.44"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   pst:PSPTO_4478 4-carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3257"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71336"
FT                   /db_xref="GOA:A1B742"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A1B742"
FT                   /protein_id="ABL71336.1"
FT                   /translation="MPRQSPAFTRKADRLSGNPTGEHPMDRIETGRQVLRELMGEDFLV
FT                   QRAGRRNDFNAAVQDYTDDVCFGTVWSPPGIDRKMRSILNIAMLTALCRPNQLRSHVEG
FT                   AINNGCTVEELREILLHTAVYAGLPAAVEAFKVAEEVLEKKNLL"
FT   gene            420838..421839
FT                   /locus_tag="Pden_3258"
FT   CDS_pept        420838..421839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3258"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: rpd:RPD_0609 TRAP dicarboxylate transporter-DctP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3258"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71337"
FT                   /db_xref="GOA:A1B743"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A1B743"
FT                   /protein_id="ABL71337.1"
FT                   /translation="MRLYAILAAITLGCALPAQAEKLVLAHGYAPSHNVLVHGIVPWMA
FT                   CVRDGTQNAYDFDHFPSGQISGHTQSVSSLNSGLADLSVIVVAYSSDKVPMNGIPLLPG
FT                   MGTTSVEMVGAYRRALSQDGILAGEYAAIDTVPLLVSILPAYQVFSTIGPIDTLEKFAG
FT                   FKVRVSGGSPTFMAQSLGAIPIEINATDMYIALQRKTVDGTFLTMSSAKPYAIHELVNA
FT                   VSTNGSFGSGSSVLAMDRGKFEALPPEHRQVFVDCGLEAEMATAEYVDAENAAVQAEFV
FT                   TLGIDAFAYPDDVLEVLAARMSQVTSEYIGRLTDRGLPAAEALQEYQNARAD"
FT   sig_peptide     420838..420900
FT                   /locus_tag="Pden_3258"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            422255..422542
FT                   /locus_tag="Pden_3259"
FT   CDS_pept        422255..422542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3259"
FT                   /product="putative integrase/recombinase"
FT                   /note="KEGG: sme:SMa2189 putative integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3259"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71338"
FT                   /db_xref="GOA:A1B744"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:A1B744"
FT                   /protein_id="ABL71338.1"
FT                   /translation="MMPPLSASGASESGRRTITSTLRSYLRFLAGAGLCRPNLDHAIPP
FT                   VVQWRLSPLPRYLAAADLERVVASCDQLTRGRLRDRAILLLLARLGLRAG"
FT   gene            422920..424332
FT                   /locus_tag="Pden_3260"
FT   CDS_pept        422920..424332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3260"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: dra:DRA0126
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3260"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71339"
FT                   /db_xref="GOA:A1B745"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1B745"
FT                   /protein_id="ABL71339.1"
FT                   /translation="MECNNILVGGTWVPSEAEARIEAINPATEEVVARIPDGTSGDVDR
FT                   ATAAAVASFERWSQSSLDERKAVLNRLADLIDRDREPLLRNMVAESGLPITPAGRSQVD
FT                   GASDELRLMAEVVDQIDWATHYGSSRVVRQAAGVTGAITAWNAPLRSIISKAGAAIAAG
FT                   CTVVVKPSEVTPLSAIALADLFGEAGAPDGVFNLVLGRGPVIGEAIASHPDIEVVSLTG
FT                   SVRAGQRVMELASRMVKRVHLELGGKSANVVLRDADVERAVQVGIEDAFRNTGQACGAL
FT                   TRVVVPRPSLAKAEAAAVAKVESYVVGDPMDPATTIGPVATASQFRRVRDYIDIGQAEG
FT                   ARLLVGGSDRPKGLNRGYYVNPTVFTGDNFMRIAREEIFGPVVVIIPYEDETEALQIAN
FT                   DCDYGLAGAVWAADTDRARAFAQRMRAGRIRVNGTAISKYAPHGGFKLSGIGREWGRYG
FT                   IEEFLEYQSIHG"
FT   gene            complement(424601..424852)
FT                   /pseudo
FT                   /locus_tag="Pden_3261"
FT   gene            425326..426882
FT                   /locus_tag="Pden_3262"
FT   CDS_pept        425326..426882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3262"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: atu:Atu5094 ISL3 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3262"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71340"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:A1B746"
FT                   /protein_id="ABL71340.1"
FT                   /translation="MTAWFSRRDFLPAGLTADQIELDGNTIRIHARSSAAAAACPHCGS
FT                   ISEHVHSRYRRRPADVPAHGRAVEIVLQVRRFRCRAPGCPARIFAERFPSGVTRPHMRR
FT                   TSRLQDLVRHLGLALGGRPAQALARRLLVPASEDTFLRGARSLMGPVSEPPRVIGIDDW
FT                   AWRKGQRYGTMICDLERRQVIDLLPDREPATVEAWLRAHPGIRIIARDRNGGYGGAATR
FT                   ALPQAVQVADRWHLLENASAAFLAAVQRSMPVIRRAIGAKTLDPALLTAAERLQYEGFR
FT                   RRQQTNRMVRTMADEGLPIKRIVRSTGLSRKLVRQILRGEREDVFRIRESSLTPWLPRL
FT                   EREWNGGCRNGAELWRRLREDGFRGSLRVVGEWATRQRRAEQAVPNGMGKSPPARRIAR
FT                   LLTMGRDHLSRADALQVAQIEAASPALATARALADRFTDMVRNGREDVLASWLDEAADS
FT                   MIASFARGLRSDCAAVAAALREPWSNGQTEGQINRLKTLKRQMYGRANIDLLRARLLAP
FT                   A"
FT   gene            complement(426907..427194)
FT                   /locus_tag="Pden_3263"
FT   CDS_pept        complement(426907..427194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3263"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71341"
FT                   /db_xref="UniProtKB/TrEMBL:A1B747"
FT                   /protein_id="ABL71341.1"
FT                   /translation="MATQKFVSNLSAILPPSCSRHRHEKLQVDAEPAIAEMLLHDRAGQ
FT                   LVVWAPVGNYHDDMLDSLGQRAFDLAERDGIVGLDLGWRTMVSIGIQTGV"
FT   gene            complement(427531..429057)
FT                   /locus_tag="Pden_3264"
FT   CDS_pept        complement(427531..429057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3264"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: sme:SMb20262
FT                   putative semialdehyde dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3264"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71342"
FT                   /db_xref="GOA:A1B748"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A1B748"
FT                   /protein_id="ABL71342.1"
FT                   /translation="MTKQDSFTPHGKHLIGGDWVASEQRFASEPAHGRAHEFSIGTVAL
FT                   VNRACEAAEDAFWSYGQVTCEERAAFLDTIAEEIEARAEAITEIGTQETGLPEARLEGE
FT                   RGRTGGQLRLFAAHIRKGDHLDRRHDPALPDRQPLPRPDIRMVQRPIGPVAVFGASNFP
FT                   LAFSTAGGDTAAALAAGCPVVVKGHSAHPGTGEIVAEAIHAAIARTGTHPGVFSLVQGG
FT                   DRKVGEALVQHPLIKAVGFTGSLAGGRALFDLCAARPEPIPFFGELGSVNPMFLLPEAI
FT                   AARAEQIGSGWAGSLAMGAGQFCTNPGIAVVLDGADADRFVEATREALAKVGPQVMLTQ
FT                   GIARAYREGQARMQARNNVTPIHETRSEGRSASPNLYQTTAGQFLEDHALSEEVFGPLG
FT                   LVVRTASVDEMLHLARGLEGQLTATIHMKPADAEIACRLVPVLERKAGRVLVNGFPTGV
FT                   EVVDSMVHGGPYPASTNFGASSVGTMAIRRFLRPVAYQNFPEALMPTDLR"
FT   gene            complement(429142..430152)
FT                   /locus_tag="Pden_3265"
FT   CDS_pept        complement(429142..430152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3265"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems periplasmic components-like protein"
FT                   /note="KEGG: mes:Meso_2079 ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3265"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71343"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A1B749"
FT                   /protein_id="ABL71343.1"
FT                   /translation="MDRRRFLGSAGIFGLTLAASGLGAPHVARAAAARITIVSNPGLEN
FT                   ATLNRLMEEQGFLKRYGAETTMVLAEGPAGPFDAIVSGAADVCMVSGYNMALPRISQGA
FT                   PVRIAGAAMRKAALAVFARPDRVNGLADLEGKTVAVGPKLGLLHALMLQLLQEKGLDAS
FT                   RVTFLDAGSNDQAYHAVVEGKADACCSSISHLNDRDGLVILSDGKMWEALPKYVFQTAY
FT                   ASEAALRDKRDGLVPVMAAYGALYGYLMKPEAREAFLSARRSAQKKFDILSANAVWEFN
FT                   QEQRPYSRNLSISEEEITYQQRMFVGLGAMSQVLPYRDVADMRPANEAFKILSAK"
FT   sig_peptide     complement(430060..430152)
FT                   /locus_tag="Pden_3265"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.959 at
FT                   residue 31"
FT   gene            430569..431600
FT                   /locus_tag="Pden_3266"
FT   CDS_pept        430569..431600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3266"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   dsy:DSY0976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3266"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71344"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1B750"
FT                   /protein_id="ABL71344.1"
FT                   /translation="MKIMRGIVLSGLAVVTASAIAAPAYPQTAEEFYKGKTLTILVSAQ
FT                   SGSLTDFIARQFAQAYVKHIPGQPEAVVMNVVGAGGMVAAASLQSKQPKDGTVIGFLQR
FT                   NNLYVPLVDPSQNAFDPREVAWIGSVDKTYYSLVAMTRSGVTTADDLFQKELVVGATGF
FT                   SNENRTLPAVLNQYLGTKLTVVPGYTDRGEVYLAMERGEVDGWASTLDGLTYGEPKRML
FT                   AEDSMKVLLNLGWDSPEEFQDIPNLSQYVTDPEAKSILDFFILPFQAGRPLAAPKEVPQ
FT                   DRIDALRKAFDETVQDPEFIKAMTDQNYAVDPISGDEVAEIVATLFATPETELEAVRKI
FT                   LKP"
FT   sig_peptide     430569..430634
FT                   /locus_tag="Pden_3266"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 22"
FT   gene            431624..432613
FT                   /locus_tag="Pden_3267"
FT   CDS_pept        431624..432613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3267"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: reu:Reut_B5784
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3267"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71345"
FT                   /db_xref="GOA:A1B751"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1B751"
FT                   /protein_id="ABL71345.1"
FT                   /translation="MVLNGLAYQDRLRAPDASRHPSCFQGKTDMTYEIIDIHPHIISTD
FT                   TGKYPIAPQAGHRSKWSASRPADFDQLVAAMDEAGIAKAAIVHSSTTYGHDNSYVADSV
FT                   ASQPDRFTGVFSFDLLARDALATFDYWLGRGMGGIRLFTGGATHQTDGSWLVDPATFPV
FT                   WERCAENDLTMVIQTTPAGLGMVADLAHRFPSVRIALDHCARPVLAGGPPYDACAELFE
FT                   LARFENVYLKITPKTFDLAQAAPGGAEAFFPHLVAVFGADHLAFGSNYPASAGSLTELI
FT                   AQGNKCFESLGDKDRAWIWGRTAKVLYPMLANQGTARPCTSEDRRAAQ"
FT   gene            432650..434680
FT                   /locus_tag="Pden_3268"
FT   CDS_pept        432650..434680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3268"
FT                   /product="protein of unknown function DUF112,
FT                   transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112,
FT                   transmembrane; KEGG: bcl:ABC0625 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3268"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71346"
FT                   /db_xref="GOA:A1B752"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:A1B752"
FT                   /protein_id="ABL71346.1"
FT                   /translation="MEFLQDSVILSAAGDALGLILQPERIMFLWLGVIVGLAIGLLPGV
FT                   GGLTGFAILVPFTYTMDPYSAFAMLLGMAAVTTTSDTIPAVLFGAAAQATVLDGLPMTK
FT                   RGEAGRALSASYLANMMGGLIGAIILAVSLPVVRPFVLAIATPELLAMTILGIAMVATL
FT                   SGKSPLKGLVVACFGILVGMVGTDTQTGQMRWTGGLLYLQDGLPMLPILLGLFALPELC
FT                   DLAIQRTSIAQDMKFSPRQGMLQGIKDVARNWFLVLRCSSLGAVLGAIPGMTGSVVDWI
FT                   AYGHALQTEKGAKESFTKGDVRGVIAPESANNARDGGSLVPMLAFGVPGGAAQAILLGA
FT                   LMVHGFTPGPDMLTKNLDLTYSMVWSIALANIFGAGTCFLLSGQFARISTLRYTLVLPI
FT                   IMSIVYVGAFQGSRSWGDMYVLLIFGLIGWSMKRLRWPRPPLILGLVLGALIERYMSIS
FT                   FLRYGMDWALRPGVMVLLACAALIMFSPVLRLLRKENRAGVVLRRRPYLGLDDLAYGLF
FT                   IAIGVYVLVTSRDWLFNARIGPVVVASTMVIAGGLSLIHKTFFKEVRAAATNGVHMDIG
FT                   GDPEEELPRRLVLVRAARFYGWFVLFLLSMAVIGLLPTVPLVIMAFMRIEGREPWRLSA
FT                   ILAASVTLLLYIVFHRIIHVPWPTSLMGDWFPILREVVPSM"
FT   gene            434713..435375
FT                   /locus_tag="Pden_3269"
FT   CDS_pept        434713..435375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3269"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bll1020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3269"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71347"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A1B753"
FT                   /protein_id="ABL71347.1"
FT                   /translation="MAGLRVRHHVLVRFKLLSPGQQARLAGNPGKTDLAGIMTHQESDM
FT                   TQDRLARISPDQANAAQKRVIDRLGAGRGRIPTPFNIWLHSPRLAEGMEIIGTHIDADS
FT                   TLTQAESEIAILSTAVHWNAPYVIANHQKHALKAGLGEEVVAAILDRRRPDGLSGRLGV
FT                   VADAVWDILNGGMVGDVAFVRYDTELGRELIAELLVTIGYFTSVSLAMSLHALAPKA"
FT   gene            complement(435394..436701)
FT                   /locus_tag="Pden_3270"
FT   CDS_pept        complement(435394..436701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3270"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF894, DitE;
FT                   major facilitator superfamily MFS_1; KEGG: hne:HNE_1254
FT                   major facilitator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3270"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71348"
FT                   /db_xref="GOA:A1B754"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1B754"
FT                   /protein_id="ABL71348.1"
FT                   /translation="MVPSPNTGKIPQENPITFPLCDTVMNRTGQIPTSLRVLTGTQFGS
FT                   FCLGNGLSLVGTWMQRIACGWLIWEWTQSAFWLGVLAAGDLLPVMLIGPFAGVAADRWD
FT                   RLRQNIRAQAVSALLALLMALLLAIGRLGLLEVIALTTLQGTLSAAIQPARLAMVRQMV
FT                   GRADLGAAVALNSVTVNLARLIGPALAGMMIVRLDIIWVFAVNAAVTALYVLILGRLSL
FT                   AFPQKLSAPQPFLREMAEGFRHVVATPALWLILLVMLLGGMIVRSMLELMPAIAVRIYP
FT                   GNAMGLALLTGSAACGAIVSGLTIRPRSAVRLLYDVMVLWGLGAGAAILMTWATIPGLA
FT                   VAAAALLGAATTRGLISTQTFVQITTPPDLHGRILSLHGLIARGSPALGALVIGFFADR
FT                   IGIAAATLIAAAMLTFCFLLLAPLIRGAASTVEETD"
FT   gene            436878..438143
FT                   /locus_tag="Pden_3271"
FT   CDS_pept        436878..438143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3271"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: csa:Csal_0331 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3271"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71349"
FT                   /db_xref="GOA:A1B755"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B755"
FT                   /protein_id="ABL71349.1"
FT                   /translation="MFRLADIPNLRHLRMVQVIGKLGGVSCASRELSTSQPAVTQAVAN
FT                   IEAEIGLPIFERCATGTYPTTIGKQFLLRIDRFFDTLDTALAQVLGRPDGAADRIPPRI
FT                   ERLATGTQLRALIVTCEQGRVSEIADSLGLSPASLFRSARSFERALGKQLFDRTAQGPI
FT                   PNRTGNYLAREFRRAVRELELARGEVLLAAGTESLELVIGTLPMAGSHDLAEATRRFMS
FT                   AYPSTKVRLVTGEYHKLLNDLSNSRIDMIFGMLRRPEWADDVSEEVLFTDNYCLVARVG
FT                   HALTRLENVTPSDLAGYEWVVPQKGTPRRNRIEQIFADEPVRPKFHLETSSLTMIRSLL
FT                   LNSETVTLMTRSELQNDVELGVLKVLPCRFLDNVLLKGVTTRSDWLPTAAHNAFLDCLR
FT                   EVTGKTNHAGKPDSGSDIRMAS"
FT   gene            complement(438194..439045)
FT                   /locus_tag="Pden_3272"
FT   CDS_pept        complement(438194..439045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3272"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: sus:Acid_0199
FT                   HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3272"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71350"
FT                   /db_xref="GOA:A1B756"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1B756"
FT                   /protein_id="ABL71350.1"
FT                   /translation="MDKTGRLNGIIAALEEGRKPTMAFARAEREEAIQLGMSQLDGVLF
FT                   EMEHTPYSPSELRDALQFMLNRRRMIEGASLRPSVTPFVRIPANGAEMNTWMAKQVLDQ
FT                   GVYGVVFPHIATAEQARNAVAACRYARPKDAPNYEPKGLRGDAPNTASRYWGLTVPEYY
FT                   ARADVWPLVPEGEIMVIVMIESVEAMENLQDILAVPGIGAIMIGEGDLSQQLGYPRQYE
FT                   HPVVAEAKRSILAAAKAAGMRVAHPHVTLANAGEVIAEGYDILFTSPSRSYATLEKAKS
FT                   LM"
FT   gene            complement(439072..440046)
FT                   /locus_tag="Pden_3273"
FT   CDS_pept        complement(439072..440046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr3843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3273"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71351"
FT                   /db_xref="UniProtKB/TrEMBL:A1B757"
FT                   /protein_id="ABL71351.1"
FT                   /translation="MSTPTLKVALRTYPYTEALKSGTVAVSGAKLEFEEVKPHIAAFRR
FT                   MVRDLAFDACEIAPTTYIIARAYGVPIIALPVFFVRRFHHEGLVVRPGAGIEAPKDLEG
FT                   KNFGVRAYSVTTGVWKRGLLQNEYGVDIDKVNWWVDDEEHVAALKLPANVRHVAEDSSL
FT                   VAMMAEGKLDAACTGDAGIGRAGKPGAGWNESGPALPDDLRQLFPNAAELDREVYARNG
FT                   VYPIHGTLAIKEEVLQANPGLARSLYDAFVEAKAPYLQALRAGTATGKQAEKDRKLMQI
FT                   VGDDPLPYGLEANRASIEALIRYGHQQGLIPRPYKAEDMFLPF"
FT   gene            440299..441330
FT                   /locus_tag="Pden_3274"
FT   CDS_pept        440299..441330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3274"
FT                   /product="4-oxalomesaconate hydratase"
FT                   /EC_number="4.2.1.83"
FT                   /note="PFAM: amidohydrolase 2; KEGG: rme:Rmet_3705
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3274"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71352"
FT                   /db_xref="GOA:A1B758"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1B758"
FT                   /protein_id="ABL71352.1"
FT                   /translation="MIIDCHGHFTTVPGYFRDYRNAQIADFKAGKTSDFSPAPQISDEE
FT                   LCEGLEKNQIRLQKERGIDMTLFSPIAGLMGHHHGNEALSRHWSRTCNDLIHRVSTLYP
FT                   DRFVPICQLPQSPGADPRGCIEELERCVLELGFVGCNLNPDPTDGYWTDPPVTDKWWYP
FT                   LYEKLVELDVPAMIHVSGSCNPNFHGTGAHYLNGDTSVFMQLLLSDLFKDFPTLRMVIP
FT                   HGGGAVPYHWGRYRGLANDLGRPPLAEALMNNVFFDTCVYHQPGIDLLTEVIPVRNVLF
FT                   GSEMVGAVRSIDPETGHAFDDTRRYVEALELSPEDRHAIFEGNVRRVYPRLDARLKAMG
FT                   KAA"
FT   gene            441327..443006
FT                   /locus_tag="Pden_3275"
FT   CDS_pept        441327..443006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3275"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; thiamine pyrophosphate enzyme, central region;
FT                   thiamine pyrophosphate enzyme TPP binding domain protein;
FT                   KEGG: bms:BRA0945 acetolactate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3275"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71353"
FT                   /db_xref="GOA:A1B759"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A1B759"
FT                   /protein_id="ABL71353.1"
FT                   /translation="MKGPRTAARILVDQLLLQGVDRVFCVPGESFLAVLDALHDCPQIE
FT                   LVTCRHEGGAAMMAEAYGKLTGRPGVVFCSRGPGATNASSGLHVAFQDSTPMILFIGQN
FT                   PRDVMTREGFQEIDYRCTFGTQAKAVLQLEDAARTAEFVTRAFQLAMSGRPGPVVIPLP
FT                   EDVLTEIAECADGRPAARFANEPSPEAVSAVRALLTEARRPVVMLGGSGWTGEAVAAFR
FT                   RFAEDSGLPVTASFRRQDLLDNDSSSYIGELGLGPNPRLVQMVAEADLILVIGARLGEI
FT                   GTNGYTIMDIPCPRQRLIHVYPGPDEIGHVYRPELGIVSDPASFALALAAGGAVRGDWD
FT                   DWRKAARADFEAWTAPRTSPGAIQMCEIMAWLDESLPEDTIYTNGAGNFTVWLHRFHRY
FT                   RRFGTQVAPICGSMGYGIPAALAAKFARPEASVICIAGDGDFQMTCTELATAAAHGLKI
FT                   RILILNNGMLGTIRMHQERHYPARVSGTDLARGNPDFTALARSYGAHAERVERTTDFAA
FT                   AFARADTHDGPAVIEIMIDPEALTPGASLSQIRQAALQTLPG"
FT   gene            443021..443260
FT                   /locus_tag="Pden_3276"
FT   CDS_pept        443021..443260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3276"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71354"
FT                   /db_xref="UniProtKB/TrEMBL:A1B760"
FT                   /protein_id="ABL71354.1"
FT                   /translation="MEVNLRPLELSLPLFSEMPGRPNLKDMKSIADGTTWTGLTRPRGE
FT                   ALRRARGGGAASAAETGGDVSAPPYRQSFRTKPT"
FT   gene            443257..444138
FT                   /locus_tag="Pden_3277"
FT   CDS_pept        443257..444138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3277"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: reu:Reut_B5784
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3277"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71355"
FT                   /db_xref="GOA:A1B761"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1B761"
FT                   /protein_id="ABL71355.1"
FT                   /translation="MTQKIIDIHPHIISPDTTAYPYNPLGGIRSDWSAERPFTFEQYVE
FT                   EMEAAGVSQAAMVHSSTTYGYDNSYAADSVCRDPERFVGVYSVDIAAPDAVAIIEKWRR
FT                   RGMAGLRLFGAGSTVQTDGRWMIAPETYKVWEHMAEIDMTVAIQTTSIGLPAVEEILER
FT                   FPEVSIILDHLGRPDLTDGAPYAKAAPLWKLAQFGNLFLKITPRTFDLAEKAPATPASF
FT                   FAKLVAEYGADRLAWGSNFPANNGSLKELVAQGHRCFAALSEADRAQIWAGTAERLYPQ
FT                   LLEAALDKAANA"
FT   gene            444135..445052
FT                   /locus_tag="Pden_3278"
FT   CDS_pept        444135..445052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3278"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr3843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3278"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71356"
FT                   /db_xref="UniProtKB/TrEMBL:A1B762"
FT                   /protein_id="ABL71356.1"
FT                   /translation="MTRMEKIFPAEGPVTLSANITLYEPTRALIEGKVASDLISLEFAG
FT                   LKNAHAGFKDMLRKGRYDISEMATATFLQAHQFGKPFTLLPIVLLGRFQHHCIGFNTDV
FT                   HPGMTPADLPGKVVGVRSYTQTTGLWVRGILQNEYGVDPDSVKWLCFDQPHLEEYADPP
FT                   SVIWGDPAKDPVNMLLDGEVDAAILGMNMPKDPRVRTLIENPHEAALDWHKRERFVPPN
FT                   HYVIVPNALCDQRPDLVREVWRMLVKSRAAATPEGSIDPWPVGIAANRKALEAAIRFAT
FT                   QQHMITKPITVEELFHPLIRDIAP"
FT   gene            445296..446237
FT                   /locus_tag="Pden_3279"
FT   CDS_pept        445296..446237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3279"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sil:SPO3430 outer membrane porin"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3279"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71357"
FT                   /db_xref="GOA:A1B763"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A1B763"
FT                   /protein_id="ABL71357.1"
FT                   /translation="MKFFSMIAMTAALAPCAALADVSLSGFGRFGLTYSEAKKQDGENG
FT                   TFLQSRLRLEIDASVDTDIGLKFGAKTWVQGDHNSPSWGFSPANFYVEYENWSLEIGNV
FT                   LPAFDGALLLKQTRLGVHAVSVGGDPLGDFFILAYRGYGRLPDRTGVALNYGTRNFDVK
FT                   LSVVDPDQIGSGTGGDLTREVSASVFYRLNDWEFSAATAQSGAGVRDNDLYFVGTRYKV
FT                   NDDLRIGLNINDNGFAELGTSYALYGDYKFNRFTLGSYVAYNDGDWAEKVTDSSYGVAL
FT                   RYDLGPSIFLAASVQRDYERMTLADMGVRFDF"
FT   sig_peptide     445296..445358
FT                   /locus_tag="Pden_3279"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 21"
FT   gene            complement(446254..447207)
FT                   /locus_tag="Pden_3280"
FT   CDS_pept        complement(446254..447207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3280"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   rsp:RSP_3937 probable transposase protein, Y4bF"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3280"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71358"
FT                   /db_xref="GOA:A1B764"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1B764"
FT                   /protein_id="ABL71358.1"
FT                   /translation="MPWRIGCFGRQMPQNVQTMSPMMQRKLHERHGIRVSSESLRQWMM
FT                   AAGLWQSRAQRRRVHQPRLRRESLAELIQIDGSEHRWFEDRGPVCTLLVFIDDATGKLM
FT                   QMRFVDSESTQAYFAALQDYLQTHGRPVAFYSDKRSIFRVNRTEARTCHGMTQFGRALC
FT                   ELNIEIICANSSQAKGRVERANRTLQDRLVKELRLAGIRDIAAANAFLPGFIEAHNLRF
FT                   AQAPARSDDLHRPLNLPASRLSDILCLRDQRQVGSNLVVHYERRKFILDDSDHERSAIG
FT                   SNISGPSQRDTTSETAISSHPYNSPPSAYGCGDMCR"
FT   gene            447565..449121
FT                   /locus_tag="Pden_3281"
FT   CDS_pept        447565..449121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3281"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: atu:Atu5094 ISL3 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3281"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71359"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:A1B765"
FT                   /protein_id="ABL71359.1"
FT                   /translation="MASWFSRRDFLPAGLTADQIELDGNTIRIHARSSAAAAACPHCGS
FT                   ISEHVHSRYRRRPADVPAHGRAVEIVLQVRRFRCRAPGCPARIFAERFPSGVTRPHMRR
FT                   TSRLQDLVRHLGLALGGRPAQALARRLLVPASKDTFLRGARSLMGPVSEPPRVIGIDDW
FT                   AWRKGQRYGTMICDLERRQVIDLLPDREPATVEAWLRAHPGIRIIARDRNGGYGGAATR
FT                   ALPQAVQVADRWHLLENASAAFLAAVQRSMPVIRRAIGAKTLDPALLTAAERLQYEGFR
FT                   RRQQTNRMVRTMADEGLPIKRIVRSTGLSRKLVRQILRGEREDVFRIRESSLTPWLPRL
FT                   EREWNGGCRNGAELWRRLREDGFRGSLRVVGEWATRQRRAEQAVPNGMGKSPPARRIAR
FT                   LLTMGRDHLSRADALQVAQIEAASPALATARALADRFTDMVRNGREDVLASWLDEAADS
FT                   MIASFARGLRSDCAAVAAALREPWSNGQTEGQINRLKTLKRQMYGRANIDLLRARLLAP
FT                   A"
FT   gene            complement(449183..449533)
FT                   /locus_tag="Pden_3282"
FT   CDS_pept        complement(449183..449533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3282"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71360"
FT                   /db_xref="UniProtKB/TrEMBL:A1B766"
FT                   /protein_id="ABL71360.1"
FT                   /translation="MNIRRDALEARVLNSLRTRLVDPDLFAEFCDAYTRETSRLRMESG
FT                   AGIDKAEAELKRISREEEKLMDLYMRDAISIEAVKERGDKLRPQGGAAGLPRHVRRAPA
FT                   PAASVDGAVNRR"
FT   gene            complement(449813..451183)
FT                   /locus_tag="Pden_3283"
FT   CDS_pept        complement(449813..451183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3283"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: rsp:RSP_3975 periplasmic sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3283"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71361"
FT                   /db_xref="GOA:A1B767"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1B767"
FT                   /protein_id="ABL71361.1"
FT                   /translation="MTMPRSLQMRLGVSLGILLTLLWIAAAATTAVMLRHEMDRIFDSS
FT                   LQEAAQRLLPLAAVEIVGREEEGVTQHLADLRDHDEFLTYIVRDDEGRILLQSHEADPA
FT                   IFPEWDGPGFHTTATHRLYGEDALQGTIRLTVAEPLAHRATTARDVWAGLGLPLLVFIP
FT                   AALLAIVLTVRSGLAPLRHYRDRLAARSPRDLAPVACNDLPVEVAPVGLAVNVLLAQLK
FT                   STFEAERTFAANAAHELRTPLAGAIAQAQRIQVETKDTGAGHRAAEIEASLKRLARIAE
FT                   RLLQLARAEGGRLRLDHLSDLRITARLVVDDIERTAPNRIALALPEHPVMSDLDPDAFG
FT                   IICRNLVENALRHGASDEPIEVSLGEDGTYRVANEGPVVPTEALGRLARRFERGTAGTE
FT                   GSGLGLAIVASIADRISSKLTLQSPRPGSSSGFEAAVILPTASRQPTPPRQASAVFR"
FT   sig_peptide     complement(451100..451183)
FT                   /locus_tag="Pden_3283"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.403 at
FT                   residue 28"
FT   gene            complement(451180..451839)
FT                   /locus_tag="Pden_3284"
FT   CDS_pept        complement(451180..451839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3284"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bmb:BruAb2_0224 two
FT                   component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3284"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71362"
FT                   /db_xref="GOA:A1B768"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1B768"
FT                   /protein_id="ABL71362.1"
FT                   /translation="MRILLIEDDTVLGAAVRDQIAAGGQSVDWVTRLDAAGDAMAGAGY
FT                   DLILLDLMLPDGRGITFLRSLRAGGNVTPVIILTALDQISDRIEGLNAGADDYLVKPFD
FT                   LAELSARIGSVARRYSGNPNPIIVHGALAVDLALRSIRRDGRPVQLTAREWALFEAFLT
FT                   RPGQLLSKAQLEEKLYAFDTEVESNTIEVHVSRLRKKLGAAVIETERGLGYRLGSP"
FT   gene            451981..452295
FT                   /locus_tag="Pden_3285"
FT   CDS_pept        451981..452295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3285"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_7166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3285"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71363"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A1B769"
FT                   /protein_id="ABL71363.1"
FT                   /translation="MKRSLTILTFLVVLPSGAALAGDDCAVPLADWQPRSAVVRLAEEN
FT                   GWVVRRIKIDDGCYEIKGTDREGRRIEATVDPGTLQVIEVEYEDGGERHFREGRGRKHD
FT                   "
FT   sig_peptide     451981..452046
FT                   /locus_tag="Pden_3285"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 22"
FT   gene            452288..452920
FT                   /locus_tag="Pden_3286"
FT   CDS_pept        452288..452920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3286"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: rsp:RSP_2807 putative
FT                   cytochrome b"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3286"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71364"
FT                   /db_xref="GOA:A1B770"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A1B770"
FT                   /protein_id="ABL71364.1"
FT                   /translation="MIEAKRDGGISDVADTMRVVRVWDPVVRSFHWGLVAAFAVAWLAA
FT                   DEVQPLHEPAGYAVAALLVLRLIWGFVGSHHARFAQFMRGPAATLVYLGDMLRGRERRH
FT                   LEHNPAGAAMIVALMVTLSGTALSGWLLEQSIEEARAVTFVGEHGSREVRGDKTLKEVH
FT                   ETLANLALVLVALHVGGVALTSWRHRENLPRAMVTGRKRPPGANDVT"
FT   gene            453110..453412
FT                   /locus_tag="Pden_3287"
FT   CDS_pept        453110..453412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_1622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3287"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71365"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A1B771"
FT                   /protein_id="ABL71365.1"
FT                   /translation="MKTILTATAFALAIPAGAALADEKCNVPTENMQSWEALVQVTDEF
FT                   GWTISKMELDDGCYELNVIDQGGNSLKMTVDPGTLEVIDGKVKRWSDGTKPEKRN"
FT   sig_peptide     453110..453175
FT                   /locus_tag="Pden_3287"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.964 at
FT                   residue 22"
FT   gene            453524..453904
FT                   /locus_tag="Pden_3288"
FT   CDS_pept        453524..453904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3288"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bma:BMAA0783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3288"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71366"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A1B772"
FT                   /protein_id="ABL71366.1"
FT                   /translation="MKTLLIAVAALAVLPAAGALAGDDCHVPRGAWQPREAVMQAAAGL
FT                   GWHVEKVEADDGCWEVKGRDAQGRRIKAKLDPATLQVVKLRHRDGEQDRKRDRGGATPV
FT                   APSAPPANPLFQNGTPPVVRVN"
FT   sig_peptide     453524..453589
FT                   /locus_tag="Pden_3288"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.937 at
FT                   residue 22"
FT   gene            453931..454401
FT                   /locus_tag="Pden_3289"
FT   CDS_pept        453931..454401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3289"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb2_0227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3289"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71367"
FT                   /db_xref="InterPro:IPR014469"
FT                   /db_xref="UniProtKB/TrEMBL:A1B773"
FT                   /protein_id="ABL71367.1"
FT                   /translation="MKSFLAALALTSALVAPGLAMARPVTLTTTLNTYGGDGAYLVLYV
FT                   TDAQGAYAGTLWMAGGKSKYYEHLSDWYRATGGDLAQIDGITGASVGAGRSLEITLDLA
FT                   DALFDAGYTLHVDAAVEDMRDSPNDIAVPLTAAGAGQPVPGRRYVASLRYDM"
FT   sig_peptide     453931..453999
FT                   /locus_tag="Pden_3289"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            454411..456618
FT                   /locus_tag="Pden_3290"
FT   CDS_pept        454411..456618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3290"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; PepSY-associated TM helix domain protein;
FT                   flavodoxin/nitric oxide synthase; Oxidoreductase
FT                   FAD-binding domain protein; KEGG: bms:BRA0233
FT                   oxidoreductase, FAD-binding, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3290"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71368"
FT                   /db_xref="GOA:A1B774"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A1B774"
FT                   /protein_id="ABL71368.1"
FT                   /translation="MIRMLHRWPGLLALALVMVLAISGAALSVFPVAERFSTPQAEAGL
FT                   TVADLAERIRTAYPGVEQIRRAPSGRITAFWFDDGTPGAAVIDPATGKGIASADPNPVE
FT                   RWLTSLHRSLFLGDAGRIVMAAGAAAMLVLSVSGAMLVARRMGGWRRWFTPLRGPASSR
FT                   IHTGIARVAVAGLILSSATALWMAASTFDLLPDGAAPPAFPTEVSGSTGVSLAAMEPLS
FT                   VIPVTELRELSFPYPGDATDAFTLKTDRGTGYLDQGTGELLAWAELTMWERISETIYML
FT                   HTGQGAASLGLVLGVMALGVPAMGVSGLVLWFAGRRSRPRLRGNHPAKGAGTILLVGSE
FT                   GGSTWGFAATLQHALTTVGQHVHVAPMSGFDPARYPRAERFIVLSATWGEGQAPATAKG
FT                   FIERLAVLDSAPRAPLAVLGFGDRSFPAFCAFADEVARLAAAKGWAQLMPFDTVDRQSP
FT                   QDFARWGRALGAALGIELALEHVPTPPVTERLTLISRRDYGAEVQAPTTILRFALPEAT
FT                   FLQRVIARGFGRFQAGDLLGVLPEGADLPRFYSLASGRRDGFVEIVVRKHPGGLCSGQL
FT                   LALEPGQAIRAFVRHNPAFHAAAGRSPLILIGAGTGIGPLAGFIRGNSRKRPIHLAFGM
FT                   RRPDSDFLYRDDLAGWRVDGRLARLTTANSRGAKPRHVQDALRAESAELIRLVHEGARI
FT                   MVCGGRDMASGVAEALTDILAPTGLTPLALKAEGRYAEDIY"
FT   sig_peptide     454411..454497
FT                   /locus_tag="Pden_3290"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.859 at
FT                   residue 29"
FT   gene            456599..457591
FT                   /locus_tag="Pden_3291"
FT   CDS_pept        456599..457591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3291"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: bmb:BruAb2_0229
FT                   ApbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3291"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71369"
FT                   /db_xref="GOA:A1B775"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:A1B775"
FT                   /protein_id="ABL71369.1"
FT                   /translation="MPKISTDPGRHALNGPTMGTRWSALFHADAGLDPAPVQAALQAAV
FT                   ADVDALMSTWKPDSDLMRLNRTPEGVRVIVPARLAEVLDLGLRIGTASGGAFDIGMGDA
FT                   ARAWGFGSEPANAEAMRAAMATARRPAQEALEVDPLAGLARKHAPIALDLNGIAKGHGV
FT                   DRLAKTLQGFGITAFLVGIDGEMRASGLRPDGMPWTVAVEMPDPERRAPHSILKLADAA
FT                   VATSGDYRHYVTLRGRRLSHTMDPTTGGPLRSSPASVTVVARTCAEADAWATALMVLGP
FT                   QAGGELASRLGLHALFLIREAGVIRTHAVGALFDSPMVSAAGREGLVRA"
FT   gene            457734..458207
FT                   /locus_tag="Pden_3292"
FT   CDS_pept        457734..458207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_1035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3292"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71370"
FT                   /db_xref="UniProtKB/TrEMBL:A1B776"
FT                   /protein_id="ABL71370.1"
FT                   /translation="MRTVKSFTTVAVALALALGSAGIAAAQSHDHDSHGAGAIEITLND
FT                   GAKWQGDQNMITGMTAIHGTMAANLDAIHNGTLPADAANGVAADIQKQVDFMVENCVLE
FT                   PEVDEQFHIVLGEVMTGISALEAGEVETGAVTIVQALNAYGEHFEHPGWQMID"
FT   sig_peptide     457734..457814
FT                   /locus_tag="Pden_3292"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.620 at
FT                   residue 27"
FT   gene            complement(458241..459146)
FT                   /locus_tag="Pden_3293"
FT   CDS_pept        complement(458241..459146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3293"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: rsp:RSP_3052 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3293"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71371"
FT                   /db_xref="GOA:A1B777"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B777"
FT                   /protein_id="ABL71371.1"
FT                   /translation="MNAQAQDWDDLRLFLAVARAGSLSGAARSLGVTHSTVFRRIGAFE
FT                   ARLGVRLFDRLPGGYALTQAGEEMRDSVIRIEEEITALALKVTGQDQRPTGTIRITTTD
FT                   LLAVGVLPRHVAAFRAEWPEIEIEVIVADTVLDLTRREADVALRIGNPGQETLIGRRVG
FT                   RLAFAAYGAADRPPGDPAEGDWIGYGSAHGPLSRNLARWWPDARQIYRTNSIIAAHAGA
FT                   KVGIGLAALPCVIADCDPSLIRAAALPEDFMLDLWLLIHEDLRQTARIRLFLDFMATAL
FT                   AADADLLEGRCPCRTRPAQA"
FT   gene            459255..459473
FT                   /locus_tag="Pden_3294"
FT   CDS_pept        459255..459473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3294"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: rxy:Rxyl_1802 heavy metal transport/detoxification
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3294"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71372"
FT                   /db_xref="GOA:A1B778"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A1B778"
FT                   /protein_id="ABL71372.1"
FT                   /translation="MTKTILRSDEFSCPSCVVKIEKALKALPGVSEAKVHFNTGRIEVA
FT                   HDQTAAPVDTLVQTIRATGYEARPAAF"
FT   gene            459535..461454
FT                   /locus_tag="Pden_3295"
FT   CDS_pept        459535..461454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3295"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: rxy:Rxyl_1801 heavy
FT                   metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3295"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71373"
FT                   /db_xref="GOA:A1B779"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1B779"
FT                   /protein_id="ABL71373.1"
FT                   /translation="MLTPILTTLRQPASRRKWLTIISGALIVLGLIALYGFGLRGLWAA
FT                   SMVTAAFVAGSDIAWRAVQALRIRHFSIELLVTVAAVGALFIGEYWESAAVTFLFSFGA
FT                   WLEARTLRQTRGALADLLKAAPEIATVIRDGQPVEIAASAVQPNETVLVRAGNRIPVDG
FT                   EVIEGAAAVSEAAITGEPIPAEKAPGSHVHAGTIAENGVLRIRATGIGSDTTLARIIRR
FT                   VEEAQEERAPSQRMIERFAQWYTPGIMVLALGAWAVTQDIRLALTLLVVACPGALVIST
FT                   PVSIVAGIGRAARSGILIKGGQHLESAGRIDMLALDKTGTLTEGRPSLVEVLPLAGVDR
FT                   KDLLHWAAIAESGSDHPLGRAIVVAGRAEGDIPAPEAVEEVAGMGLVVNHEGRQVAAGN
FT                   RRLFDKLGIGFEPEAEAAMAGVLERGRTPIIVALDGRIAGIFGLSDQPRPSAKGAIARL
FT                   RDIGVSRIAMLTGDQPQAASAIAAEIGITEVHAGLLPEDKLDLIRGFQAEGRHVAMIGD
FT                   GINDAPALAAADTSIAMGAAGSDVAIETADIALMGDDLEKLPEAMAISRATLRNMRQNL
FT                   VIALLTVAGLLFGVFNGDVHMAEGMLIHQLSVLVVIANAMRLLRVPRGLGGRRPVPAAV
FT                   PATA"
FT   sig_peptide     459535..459669
FT                   /locus_tag="Pden_3295"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.878 at
FT                   residue 45"
FT   gene            461511..462173
FT                   /locus_tag="Pden_3296"
FT   CDS_pept        461511..462173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3296"
FT                   /product="protein of unknown function DUF924"
FT                   /note="PFAM: protein of unknown function DUF924; KEGG:
FT                   gvi:glr1115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3296"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71374"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A1B780"
FT                   /protein_id="ABL71374.1"
FT                   /translation="MGDDMTDSNDARQIGEVLDFWFPEGRALDIDPDRHAELWRWRMHG
FT                   GADGAIAARFGPLTERGAAGGLDHWSATPEGRLALIVVLDQFPRSLWRGSARAWAQDTE
FT                   ALAQAEAGLDNGDWTALGLSWFQITFTQPLGHAEGPEHLARIDRLIALRRDIATRAPAP
FT                   LRPLYASLVDQAGQVRRIIASFGRHPHRNAILGRRSTPEEEAYLEKGAFPHQRVFRG"
FT   gene            complement(462189..464129)
FT                   /locus_tag="Pden_3297"
FT   CDS_pept        complement(462189..464129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3297"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: nwi:Nwi_1949 heavy
FT                   metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3297"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71375"
FT                   /db_xref="GOA:A1B781"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1B781"
FT                   /protein_id="ABL71375.1"
FT                   /translation="MKRFPPVDLSLTLSLVTVLGMAMAAAGRWLPSGAFDALELPGLVL
FT                   VYLAGGLPTGWRALSELWRARVLDIDLLMIVAAIAAAIVGAPFEGAVLLTLFSISTTLE
FT                   ERALGRARRAIEALMALRPETALRKTANGAVEEVPAEVLAVGDVVVLRPGARVPSDGVV
FT                   VTGRGGIDEANITGESMPVSKEAGAQVFEATINLDGVLEVEVTRSVSDSTIARMIRLVT
FT                   EAQAARAPSERFSEWFGQRYTVAVLAGAVIAFATFWWLGGDWELALYRAATLLVAASPC
FT                   AIVISVPAAILSALSAAARGGVLFKGGGALETLAEVDIFAFDKTGTLTTGRAEVTEIVA
FT                   LDGDEAGFLSLLAGLEAHSEHHIAAAIRREVATRGLDPAIVADVNARPGIGIEGADALG
FT                   PVWAGNAYLAEDMKAATDHPALQALADGANTVVYLGRGATLLGAVSVADEARASSAGAI
FT                   TALRDSGVRRIVMMTGDRRPVALRIGARLGLRPEETHAEMLPQDKVRAVGELAATGRVA
FT                   FVGDGVNDAAALARADVGIAMGAAGSEVALQAADVALLSEDMERLADAHRLSRRTSRVI
FT                   RQNLTFAIGAMVVLVIGGLFFDLPLPLVVIGHEGGTVLVVLNGLRLLSDPIRRPKASVA
FT                   GQAPTGVARPA"
FT   sig_peptide     complement(464055..464129)
FT                   /locus_tag="Pden_3297"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.776 at
FT                   residue 25"
FT   gene            complement(464191..464571)
FT                   /locus_tag="Pden_3298"
FT   CDS_pept        complement(464191..464571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3298"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="KEGG: sat:SYN_02345 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3298"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71376"
FT                   /db_xref="GOA:A1B782"
FT                   /db_xref="UniProtKB/TrEMBL:A1B782"
FT                   /protein_id="ABL71376.1"
FT                   /translation="MPARTRALAIAAAVAVIFGLLTLVSGGRALFGGVDMGAVVPFVLW
FT                   FNFGAGFAYVLAGIGLWRGAGWAPMLAIAIATATVAVFAAFLWHVGAGGAWEARTMGAM
FT                   ILRSAIWIAIAAFALRCHKPSD"
FT   sig_peptide     complement(464473..464571)
FT                   /locus_tag="Pden_3298"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.471 at
FT                   residue 33"
FT   gene            complement(464586..465278)
FT                   /locus_tag="Pden_3299"
FT   CDS_pept        complement(464586..465278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3299"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mag:amb2540 ABC-type antimicrobial peptide transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3299"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71377"
FT                   /db_xref="GOA:A1B783"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1B783"
FT                   /protein_id="ABL71377.1"
FT                   /translation="MALGDILIKVSNVAKHFGEGETRVDALRAVDLTVRAGEVIALLGP
FT                   SGSGKTTLLNIIGCILAPSGGRVVLDGEPVFDGKWLRRDLRRLRLDKIGFIFQSHNLLP
FT                   FLTAQENVAVVLDLAGRPTEEGRARARELLDYLEVGHRAMVKPALLSGGEAQRVAIARA
FT                   LANRPRIILADEPTAALDGARAGLVMDLMRKLAVEQEACIVTVTHDEKIFDRFDRLIYL
FT                   RDGRLADA"
FT   gene            complement(465284..466417)
FT                   /locus_tag="Pden_3300"
FT   CDS_pept        complement(465284..466417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3300"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   mag:amb2541 ABC-type antimicrobial peptide transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3300"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71378"
FT                   /db_xref="GOA:A1B784"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A1B784"
FT                   /protein_id="ABL71378.1"
FT                   /translation="MNLALKDIRHGLFRFVLTCFGLGLLMTVVLAMIGIYNGLVSDALA
FT                   VVKAPAADVWVVEAGTKGPFAEASSIPADTRDAVARMPGVAEAGAVNYQNVEAAHTGQT
FT                   LRLYVIGYEPGRPGGPQAIAEGRGIGAGHFELVADRKTGLLPGETIRLGRDRFTVVGLV
FT                   EGAMNSGGDPAVYVTLADAMALQTELDPAAQRVQTARGAVSVKSASVATIIARMSPGAD
FT                   VDLLTATVRQWKHLAAMTQVEQEELLLASVVDKARRQIGLFLGILLSVSAVVIALIIYT
FT                   MTMEKLKQIATLKLIGAPDRTIIALIVQQALILGAAGWGIGLMLILTVKDYFPRRVVLE
FT                   PFNVMVLAGIIAAVCLLSSALGVRAAMKVDPATALGS"
FT   sig_peptide     complement(466322..466417)
FT                   /locus_tag="Pden_3300"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.961 at
FT                   residue 32"
FT   gene            complement(466414..467559)
FT                   /locus_tag="Pden_3301"
FT   CDS_pept        complement(466414..467559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3301"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   mag:amb2542 membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3301"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71379"
FT                   /db_xref="GOA:A1B785"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1B785"
FT                   /protein_id="ABL71379.1"
FT                   /translation="MRRIWLSGLLLAAAVAAGFLFFTERPLTVAIVQPEHDVALRIYGL
FT                   GTVEARILSRVGFEVGAALTRLSADAGDSVAKGQELAILHSAEQEARVARAGAAVTANE
FT                   ANLAKADAAVVRARAVLAQREAANRRQQGLALRDVASVQRAEEAQRDEDVARADLAVAE
FT                   ADVAVIRAQGLDAAAALRQEEALLAHHRLVAPYDALIVARHAEPGTVVKAGDAIFTLID
FT                   PATVWIQAYVDEERAGQLALGQPGTIRLRSQPAAEFHGTIARIGIESDRVNEERRVWLT
FT                   CADCPAEMFLGEQAEVRILTGTRASALMVPEVAITGFDGHRGTVWTVQDSRLARVGLTF
FT                   GARDDRGRVEVTGGLPEGAAIVTSPPKGAAEGRRARVGEAP"
FT   sig_peptide     complement(467509..467559)
FT                   /locus_tag="Pden_3301"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.457 at
FT                   residue 17"
FT   gene            complement(467563..468210)
FT                   /locus_tag="Pden_3302"
FT   CDS_pept        complement(467563..468210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3302"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: eba:ebA6247
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3302"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71380"
FT                   /db_xref="GOA:A1B786"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:A1B786"
FT                   /protein_id="ABL71380.1"
FT                   /translation="MRLPKYVCDYSLTSRCPVRKSAELRKAEIVATVLDLADGIGPDRV
FT                   TTGAVASQIGVTQAALFRHFPTKDALWQAVAEHVAEGLALAWDGALNLGDGPLVRLRAL
FT                   IAAQFAQIAATPALPMLLFSRELNVTNAELRATFHGRLTTFHGLLATEIRTAQEAGVLR
FT                   GDMPANDAAVLLTSLVQGVAIRWALGARDFDLRAEGLRLFDVQCRLLAAEGK"
FT   gene            complement(468512..469312)
FT                   /pseudo
FT                   /locus_tag="Pden_3303"
FT   gene            469314..469814
FT                   /pseudo
FT                   /locus_tag="Pden_3304"
FT   gene            470021..471202
FT                   /locus_tag="Pden_3305"
FT   CDS_pept        470021..471202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3305"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: atc:AGR_pAT_51 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3305"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71381"
FT                   /db_xref="GOA:A1B787"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025758"
FT                   /db_xref="InterPro:IPR026287"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:A1B787"
FT                   /protein_id="ABL71381.1"
FT                   /translation="MTDSNPDQRLGRYVETPVAGEMVRAFVPPPLPPKPQIDVLALLDR
FT                   LSLAERALGRLDGITMLLPRQELFLYMYVRKEAVLSSQIEGTQSTLTDLLRFETEAQAG
FT                   EPIDDIREVSNYVDAMMYGLERLEELPLSLRLIREMHARLLQSGRGDTKSPGDFRRSQN
FT                   WIGGSRPGNALYVPPPVTELDACLDALERFIHEDGSQLPALIKAGLLHVQFETIHPFLD
FT                   GNGRIGRLLVTLYLCVNGVLRKPLLYLSLYLKTHRADYYRLLQEVRENGNWEAWLDFFL
FT                   AGVAETANQAFEAATRIVDLFKEDRERITNESDRAGSTLRIHDLFQQNPFLTSNQLVQK
FT                   TGLSAPTVNAALADLEKMGIVEEVTGRKRGRVFSYQRYLAILSEGTDPLPAAT"
FT   gene            complement(471348..471779)
FT                   /locus_tag="Pden_3306"
FT   CDS_pept        complement(471348..471779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr1867 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3306"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71382"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A1B788"
FT                   /protein_id="ABL71382.1"
FT                   /translation="MGPGQRLSARQARSAPLVAAFGDWLQLQCRRISMKSRLGEKLAYI
FT                   HRHWDGLQTFLHDGRVEIDSNSVENLIRPIALTRKNALFAGHDEGGRSWARIASLIATA
FT                   KVNGVEPFAYLKTTLEAVAASHPQARIDDLLPWNFKPSS"
FT   gene            complement(471872..472897)
FT                   /locus_tag="Pden_3307"
FT   CDS_pept        complement(471872..472897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3307"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: bja:blr1700 putative
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3307"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71383"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:A1B789"
FT                   /protein_id="ABL71383.1"
FT                   /translation="MSAAPSIDLSAIPESQRAAVLAVLRERDALRESNRRLEHLIAELN
FT                   QAVHGKRSEKLNDDERQLAFEDLEAAVAEAESRQDAEAGPRTPSRRAARRNRGHLPASL
FT                   PRFEQVIEPDSLLCPCGCGEMHCIGEDRTERLDIVPAQLRVIVTVRPKYACRRCADGVT
FT                   QAPAPAHLIEGGLPTEGALAHVLVSKYADHLPLYRQSQIMARAGVELHRSTLADWVGTA
FT                   AFHLGPVVDRLAEHLKTSSKLFMDETTAPVLDPGRGRTKTGYLWALARDDRSWGGGDPP
FT                   GVVFTYAPDRAGQNAEHILQGFDGILQLDGYTGYNRLRARPGQAARRSSSPIAGRMQGA
FT                   S"
FT   gene            complement(472952..473305)
FT                   /locus_tag="Pden_3308"
FT   CDS_pept        complement(472952..473305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3308"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: bja:bll2160
FT                   putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3308"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71384"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A1B790"
FT                   /protein_id="ABL71384.1"
FT                   /translation="MLMSSQGMRILVATKPVDFRKGHDGLAALAQSMLAEDPFTGTIFV
FT                   FRSKRADRLKILFWDGSGLVMVYKRLEADSFTWPAVRDGAMTLSRTQFEALFAGLDWRR
FT                   VRPLETPKPAVAE"
FT   gene            complement(473299..473631)
FT                   /locus_tag="Pden_3309"
FT   CDS_pept        complement(473299..473631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3309"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   atc:AGR_pTi_30 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3309"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71385"
FT                   /db_xref="GOA:A1B791"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:A1B791"
FT                   /protein_id="ABL71385.1"
FT                   /translation="MKALVVADTLEPGATVNAVADRYGVQPNQLSAWRRLAKQGKLVLP
FT                   SAPTDEPVFAPLVVCDPAPAPPSCDRRPAEEQIRIVIGEVRLELAADTSAVRLAEIVRA
FT                   LGAAPC"
FT   gene            473734..474063
FT                   /locus_tag="Pden_3310"
FT   CDS_pept        473734..474063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3310"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sme:SMb21085 hypothetical protein encoded by
FT                   ORF3 of ISRm14, IS66 family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3310"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71386"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A1B792"
FT                   /protein_id="ABL71386.1"
FT                   /translation="MGKDCAAARQPSNVGFSRRLLAFDMDSNLVENAIRSPAMNRRNAL
FT                   FAGHDDGGRSWARFASLIGTCKMNGVEPYAYLRDLFTKLANGHLDKDIDALMPWAYAAA
FT                   PHSSQ"
FT   gene            complement(474208..475173)
FT                   /locus_tag="Pden_3311"
FT   CDS_pept        complement(474208..475173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3311"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; KEGG: rpd:RPD_3866 response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3311"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71387"
FT                   /db_xref="GOA:A1B793"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1B793"
FT                   /protein_id="ABL71387.1"
FT                   /translation="MTAPLILCVEDEPSLRDDIAFELHEAGYIVSAAGDAREALACLER
FT                   QRPDLILCDILMPGMDGKRFMSHLRRTRPDLDDVPFVFLTALSSRQQVIDGRMAGADDY
FT                   VTKPIDYDLLRATVEARLNRMQRLRAMPGDRSGLAALDRLALGVVLLDANGGVVHANPL
FT                   AQSLSGAAGISLSGRFAASGENGRKLSALIAGLAPGKGMAPTGLRLDDGCRLMIIGMSL
FT                   PAHSHHDEAVAMLILSGTDSKPPMDTATLGQLFGLTPMEAQVACLLAEGLRRSQIADRL
FT                   AISGTTVAFHLRNIFSKTGVQRQAELVALILSVPLAQPVT"
FT   gene            complement(475170..476507)
FT                   /locus_tag="Pden_3312"
FT   CDS_pept        complement(475170..476507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3312"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: ret:RHE_PF00324 probable two-component
FT                   sensor histidine kinase/response regulator hybrid protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3312"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71388"
FT                   /db_xref="GOA:A1B794"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1B794"
FT                   /protein_id="ABL71388.1"
FT                   /translation="MTGTGGRARYLWLGGLVAICLGLLALAAWQLVVLERQMRIAATEN
FT                   MIWVFGQTQIEALNLALALSDEAALQQIQTRFDILVSRLTLLEDGPQRRFLENAGVSET
FT                   LARWRSGLLALDPAQGADPAALRAHVTALVAALRTKASLVMSHEWQSQATRLDSLRHLH
FT                   LLALMSVLGAAVAGLGLVAILIDRERRLMSGQLDHLRAEKLASDLERERETSENHRRFA
FT                   DLIAHQFRTPLAVIDSAMHRLTRRSGGPVPPELISEKAAVSREAVARLVKLTDTALMMS
FT                   RLERDAVLPSLRAHDLNDLVSSVIDDLMATAWDRDPARIRQSVQTEPTVALCDPMLTAE
FT                   ILSNLLRNALLYSPPDCRVDVSVFQSRDCIVCRIEDRGRGMSPEEIECAFDRFYRGSGH
FT                   ETLPGSGLGLTLARDLARIQGGDVTLSQRDGGGLTAALYLPKDDVA"
FT   sig_peptide     complement(476424..476507)
FT                   /locus_tag="Pden_3312"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.975 at
FT                   residue 28"
FT   gene            complement(476504..476986)
FT                   /locus_tag="Pden_3313"
FT   CDS_pept        complement(476504..476986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3313"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rde:RD1_3578 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3313"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71389"
FT                   /db_xref="GOA:A1B795"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A1B795"
FT                   /protein_id="ABL71389.1"
FT                   /translation="MSLRYHIVQTALMTALVFMAVPAAAEDVLLTLTGAVTDGRVEMTR
FT                   ADFDTMDWHEFSTSTSVTDGRPEFRGVLMRDALAHAGAEGSSVRATALNDYVVDIPVED
FT                   FHRFDVLAALYMDDVPLTPRDKGPVWIVYPRDNHGVLADIRYDMRWVWQLVALHVQ"
FT   sig_peptide     complement(476909..476986)
FT                   /locus_tag="Pden_3313"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 26"
FT   gene            477123..477602
FT                   /locus_tag="Pden_3314"
FT   CDS_pept        477123..477602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3314"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B796"
FT                   /protein_id="ABL71390.1"
FT                   /translation="MTIFSTMRRAGIPVLACLLALPALADEPGGLVTGSFGDQPLELTV
FT                   APELSGATIIGNYADASLLASQMEGDQGPVNLELTINGELPAPGEMALTITFARDMGRN
FT                   WTGDQDSLTLTLEEFTPGDGIVALKGTLTGQVSGGPSSETRPVTFSFDTRLEELD"
FT   sig_peptide     477123..477200
FT                   /locus_tag="Pden_3314"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            477604..478176
FT                   /locus_tag="Pden_3315"
FT   CDS_pept        477604..478176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3315"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71391"
FT                   /db_xref="UniProtKB/TrEMBL:A1B797"
FT                   /protein_id="ABL71391.1"
FT                   /translation="MAGPAFARTAALLLIATATSALAGEPSNPVCHADVHRAGNFDLRQ
FT                   IGPLIAGTWTEAAIGTSVAIGVQESTFEIIYDRNRNRLYLGSDGIQTELVPVRGGNKPL
FT                   RFDFVRGEAMDPQFYMLTSTGSEPGAEPWEWALVQDCQIASAPQFEWQFGTGARRSDGI
FT                   ISFFSANEAMGTKRNSARGVREQLISR"
FT   sig_peptide     477604..477675
FT                   /locus_tag="Pden_3315"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            478185..478664
FT                   /locus_tag="Pden_3316"
FT   CDS_pept        478185..478664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3316"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71392"
FT                   /db_xref="UniProtKB/TrEMBL:A1B798"
FT                   /protein_id="ABL71392.1"
FT                   /translation="MKVLVPLVLALGIATPAGALDAIGEIGANLDGEELNWQVMRQDDG
FT                   SAMVQITDIGPLTMIELHALGDGSISIGLIFHGKPSGDTPPAGLTIDMRPDRGAMAGAV
FT                   WESEEEPPQMSIDLLDLEDEGRIQASFAATLCRRDAPDDCRDVEGRIDTSLGAGP"
FT   sig_peptide     478185..478244
FT                   /locus_tag="Pden_3316"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.977 at
FT                   residue 20"
FT   gene            478661..479188
FT                   /locus_tag="Pden_3317"
FT   CDS_pept        478661..479188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3317"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71393"
FT                   /db_xref="GOA:A1B799"
FT                   /db_xref="UniProtKB/TrEMBL:A1B799"
FT                   /protein_id="ABL71393.1"
FT                   /translation="MTLAEFLADPLRVTQISDSVLEIENRPVRRAVIAAAVILVAIAAG
FT                   LAAIGDGATGTGIIVLAVVGLIGWLYMHELVQLTQLSLDRHAGLVRLRVTTLRGRREET
FT                   FALSDLHKLESIAHYGTAAGNDETRLVLICGSGPERREIIVPMFRPDPEEVAHLTGVVN
FT                   GWLSRQGKGNPS"
FT   gene            479185..479709
FT                   /locus_tag="Pden_3318"
FT   CDS_pept        479185..479709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3318"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71394"
FT                   /db_xref="GOA:A1B7A0"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7A0"
FT                   /protein_id="ABL71394.1"
FT                   /translation="MSIETNTPERLELELAIPRFILWFVMLPVLPITLIGLANLIGGEI
FT                   LTALVLLVGLNGAFLAGYIALSERTRLRLDAGSGLVSIIRTSRLGTRQRDYPLEALDSA
FT                   ELDRSHTSREDRSTSKVVLVFRNTRPATRVPLSRWGVSGDGPGQVANDINAWLRRHFGG
FT                   EQTAPASQPSS"
FT   gene            479733..480704
FT                   /locus_tag="Pden_3319"
FT   CDS_pept        479733..480704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3319"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mlr7467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3319"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71395"
FT                   /db_xref="GOA:A1B7A1"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7A1"
FT                   /protein_id="ABL71395.1"
FT                   /translation="MWDFNIGQALGLLGRTLPFVLLRAAVYFGITLAYILATGAGIGVG
FT                   WGVGAFGDDEFRATAMAWGGIAGFGLTGAVMYWLREYILYIVKAGHVAVLVELIDGKPL
FT                   PEGRGQIAHATAVVKGRFGQASLLFALDQLVKGVIRAVIGLVRGVLSILPIPYVRQLMG
FT                   IVQAFLRVAVGFIDEVILAHAIRTRSTDPWGSAREALVLYGQNWKAMLRNAAWLTLFTY
FT                   GLAFLIFLVMLAPAAALVYVMPGAWSAGGFVFALLFAWSVKAAFLEPFAVTCLMQVYFR
FT                   ITDGQEPDPEWDARLEQMSSHFRKLKERADARFGTARDGEAA"
FT   gene            480701..483268
FT                   /locus_tag="Pden_3320"
FT   CDS_pept        480701..483268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3320"
FT                   /product="von Willebrand factor, type A"
FT                   /note="PFAM: von Willebrand factor, type A; KEGG:
FT                   jan:Jann_1721 von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3320"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71396"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7A2"
FT                   /protein_id="ABL71396.1"
FT                   /translation="MRSLVTAGLIALTSALAPAALAQERPSTILVLDASGSMWGQIDGI
FT                   NKITIARDVVGDIVSDFPADQNLGFVTYGHRERGQCADIETLVEPAPGTAAEIAGIVEG
FT                   LNPRGMTPMTDAVVTAAQALRHTEQAATVILVSDGIETCNPDPCAAARALEEAGVDFTA
FT                   HVIGFDVRGEADALLQMQCIAEETGGRFLTADNAQELNEALREVTAAPASGSFTFTANL
FT                   GGEEIGDETVWERPAAPPELPLLSGEVIWEISDTSFNMVQTGTANPFTTDLPFGDYIVT
FT                   VHSTAQDDFSQTEASLALDSARNVHAIFPPITSQQPAAQVFGPAQTLVGSAFTVSWEGE
FT                   GLAPRDYVTIVPADAEDGAYADYDRLENRTEGELRAPAEPGLYEVRLQLDAGNRVLART
FT                   PVEVVDADVTVSAPAQVVVGSAFPVTWQGEGLHPRDYVTIVPAGSADGTYADYDRTQGR
FT                   SEGELRAPAEPGLYEVRLQLDVGDRVLARTPVEVVDAEVAVSAPAQVVVGSAFPVTWQG
FT                   EGLHPRDYVTIVPAGSADGTYADYDRMQGRSEGELRAPAEPGLYEVRLQLDAGDRVLAR
FT                   TPVEVVDAEVTVSASAQVVVGSAFPVTWQGEGLHPRDYVTIVPAGSADGTYADYDRMQD
FT                   RSEGELRAPAEPGLYEVRLQLDAGDRVLARTPVEVMDGNVSLDGPDRARAGAEITLSWT
FT                   GAIHPRDYIAIVPGGTPDGEQSGYRRIQDEDQATFTAPAEPGAYEIRYHLDRGDRVMAR
FT                   RPLEVLAADAPIDEGAGLMVPGTARPGDIVTVSWTIEAGDADRRVALARADAPDFTWIT
FT                   VDHVGDETETVIKLPDEPGQYEVRFLDLQSQSVLGRAMITLGE"
FT   sig_peptide     480701..480769
FT                   /locus_tag="Pden_3320"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            483265..483801
FT                   /locus_tag="Pden_3321"
FT   CDS_pept        483265..483801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3321"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71397"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7A3"
FT                   /protein_id="ABL71397.1"
FT                   /translation="MNYDNFKESGALTTMLRSAIAAFGFLALVVPVIAAEPGGAASGTI
FT                   AGEEIELSVWTEQSDFTSSSFSIYFQAPALRERGLGSLSLGAEWIGDLDGDFFSAEIDI
FT                   PILDTDPYRIYRADLDDELSLTITSASHQGGVLAIAGQVEGVLTSVDRIALRNPDPDDT
FT                   LSVSLTFEAVLGELQ"
FT   sig_peptide     483265..483369
FT                   /locus_tag="Pden_3321"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.974 at
FT                   residue 35"
FT   gene            483798..484283
FT                   /locus_tag="Pden_3322"
FT   CDS_pept        483798..484283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3322"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71398"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7A4"
FT                   /protein_id="ABL71398.1"
FT                   /translation="MRTAALSLIAICLSAPVLADQPGGDMTGFLEETPVSWRIDAERSE
FT                   YHFESEGIGSLRILAEPQEVPSGIGSVRLMVMVADGTTSLLELRLEDEDGNPALGLSSE
FT                   AGGQAMLDIDHDNDGSLHFTGVIEAGLMAYPMSGRTAGERQMLVLDVDGGRITATGH"
FT   sig_peptide     483798..483857
FT                   /locus_tag="Pden_3322"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            484311..484901
FT                   /locus_tag="Pden_3323"
FT   CDS_pept        484311..484901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3323"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71399"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7A5"
FT                   /protein_id="ABL71399.1"
FT                   /translation="MRPVIVLTAILSCAAVPALAQRASDISGLCGTSSPATWQGLREHF
FT                   VGDWRVDHLSGYVHAGRMVIPMEPSPETETMSIWVLGEDLLLDHAEMTEPMAITLADEG
FT                   RWVIEANHPEIPEPALTPDEAVLAWAGDCDQEDLPRLIGQSHVAMAGAVMDMTLRMLPV
FT                   DMDTIYAILEIEGAAQGQYVVARRVVWLNRAGE"
FT   sig_peptide     484311..484373
FT                   /locus_tag="Pden_3323"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 21"
FT   gene            484910..485728
FT                   /locus_tag="Pden_3324"
FT   CDS_pept        484910..485728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3324"
FT                   /product="type III restriction enzyme, res subunit"
FT                   /note="KEGG: rpe:RPE_0562 type III restriction enzyme, res
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3324"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71400"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7A6"
FT                   /protein_id="ABL71400.1"
FT                   /translation="MKRYLATLLAALIFPAAAAAQSEIALAGHLIAFDTIDYDSHADLL
FT                   YKLAGQVVGHLRSYLSTEDDVENVALNHGKEWADFIFQQMKDHYWEMPTDYRAKVTRGF
FT                   RVLNAQNFNVSGVDRIRDLKNGVTPRSDTRKYVFNGLQKCGYPYQKFDSDDERRFAVLI
FT                   DGDFEKSVRRWIKPGARQFQIEYASGQAYEPDFVVETDTEKLIVEIKARNEMTDEIVLA
FT                   KARAAAEWVKYANEHAEANGGKSWGYLLVPGDSITESATLAGLVASHRRE"
FT   sig_peptide     484910..484972
FT                   /locus_tag="Pden_3324"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.765 at
FT                   residue 21"
FT   gene            485821..488112
FT                   /locus_tag="Pden_3325"
FT   CDS_pept        485821..488112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_4292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3325"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71401"
FT                   /db_xref="InterPro:IPR026866"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7A7"
FT                   /protein_id="ABL71401.1"
FT                   /translation="MLTHINLVRNVGRFDSVSAGANLPFQKFTVLYGENGRGKTTLSAI
FT                   LKSLATNDPLLIEQRHRLGAQHPPHVVVARSANQHVFQNGGWSASDDRIVVFDDDFVAQ
FT                   NVCSGIEIASEHCKNLHELIIGARGVALNETLQQHIREIEEHNAEIRKLGGNIPASVRG
FT                   AMNVDQFCALEKRDDIDAAIAETERKINAAKASDEVQKRESFKNFALPEFDIDGLNGLL
FT                   SRGLPELEAEAAQRVRDHLSHAGRNAETWVAEGLPRVAAMAEATDRNDCPFCAQSLDAS
FT                   PVIRHYQAYFSDAYAKLREDVTEAGKALTRDFGGDIAAAYERAIAAISESRNFWGRFAD
FT                   IPEQEFDTAATVRALNAAREAVRQQLLAKHAAPFEIAPLSEETLNAIGAYDALRQQHIE
FT                   AMRVYEEANAKIALIKEQAASSNLSALQTDLDNLKRIKVRHSDPYDEICRKYLEAAAKK
FT                   QKTERARDAAREALNQYQQQVFPRYEAAINTYLGKFHAGYRLGSVSSRNTRSGATCDYK
FT                   VLINNVPVSLSANAGPSFRNTLSAGDRNTLALAFFFASLEQDSDLASKIVVIDDPMTSL
FT                   DEHRSLTTRQEIIALTGRVTQVIVMSHEKPFLCGLWEAASRINRAAIMVMRNGDGSTLA
FT                   EWNVNDDCITEHDRRHRLVAEFLNSYSATQERNVAVALRHILEAFVRVAYPEHFPPGSM
FT                   LGPFVDKSRQRIGEQNEILSKADTVELRAILDYANKFHHDTNPAYETEQINDTELESFA
FT                   RRTLAFTKRT"
FT   gene            complement(488297..490102)
FT                   /locus_tag="Pden_3326"
FT   CDS_pept        complement(488297..490102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3326"
FT                   /product="Recombinase"
FT                   /note="PFAM: Resolvase, N-terminal domain; Recombinase;
FT                   KEGG: nha:Nham_3864 recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3326"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71402"
FT                   /db_xref="GOA:A1B7A8"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7A8"
FT                   /protein_id="ABL71402.1"
FT                   /translation="MRVAIYARYSSDQQRDASIADQFRMCRLRAEKEGWQVVEEYSDHA
FT                   ISGSSMIQRPGLQALIMDSARGRFDMVLAEALDRVSRDQEDIAGIYKRMRYADVKMFTL
FT                   SEGEISELHVGLKGTMNALFIKDLADKTRRGLRGRVEDGKSGGGNSYGYNVVKKFDASG
FT                   EPIRGDRMINAVQAAVIRRIFADYDSGLSSRTIAMALNREGVPGPMGREWGPSTIHGNR
FT                   ERGTGILHNELYVGRLVWNRLRYVKDPDTGRRVSRLNPESEWVVQDVPDLRIVDQALWD
FT                   AVKARQGELAFSTRSRLEGNPLNDRRRPKHLFAGLVKCGCCGGGYSMISKDLLGCSTAR
FT                   NKGTCDNRVNIRRDALEASVLNGLKKHLMEPELFREFCAEFTREVNRLRMERGADLEVA
FT                   RRELDKIGRQISQIIEAITDGMYHPSMKEKMTKLEARKAEATEKLANADEPPPLLHPNM
FT                   AALYAQRITELSENLQHEDSRAQAAEILRSLVDQVTLLPEEGELAIVLRGDLGAILRFA
FT                   AGKKDPDFLSEAEALDNLLGQMAVSRKPGRTKAKTSALNATEVSQLSLVAGARNHLYLR
FT                   PPPALNSVLLRVDEATLGEVFRTAA"
FT   gene            490103..490552
FT                   /locus_tag="Pden_3327"
FT   CDS_pept        490103..490552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3327"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71403"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7A9"
FT                   /protein_id="ABL71403.1"
FT                   /translation="MQASCSVGAVFEILALLGFDELPCRVSGQQADQVRKAPVRGGQGR
FT                   GRIPGRFCDHPEPFRNCLPPPCHRPVPLPARQDPRQHERGAGKGEITGGFGRIASSLGA
FT                   AQRKPALPRLLQGALRGGIHVGWRKNTGKARDISRQGARSAGFRS"
FT   gene            complement(490853..491890)
FT                   /pseudo
FT                   /locus_tag="Pden_3328"
FT                   /note="similar to oxidoreductase; premature stop"
FT   gene            492010..492963
FT                   /locus_tag="Pden_3330"
FT   CDS_pept        492010..492963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3330"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC-type transcriptional regulator domain
FT                   protein; KEGG: rsp:RSP_3202 transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3330"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71404"
FT                   /db_xref="GOA:A1B7B0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7B0"
FT                   /protein_id="ABL71404.1"
FT                   /translation="MRADFGLRTARRDPRLRFMENDHLAPLKELIARQWQAHGRETPIE
FT                   GLVLTSVTAPTGPIHAVYRPSLCVVAQGAKTSMLGERAYRYDAGKCLIASMEVPIRAEI
FT                   TRATPDRPYLAFSLALDPATISDLLLERDGTDDAPAGAALAVHAFGPELADPLCRLLAL
FT                   CDRPRDIAILAPLVRREITWLLLNGPMGPALRQIGLAGSPMARIARAIACIREGFADKL
FT                   NIRQLADVAGMSPATFHRHFKAVTAMTPVQYQKQLRLQEARRLLLFDNADVARIGYAIG
FT                   YESPSQFSREYRRLFGSPPGRDGQEIRRSLAPQVEG"
FT   gene            493215..493538
FT                   /locus_tag="Pden_3331"
FT   CDS_pept        493215..493538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3331"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71405"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7B1"
FT                   /protein_id="ABL71405.1"
FT                   /translation="MEPAYLTEAMRLVSLSQRRANKRLGDETAAAFRALLRDLEAAATF
FT                   SEVPIAPLAVRQSNRILLTYGLNGSLVLEVEPRTRHEMTLQQWPEAHRFCLHRILDDSR
FT                   VIV"
FT   gene            493535..494413
FT                   /locus_tag="Pden_3332"
FT   CDS_pept        493535..494413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3332"
FT                   /product="putative plasmid maintenance system antidote
FT                   protein, XRE family"
FT                   /note="KEGG: bxe:Bxe_A0212 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3332"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71406"
FT                   /db_xref="GOA:A1B7B2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7B2"
FT                   /protein_id="ABL71406.1"
FT                   /translation="MSFEPDWATPPGASIARLLSAKELPAEELAEELGLDDAGFDLLIA
FT                   GERRITADIAATLSEYLGSTAEFWLRRDEIYYAEIDRLSVAHSSNLDEWTKCLPTRQMS
FT                   QFGWIRKNLRSNNLADELLKFFGCESISEWKAIYTSGLDAVSFRTSSSFHADDLATLAW
FT                   KRAGEIQASQIDLCEFSRSDFNRLLPELKRLGFIRDPKELVANLRARLAQVGVALTTAR
FT                   APAGCRASGATWRLEQGNPIIHLSFRHLSDDHFWFTLYHEAAHIALNHGEHVGYDTKCA
FT                   ANLGSGFITNK"
FT   gene            complement(494397..494957)
FT                   /locus_tag="Pden_3333"
FT   CDS_pept        complement(494397..494957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3333"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   sil:SPOA0134 ISSpo7, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3333"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71407"
FT                   /db_xref="GOA:A1B7B3"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7B3"
FT                   /protein_id="ABL71407.1"
FT                   /translation="MERERHFRQDDDRAGRRPRRGKDRDDRRDLSESAPHRDQHGREKG
FT                   GRGRLVGRTKGGMNTKLHAICDSQGRPLDLFVTAGQVSDYIGARALLSSLPKVDWLLGD
FT                   RGYDADWFREALQDKGIRACIPGRKQRKTPVKYDKRRYKRRNRIEIMFGRLKDWRRVAT
FT                   RYDRCPKVFLSAIALAATVIYWL"
FT   gene            495252..495524
FT                   /locus_tag="Pden_3334"
FT   CDS_pept        495252..495524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3334"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71408"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7B4"
FT                   /protein_id="ABL71408.1"
FT                   /translation="MLSARGALSMRWTPPIYTHSPDPGVPRAVAGPLTAAREGLVSLYM
FT                   RCHRRRDSIGMTATAEVELVEIDGRALFALPAVVGEGIHRRAIIE"
FT   gene            complement(495620..495898)
FT                   /locus_tag="Pden_3335"
FT   CDS_pept        complement(495620..495898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3335"
FT                   /product="SH3, type 3 domain protein"
FT                   /note="PFAM: SH3, type 3 domain protein; KEGG: rsp:RSP_6161
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3335"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71409"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7B5"
FT                   /protein_id="ABL71409.1"
FT                   /translation="MRTHLAALFALMVATACAVGSGAVVKGVGPDDLLKLREGPGLDHN
FT                   IIIGLPDGTRLTRQNCVTNNGKVWCRVSLTDRPGISGYVSADYLAHR"
FT   sig_peptide     complement(495827..495898)
FT                   /locus_tag="Pden_3335"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.294 at
FT                   residue 24"
FT   gene            495960..496316
FT                   /locus_tag="Pden_3336"
FT   CDS_pept        495960..496316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3336"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71410"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7B6"
FT                   /protein_id="ABL71410.1"
FT                   /translation="MRARMKGLQKTSHRRPVPSHGAALLVRISPQRQSSGSIRRMRSRS
FT                   MGCVRRAVLAAPCLSGGKSPRFSQTCHLLSRSELLESPLLPLETDPAQMISSGCSVHCF
FT                   QVWSTGCTRHRAAR"
FT   gene            complement(496474..497838)
FT                   /locus_tag="Pden_3337"
FT   CDS_pept        complement(496474..497838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3337"
FT                   /product="chromate transporter, chromate ion transporter
FT                   (CHR) family"
FT                   /note="TIGRFAM: chromate transporter, chromate ion
FT                   transporter (CHR) family; PFAM: Chromate transporter; KEGG:
FT                   sme:SMc00808 putative chromate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3337"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71411"
FT                   /db_xref="GOA:A1B6R8"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6R8"
FT                   /protein_id="ABL71411.1"
FT                   /translation="MKRRDGFPTLGQATGVWARIAALSFGGPAGQIAVMHRILVEERKW
FT                   LGDARFLHALNFCMLLPGPEAQQMATYIGWLMHGVRGALIAGMLFILPGFIAMMVLSWV
FT                   YALYGDVPVVTALFFGLKAAVLAIVLQAVFRIGKRALKNKVMLGLAAASFLAIFLFDAP
FT                   FPVIVALAAAIGWIGAKAGIAAFRGGGGHGSSGGAHVSDADTILGEDLDLPPSARRNAF
FT                   RAGWAAVALWLLPVLLLLALVPGSVFTDIALYFSKLAVLTFGGAYAVLAWVAQEAVGSY
FT                   GWLQPGEMLDGLGMAETMPGPLIKVLQFVGFMGAMREAGWAMPLLAATLGGVLTTWVTF
FT                   APCFAWILLGAPFMEGLRENRALAAALASVTAAVVGVILNLAIWFAIHVVWREVEPFDW
FT                   GPVSTSVPVLETLDGWAMALSALAILAVFRLKLGIGLVLGGAALAGLGLHMAGAI"
FT   gene            complement(497835..498680)
FT                   /locus_tag="Pden_3338"
FT   CDS_pept        complement(497835..498680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3338"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: mlo:mlr5406
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3338"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71412"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR018634"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6R9"
FT                   /protein_id="ABL71412.1"
FT                   /translation="MPAPDAITCDKLAKLIGTARCPVVLDLRRADARDTEPRLIPSARW
FT                   LAEDEIAPAALSELARSLDRPVVVLCAEGHGRSQGVAAWLRHEGVAAEYLEGGMAAWLA
FT                   AGLPLVTTTRITGHDPQGRSLWVTRARPKIDRIACPWLIRRFIDPRAVFLFVAPAEVPA
FT                   VAERFGAMPFDVEGVFWSHRGEDCTFDTLLKETRLSIPALDRLALIVRGADTARLDLAP
FT                   EAAGLLAASLGLSRMYSDDLEQLDAGLQLYDAFYRWARDATDEIHNWPTNARGTGRSAT
FT                   "
FT   gene            complement(498895..499602)
FT                   /locus_tag="Pden_3339"
FT   CDS_pept        complement(498895..499602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3339"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   rsp:RSP_2731 arsenical resistance protein, ArsH"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3339"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71413"
FT                   /db_xref="GOA:A1B6S0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A1B6S0"
FT                   /protein_id="ABL71413.1"
FT                   /translation="MIPDLPNLSPGAVHQPDLPPVPRATHPPRILLLYGSLRERSYSRF
FT                   ATLEAERLLRHFGCETRVFHANGLPLPEDADPSHPKVQELRDLCLWSEGQVWTSPERHG
FT                   AMTGVMKSQIDWIPLSMGAIRPTQGRTLAVMQVSGGSQSFNAVNQMRVLGRWMRMLTIP
FT                   NQSSVARAYQEFDEAGRMRPSSYYDRIVDVMEELVKFTLATRDLSAFLTDRYSERKEAA
FT                   AKLEERVNLKAAT"
FT   gene            complement(499599..500675)
FT                   /locus_tag="Pden_3340"
FT   CDS_pept        complement(499599..500675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3340"
FT                   /product="arsenical-resistance protein"
FT                   /note="TIGRFAM: arsenical-resistance protein; PFAM: Bile
FT                   acid:sodium symporter; KEGG: sal:Sala_2405
FT                   arsenical-resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3340"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71414"
FT                   /db_xref="GOA:A1B7C0"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7C0"
FT                   /protein_id="ABL71414.1"
FT                   /translation="MMTLDRPARRLSFLDRYLTVWIFAAMAFGILLGTVFTGLPDALHA
FT                   MSVGPTNIPIAIGLILMMYPPLAKVRYEDLPRVFADRRVLVLSLVQNWLIGPVLMFALA
FT                   VIFLRDHPEYMTGLILIGLARCIAMVLVWNQLARGDGQYVAGLVAFNAIFQILFFSTYA
FT                   WLFLTVLPPLFGLEGSVIEVGFRTVTEAVLIYLGIPFAAGFLTRHVLIARKGDAWYQNV
FT                   FLPRIGPITLAALLFTIVAMFSLKGGDVLRLPLDTIRIAIPLVLYFAIQFVVSFAMGRL
FT                   IARDYPRSTAIAFTAAGNNFELAIAVAIAAYGLTSPVAFAAVIGPLVEVPVLILLVNAA
FT                   LWLGRRWFPAATPQEARA"
FT   gene            complement(500685..501638)
FT                   /locus_tag="Pden_3341"
FT   CDS_pept        complement(500685..501638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3341"
FT                   /product="arsenate reductase"
FT                   /note="TIGRFAM: arsenate reductase; PFAM: low molecular
FT                   weight phosphotyrosine protein phosphatase; arsenate
FT                   reductase and related; KEGG: nwi:Nwi_3124 low molecular
FT                   weight phosphotyrosine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3341"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71415"
FT                   /db_xref="GOA:A1B7C1"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7C1"
FT                   /protein_id="ABL71415.1"
FT                   /translation="MADASPRVFNVLFLCTGNSARSIIAESVLRKEGDARFRAFSAGNQ
FT                   PKGEVHPRTLKILQNYHYPTEGLRSKSWDEFAGPDAPVMDFVFTVCDDAAGEACPYWPG
FT                   QPMTAHWGLPDPAAATGSELQRDMAFIETLRYMKARIQTFAALPIGTLDRASLVSRLHE
FT                   IGRSEGANGAADGMDVVIYHNPDCGTSRNVLAMIRNAGIEPHVVEYLKTPPSRAMLEQL
FT                   IARMGIAPRDLLRQKGTPYAELGLDDPALPAAALVEAMLAHPVLINRPIVVSPRGVRLC
FT                   RPSEQVLDLLPPQRAAFSKEDGEQVVDAQGNRIRPA"
FT   gene            complement(501631..501993)
FT                   /locus_tag="Pden_3342"
FT   CDS_pept        complement(501631..501993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3342"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: nwi:Nwi_3123
FT                   transcriptional regulatory protein, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3342"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71416"
FT                   /db_xref="GOA:A1B7C2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7C2"
FT                   /protein_id="ABL71416.1"
FT                   /translation="MDEQRALAGFAALSQETRLRIVRLLVKAGPEGMAAGAIGEALGGA
FT                   STSRLSFHLTHLEQAGLIRSRREGRFIIYSAVFPTLAGLIAFLMRDCCDGHPEICAPVA
FT                   AALSCSCEPGKDALHG"
FT   gene            complement(502273..502657)
FT                   /pseudo
FT                   /locus_tag="Pden_3343"
FT   gene            complement(502687..504177)
FT                   /locus_tag="Pden_3344"
FT   CDS_pept        complement(502687..504177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3344"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; Xanthine/uracil/vitamin C permease;
FT                   sulphate transporter; KEGG: rsp:RSP_4197 antisigma-factor
FT                   antagonist, STAS"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3344"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71417"
FT                   /db_xref="GOA:A1B7C3"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7C3"
FT                   /protein_id="ABL71417.1"
FT                   /translation="MISLDAYRTQWFGNIRGDLLAGLVVALALIPEAIAFSIIAGVDPK
FT                   VGLYASFSIAVLVAFTGGRPGMISAATAATAVLMVTLVRDHGLQYLLAATVLAGLIQIG
FT                   AGLLRLGFVMRYVSKSVMIGFVNALAILIFLAQLPELDPSRVSWLTYVLVAAGLAIIYL
FT                   FPLLTRAVPSPLVAIVVLTALSMAFGWDVRTVGDMGVLPDTLPVFMIPQIPLTGETLLI
FT                   VLPYSLAIAVVGLLESLMTQNLVDELTDTKSDRNQECIGQGIANAATGFIGGMAGCAMI
FT                   GQSMINVKSGGRGRLSTFTAGFVLLILVVFLGEWVAQIPMPALVAIMVMVSVGTFSWSS
FT                   LKNLRTHPRSSSMVMLATVASVVWTHNLAIGVLVGVLLSGIFFAAKIAQLFKVTTHLTP
FT                   DGRLRSYVIEGQLFYGSVEDFMEAFDFNEAVEKVIIDVSRAHIWDISSVQALDMAVLKF
FT                   RRDGAEVEIVGMNEASETIVDRLAIHDKPGAMDRLMAH"
FT   gene            504673..504870
FT                   /locus_tag="Pden_3345"
FT   CDS_pept        504673..504870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3345"
FT                   /product="protein of unknown function DUF1127"
FT                   /note="PFAM: protein of unknown function DUF1127; KEGG:
FT                   rde:RD1_2086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3345"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71418"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7C4"
FT                   /protein_id="ABL71418.1"
FT                   /translation="MSAVEMSHSRAAAGGLGQVFARVTAMVAAWNDARITRRELHRLTD
FT                   RELTDIGLTRGDIERVARGL"
FT   gene            505006..505248
FT                   /locus_tag="Pden_3346"
FT   CDS_pept        505006..505248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3346"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71419"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7C5"
FT                   /protein_id="ABL71419.1"
FT                   /translation="MIGESEEMAVDLRHRPEPIAARCRIRRSTGMSWRRRRPAPHRTPD
FT                   GKGVSGYDPAMDRMPVNYRPIEADGLTGAEDGMAP"
FT   gene            505270..505680
FT                   /locus_tag="Pden_3347"
FT   CDS_pept        505270..505680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3347"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mlo:mlr1197 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3347"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71420"
FT                   /db_xref="GOA:A1B7C6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7C6"
FT                   /protein_id="ABL71420.1"
FT                   /translation="MLEAPRIYPTFRFRNAAAMIDWLEKAFGFTIHAKYMEDGKVAHAE
FT                   LAFGSSMIMCGDDRDDAYGEMVGPPSAQGGKSLYIAVDDADAMFARAQAAGAAIEEGLT
FT                   DRDYGSREFICRDPEGNLWCFGTWWPKVTDKT"
FT   gene            505686..506120
FT                   /locus_tag="Pden_3348"
FT   CDS_pept        505686..506120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3348"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: gvi:glr1626 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3348"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71421"
FT                   /db_xref="GOA:A1B7C7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7C7"
FT                   /protein_id="ABL71421.1"
FT                   /translation="MAPRISNRIASFVDALPLAPSHRVLEIGCGPGVAAREVSRRVGNG
FT                   FVLAIDRSAKAIESAVAGSKAEIATGRLRFLRAAIEDFALPPGEEPFDIAFAMRVGALD
FT                   GRHPDIEQRALERLRAVLKPTGRLFIDTGHPLREIGLRGR"
FT   gene            506216..506533
FT                   /locus_tag="Pden_3349"
FT   CDS_pept        506216..506533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3349"
FT                   /product="nucleoid protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: jan:Jann_4229 histone-like
FT                   nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3349"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71422"
FT                   /db_xref="GOA:A1B7C8"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7C8"
FT                   /protein_id="ABL71422.1"
FT                   /translation="MTDIDLNALSLAELKQLEKNLAKAIASFEDRRKAEAGAAAEAVAK
FT                   EHGFSLGELAKMTPAQKRAAVAPKYRHPENPEITWSSRGREPGWIAEALEAGKSLEDFA
FT                   I"
FT   gene            506549..507166
FT                   /locus_tag="Pden_3350"
FT   CDS_pept        506549..507166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3350"
FT                   /product="plasmid pRiA4b ORF-3 family protein"
FT                   /note="PFAM: plasmid pRiA4b ORF-3 family protein; KEGG:
FT                   sme:SMa0896 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3350"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71423"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7C9"
FT                   /protein_id="ABL71423.1"
FT                   /translation="MFQPPNAVRLHVSLAEIEPEIWRRLVVPCDWTLDRLHPVLQAAFG
FT                   WTDSHLHEFRISGLRYGDPVLLADGFGGPRVFDSAEVRLQDFVGSDVGFTYAYDFGDGW
FT                   EHLIRIEDWLALDPAPRHALCLEGARARPPEDVGGPWGYADFLGIIRDPTHEEHRSTLR
FT                   WAGGHFDPEWFDLDLINKDLRNALRANARRRLHQPKPKAPKG"
FT   gene            complement(507323..508096)
FT                   /locus_tag="Pden_3351"
FT   CDS_pept        complement(507323..508096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3351"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bja:blr0060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3351"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71424"
FT                   /db_xref="GOA:A1B7D0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7D0"
FT                   /protein_id="ABL71424.1"
FT                   /translation="MAWTLPSRSGIPLTMAQNIYDNPDFFAGYSQLPRQVHGLDGAPEW
FT                   PAIRAMLPDVAEKRVADLGCGFGWASRWFREQGAASVAGYDLSHNMIARARADTSDPAI
FT                   DYRNADLEVLDLPQAVFDLVYSALAFHYVADFDRLIRMIHKALAPGGDLVFTIEHPIFM
FT                   AAAHPHWTLDEDGRKTWPVNGYSVEGERRTDWFAKGVLKYHRTLATTLNTLIGAGFALR
FT                   RVQEFAPTAAQIEAMPVLAEELERPMMLLVAARKA"
FT   gene            508181..508453
FT                   /locus_tag="Pden_3352"
FT   CDS_pept        508181..508453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3352"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   atc:AGR_C_1623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3352"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71425"
FT                   /db_xref="GOA:A1B7D1"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7D1"
FT                   /protein_id="ABL71425.1"
FT                   /translation="MSHTIRDKQKLIARVRRLRGQIEGIERALEAEKPCGEILRQLASA
FT                   RGAMSGLTAEVMEDHLREHVLQAETDAERRQGGEELIEIIRTYMK"
FT   gene            508469..509425
FT                   /locus_tag="Pden_3353"
FT   CDS_pept        508469..509425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3353"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   sme:SMc04167 putative histidine-rich transporter
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3353"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71426"
FT                   /db_xref="GOA:A1B7D2"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7D2"
FT                   /protein_id="ABL71426.1"
FT                   /translation="MSAIDISAHTHGHDFLGRHHRRNERRVWLVIALTAAMMVAEIAAG
FT                   TLYGSMALVADGWHMSTHAGAMLITALAYVYARRHVGDARFSFGTGKLGDLGGFASAVV
FT                   LALIALLIGWESLVRLANPVEIRFGQAIAVAVVGLVVNLACAWLLRGDHSHHHHGHGRH
FT                   HDHDHDHHHGHARDNNLRAAYLHVLADALTSILAIVALLAGRSYGWTWADPAMGVVGAL
FT                   VIARWSWGLIRDSAAVLLDRTPQDADLPQEIRTAIETGTDRIADLHVWQVGPGHHAAIV
FT                   SLVSSDPQAPSHYKSRLARIHALSHVTVEVERVSAAS"
FT   gene            509433..509882
FT                   /locus_tag="Pden_3354"
FT   CDS_pept        509433..509882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3354"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71427"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7D3"
FT                   /protein_id="ABL71427.1"
FT                   /translation="MAGWRGCNPLRPFAGLCEAGPCSNPCPDRPMTEIAPQPRIKLSKL
FT                   RDIGWSFWDPIGLLDPESPAGRWDDEANLSFADEYDSYLVAAASQLRRGTPRDEVVAFP
FT                   VEIETQHIGVGDSPSAGPRAEVVVEAILADETIWTWPDAQGRFRV"
FT   gene            509912..510370
FT                   /locus_tag="Pden_3355"
FT   CDS_pept        509912..510370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3355"
FT                   /product="Gentamicin 3'-N-acetyltransferase"
FT                   /EC_number="2.3.1.60"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sal:Sala_0626 gentamicin 3'-N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3355"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71428"
FT                   /db_xref="GOA:A1B7D4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7D4"
FT                   /protein_id="ABL71428.1"
FT                   /translation="MSVSIRCLGRSDVSVLRQMNALFGDAFDDPDTYLGEPPDDAYLSG
FT                   LLAGDHLIALAAMDGAVVVGGLIAYELEKFERARSEIYIYDLAVAETHRRQGIATALIG
FT                   TLQRIAAERGAWVVYVQADYGDEPAIALYTGLGKREDVLHFDIPVDAG"
FT   gene            510604..511020
FT                   /locus_tag="Pden_3356"
FT   CDS_pept        510604..511020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3356"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_3831 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3356"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71429"
FT                   /db_xref="GOA:A1B7D5"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7D5"
FT                   /protein_id="ABL71429.1"
FT                   /translation="MTLILLALMLTALTCVIAWYLATWALPVMVFVETFSFIHANETGF
FT                   LLSVLAAAAAALLSVGLVLLVLFKARNPILCLLARAVFVIPAMIAGYAVVHGVTHEAID
FT                   SAIALTLLCGTAGLITGIAALINLNGFGELAPQV"
FT   sig_peptide     510604..510681
FT                   /locus_tag="Pden_3356"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.573 at
FT                   residue 26"
FT   gene            511449..512126
FT                   /locus_tag="Pden_3357"
FT   CDS_pept        511449..512126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3357"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   nha:Nham_0569 DNA methylase N-4/N-6"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3357"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71430"
FT                   /db_xref="GOA:A1B7D6"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7D6"
FT                   /protein_id="ABL71430.1"
FT                   /translation="MTAQENTPRNLVINGDCIEVMQAFGTGSVDFILTDPPYVTRFRDR
FT                   QGRTVANDDNARWLRPAFAQMHRVLKQGGFCVSFYGWNKVDLFVEAWKAAGFRIVGHLV
FT                   FRKRYASSARFLRYEHEQAYLLAKGDPVLPARPVPDVLDFPYTGNKLHPTQKPVAALRR
FT                   LIGAFTQPGDLVLDPLSGSGSTLAAAHLLGRDWLGVELDVAHYQTAGKRMAALQQRDRK
FT                   AAA"
FT   gene            512201..512491
FT                   /locus_tag="Pden_3358"
FT   CDS_pept        512201..512491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3358"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71431"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7D7"
FT                   /protein_id="ABL71431.1"
FT                   /translation="MRWIVTKDHHGGCIGLGEDADGVPARGKPEDGDALPVEFRLYTAR
FT                   GRLLFEGRCGDIAADWWHGMEPLLYAWTTFRCRRLTWRPAETDEPWRPLRP"
FT   gene            512788..513231
FT                   /locus_tag="Pden_3359"
FT   CDS_pept        512788..513231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3359"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   atc:AGR_L_1711 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3359"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71432"
FT                   /db_xref="GOA:A1B7D8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7D8"
FT                   /protein_id="ABL71432.1"
FT                   /translation="MFEIRTSTDQDTARVMDIWRRAVDATHDFLASHDRAAIDDELSIF
FT                   LPQVRLSLAVDHTDNPLGFMFLHEGHLEALFIDPDHHGRGMGTALIRAALADHPDLTTD
FT                   VNEQNPKALGFYERLGFERTGRSPCDGQGRAYPLIHLRYRSPA"
FT   gene            complement(513239..513475)
FT                   /locus_tag="Pden_3360"
FT   CDS_pept        complement(513239..513475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3360"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71433"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7D9"
FT                   /protein_id="ABL71433.1"
FT                   /translation="MHGTKWTDADGQDRCGCGVDDDTGFPSRARLAGTGDERRFVGDDI
FT                   PRAEARGRTLPAAGFSMGAAGCGRPHRPNRARG"
FT   gene            513986..514396
FT                   /locus_tag="Pden_3361"
FT   CDS_pept        513986..514396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3361"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: nha:Nham_4669 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3361"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71434"
FT                   /db_xref="GOA:A1B7E0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7E0"
FT                   /protein_id="ABL71434.1"
FT                   /translation="MQNIVILAGTIRQAPETRTTRTGTDVTRFKLVTSRPRYSEGRVVR
FT                   DEKGYRVEDAEWHRIVAFNGLGRTIQQYCDTGTKVLVRGRIHYTKWQDAEGQDRYGCEI
FT                   VAETVDFLSRAPQSETDDEDEGRFIDEDDIPT"
FT   gene            514440..514847
FT                   /locus_tag="Pden_3362"
FT   CDS_pept        514440..514847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3362"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71435"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7E1"
FT                   /protein_id="ABL71435.1"
FT                   /translation="MGKAVRPEAAPAREGFPTGLTGRRSSGGATPADLPSPDPPAFTGE
FT                   EETGAWEKGLESEAAPRRHRWASHDRRRVGGHGAFCFRAEGNGCRRRTGAATRVFRTLR
FT                   QGAWKPSKRLKIIDKTPQSTCIKALFLLDYS"
FT   gene            514954..515157
FT                   /locus_tag="Pden_3363"
FT   CDS_pept        514954..515157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3363"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71436"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7E2"
FT                   /protein_id="ABL71436.1"
FT                   /translation="MHNATFEINVPANPLAGHINLEDIEMGMDADTGVKARTSRDSMTL
FT                   MVIVHATDAGDAANWLQKAGLI"
FT   gene            515762..515974
FT                   /locus_tag="Pden_3364"
FT   CDS_pept        515762..515974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3364"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71437"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7E3"
FT                   /protein_id="ABL71437.1"
FT                   /translation="MNRPTTVTELMAEAANALIRRDPHRLEELERISRGWMQTHDEELA
FT                   QIILLQAMTEAADLLLDTPSEIESA"
FT   gene            complement(515995..516369)
FT                   /locus_tag="Pden_3365"
FT   CDS_pept        complement(515995..516369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_3838 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3365"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71438"
FT                   /db_xref="InterPro:IPR018754"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7E4"
FT                   /protein_id="ABL71438.1"
FT                   /translation="MARIRLAIIVPLDEDLMLRLNSIRRFHRLLTGKPIRPIPSLQALS
FT                   ASERYRATLMLRAWDGADSGASRRDIAGVLFRSDFSGLSAAEWKSASERRQLARILAEA
FT                   RAMIGGEYLTLLRGDVRRRR"
FT   gene            complement(516539..516805)
FT                   /locus_tag="Pden_3366"
FT   CDS_pept        complement(516539..516805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3366"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71439"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7E5"
FT                   /protein_id="ABL71439.1"
FT                   /translation="MPSSTDWRSPGYDDRFRALDRARMTFQFLRRNRRYRAEYSRIRKH
FT                   IGRGVPPADSVREEIARMARRWGLMFPGRSCPSGIGRPAALAS"
FT   gene            complement(516952..517215)
FT                   /locus_tag="Pden_3367"
FT   CDS_pept        complement(516952..517215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3367"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3367"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71440"
FT                   /db_xref="InterPro:IPR018754"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7E6"
FT                   /protein_id="ABL71440.1"
FT                   /translation="MAADAFEETPPQSERLTGYDEAHLTTYLRLLDAEEEGADWREVAR
FT                   IVFGLDVAADPDRAKRIHDSHLARARWMTEAGYRQILKPRMR"
FT   gene            complement(517401..517637)
FT                   /locus_tag="Pden_3368"
FT   CDS_pept        complement(517401..517637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3368"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   mlo:msr6108 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3368"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71441"
FT                   /db_xref="GOA:A1AYA3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA3"
FT                   /protein_id="ABL71441.1"
FT                   /translation="MPGDSSGMRLRERVARNLRRLRQEKSLSQEELADRADINRNYVGM
FT                   LEREENAATVDMLEKLAAVLEVDPVELLRRDKD"
FT   gene            517829..518098
FT                   /locus_tag="Pden_3369"
FT   CDS_pept        517829..518098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3369"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0845 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3369"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71442"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA4"
FT                   /protein_id="ABL71442.1"
FT                   /translation="MQNEPDPDWPRFVRTEEAARLLDLSPRTLEKHRCGGTGPVYRKLG
FT                   GRVVYTIADLRAWIEGSARQSTSEMAKIARKPDRTLAEARRAGR"
FT   gene            518095..518964
FT                   /locus_tag="Pden_3370"
FT   CDS_pept        518095..518964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3370"
FT                   /product="putative replication protein A"
FT                   /note="KEGG: nwi:Nwi_0846 possible replication protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3370"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71443"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA5"
FT                   /protein_id="ABL71443.1"
FT                   /translation="MSSPISARRICGGRQMELFRPVASDIAARDSRDLMSWPFFSLAKS
FT                   RRVVPIDFHMGPVSIRVEATPEHGMATIWDADILIWAASQIVEARNQGLRTSRLMAATP
FT                   YEILTFIRRGDSARSYLRLKAALDRLQSTTVATSIRQPAERRRHRFSWINEWKELLDDQ
FT                   RRPLGIELILPDWFYAGVMDDALVLTIDRAYFDLKGGLERWLYRLVRRHGGRQPGGWSF
FT                   DLRHLHLKSGSLSPFKRFAFEVRAIVQRQPLPGYRLSLAVGSDGLPRLCFQPAPANPFA
FT                   AAPRAARR"
FT   gene            519220..519720
FT                   /locus_tag="Pden_3371"
FT   CDS_pept        519220..519720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3371"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_2334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3371"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71444"
FT                   /db_xref="InterPro:IPR021263"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA6"
FT                   /protein_id="ABL71444.1"
FT                   /translation="MSARHPEQPRPDPGSTTFVDLIWQEKRVEHWLRFGRFCHEHRIDR
FT                   QRRTVGFASDSTFAVVRWAGNDYGTVVSRLDILRAVAPGEPFQTLPFIRPGAEILLRVS
FT                   GWPKVERVLQAVDAVEALGIDPCLVSLEHWRHVHNRIAAGEPFRTYAKAQHAAWLKRRR
FT                   VGA"
FT   gene            519717..521225
FT                   /locus_tag="Pden_3372"
FT   CDS_pept        519717..521225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3372"
FT                   /product="C-5 cytosine-specific DNA methylase"
FT                   /note="PFAM: C-5 cytosine-specific DNA methylase; KEGG:
FT                   ngo:NGO1894 putative 5-methylcytosine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3372"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71445"
FT                   /db_xref="GOA:A1B7F1"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7F1"
FT                   /protein_id="ABL71445.1"
FT                   /translation="MTMPRASLSLPLHVLDLFSGAAGGWSLGLHRAGFMTIAACEIVEW
FT                   RRILYSENFPHVRLYADIRDLTATRLVSDLGCLPDIVVGSPPCQDISSANTKGKGIEGE
FT                   RSGLYLEAVRLVGECRPRWFAFENSSNLRTRGADRLLDALEALGYACWPCVVGAADIGA
FT                   NHVRKRSWLIGCDPRQLADTRVAIPAGRHAAGGRIGGAEGDEGVGAFRAVPQSPAADAD
FT                   GLGRDEGRGGWRGGLDISAADDPGDAAEDGRGSRRPGRSAEPASAPQQPPCGDDGHADG
FT                   ECGATGERAAEAQGQDDLGSGPFRPQPDDRRGAAFRQTAAPGTRNLTDADQARQPHGRL
FT                   ESGLRPAQIADHGRGDGQSDGWCDDRPGAGQMGGRAGFGGDLAEPWPHWNGGLAHHIRV
FT                   DDGVSAWLARTRIALGNRKGTSAASLIVEAFGDAVVPQIPEAIGRAILRSEAALNAVLG
FT                   GAPASDAAADDSPTMSTVAGDAATDGDAVGNAPTDNPADHGGAS"
FT   gene            521222..521788
FT                   /locus_tag="Pden_3373"
FT   CDS_pept        521222..521788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3373"
FT                   /product="conjugation peptidase TraF, Serine peptidase,
FT                   MEROPS family S26C"
FT                   /note="KEGG: mes:Meso_2333 conjugal transfer protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3373"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71446"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7F2"
FT                   /protein_id="ABL71446.1"
FT                   /translation="MTRRNRITYLAATALAVLVIGGISVTEIAPRLIWNASASLPLGLY
FT                   RVEPPINLALGDLVAVTPPEPLAQFVTARGYIGPGVPLLKRVAALPGTRVCREETTITV
FT                   DSQAVGEARERDSLGRPLPVWRGCRLIVGGEIFLMNRDVGDSLDGRYFGPLPLGSVTAR
FT                   IVPLWTDTAGDGRFRRPAIGAESGL"
FT   sig_peptide     521222..521302
FT                   /locus_tag="Pden_3373"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.898 at
FT                   residue 27"
FT   gene            521824..522159
FT                   /locus_tag="Pden_3374"
FT   CDS_pept        521824..522159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3374"
FT                   /product="protein of unknown function DUF736"
FT                   /note="PFAM: protein of unknown function DUF736; KEGG:
FT                   mes:Meso_2332 protein of unknown function DUF736"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3374"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71447"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7F3"
FT                   /protein_id="ABL71447.1"
FT                   /translation="MPQIGEFTRTQSGYEGRIRTVTLDLNLVFVPTHNADIEKAPDYRI
FT                   HLDGEDGPEIGAGWTHSGEKAGTYISVALDDPALVQPIRARLFQSDEQGRSWGLHWSRP
FT                   RKRDERD"
FT   gene            522163..522981
FT                   /locus_tag="Pden_3375"
FT   CDS_pept        522163..522981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3375"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   mes:Meso_0517 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3375"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71448"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7F4"
FT                   /protein_id="ABL71448.1"
FT                   /translation="MPQSVHRIADGRAGAARCAAVLLLSGLSFAAVPAAGLLTQTVQPA
FT                   AQQTRDPFAAHVAEASLRFGIPPGWIRAVQHVESRGNPRAVSPKGAMGLMQIMPKTWAA
FT                   LRARHGLGGDPFDPRDNILAGAAYLREMHDRYGTISGMLAAYNAGPGRYDEHLVSGRTL
FT                   PAETRAYVATLASMLGGDPLLGTSSVAAAPPDWREAPLFAGSTTDGPDAERPQLGGLFV
FT                   RRSAAEPVLSDGALAADPEPPAEPSDTAPDAAAPQSDTLFIRRSDAGSAQ"
FT   sig_peptide     522163..522255
FT                   /locus_tag="Pden_3375"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.991 at
FT                   residue 31"
FT   gene            523031..523612
FT                   /locus_tag="Pden_3376"
FT   CDS_pept        523031..523612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3376"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71449"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7F5"
FT                   /protein_id="ABL71449.1"
FT                   /translation="MRIAYADPPYIGCAHLYRDRSDYAGEVDHAALIERLERDYDGWIL
FT                   HAAATPRSFAVLAPLVERTGARWMAWVKGFAAFKRNVPVAYAWEPVIVKPARKPVVSKR
FT                   LVLRDWVQESITLRRGLTGAKPEAVCHWAFEMVAARPEDRLDDLFPGTGAVTAAWHSWQ
FT                   RKFTLPDDPLPDFPQPDSARRGRSRLGGPS"
FT   gene            523854..525593
FT                   /locus_tag="Pden_3377"
FT   CDS_pept        523854..525593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3377"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll0044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3377"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71450"
FT                   /db_xref="InterPro:IPR021795"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7F6"
FT                   /protein_id="ABL71450.1"
FT                   /translation="MSNEDDFRIRSGRIRSSRSQRARPFVAQALAAAQKAGGRVSRSGR
FT                   IVSPGASRFGRGRTAAVRANRLITRRTRLCTVKVRVVRRIGQAAALPRHLGYLGRDGVA
FT                   RDGEKAHMFDPSSDDADIREFAERSEDDRHHFRFIVSPEDAADMADLKQFARDLMAQAE
FT                   KDLGTELDWIAVDHWNTDNPHVHVILRGRADDGKDLVISRDYIREGLRDRAQDLITREL
FT                   GPRHDHEIRRSLMRQVEAERWTALDRQLVRDAGKSGVIDMAPGIDGPRDDFLPQKVGRL
FT                   RHLERLGLADRVGQAQWVIRREAETVLRDLGERGDIIKRIHRALSGQGIDRGVSDYVFA
FT                   SEKADGPILGRLVERGHDDELKGTAYAVIDGVDGRTHHIRLPHFDAAGDSAPGSIVELR
FT                   SYEDAKGVRRTALAVRSDLDIRAQVTASGATWLDRQAVSRDPAVLSEAGFGAEVRQTMQ
FT                   RRTEHLIGEGLAERQGSRIVFARRLLDRLREREIGALAEKLAAETGLSFERAARGDTIA
FT                   GTYRRRFALASGRFAMIDDGLGFKLVPWTPSLERHLGQHVSGVVRGDGGVDWSFGRKRG
FT                   LGL"
FT   gene            525662..525913
FT                   /locus_tag="Pden_3378"
FT   CDS_pept        525662..525913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3378"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: rru:Rru_A0090
FT                   prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3378"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71451"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7F7"
FT                   /protein_id="ABL71451.1"
FT                   /translation="MKELQLRDAKATLSAVVDQAVAGEPTVITRHGRKEAVLLSFEEWQ
FT                   RISRVPDFADLLLAFPGDAEDIPERARKPARALRDPGL"
FT   gene            525917..526351
FT                   /locus_tag="Pden_3379"
FT   CDS_pept        525917..526351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3379"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   rru:Rru_A0091 PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3379"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71452"
FT                   /db_xref="GOA:A1B7F8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7F8"
FT                   /protein_id="ABL71452.1"
FT                   /translation="MYLLDTNILSAFAPTRRDADAEALAAWMRAQSDRLYLSAISIAEI
FT                   EAGIARAIRIGASTKAPALRRWLAAVEHFYASRILPFGIEEARHAGAILDRARAHDPGF
FT                   EDIAIAATAAAHGLTVMTANERHFAPLGVPYVNPLKELPA"
FT   gene            complement(526562..526813)
FT                   /locus_tag="Pden_3380"
FT   CDS_pept        complement(526562..526813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nmu:Nmul_A0143 ATP-dependent endonuclease of
FT                   the OLD family-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3380"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71453"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7F9"
FT                   /protein_id="ABL71453.1"
FT                   /translation="MTTLKWRWKVAGLADVVQAGQPIVGQIEAWAQAQGVNLDEHWKVP
FT                   LSIKVKQRMLTRGLNAIPHDFVDRWVGLFEAFSPQDAQ"
FT   gene            526818..527030
FT                   /locus_tag="Pden_3381"
FT   CDS_pept        526818..527030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3381"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: rsp:RSP_3202 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3381"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71454"
FT                   /db_xref="GOA:A1B7G0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7G0"
FT                   /protein_id="ABL71454.1"
FT                   /translation="MTPVQYQKQLRLQEARRLLLSDDADVARIGYAIGYESPSQFSREY
FT                   RRLFGSPPGRDGQQIRRSLTSQVEG"
FT   gene            complement(527269..527922)
FT                   /locus_tag="Pden_3382"
FT   CDS_pept        complement(527269..527922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3382"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: bja:bll2927 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3382"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71455"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7G1"
FT                   /protein_id="ABL71455.1"
FT                   /translation="MTAILSEETRMRDQIAAVGKSVFDRGLTAGSTGNISVRLGDGRLL
FT                   MTPTNTSLGVLDPARLSLLDADCNHLSGDKPTKEAFLHGCMYCRRAGANAVVHLHSTHA
FT                   VAVSILADTDPEDALPPLTAYYAMRVGHLPMVPYYAPGDDALALAVKERAGSAHAVLLA
FT                   NHGPVVAGKTLLDAQYAAEELEETAKLHLMLQERKLNILPRAEADRLSAISSAG"
FT   gene            complement(527919..529178)
FT                   /locus_tag="Pden_3383"
FT   CDS_pept        complement(527919..529178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3383"
FT                   /product="type III effector Hrp-dependent outer"
FT                   /note="PFAM: type III effector Hrp-dependent outers; KEGG:
FT                   reu:Reut_A1426 type III effector Hrp-dependent outers"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3383"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71456"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7G2"
FT                   /protein_id="ABL71456.1"
FT                   /translation="MLLGAIADDLTGATDLSLILSRAGMSVIQVVGVPDEGDDFGNADA
FT                   VVVALKSRTIPAAEAVEQSLASARVLRARGARQLYFKYCSTFDSTAEGNIGPVTDALLD
FT                   LIGETRTVACPAFPQNGRTVYQGHLFVGSQLLSDSPMKDHPLTPMRDADLRRVLAAQTA
FT                   RPVDLVAHATVAQGAEAVAAALAGAQGIAITDAICNADLMTLGKALAGYGLVTGGSALA
FT                   LGLPQNFRAAGLLAEDAGNADFTAPKGPGIMLAGSCSAATRQQVARAEANGIATLALDP
FT                   LAIASGETRIEDALAFIAAHAGDPRPPLLYSSADPEAVAQAQEKLGRAQAGVVVEAFLS
FT                   GVARKLAEAGTRRFIVAGGETSGAVVEALEAMAVRIGPEIDPGVPWVVSTDPVAPMALA
FT                   LKSGNFGCEDFFAKAWDMLA"
FT   gene            complement(529196..530473)
FT                   /locus_tag="Pden_3384"
FT   CDS_pept        complement(529196..530473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3384"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: gka:GK1972 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3384"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71457"
FT                   /db_xref="GOA:A1B7G3"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7G3"
FT                   /protein_id="ABL71457.1"
FT                   /translation="MILLVFILSLLAAILIGIPIAFGLILSGIVMMWWLGALDWQLIAL
FT                   QMTNGADSFPLLAIPFFMLAGEAMNAGGISKRLVNFGMTLVGHKRGGLGYVTIVAALLL
FT                   ASLSGSAVADTAVLAGMLLPIMRQAGYDINHSGGLIASGGIIAPILPPSIGYIVFGVAG
FT                   GVSITKLFMAGIAPGIMMALTLAVTWWFLSRNSEVSVPQRAPLREVLKAAGQASLAFIL
FT                   PVIIIVGLKAGIFTPTEAGVVACVYAIFIGMFVYRELHPKMLYHVMIAAVRTTASVMLL
FT                   VAAASITAYLVAIANIPGVIGDMLSGVREHPVLLMLVIMTIILVVGTALDFIPTILILT
FT                   PVLLPIAKSAGIDPVYFGVMFIMAGAIGLLTPPVGAVLNVVCAVGNMRYTDAVRGVVPF
FT                   LIVQAFLILLLALFPQLVIVPANWFY"
FT   sig_peptide     complement(530402..530473)
FT                   /locus_tag="Pden_3384"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.884 at
FT                   residue 24"
FT   gene            complement(530470..531030)
FT                   /locus_tag="Pden_3385"
FT   CDS_pept        complement(530470..531030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3385"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component; KEGG: msu:MS0052 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3385"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71458"
FT                   /db_xref="GOA:A1B7G4"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7G4"
FT                   /protein_id="ABL71458.1"
FT                   /translation="MNASPNSSPLGTQLQRIADLGFRLIEAVLVLIFTGLIVLVFSNVV
FT                   MRYLLDTGLVVTDEVSRMMFVWICFLGAIVVARRNEHLDVDLLTAHMSPATAHVARMVA
FT                   LLGVIVCCVVLGVGAWQQTMFNTSNIAPASGLPTAVTYAAPFVGAVGIGLVSLTELISL
FT                   LIRGPRPPAENTVEHITEKGKAE"
FT   gene            complement(531027..531698)
FT                   /locus_tag="Pden_3386"
FT   CDS_pept        complement(531027..531698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3386"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: pmu:PM1641
FT                   hypothetical Synechocystis sp."
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3386"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71459"
FT                   /db_xref="GOA:A1B7G5"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7G5"
FT                   /protein_id="ABL71459.1"
FT                   /translation="MRIVDLSMPVRDHFRWKPEITVKGNKSAGDQFRVTRLGTTCHGFS
FT                   HVDAQAHFIADGPTIEATPLDQVVGAARVFDLSAIGPDTEITPEILAAADPGGKQGDII
FT                   LLATRWDTRRDHETRAFWTEAPWLNRAAAEWLWTLRPRALAVDFPQDYPIRLLLDGIEV
FT                   PDAEHVTHDVLLRNGVTLIEYVVNTAALTQSRVFLSAAPLKIENADGAPARIYAIEGLP
FT                   L"
FT   gene            complement(531715..532722)
FT                   /locus_tag="Pden_3387"
FT   CDS_pept        complement(531715..532722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3387"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: hso:HS_0762 possible C4-dicarboxylate
FT                   transport system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3387"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71460"
FT                   /db_xref="GOA:A1B7G6"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7G6"
FT                   /protein_id="ABL71460.1"
FT                   /translation="MIKINRRLFVQGAAAVSAASILATPQILRAQGSVKLRFGHPHPET
FT                   DSWQDAGKWMAEQLAERSGGEISLDIFPNGILGNDSTMINSVRGGTLDLMVTGNPFFTG
FT                   LAPQLNVLDLPYLFHSREHVGAVLDGELGDELRMGLAGSGLKALSTWETGWRHITNSRR
FT                   PVHTPDDVKGLKIRTTPNPAHIMAFELLGAVPTPMAFTELFTALEMRSIDGQENPTTLI
FT                   LNSNFYEIQKYISLTGHAFTSSPLVMNETKFNGLGADQQTLLVSVAAEAAKLQRQMNTE
FT                   REGTALAALKENGMEAVEDIDQAAFRAIVEAPIKEDFSAKFGPELIDRITALAS"
FT   sig_peptide     complement(532630..532722)
FT                   /locus_tag="Pden_3387"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.819 at
FT                   residue 31"
FT   gene            complement(532760..534163)
FT                   /locus_tag="Pden_3388"
FT   CDS_pept        complement(532760..534163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3388"
FT                   /product="SAF domain"
FT                   /note="PFAM: SAF domain; KEGG: rru:Rru_A3141 homoserine
FT                   dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3388"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71461"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7G7"
FT                   /protein_id="ABL71461.1"
FT                   /translation="MNYHIQFPPSSDKVATTIIGTGGFGRSYLAQCRKVPLLEARVAVD
FT                   VTAEQAARTMIEVGYPEARIRKCDTAEEAAAAWAAGDFIAAGDFAHVAALPVHVVIEAT
FT                   GHPEAGARHCRLAVEAGHHVALVSKEVDSVVGPGLAALAREKGCVVSPVDGDQPSLLIE
FT                   LITWAELLGFEIIAAGKSSEYDFIFDAAAGTLTSDGRMVSAPDFAQWADLDDRPAAEVV
FT                   AGRANAASALPQRAVPDLCELTVVANATGFAPDAAPLHAPIARITEVPTLFSTRDEGGI
FT                   LDGRRVLDVFHCLREPGEVSFAGGVFVVIRCDDAETWKMLEGKGHVVARDRNTAMIYNP
FT                   RHLLGLEAATTILSLGLLARGTGGHAPAHHIDLVAFADRDLAAGEALVMGGHHHSIPGV
FT                   SARMVAAGPLSDESPAPFYLASNQTIRRPVAAGSYIRMGDLEHRSNTELLTLRQRQDAI
FT                   FAKAKGMQG"
FT   gene            534444..535115
FT                   /locus_tag="Pden_3389"
FT   CDS_pept        534444..535115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3389"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: sme:SMb20773 putative transcriptional
FT                   regulator, GntR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3389"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71462"
FT                   /db_xref="GOA:A1B7G8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7G8"
FT                   /protein_id="ABL71462.1"
FT                   /translation="MDIEKQWPRGQRAAFVANFIRDQIVSGELAASTRINERVLTEQLG
FT                   VSRTPLREAFKILESEGLLTIEPNRGAMVTAISPQEVELAIEVLIALESVAAERACKHA
FT                   TDAQIDEIQALHDEMVGAWKAGALMRYFHINQTIHQKIVDCAANPTLSRLYMAESQRIR
FT                   RFRYAGNQISDRWARAVYEHEQILDALRHRQGALLREVLRSHHLSGWRTTRAVLEGEIR
FT                   L"
FT   gene            complement(535370..538231)
FT                   /locus_tag="Pden_3390"
FT   CDS_pept        complement(535370..538231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3390"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71463"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7G9"
FT                   /protein_id="ABL71463.1"
FT                   /translation="MRTCGPYVIGKMVLKPGLAGLGRIEVHPARFSGLAESGILVIQSL
FT                   AAFMTKNTLPALTAFLLAAIGPALAQDLPPYQSLETRHVCTAQPIHETPAGTQARVLGA
FT                   GAEVMLRDVTFGPEGGAWFALDYPTGKGLERAIGYLPVSSVKHFCAPEGAAPEDSTSRL
FT                   QSYLAPPNTCHVVAARADTVEELNGQARSMPAYAPVISGYRLHSGGYALSLGLVSTNLR
FT                   DRIGSPAARLQTGITCVSGADFAEALVHDGTVLTPADPGGLSDDAARLSTAQALRARGL
FT                   ESGDPAMLKRSCDLGLGAACTEFASRIHDAPDGPGRGPAVVTRYALLGCMAGDMEGCQM
FT                   AINRQGNTLELTREQVLPDARPDDGSVTTEISKGLCDAQDRFGCVLLARGTAVDRAPSL
FT                   VEASSNFSANLTACQQGITWICEGLNDDLKTVSAARGSGLTGNERYALAGIEAGLCAPG
FT                   PREPNQRSCTGAYYLYRDFLNYSDAATLDAGRVAQATAFLSSGCAAGDPPACATLAGMA
FT                   GFWPEADRRAATARAIALCDAQSAKDTICESLGGVLDPTFPESRPVMAARYERLARSCL
FT                   SPGEGDAQDCAWALHSYAALDAPDGLATAEAMLKDACGPANIKGCPALAQLYGTEGQSL
FT                   SGVTIPGRNDPEARIAALRMGCRGGVEAGSTCDQLADLMTVEGDGENALHIRGEACERA
FT                   IAAGEERDLWECYDAAKQALDQSQRLPGAHRWADYVCRGADVSVSPYGCKLVGNMLAQG
FT                   LGQPADPAGALSAYQRGCFHPRVATTDGEACLHYGTMLIEAVRRGEKPAEPLAFAHRED
FT                   GEEPEPPLMLAEASRAFDMGCLDSIAPACAANVRLLEEWSTGDLPYDRFICQVRNAAGE
FT                   VTSEKPCRGLIFYQAAEARKETREQVGLNVYVWPDGDRSVTYIRDGIWRLNEVRTDYPA
FT                   TEGNSRCWRNPISTRSFCVTPAG"
FT   gene            complement(538268..539467)
FT                   /locus_tag="Pden_3391"
FT   CDS_pept        complement(538268..539467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3391"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71464"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7H0"
FT                   /protein_id="ABL71464.1"
FT                   /translation="MRKLKCTSCGGTLGLVTTAEGHLIGRCGSCGSEYVVETQGRHHVV
FT                   LEHRFPDGQPAGAVLPGPVSRRGALAAGLCVMAIGGGALVLPQFLRSAHRAAPEEGLAV
FT                   KTVFNVGGEGAGPGLFREYPSYIGIDSLGRAMIQDGGRRFYIFGPDGAFLNQFPSPEDS
FT                   GAMLAVLPDGSIITDGSRRILRIDPASGEIAGSQPMPEGESYWSNGEGSCVTPDGGLAI
FT                   YRVAPRSAGDDASLPPSDTLILLDRNLTEQRRLTGLMAQAIAADPMVTSAPRATGIAIN
FT                   GAGTIYIVMRRSEDQDSRDGIFEFNADGRFQRRIATTPKFFPCIVASPDGRIWLSDPWD
FT                   NMLEEVTPDGIRRVGLAAVGRENGAQIGNIRSIAAYPNGDIAVIGVSAWRFARLSIGTG
FT                   "
FT   sig_peptide     complement(539402..539467)
FT                   /locus_tag="Pden_3391"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.695 at
FT                   residue 22"
FT   gene            complement(539614..539919)
FT                   /locus_tag="Pden_3392"
FT   CDS_pept        complement(539614..539919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3392"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71465"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7H1"
FT                   /protein_id="ABL71465.1"
FT                   /translation="MHHDHNNPEHQPRAPLPRERLRPRAPSDGAASFGGPLPDHADRLN
FT                   CGGPLAVSLARWMARDRVRQSSHSACAAAKSCYHGSEMDLHAFCTFGTSTRGVRQA"
FT   gene            539981..540872
FT                   /pseudo
FT                   /locus_tag="Pden_3393"
FT                   /note="similar to phage integrase family protein;
FT                   frameshift"
FT   gene            540885..541514
FT                   /locus_tag="Pden_3395"
FT   CDS_pept        540885..541514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3395"
FT                   /product="putative transposase"
FT                   /note="KEGG: sal:Sala_0067 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3395"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71466"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7H2"
FT                   /protein_id="ABL71466.1"
FT                   /translation="MTRSKLEIADIFRRYGPAWRRANAGHVSLTQLKVMSAIEACRIEA
FT                   LGGHVAACGKCGHHHIAYNSCKNRHCPKCQAPAARDWMEARADDLLPVEYFHVVFTLPA
FT                   RIAQIAFWNKRAVCRLLFKGEGMTAIGPKECPNAETVTTIAADPKRLGARIGMTAVLHT
FT                   WGSALTHHPHTLREPCPCCGGPMRIVEIFRRGQKPSSRDPPREKAA"
FT   gene            complement(541860..542732)
FT                   /locus_tag="Pden_3396"
FT   CDS_pept        complement(541860..542732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3396"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: abo:ABO_1099 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3396"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71467"
FT                   /db_xref="GOA:A1B7H3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7H3"
FT                   /protein_id="ABL71467.1"
FT                   /translation="MQPQQNNLLETDLLKTFVTISETGNFTVAAKRVFRTPSAVSMQIR
FT                   RLEDQLGRALFVRHPRHVTLTADGEAFLVHAKDILRINDEALSRFRVPQLEGRVRFGAP
FT                   DDFGVRYLPAILSRFAATHPLVEVEVFLSTSVILARRFEAAEIDMILTVSAQSDPAPGQ
FT                   VIHSEPLVWVGARDGMAFSRTPVPLALSSHGCPWRAAALAALDKASRRYRIAYTSEAAA
FT                   GQLAAVMADLAIAPLPVSLVDEQHRRLTEKEGFGAIGSYQLRLQKNPDIGSAAQAFADH
FT                   VRESFGRQE"
FT   gene            542800..543111
FT                   /locus_tag="Pden_3397"
FT   CDS_pept        542800..543111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3397"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71468"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7H4"
FT                   /protein_id="ABL71468.1"
FT                   /translation="MPPWPEPRRITMAKEICTMSPPSRSPWIGAAFRALMSRLRGLFET
FT                   YRRNKERRDAFLTLLRLDDQILDDIGVSRAEVECAARLPLRSNASDALAAKADARRKG"
FT   gene            543498..543977
FT                   /locus_tag="Pden_3398"
FT   CDS_pept        543498..543977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3398"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /note="KEGG: rpb:RPB_3880 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3398"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71469"
FT                   /db_xref="GOA:A1B7H5"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7H5"
FT                   /protein_id="ABL71469.1"
FT                   /translation="MTDVLTNRRTLLIAASVAVVPGLFVPARAQGLAPTPSMRGGANNY
FT                   LPGAPIVDRIGGGGFWMTGSVRRVGDGVPLAGQRIQIWAHTTEGHERDPHSHGATLTDA
FT                   NGVFRLEMPQIVPAFGQPHGHLAYDSGDFETVFLRPVMRSARDTSLHADFVLVPV"
FT   sig_peptide     543498..543587
FT                   /locus_tag="Pden_3398"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.972 at
FT                   residue 30"
FT   gene            543983..544609
FT                   /locus_tag="Pden_3399"
FT   CDS_pept        543983..544609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3399"
FT                   /product="Ferric reductase domain protein transmembrane
FT                   component, N-terminal domain"
FT                   /note="PFAM: Ferric reductase domain protein transmembrane
FT                   component, N-terminal domain; KEGG: rde:RD1_1724
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3399"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71470"
FT                   /db_xref="GOA:A1B7H6"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7H6"
FT                   /protein_id="ABL71470.1"
FT                   /translation="MRIGWADLVRGILVWTGLTTAVAVPVAAAAASPLLAWREPIYIAA
FT                   GFTGVIALALLLFQPLLAGGYLPGLPALKGQRVHRLVGGVLVAAVILHVAGLWVTSPPD
FT                   VIDALLFRSPTPFSFWGVVAMWAVFASALMAASRRRWRRHPHAWRLGHTVLAAVIVVGS
FT                   VVHALLIEGTMETKSKAILCGLLIAATIMAVAKMRGWTIRARRDS"
FT   sig_peptide     543983..544075
FT                   /locus_tag="Pden_3399"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.483 at
FT                   residue 31"
FT   gene            complement(544753..545640)
FT                   /locus_tag="Pden_3400"
FT   CDS_pept        complement(544753..545640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3400"
FT                   /product="molybdenum cofactor synthesis domain"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein, domain
FT                   IV; KEGG: rru:Rru_A2222 molybdopterin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3400"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71471"
FT                   /db_xref="GOA:A1B7H7"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7H7"
FT                   /protein_id="ABL71471.1"
FT                   /translation="MRPLPDDEREPRCCRTICRAHIRRIGEDVVRGTPVLKAGSRIGPG
FT                   QLAPLTALGLRSVLVVPRPRVALLSTGNELVESPGALEAGLIYDSNRPMLSRMLQAAGA
FT                   VVTDLGIAKDDPAAIAARLVGAASDHDLLISSGGAPVGFADHLTQIISRRGYLEFWRLA
FT                   MRPGKPIGFGDVDDCPTLLQPGNPLAAAAGFALIGRAILARLESRPPAGTGWRLPVATS
FT                   LSKPAGRTQILLGRLCHDPSGRSTVVEPLPDQGSASLRYLALADVMILLHSEQTVINGS
FT                   DPVEIVPVRQGFPA"
FT   gene            545967..546131
FT                   /locus_tag="Pden_3401"
FT   CDS_pept        545967..546131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3401"
FT                   /product="transposase, IS4 family"
FT                   /note="KEGG: nwi:Nwi_2919 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3401"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71472"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7H8"
FT                   /protein_id="ABL71472.1"
FT                   /translation="MDRTLYRLRNLVERCCNKPRHARRVATRHGKTAESFLDFIDMTSI
FT                   RLWLRHSST"
FT   gene            complement(546172..547575)
FT                   /locus_tag="Pden_3402"
FT   CDS_pept        complement(546172..547575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3402"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: rfr:Rfer_3645 periplasmic sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3402"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71473"
FT                   /db_xref="GOA:A1B7H9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7H9"
FT                   /protein_id="ABL71473.1"
FT                   /translation="MLSRLSLRWLASLWVVLAMAAGGGGVWLWMASQAAWQTHLDRAYI
FT                   AGLALHDSLENRSALPAGVTMVQQGAAPSLPNGWRETLLTLTGGGRPDLSRGARLSIRV
FT                   QSPDIQYPVAEVQSFGGGSQAAGLASVTRTLARFCSTPRLFVQFDTGPWMRIEGAAIWG
FT                   CDAAPPDRRLLAALVLAGALILLLGWVAEVSGAFAGFAAALRDHRARNAALPVGGVEEL
FT                   RQTAEAVNAYVAQDRAALENRALVLSGVSHDLGTPATRLRLRSTLIEDDTLRSKLEHDI
FT                   DEMTTMIEGVLTYTRAEIGAEPFRQLSLTSLAEAVVADYQDVDMPVRLVPAPIRAARAG
FT                   TLFARSRRQPVETHAILMRGQPTSLRRALSNLIDNALKYGREAEVMVDGDADDAWITVT
FT                   DRGSVLTEEDLARLTGAFQRGGNAGTAPGVGLGLAIVSTIAAQHGGRLEFFRADQGLAA
FT                   KLVLCRRWA"
FT   sig_peptide     complement(547471..547575)
FT                   /locus_tag="Pden_3402"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.803 at
FT                   residue 35"
FT   gene            complement(547568..548272)
FT                   /locus_tag="Pden_3403"
FT   CDS_pept        complement(547568..548272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3403"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rfr:Rfer_3646 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3403"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71474"
FT                   /db_xref="GOA:A1B7I0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7I0"
FT                   /protein_id="ABL71474.1"
FT                   /translation="MSLHRLLLVEDDAEMAAMLAAYLQRQGFHVSRADSRAGALEALRA
FT                   GRVDLILLDVSLGEDDGVQICAEIRAAQDVPIVMVSALSADHQRMAGYEVGADDYIAKP
FT                   FNPDLLLARIRAVLRRARRAPSLTHRRRDAILRFQGWRYDARRDEVTAPGGWQVSLSSR
FT                   ETALLRVFLANPLIPLTREEIAAALDHDEAAGGRAIDMLVGRLRQKTDPALIRTERGTG
FT                   YVLAAEVSRDDA"
FT   gene            548443..549684
FT                   /locus_tag="Pden_3404"
FT   CDS_pept        548443..549684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3404"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: pub:SAR11_0769 probable binding protein component
FT                   of ABC sugar transporter; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3404"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71475"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7I1"
FT                   /protein_id="ABL71475.1"
FT                   /translation="MTMKPLLAASTAVMLAGPVLAEPQAEVLHWWTSGGEARSVAVLQE
FT                   QFAAEGGSWTDMPVAGGGGDAAMTALRARVLSGNAPTAVQLKGPAIQEWYEETGLADIG
FT                   PVAEENGWEAVLPVRIAEHMQCEGQWCAAPVNVHRVNWIWGNKQILDEHGIAMPTTWEE
FT                   FNAAAETLKAAGVTPLAHGGQSWQDATVFETVVLGLGGPEFYQQALVDLDPQALNSDTM
FT                   RQVFDQMRVIRGYVDDNFSGRDWNLATAMVMNGEAAFQIMGDWAKGEFLAADKKPGVDF
FT                   VCAETPGGGFLYNVDSFAFFKVDGDDRQQGQALLARLIMGEGFQKTFNLNKGSIPARTD
FT                   VALDEFDDCARQSAEAMNAGAENGSLLPSYAHGMALRGAPAGAITDVVTAHFNSDMTSD
FT                   EAVEQLANAVASAM"
FT   sig_peptide     548443..548508
FT                   /locus_tag="Pden_3404"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            549751..550623
FT                   /locus_tag="Pden_3405"
FT   CDS_pept        549751..550623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3405"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rru:Rru_A0093
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3405"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71476"
FT                   /db_xref="GOA:A1B7I2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7I2"
FT                   /protein_id="ABL71476.1"
FT                   /translation="MEWLERNVPKLVLAPSFVAILVFVYGFIAWTAWISLTRSRLMPRY
FT                   EFEGIGQYERLFAAPRWDVAMDNLFIFGGLFIVISMVIGLMLAIFLDQRIRAEGVLRTV
FT                   YLYPMALSLIVTGTAWKWILNPGLGIQATVRSWGFENFTFDWLIRPEMAIYTIVLAAVW
FT                   QASGFVMALFLAGLRSVDTEIIRAAQVDGIPTHRIYSAIIIPTMAPIFLSAFIVLAHLA
FT                   IKAFDLVIALTNGGPGYATDLPATYMYAMAFSRGDLGQAAASAMVMMMVIFAIVVPYLY
FT                   SELRPRHDK"
FT   gene            550613..551482
FT                   /locus_tag="Pden_3406"
FT   CDS_pept        550613..551482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3406"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rru:Rru_A0094
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3406"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71477"
FT                   /db_xref="GOA:A1B7I3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7I3"
FT                   /protein_id="ABL71477.1"
FT                   /translation="MTSKAVTSNTMLRWGLYAVLILFALFYLMPLFVMLTTSLKSLEEI
FT                   RTGSLLSLPRELTFAPWAEAWSSACAGTQCQGLRPFFWNSVLMAVPAVAISTIVGALNG
FT                   YVFAQWRFRGANLFFAAILFGCFIPFQVVLLPMAQMLGLMGIAGTIPGLIFVHVIYGIG
FT                   FTTLFFRNYYVTIPQELVRAAKVDGAGFFRIFFAIFLPLSLPIITVSVIWQFTQIWNDF
FT                   LFGVSFSGPGSQPVTVALNNIVNSTTGVKAYNVDMAAAIIAAAPTLLVYVIAGKYFIRG
FT                   LTAGSVKG"
FT   sig_peptide     550613..550720
FT                   /locus_tag="Pden_3406"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.744) with cleavage site probability 0.436 at
FT                   residue 36"
FT   gene            551486..552592
FT                   /locus_tag="Pden_3407"
FT   CDS_pept        551486..552592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3407"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: sme:SMc04393
FT                   putative ATP-binding ABC transporter protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3407"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71478"
FT                   /db_xref="GOA:A1B7I4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7I4"
FT                   /protein_id="ABL71478.1"
FT                   /translation="MPILEIDHLQKAYGDTHILHDINISIEPGDFLVLVGPSGCGKSTL
FT                   LNCIAGLEPITGGTIRIGGRDVTGVSPKDRDIAMVFQSYALYPTMSVARNITFGMQVRG
FT                   VDKATQAAKLAEVARQLQIEPLLARKPGQLSGGQRQRVAMGRALVRDPKLFLFDEPLSN
FT                   LDAKLRVSMRTEIKKLHQDLNASIVYVTHDQIEAMTLATKIVVMKGGVIQQIGAPAEIY
FT                   NRPANMFVADFMGSPAMNLIPAQVRSEGGQTRIEIAREGAAPLVITDPVARQLPAEIVL
FT                   GVRPEDIHEATGSAHLPGLAQGAGGEVMIEIVEPAGADTFAVTHLGGKPVTARLRAESA
FT                   VRARAMFPLAFDLSKVSYFSPENGERLN"
FT   gene            552977..553237
FT                   /locus_tag="Pden_3408"
FT   CDS_pept        552977..553237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3408"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71479"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7I5"
FT                   /protein_id="ABL71479.1"
FT                   /translation="MTGTGWPGKFFILDQHGYTVFLAKSVRKWTSPGLSDAGAVSRIYL
FT                   EALSTCVILFCSHALMFLRNPQALCDAKECHALLLASRQIR"
FT   gene            553476..554615
FT                   /locus_tag="Pden_3409"
FT   CDS_pept        553476..554615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3409"
FT                   /product="creatinase"
FT                   /note="PFAM: creatinase; peptidase M24; KEGG: ppu:PP_3667
FT                   creatinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3409"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71480"
FT                   /db_xref="GOA:A1B7I6"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="InterPro:IPR039394"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7I6"
FT                   /protein_id="ABL71480.1"
FT                   /translation="MQRRQDDMRRWMAGNGVDAALFTSYHCINYYSGWLYCYFGRKYGM
FT                   VITQDAATTISAGIDGGQPWRRSFGGNVTYTDWRRDNYFRAVRQLTPGVKRLGIEFDHV
FT                   NMDLRRQLEAALPGVEFVDVGQPSMWMRSIKSAEEHKLIREGARICDVGGAAVAAAVKA
FT                   GVPEHEVAIASTNAMIREVAASFPFVELMDTWTWFQSGINTDGAHNPVTNKKIASGEIL
FT                   SLNCFPMIFGYYTALERTMFCDSVDDASLDIWEKNVAVHRRGLELIKPGAKCNEIALEL
FT                   NDMYRQWDLLKYRSFGYGHSFGVLSHYYGREAGVELREDIETELKPGMVVSMEPMVMLP
FT                   EGAPGAGGYREHDILIVTEDGADNITGFPFGPEHNIIRN"
FT   gene            complement(554677..555207)
FT                   /locus_tag="Pden_3410"
FT   CDS_pept        complement(554677..555207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_0459 creatininase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3410"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71481"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7I7"
FT                   /protein_id="ABL71481.1"
FT                   /translation="MGSGWAIFGLGLSRWKAGQVSPAHVGSSLSSPVGKTGSRNRCSVT
FT                   ARGKGRIHPCPFPGRVARTAPAAEIVGEADISRLYPDGFPGWELEHGGELETSLMLALY
FT                   PTLVDLSRAVDVEPAQFPPYDVYPAKPEWTPASGTLSSPKDASAEKGELLLEVCTKGIV
FT                   AALRAEFGTPCPA"
FT   gene            complement(555233..556117)
FT                   /locus_tag="Pden_3411"
FT   CDS_pept        complement(555233..556117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccr:CC1457 flagellin modification protein
FT                   FlmG"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3411"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71482"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7I8"
FT                   /protein_id="ABL71482.1"
FT                   /translation="MAQVYGLLEDRAGEIVISCEPRLETLLARSFPFVRFHPLRRRWTL
FT                   LWQERPIMHEEIAERILSGYLDADYLVKLRDCDHVFFPEEIMGQMELFQPGLWQSHLGR
FT                   IRAGYLRPEPTRHAHWAAQFRGSGERPVVGLLWRSAVQSHSRNPNYLSLEEMLPLIREL
FT                   PCTWVSLQPQLSPEERRLCEDHGILIPAELDLFDDMEGIAACCAALDLVVGISSLPFEL
FT                   AAAVGCPVWMLALTPAAQYKRQGTAGMDQLTVNGRVFAPRDLTLFADRNAMLGDLLEQI
FT                   VGALKAFRSERRR"
FT   gene            complement(556142..557041)
FT                   /locus_tag="Pden_3412"
FT   CDS_pept        complement(556142..557041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3412"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71483"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7I9"
FT                   /protein_id="ABL71483.1"
FT                   /translation="MEWLEFAEPLLQTQITFQTRLAILNQMQQYNRLGPVLEELLAHID
FT                   GPEPRSIALERAFHAAWFRQDAEILERLIARCLALPYPLSGPVRFAREREGIFPGLRRM
FT                   TETAALWLEGWSPPKVPQATDHTEIAEIARLAGLTGQPERGVGWLRHLLGHYPFLVRAR
FT                   LALAELLSQAGAPSEARAELDIVLTEAPQLPRGYAVYYELLSQCPGTEAETERLLRRRR
FT                   NRVKALRQPPGPDGLPPYDQESYEFELRRGALGKALLHRSGRPACHYLAAALGEAYPGL
FT                   RRPVLIPGTRARKIGLMA"
FT   gene            complement(557134..557493)
FT                   /locus_tag="Pden_3413"
FT   CDS_pept        complement(557134..557493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3413"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71484"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7J0"
FT                   /protein_id="ABL71484.1"
FT                   /translation="MLPEAITDKSDPALLLAHVQQVAGDWRHVGVLPRLLQARAMARLH
FT                   LAPDALAILDSGGKDLHSQERLLRIDLLLRLSRTRRAGEELRTLPARDLSPRSAGAGPG
FT                   WRSNGRNRPGATTPP"
FT   gene            complement(558039..558896)
FT                   /locus_tag="Pden_3414"
FT   CDS_pept        complement(558039..558896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3414"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpa:RPA2826 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3414"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71485"
FT                   /db_xref="GOA:A1B7J1"
FT                   /db_xref="InterPro:IPR018692"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7J1"
FT                   /protein_id="ABL71485.1"
FT                   /translation="MHRETIGNPLSWSAQKLAGIGRSAGAAVDGIGSHEMTLPEVNRIG
FT                   LGDIRAALRKGVKDFAALRTDVITAVALYPVIGFVLAAWAFNAGQVHLLFPLAAGFPLI
FT                   GPVAAIGLYEMSRRRERGEETDWSAVLATLTGRVLGPVLMLGCLLAVIFAFWLLAAHAI
FT                   WVVTLGPGPYDSLSVLLRDALTTSAGWTMVLAGFGVGFVFAAVVLCVSLVSFPMLIDRP
FT                   VGVPVALATSLAVARRNPGTTALWGVIVTVSLVLGMIPLFAGLIVVLPILGHATWHLYR
FT                   RAVA"
FT   gene            559011..560171
FT                   /locus_tag="Pden_3415"
FT   CDS_pept        559011..560171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3415"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: atc:AGR_pAT_469 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3415"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71486"
FT                   /db_xref="GOA:A1B7J2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7J2"
FT                   /protein_id="ABL71486.1"
FT                   /translation="MQRQVALSESSALLSGALPKPPECRTAGGASGRCDFKPLPPGRPL
FT                   CASCGSEHGFIDAPHACQNADRIGHAHDLDQTIAADIGRNVDRNITRSRQLKTLLAIVE
FT                   TGSFARAANRVALTPSAVSQQIQALENEVGVSLFNRENRPPTLTAAGQQMVEAAAELVR
FT                   AAENAIDAISGRRIVGKFVIGSVRTSAIGLLPQAVSRVVANHPGLKIRLLVGNSENLVQ
FT                   DVYAGRLDAAIIAENSLSSRDLDWSPFIREPLFLIAPPGTPVVDVRQALSAFPFVRFRS
FT                   NVPLARLIETELGRMNLPLNDIAEMDTISAVTACVENGLGVSIVPRIAAIERGVDLVML
FT                   PFGDPPVFRQIGLLQRPKGPRAGLIAELHEQLAQVSGEYGVPRPLS"
FT   gene            complement(560290..561237)
FT                   /locus_tag="Pden_3416"
FT   CDS_pept        complement(560290..561237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3416"
FT                   /product="Acetamidase/Formamidase"
FT                   /note="PFAM: Acetamidase/Formamidase; KEGG: rsp:RSP_3443
FT                   putative acetamidase/formamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3416"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71487"
FT                   /db_xref="GOA:A1B7J3"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7J3"
FT                   /protein_id="ABL71487.1"
FT                   /translation="MHHHLAATPETVLWGHIDPAAAPVLHIASGDSVTIETLSGGPRNL
FT                   PAPETGCHALAAHRDVIARCRPHLGPHMLTGPIFIRDAAPGDRLLVEIETIELAQDFGW
FT                   NAIEPGAGILPDLADEYESLTVPLDRSRRQARLPWGPVVDLAPFFGILAVAPDASGGCV
FT                   TSVVPGPFGGNMDNRYCRAGARIALPVFCEGALFLAGDGHALQGDGEICDTALETALNG
FT                   RLRFHLEKGTAPEAPEILCDNRIITMDFDEDLDKAATTAARRMVHWLTRNTPLSAGEAY
FT                   RHCSLLADLRVTQMVNRRKGAHCVLDLGSLSPAA"
FT   gene            complement(561264..561575)
FT                   /locus_tag="Pden_3417"
FT   CDS_pept        complement(561264..561575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3417"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71488"
FT                   /db_xref="GOA:A1B7J4"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7J4"
FT                   /protein_id="ABL71488.1"
FT                   /translation="MRELVPVIAVLTLMATAAILPALLHRWRRRHWRRVVARIDAAYYA
FT                   APERTALPLIDVSFRDHGETRLVKGLLRHGTDVEDLVPGGPIRILVSPVDSRRCVIDE"
FT   sig_peptide     complement(561522..561575)
FT                   /locus_tag="Pden_3417"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.856) with cleavage site probability 0.771 at
FT                   residue 18"
FT   gene            complement(561585..562298)
FT                   /locus_tag="Pden_3418"
FT   CDS_pept        complement(561585..562298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3418"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase; KEGG:
FT                   rsp:RSP_3441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3418"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71489"
FT                   /db_xref="GOA:A1B7J5"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7J5"
FT                   /protein_id="ABL71489.1"
FT                   /translation="MTTENETALIEALSKVTTATLTTVLLKKGLRNVWLRGAAPLNPGQ
FT                   PRLVGRAFTLRFVPAREDLATPESWSSPISTRAAIEAMPEGCICVTDAMGVSDAGIFGD
FT                   ILCARMKKRGVAALVTDGVVRDVAGVRATGLPVWCSGVAAPPSVAGLTFVNWQEPVACG
FT                   GVAVYPGDMIVVDDDGAVLIPAALVEEVAAQATEQERLEGWIMDQVDQGVPLPGLYPPN
FT                   AENKAKYAAFKAGQP"
FT   gene            complement(562313..563098)
FT                   /locus_tag="Pden_3419"
FT   CDS_pept        complement(562313..563098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3419"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rsp:RSP_3440 putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3419"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71490"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7J6"
FT                   /protein_id="ABL71490.1"
FT                   /translation="MDLGIRGKTALVLGAGGGLGRAIARALAAEGARVALGDIDSAAVE
FT                   ETARILRQEGGKALPLTWDLGDLAQIGPNVDRIEAELGPVDILVNNTGGPRPSTVSGQD
FT                   AALWQQSFQSMVLSVIALTDRVLPGMRERKWGRIITSTSSGVVAPIPNLGLSNALRLSL
FT                   VGWSKTLAREVGRDGITCNIILPGRIATPRITFLDEQKAAREGRSTAEVAAESVAAIPV
FT                   GRYGQPEEYGDTVAYLASTRASYITGSTIRVDGGLIASI"
FT   sig_peptide     complement(563012..563098)
FT                   /locus_tag="Pden_3419"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.828 at
FT                   residue 29"
FT   gene            complement(563140..564366)
FT                   /locus_tag="Pden_3420"
FT   CDS_pept        complement(563140..564366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3420"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   rsp:RSP_3439 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3420"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71491"
FT                   /db_xref="GOA:A1B7J7"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7J7"
FT                   /protein_id="ABL71491.1"
FT                   /translation="MQIAAKPNASRLSSRLMAVQPSPTIAMTRLAAEMRRAGKEIIGLS
FT                   QGEPDFDTPEHIQRAANDAIAAGKTRYTDVDGTPELKAAIIRKFRRENGLDYEPAQISV
FT                   GTGGKQVIYNALLATLDEGDEVIVPAPYWVSYPDMVRLAGGTPVIAPCPEEDGFLLTPR
FT                   TLRAAITPRTKWLILNSPSNPTGAGYSAEALAALAEVLLAHPHILVLTDDMYEHIRYDG
FT                   WQFATIAAVEPRLAERVLTVNGVSKAFSMTGWRIGYAGGPADIVKAMATLQSQSTSNPS
FT                   SVSQAAALAALDGPMDFLAARNRTFRERRDLCLAAFDAIEGLSCRKPEGAFYLFPSCAG
FT                   MIGRCRPDGRVIESDGDFVMWLLEEAGVAAVPGSAFGLAPYFRISFATATEQLERACAR
FT                   IEAACKKLS"
FT   gene            complement(564392..564814)
FT                   /locus_tag="Pden_3421"
FT   CDS_pept        complement(564392..564814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3421"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: rsp:RSP_3438
FT                   translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3421"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71492"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7J8"
FT                   /protein_id="ABL71492.1"
FT                   /translation="MSAHPQPVPQGDYVPARRHGTLIFTSGMTPRRDGVLLHHGPVRAD
FT                   APVDDYRDAVRLACGNALAAAHGMLAPGESLAAILSLTVYVAAEPGFAAHSRIADLASA
FT                   YLREELGDAGIGSRAAVGVASLPGNAPVEIQLVAAT"
FT   gene            complement(564811..566043)
FT                   /locus_tag="Pden_3422"
FT   CDS_pept        complement(564811..566043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3422"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   rsp:RSP_3437 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3422"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71493"
FT                   /db_xref="GOA:A1B7J9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7J9"
FT                   /protein_id="ABL71493.1"
FT                   /translation="MNIQNKFARLATDNAPGQEVRQNAAGIQALLRGDVLPGRPVDFSH
FT                   GDVDAHEPTPGAFEVFAQGVARGGRQAYTEYRGDLEIRETVAARLAGFTGAPIDARDGM
FT                   IVTPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMIPVRLDYETVDYET
FT                   AGEDRAGLDLDQLEAAFRGGARVFLFSNPNNPAGVVYSPAEIARIAALAGQYGATVIVD
FT                   QLYSRLRYSGVTYTHLRAQDVDPQNIITIMGPSKTESLSGYRLGVAFGSPAIIARMEKL
FT                   QAIVSLRAAGYCQAVLRTWFAEPEGWMDERIRRHQAIRDDLLAVLRGIDDGFARAPQAG
FT                   SYLFPRLPALAVSHADFVRILRLQAGTVVTPGTEFSPHHGDCVRLNFSQDHRAAVAAVE
FT                   RMAALVERYRA"
FT   gene            566180..567067
FT                   /locus_tag="Pden_3423"
FT   CDS_pept        566180..567067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3423"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: rsp:RSP_3436 transcriptional
FT                   regulator, LysR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3423"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71494"
FT                   /db_xref="GOA:A1B7K0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7K0"
FT                   /protein_id="ABL71494.1"
FT                   /translation="MDIRFLESFVTVAECGSIAEAARRLNLTPAALAQRLRALEQDLGH
FT                   SLVSRVGRTVRPTASGLAVLRHAGALIEGARDLRAIAANDQPEGQLRLGATATALTGLL
FT                   PAIIETLGARHPRIELFIRPGASVDLYHGVVAGDLDAAVIVRPQFPVPKATGWLTLREE
FT                   PLVLIARAGMALDDPFDVIRRHPFIRYDRNQWGGQIVDRFLRQQGLKVREWLELDALDA
FT                   IAALVSRGLGIAIVPDWAPPWPEGLRLEKLPLAGAGSRQTGVLWNRSGARIAAVRAFVD
FT                   VCGGGQAPTQGRGL"
FT   gene            complement(567071..567997)
FT                   /locus_tag="Pden_3424"
FT   CDS_pept        complement(567071..567997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3424"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   rsp:RSP_3456 putative dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3424"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71495"
FT                   /db_xref="GOA:A1B7K1"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7K1"
FT                   /protein_id="ABL71495.1"
FT                   /translation="MAQRIGRDSGGVFIIAATPFTDRGEIDHDSLRRLVDFYAGHGVTG
FT                   LTILGMMGEANKMTPEERRAVVDTVIDRAAGLPVIVGVSDAGMRNLTDLAGHAMDRGAA
FT                   GVMVAPAAGPAREDRIEGYFHAVAQALGPDVPMVFQDFPLATGLPVSAALIRRLSSELP
FT                   QMMMLKHEDWPGLSKITALRADEETPGTPRLSILVGNGGLYLPQELQRGADGAMTGFAY
FT                   PEALVQTVALHRAGQVDAAEDFFDRYLPILRHEQQPGFGLAVRKHVLMRRGAIASAATR
FT                   APGPRLSATDIAEVERLMARLETRLAA"
FT   gene            complement(568008..568865)
FT                   /locus_tag="Pden_3425"
FT   CDS_pept        complement(568008..568865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3425"
FT                   /product="branched chain amino acid:
FT                   2-keto-4-methylthiobutyrate aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class IV; KEGG: rsp:RSP_3455
FT                   D-alanine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3425"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71496"
FT                   /db_xref="GOA:A1B7K2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7K2"
FT                   /protein_id="ABL71496.1"
FT                   /translation="MSRILYLNGAWLPESEARVSVFDRGFLMADGIYEVTCVLDGKLVE
FT                   YAGHSARLQRSARELGLTVPLDAEALLAVHREIVARNALDQGMIYLQLTRGAADRDFAY
FT                   PPAGTPPTLLLFTQAKNVLENKAAERGISVALLPDLRWGRRDIKTIQLLYPSMAKMEAM
FT                   ARGADEAWLVEDGLVTEACAATAHIVTAEGVLVTRDLSHALLPGVTRASVLELAGTHGV
FT                   RVEERAFTSDEARSAREAFITSATNFVVPVTRIDGQAVGDGAPGALTRRIRDIYIETRR
FT                   AAAI"
FT   gene            complement(568877..569647)
FT                   /locus_tag="Pden_3426"
FT   CDS_pept        complement(568877..569647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3426"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: rsp:RSP_3454
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3426"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71497"
FT                   /db_xref="GOA:A1B7K3"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7K3"
FT                   /protein_id="ABL71497.1"
FT                   /translation="MARTIDLNCDMGESFGAYTIGDDAAMLQLVTTANVACGFHAGDPV
FT                   VMRRTIRMARENGVSVGAHPSFADLYGFGRRRISGERPEDLETQLIYQIVAMQGMCALE
FT                   GHPMTHVKTHGALGNMAAVDPDLAALCVRAIRAVDPGLTFVTLPYSETHAAAEKAGLRV
FT                   ACEIYADRSYTDTGELTPRSQPGAVIHDPRQSLDQVLEMVVNGHIPTTGGKRLPVLPET
FT                   LCVHGDTPGAVGIVRALRAALIENGIKIAPFAKN"
FT   gene            569820..570806
FT                   /locus_tag="Pden_3427"
FT   CDS_pept        569820..570806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3427"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: rsp:RSP_3453 TRAP-T family transporter, periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3427"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71498"
FT                   /db_xref="GOA:A1B7K4"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7K4"
FT                   /protein_id="ABL71498.1"
FT                   /translation="MKQGRIFAFAAACAVGLGVSAAVAETAWDMSVVWPEGNFHTQNAI
FT                   AFAEAVKDVTDGEVVITVHSGGALGIKGPEGMAAVRDGLVPIADILLNQQVGEAPILGI
FT                   ETLPYLAPTMPDLALLHKFYRPKLEEVAEGMNQKLLYLVPWPGQAVFAPNPINGLDDMK
FT                   GLTVRVVDANGSSYFEALGATPVQMPWGEVVPSLAAGTIKGVTTSSSSGVDGAFWEFTK
FT                   HMNTFNWQASSNAVMVNLDAWNALEPETRASIEATAARMEGQFWLNSQAEDAKKLAVLQ
FT                   EHGIEITEPSPELRAALLERAKPLWDDFKARVPDAAAYIDAYLTARQ"
FT   sig_peptide     569820..569894
FT                   /locus_tag="Pden_3427"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.966 at
FT                   residue 25"
FT   gene            570897..571439
FT                   /locus_tag="Pden_3428"
FT   CDS_pept        570897..571439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3428"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component; KEGG: rsp:RSP_3452 TRAP-T
FT                   family transporter, small (4TMs) inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3428"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71499"
FT                   /db_xref="GOA:A1B7K5"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7K5"
FT                   /protein_id="ABL71499.1"
FT                   /translation="MLETTFPETRPFGCIISTIDFLTGIGGYAAALSLLGILGLILAEI
FT                   FTRNFLASSLHFSWDLAGYLMGACFLLGCGSAMKAGSHVRVTALIEISSPIVGRVLEIA
FT                   STLVGLAICGALSWALIDMAVLSGQRGSTAATTFRVPLVYPQAVLAAGAVLLTLQCLAQ
FT                   VLRLLRGEALTSGPGLE"
FT   gene            571452..572753
FT                   /locus_tag="Pden_3429"
FT   CDS_pept        571452..572753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3429"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: rsp:RSP_3451 TRAP-T family
FT                   transporter, large (12TMs) inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3429"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71500"
FT                   /db_xref="GOA:A1B7K6"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7K6"
FT                   /protein_id="ABL71500.1"
FT                   /translation="MATIVFTLLFLMAVLLGSGMWIGIGLIGTGIGLVEIFKPNLPALK
FT                   LLSQQSWNTVVSPELLALPLFILMAEILFRTRISEALFSGLSPWLRRVPGRLSHLTVLG
FT                   CTLFASVCGSSAATTATVGRITAKELIDRGYNRDLVTGSLAGAGTLGFLIPPSTIMIIY
FT                   GVMAEESILKLFIAGILPGFMLAAAYMGYLAIRSMMNPSLVGAPPPPSSLWDKIVALKD
FT                   LGPLLLLILGVIGSMYGGIATPTEAAAVGVAASMLIGFLQRTLDLKGVLIAARHAAESC
FT                   AMIGLIMIGAMFLSTAIGYLGVPRYIASEIQGWGMSPFMLIVVLLIFYVILGTVMEGLG
FT                   IIVMTLPITLPLVLAAGYDKVWFGIFLVIVVEMAQITPPVGFNLTVIQRLTGDSMGRIT
FT                   RATMPFFYIMSAFVLLIAVFPGIIDLLPGMMAGR"
FT   gene            572761..573534
FT                   /locus_tag="Pden_3430"
FT   CDS_pept        572761..573534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3430"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="PFAM: Allophanate hydrolase subunit 1; KEGG:
FT                   rsp:RSP_3450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3430"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71501"
FT                   /db_xref="GOA:A1B7K7"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7K7"
FT                   /protein_id="ABL71501.1"
FT                   /translation="MPAARTGPRRTSPEQEEMMQPKILPCGDTALSLQFGETIDAKANA
FT                   RVIATAARLEGMAVPGLVDIVPTYRSLLLRYDPEIVSGARLETILAGLAPDDCASEAPS
FT                   RLWVVPCLYGGEVGQDLDELARMKGMPPDEIVALHSAAEYRIYMIGFAPGFAYLGGLPE
FT                   ILHTPRLPRPRQNIPAGAIGIGGQQGNINSVAGPSGWRFIGWTPLRSFDPSRTEPFLFR
FT                   AGDRIRFRPIDAAEAQVLAGRVAAGEAILQPEAMA"
FT   gene            573531..574595
FT                   /locus_tag="Pden_3431"
FT   CDS_pept        573531..574595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3431"
FT                   /product="urea amidolyase related protein"
FT                   /note="TIGRFAM: urea amidolyase related protein; PFAM:
FT                   Allophanate hydrolase subunit 2; KEGG: rsp:RSP_3449
FT                   putative allophanate hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3431"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71502"
FT                   /db_xref="GOA:A1B7K8"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7K8"
FT                   /protein_id="ABL71502.1"
FT                   /translation="MSVEIVSAGPMLTVQDAGRIGLRHMGVSDAGPVDAAAMALANALC
FT                   GNASGMAALEFAGPAGSFTTSRPVRFAVAGGDCDIRIDDRIVQAGESHRLKPGELLRIG
FT                   LAREVVWAYLAFSGGIATAPVLGSRATHLRSGLGGVDGRCLRGGDILPLGADQPDVPCL
FT                   RPASPLQGASLPRGQGPIRVVLGPQQDYFDAGTLARLTGEEFLVTPQRDRMAMVLGDAC
FT                   LPAARGHDIVSDGTVPGSIQVPGSGQPLVLLVESQTTGGYPKIATVISADLPRLAQLPV
FT                   GSRIRFAAVSRDEGERIGIARARALRDALAALVAKPEGILRSDYLLSCDLVGGIVFPEE
FT                   VVWAEAVMRKGRKA"
FT   gene            574592..575242
FT                   /locus_tag="Pden_3432"
FT   CDS_pept        574592..575242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3432"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: rsp:RSP_3448 transcriptional regulator,
FT                   GntR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3432"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71503"
FT                   /db_xref="GOA:A1B7K9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7K9"
FT                   /protein_id="ABL71503.1"
FT                   /translation="MSISSNLSQEAHRRIIGMIFEGALKSGDALQEAPLGERLGMSRTP
FT                   VREAIKRIESEGLAETSGRFTRVRHMRRSEFEEIFFLRLQLEPFAARAAVRLPPAQVDA
FT                   MEERIRRLMAAGPELDGSHFQTDNDFHDMMLQPLGNRTISAVVASLRRRTCVFDHTQVP
FT                   DRFLQGCDEHLDILNAVRSGNADAVATGMVRHLENARDAVLDRLDRISAETAP"
FT   gene            575239..576189
FT                   /locus_tag="Pden_3433"
FT   CDS_pept        575239..576189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3433"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding; KEGG: rsp:RSP_3447 putative
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3433"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71504"
FT                   /db_xref="GOA:A1B7L0"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7L0"
FT                   /protein_id="ABL71504.1"
FT                   /translation="MKCLIVQPIHESGLALLRENGIEPVPCPAPDMATVAHHIAGCQAV
FT                   ITRDAGLSAPAFAAAGELRVVVVHGTGHDPVDKGAATARGVVIANTPGANAQSVAELAL
FT                   GLALAVARRIPAADRAQRAGVAGFRESARFAELSGKTALIVGWGAIGRSFGRMLDRALG
FT                   MTVLVHSPRASDTAPYRRAADLAEGLAQADLVSLHTPLRAETRGMMGLAQFRAMKPGAI
FT                   LLNLARAGLVDEPALCEALASGRLAGAGLDVWSGDAPQGPLAAFPNVVFTPHLGGTTED
FT                   ALKRVAEAAARHVISALSGRLPETAINPEVWSQTA"
FT   gene            576186..577457
FT                   /locus_tag="Pden_3434"
FT   CDS_pept        576186..577457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3434"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: rsp:RSP_3446 N-carbamoyl-L-amino acid
FT                   amidohydrolase; TIGRFAM: amidase, hydantoinase/carbamoylase
FT                   family; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3434"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71505"
FT                   /db_xref="GOA:A1B7L1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7L1"
FT                   /protein_id="ABL71505.1"
FT                   /translation="MTILAARRQNTVIGDTIARVLSRVNAITQGGPGHTRPSYSDEESA
FT                   AHAVVEDEARALGLEVRRDPAGNLFARLRGGDPVAVPLYVGSHLDTVSQGGAYDGQAGV
FT                   AGGLALIAALRAHGATPAMDIVLTVTRAEESVWFPVSYIGSRAALARLSPEDLQARRVD
FT                   TGRSLADHMRDQGFDADAVLAHEPPAPARFLEFHIEQGPVLDAAAEPYGIVTAIRGGLR
FT                   YRAARVHGAWAHSGGAPRHGRADAVAAFAELVVAMQRVWDELLAQGRDLTVTFGRVDAA
FT                   TPAHAMAKVAGELEFCLDMRSEDVAALDLADRLLRAEIARIEAAQPGIRFELGRQSRSQ
FT                   PAALSQAMADLVARGAERLGDRPRRMLSGGGHDAAAFAAAGWDSVMVFIRNWNGSHCPE
FT                   EAMDEADLARAVEAVFLALAEDRT"
FT   gene            577454..578089
FT                   /locus_tag="Pden_3435"
FT   CDS_pept        577454..578089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3435"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: rsp:RSP_3445 transcriptional regulator, GntR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3435"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71506"
FT                   /db_xref="GOA:A1B7L2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7L2"
FT                   /protein_id="ABL71506.1"
FT                   /translation="MTAETLSQTAYRRIKQDILEGRIAPDSMLSERELALRLGISRTPL
FT                   RSALSRLENENVIGRLANGALIVRSVTVEQLLEIVQLRQVLERAAAARAAERGITDELR
FT                   QVWDEMLPYAEGRSVGFDEFWQVDERFHAAVARAAGLELLPAILAEQRAVARRCTITRV
FT                   HDRFDEQAREHIAVLEAISRGDASAARDAMSLHFENVRNRFLGWFSKG"
FT   gene            578094..579287
FT                   /locus_tag="Pden_3436"
FT   CDS_pept        578094..579287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3436"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: rsp:RSP_3444 putative
FT                   Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3436"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71507"
FT                   /db_xref="GOA:A1B7L3"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7L3"
FT                   /protein_id="ABL71507.1"
FT                   /translation="MKMIDDLIAAPPADPLQGGDAVFPQAEFTGRLARLRLAIQPLGAD
FT                   AVMLTGPENIFWACGRQTAGYFAFQALIVPLEGEPVLLVRQLETTGARASTWLRDIRAW
FT                   QDGEDPARALAELVADLGIRRLAVERDGWFVSQSLGARISAALEGVDLCDGASVVEGLR
FT                   AVKSPAELAAIRLAAGYAQAGLGAAIERCAAGVSENDLAAAMFSAAISAGSEAMAMEPL
FT                   ISSGPRSGVPHATWRRRVLLEGDPVFLELAASHDRYHAALMRSVWIGSPPAEARRMMDV
FT                   ALRALDAALASMRPGVPCSLPHDAAQAVIDDAGYAAAFRKRIGYSMGAAFAPDWGEGAI
FT                   LSLFSGVSRELEPGMVFHLPATLRAYGAFTVGASETVIVTRSGIEILSDLPRTLCIR"
FT   gene            579311..579997
FT                   /locus_tag="Pden_3437"
FT   CDS_pept        579311..579997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3437"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   jan:Jann_2909 5-carboxymethyl-2-hydroxymuconate
FT                   delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3437"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71508"
FT                   /db_xref="GOA:A1B7L4"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7L4"
FT                   /protein_id="ABL71508.1"
FT                   /translation="MTHVLPLPAIPSVPVAGSDDRFPVRRIFCVGRNYADHAREMGHDP
FT                   DREPPFFFSKPADALLTDDAPLPYPPRTADLHYEGELVVAIGKAGRDIPMTEAARHVWG
FT                   YAAGNDFTRRDLQAEAKKLGRPWDMAKGFDHSAACGAITPAAQAGPMDRGRIMSTVDGV
FT                   VRQDGDLGQMIWSIPEIVAILSGYVGLAAGDLIFTGTPAGVGALSRGARVAVRIDGLAP
FT                   LVTDIV"
FT   gene            complement(580165..581424)
FT                   /locus_tag="Pden_3438"
FT   CDS_pept        complement(580165..581424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3438"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: rpc:RPC_3026 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3438"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71509"
FT                   /db_xref="GOA:A1B7L5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7L5"
FT                   /protein_id="ABL71509.1"
FT                   /translation="MSSLQTRIAALLIAAIVSVVVLATYTATSVMRPPLPQATMEPVAR
FT                   QIHATLALLGHGQPQDRPGALQPAPAGGEPDERMSRFLGGALRHTGQPLEARVSKLPGQ
FT                   ESFTASIRVGDGRWFITEIPDLSPPPGRWKVLVIWLALIVLGSAAISIHAARRLTRPLQ
FT                   LLEDAVDRVGPDGVLEQIPETGTGEVRTAARALNRLSAQLRQAMESRMRLVAAAGHDLR
FT                   TPMTRMRLRAEFIEDDAERAKWLSDLEELDMIADSAIRLVREEVGLDGGEPIRLDRLLR
FT                   QIALELHALDQKVELGALPPLTVHAGPIALKRALRNLIANAATHGGGARVALAREGDDA
FT                   VIRIEDDGPGVPPELLAQIFEPFFRVDQARRKSFPGAGLGLAIAREIVERHLGRITIRN
FT                   REPRGLLQICTLPCAQSGRS"
FT   sig_peptide     complement(581353..581424)
FT                   /locus_tag="Pden_3438"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.732 at
FT                   residue 24"
FT   gene            complement(581421..582140)
FT                   /locus_tag="Pden_3439"
FT   CDS_pept        complement(581421..582140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3439"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rpc:RPC_3029 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3439"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71510"
FT                   /db_xref="GOA:A1B7L6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7L6"
FT                   /protein_id="ABL71510.1"
FT                   /translation="MNHILIVDDDPEIRNLLRRYLEGQGFRVSTAADRRECEARVTDGA
FT                   PDLIVLDVMLPDGSGLDICRSLHEHRPELRIILLTALKEDVDRIIGLELGADDYLGKPF
FT                   NPRELVARIKAVLRRTGGQDEPAAAEARTYGFAGFDVDPGQRRVRAADGSEIELTGAEF
FT                   DLLRVFLERPGRLLSRDQLLDLTQGRDRDPLDRSIDVLMSRLRRKLAEKEPTPIFRTVR
FT                   NGGYQLAVPVSMGAMRG"
FT   gene            582349..582957
FT                   /locus_tag="Pden_3440"
FT   CDS_pept        582349..582957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3440"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71511"
FT                   /db_xref="GOA:A1B7L7"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7L7"
FT                   /protein_id="ABL71511.1"
FT                   /translation="MKNIPMKALAVAALLGAAGTPLAAMAQNAGEAPPARAEEPARPML
FT                   GPAAAPHGRPDAFRLDIGRPGPGGMSPALGLSAHLAATETYLGITGEQQDAWRDYSQAL
FT                   IAFIEPPAADARAEGDERPADQARPLAAERMAQHALARAEKARALLAATTALRGTLEPA
FT                   QLERLQQVDPGFGPGPHGPRHEGPERQQPGPRHQPAPAR"
FT   sig_peptide     582349..582429
FT                   /locus_tag="Pden_3440"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 27"
FT   gene            583029..583505
FT                   /locus_tag="Pden_3441"
FT   CDS_pept        583029..583505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3441"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71512"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7L8"
FT                   /protein_id="ABL71512.1"
FT                   /translation="MRRFFMITAIAATTLGSSQMAMAETRPDGPPPECRQNDRKCPAPP
FT                   SKDARKKGERSKGEHRPPPSAEARRDGHKPRQAPDHRPGEGREAKGKPPADGRQALRVG
FT                   DSGRDGRAFQRAGNSRYAPAPRGQEYRVIRDQLVLVDQKSKRIVSILGPIHAQR"
FT   sig_peptide     583029..583100
FT                   /locus_tag="Pden_3441"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            583517..583921
FT                   /locus_tag="Pden_3442"
FT   CDS_pept        583517..583921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3442"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71513"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7L9"
FT                   /protein_id="ABL71513.1"
FT                   /translation="MKRMMILVAMTLLNLATTPALAEPAAHCGQADQRCAVKAEPAKKA
FT                   QPSKKVEPVQKAQPTKRHTPSDARAQTRKGPKVGEIMNGGRALKTAEARKLARPATGRA
FT                   YRVMEDRVVLVDARTMKIVQVLGLASDILR"
FT   sig_peptide     583517..583585
FT                   /locus_tag="Pden_3442"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(583981..584262)
FT                   /locus_tag="Pden_3443"
FT   CDS_pept        complement(583981..584262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3443"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71514"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7M0"
FT                   /protein_id="ABL71514.1"
FT                   /translation="MKIIPLLALMATLAACSEKDEPTGHIFRYPDGTEPAAVEPAARSG
FT                   RGLVVDYHNHALPKPEAGRRWELQPGAFLLVDASGRVLSTVPALYSGR"
FT   sig_peptide     complement(584203..584262)
FT                   /locus_tag="Pden_3443"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.689 at
FT                   residue 20"
FT   gene            complement(584310..586316)
FT                   /locus_tag="Pden_3444"
FT   CDS_pept        complement(584310..586316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3444"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; protein of unknown
FT                   function DUF214; SMART: AAA ATPase; KEGG: rpb:RPB_2235
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3444"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71515"
FT                   /db_xref="GOA:A1B677"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1B677"
FT                   /protein_id="ABL71515.1"
FT                   /translation="MAETGAPLIRLRGVGREYPSGEGVLRVLTDIDLDIGQGEFVAVMG
FT                   ASGSGKSTLMNILGCLDRPSSGSYRMDGREVARLGAGELAALRRETFGFIFQRYHLLSE
FT                   MTALGNVEVPAIYRGLPADARRARARDLLERLGLGDRTGHRPGQLSGGQQQRVSIARAL
FT                   VNDARVILADEPTGALDSRSGDEVLGILERLNAEGRTVVIVTHDPRVAARAHRVVEIAD
FT                   GRIVADRRTGAPAADPGPGPAQAPQPAPQPAPVQAPVQARVQARAAVPVLGRLAEALRM
FT                   ALLSMRAHKLRSFLTMLGIIIGIASVVSVVALGEGSRRQVLQNIAGLGTNTLQIFPGRD
FT                   FGDMRSGRVTTLVTADAAALARQPHVASVSPTVGTSATLRHGATEASAQISGVGEQYFD
FT                   VAGVALTQGRGFDEADVAAMGQNVVIDENTRTSLFGDGPALGQVFMAGKVPLRVIGVAE
FT                   AQNRGPGGSTSLTVYAPYTTVQARYLGSTSVSGLTLRVADDVDMALAEQMVADILTRRH
FT                   GTRDFFIVNNDQIRQTITSTTQTLALLIAAIAVISLVVGGIGVMNIMLVSVTERIGEIG
FT                   LRMAVGARRGDIRAQFLIEAVLVCVIGGIAGILAALGFGLAFERMSSDFTLVYSPLSML
FT                   AALASACAIGLAFGYLPAVNAAKLDPVKALQKG"
FT   gene            complement(586309..587514)
FT                   /locus_tag="Pden_3445"
FT   CDS_pept        complement(586309..587514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3445"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   rpc:RPC_1868 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3445"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71516"
FT                   /db_xref="GOA:A1B7M2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7M2"
FT                   /protein_id="ABL71516.1"
FT                   /translation="MRKTMPVALILGALLIAVAVLRWPGATPGGAAAPGYLTAPAERGS
FT                   LEVSVLAEGRLKPSNLVAVGAQVSGRITELAVVLGQRVEQGDLIARIDSVQQANELRTA
FT                   QAALANLKAQMAERRAVLALAEKTLERQQNLIRSNAASRSTMDSAQQDVDVARAQIAAL
FT                   QAQIAQAEVAIEIARTDLDYTRITAPMAGTVLAIVSQAGQTVNAVQSSPTIVVLGQLDR
FT                   MDVHAEISEADIGKVRPGQKVRFSLLDDSGRSYEGVLDSIAPAPQSIVNDSAIQGGTGT
FT                   DSSSGAIYYTGIVPVENPDGRLRSYMTAQVSIVLGAAQDVLTIPSSALGRRNPDGSHQV
FT                   RVLGGAGIETRDVVIGLNDKVAAEVVSGLAEGERVVTGEQGAAPAAAAPRGSRRMMGPL
FT                   GG"
FT   sig_peptide     complement(587419..587514)
FT                   /locus_tag="Pden_3445"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.452 at
FT                   residue 32"
FT   gene            587614..588063
FT                   /locus_tag="Pden_3446"
FT   CDS_pept        587614..588063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3446"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71517"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7M3"
FT                   /protein_id="ABL71517.1"
FT                   /translation="MYPCVSRKTEIVTKRFSPPARNNSLQIYACAPAIVGHHGSGWRQN
FT                   AARGQVTGRATMTSETLAEARRCMTLCVPRAGDADADAGAGRMVPVSFSLIGFGGERLV
FT                   FRLVDGQDELLDPAVAGALRDCIILAECLAGRADPVAAPQDGGAG"
FT   gene            588344..589516
FT                   /locus_tag="Pden_3447"
FT   CDS_pept        588344..589516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3447"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   ret:RHE_CH03411 probable protein secretion protein, HlyD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3447"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71518"
FT                   /db_xref="GOA:A1B7M4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7M4"
FT                   /protein_id="ABL71518.1"
FT                   /translation="MTFRFLHRLARLGIALAAFSLAGQAAAQQPAAPGPRQVGVISVTA
FT                   ESVPLVSTLPGRAVARDAVDIRPRVDGFVTEVLYNPGQPIKVGDPMFRIDPTTYEAAVQ
FT                   EARANLASAKAAVPQAEAAYERSRRLQGSGSTQAALEQAQATMEQAQAAAAAAEAALKL
FT                   AETQLSWTTIASPLDGLPSVAAVSPGDLVTAGQSDALATVTQLDPIDVDMYEPSARLQR
FT                   IRERIESGQIRMSQGLKAQLTLENGVTYAATGEMVAPGYTVSTSTGAIDFRFRFDNPER
FT                   RILPGMFVRGRIEIGRIQAVLVPQMAATRGRDGTLSAWVAEDGKAVKRVLTEEGVHENS
FT                   WIVTDGLKDGDALIVNGGTNLAEGAEVAPVAVEIDENGVVRDLPATQQAE"
FT   sig_peptide     588344..588427
FT                   /locus_tag="Pden_3447"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.940 at
FT                   residue 28"
FT   gene            589521..592625
FT                   /locus_tag="Pden_3448"
FT   CDS_pept        589521..592625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3448"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   ret:RHE_CH03412 probable multidrug efflux transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3448"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71519"
FT                   /db_xref="GOA:A1B7M5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7M5"
FT                   /protein_id="ABL71519.1"
FT                   /translation="MARFFIHRPVFAWVLAIITMLAGVYGLSSLPIAQYPDIAPTTVRI
FT                   SATYTGASPDIVENSVTSIIEDGMTGLDGLIYMTSTSSQGSSSIQLTFDDSVDPDIAQV
FT                   QVQNKLQLVTSQLPESVQSKGVSVSRSTSSILLVGALTSTDGSYSSLELGDLVAQVIEN
FT                   PVKRTAGVGSINSFGSGYAMRIWLDPDRMLQYQVTPSDVVSAVSEQNTNVTLGSLGSQP
FT                   TVKGQQLNVALSAQSQLTSVREFERILLRTDSDGATIFLGDVADIEIGQEDYGSSSRYN
FT                   GMPAAGFGVNLATGANAVDTAEAVREVLDGLQSSLPAGVQIVYPYDTSPFVEESINQVY
FT                   HTLIEAVVLVFLVILVFLQSWRATLIPTLAIPVVLLGTFGVLSFAGMSINTLTMFAMVL
FT                   AIGLLVDDAIVVVENVERVMEEESIGPVEATEKSMDEISSALVGIVLVLSAVFLPMAFM
FT                   SGSTGVIYRQFSVTIITAMVLSLGVALILTPAMCATLLRPRGHGDGIAPARWFNRNLDR
FT                   ATNGYAGAVGAFVRRPFRFLVVLLAFGAGAYMLYQKLPGSFLPSEDQGVLMVMVETPEG
FT                   STAERTRALVEEVEQYVLGTEKDTAESVFAALGFGFGGSGPRNAMIFVKLKDFELREGF
FT                   DAASMATRGNLRFMENRNGQVFFMQPPAIQGMGNTAGFTMHLIDQSGHGQEALAAAADE
FT                   LVEKATADGRVTSLQGNDAPFETSRRIDIDQQKAAAYGLSISDLNTTLSVIFASANVND
FT                   FSLGTELRPVIVQGKAEARMQPDDIEKWYVRNTAGDMVPFTAFTAQDWDQQAQSLARYG
FT                   GTRSLEVTGAPAQGVSSGTAMEVMEELVAGMDGGYGTAWTGLSYQERLSGSQAPMLFAL
FT                   SALVVFLALAALYESWSVPLSVMMTVPIGIVGAMAAALVFDQSNDVYFKVGLLTTIGLA
FT                   ARNAILIVEFAQQLHGHGKPLLEAAVEASRMRLRPILMTTLAFMLGVLPLALASGAGAA
FT                   AQQSIGIGVLGGITASAVIGIFLVAVFYVAVLRAVQHFTNKRAKT"
FT   sig_peptide     589521..589622
FT                   /locus_tag="Pden_3448"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.605) with cleavage site probability 0.344 at
FT                   residue 34"
FT   gene            592622..593998
FT                   /locus_tag="Pden_3449"
FT   CDS_pept        592622..593998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3449"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: ret:RHE_CH03413 nodulation protein (outer
FT                   membrane efflux protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3449"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71520"
FT                   /db_xref="GOA:A1B7M6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7M6"
FT                   /protein_id="ABL71520.1"
FT                   /translation="MISPSRFFGPALLLLAAGCAAVGPDPDARPAIPVPATFVEGEAAS
FT                   AGKLASRAFWAEYRDPVLNDLIARGLKQNLDEAAARERIRAAAADLRGTGVLAGQVSGT
FT                   ASAARERGASAGGAVQTAGNSSLGANFVFDLFGGARRERQGAAASLESAKAGLGTARLA
FT                   WIAELIDAYGDARYYRQALALTRKTVSTREETVRITRDQREFGVVSEFDMAQAEALLAA
FT                   ARAEIPGYQAQYDAQVFAIATLLNEPASSVQAQMRRGSGQPRIPGSARAGVPADLLRNR
FT                   PDLRSAEYDLAAALATVGVATADLLPSLSLTGSVSESGGAKSWGFGPAISFPVLNQGAL
FT                   QATRARRIAEAREAEIAWRAAVSQAVEDVQVAQSNLRRYREQAAALEGAAAAYDRAYQL
FT                   ARTSFAEGELALLDLLDSDRSTASARLSAASARNQAAKEWAALQIATGAGAGEVVLVSR
FT                   "
FT   sig_peptide     592622..592687
FT                   /locus_tag="Pden_3449"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.588 at
FT                   residue 22"
FT   gene            complement(594069..595274)
FT                   /locus_tag="Pden_3450"
FT   CDS_pept        complement(594069..595274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3450"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: rsp:RSP_3749 putative
FT                   beta-lactamase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3450"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71521"
FT                   /db_xref="GOA:A1B7M7"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR001586"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7M7"
FT                   /protein_id="ABL71521.1"
FT                   /translation="MAAADKPPRYEQSGNMNMNYGCVGLGLFAAGLAMPASAMSEAEFR
FT                   QMAAGIFAPVIAEHDIPGLAVGVTWQGQDYVYTAGMADRAAAVPVTAETLFELGSISKT
FT                   FNVTLAALAAQQGRLSLADPVAAHLPELKGSAIGSVSLMDLATHQTGGLPLQVPDEAGD
FT                   DGTLMRWLEDWQPVPSQGERSYSNVSIGLLGRIAARAFGEPYAEALRSHVLHPLGLEST
FT                   HVDVPAAEMPRYAWGYSRRDDSAIRVNPGMLDDEAYGLKSDLHDMLRFLRVNLGDTDVP
FT                   PKLRDAVTQTHAGQTGTQHFQQAMIWERYPWPVSRDQLLAGNAAEMVMESQPATRLERP
FT                   DLSDHAVLFSKTGATNGFGGYVVFIPAEDLGLVILANRNIPNPARVDAGLALIEAVLQA
FT                   DE"
FT   sig_peptide     complement(595158..595274)
FT                   /locus_tag="Pden_3450"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.673) with cleavage site probability 0.466 at
FT                   residue 39"
FT   gene            595356..596231
FT                   /locus_tag="Pden_3451"
FT   CDS_pept        595356..596231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3451"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: sme:SMa2293 probable beta
FT                   lactamase transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3451"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71522"
FT                   /db_xref="GOA:A1B7M8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7M8"
FT                   /protein_id="ABL71522.1"
FT                   /translation="MDRPQLPLNALRAFEVASRHLNLTRAAIELCVTQAALSHQIRGLE
FT                   ERLGVTLFRRVPRGLVLTEEGIMLAPVLTRIFDEMSGTLDRFSAGHYHETINLGVVNSF
FT                   ATEWLIPRLADFQRLHPSIDLRIHTNNNRVDLAGEGLDLAVRFGDGSWHGVAATRLMSG
FT                   AMMVVCSPELAGRLRRVEDLLSVPLLRSYRANEWERWFAGHGLPAPQLRGPVFDTSLAI
FT                   AEMAARSHGLGLVPVALFSSWTQAGRLARPFEAVLAAGDYWLTRLHASPETTGQGALRE
FT                   WLVARCEDVA"
FT   gene            596329..596745
FT                   /locus_tag="Pden_3452"
FT   CDS_pept        596329..596745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3452"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71523"
FT                   /db_xref="GOA:A1B7M9"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7M9"
FT                   /protein_id="ABL71523.1"
FT                   /translation="MRKAGHLAYIAALAMMAFVGLAYEDLSPGLAFRDADGPFFCRDLF
FT                   SSGGDDDAMIGSFGIFVAPLALRLLRLNRAVARYEVVLFWICAGLVCLSLMLASMDCAS
FT                   IFYTAFVLPDPLLAGGLIALPLAAFLVMRSRAEG"
FT   sig_peptide     596329..596397
FT                   /locus_tag="Pden_3452"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.917 at
FT                   residue 23"
FT   gene            596845..597135
FT                   /locus_tag="Pden_3453"
FT   CDS_pept        596845..597135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3453"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71524"
FT                   /db_xref="GOA:A1B7N0"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7N0"
FT                   /protein_id="ABL71524.1"
FT                   /translation="MPLTAIVNSLGSLLFILLVAHSTSYQEANWPAGRVVHVRDWVVHA
FT                   TYALGAALLWMAVVPIRDERRRAFLAAWFPWACWALLIVGVVVMPMFFPAS"
FT   sig_peptide     596845..596928
FT                   /locus_tag="Pden_3453"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.518 at
FT                   residue 28"
FT   gene            complement(597192..598448)
FT                   /locus_tag="Pden_3454"
FT   CDS_pept        complement(597192..598448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3454"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: rde:RD1_4140 transcriptional
FT                   regulator, LysR family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3454"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71525"
FT                   /db_xref="GOA:A1B7N1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7N1"
FT                   /protein_id="ABL71525.1"
FT                   /translation="MNPAGRRCIAAPGRCTRHPAKARRPCRPGFLHIAPDEGSMRFSPD
FT                   QMRRYVTLLAVTKLSGQYSGHVGARPQAKGAKTGGKGIRRNANHRVGRNMPLRYTLRQL
FT                   EYFVAVGETGSIAAASQQVNVSSPSISAGISQLEEELGVKLFIRYHAQGLTPTLAGRKL
FT                   LDHAQTVLRQAATLRDLAGDLSGSVRGPLAIGCLSTFAQIVLPGLRRSFIEEYDEVRIS
FT                   QVEADQAELFSLLRQAKIDLALTYDLDLPGDLRFFPIIELPPLVAMSENHPLAHLSEVS
FT                   VQQLAPHPMVLLDLPLSSEYFLSFFTKAGLRANISERTRDMAVMRSLVANGFGYSIVNV
FT                   RPLHDVAPDGKPMRFLPLTGTPRPMKLGLLISRGTERPRLHKVFIDHARDWIERQSRNL
FT                   LGLLPPADTEEPRRASRSG"
FT   gene            complement(598445..599119)
FT                   /locus_tag="Pden_3455"
FT   CDS_pept        complement(598445..599119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3455"
FT                   /product="protein of unknown function DUF1028"
FT                   /note="PFAM: protein of unknown function DUF1028; KEGG:
FT                   rde:RD1_4139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3455"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71526"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7N2"
FT                   /protein_id="ABL71526.1"
FT                   /translation="MTFSLVARCPETGMFGIAISSSSPAVAARCSHARAGVGAVASQNV
FT                   TDPALGPLALDLMEGGMSATDAVAEIRRRGRFIEYRQVLAVDAKGRTAIHSGPNSLGIW
FT                   TQAQAENVASGGNLLADDGVPQAIVDGYLAASGHIGDRLIAAMRAGLAAGGEAGPVHSA
FT                   GMMIVDKVGWPVADLRCDWTEDCPIEAIARLWDIYKPQLDAYVQRALDPREAPSYGVPG
FT                   DE"
FT   sig_peptide     complement(599036..599119)
FT                   /locus_tag="Pden_3455"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.745) with cleavage site probability 0.712 at
FT                   residue 28"
FT   gene            complement(599124..599540)
FT                   /locus_tag="Pden_3456"
FT   CDS_pept        complement(599124..599540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3456"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: rde:RD1_4138
FT                   endoribonuclease L-PSP family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3456"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71527"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7N3"
FT                   /protein_id="ABL71527.1"
FT                   /translation="MAHTRIRKFNTRDTYPEQKLDNDLCQAVVTQGGRIVWLRGQCPQD
FT                   LDTARNINSHDPVEQTHKVMQNIRQLIEEAGGRMEHLVKVVVYITDVRHREAVYRTMGE
FT                   YLGGVHPVSTGLVVQALARPEWLVEIDGTAVIPV"
FT   gene            complement(599599..600870)
FT                   /locus_tag="Pden_3457"
FT   CDS_pept        complement(599599..600870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3457"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pau:PA14_71210 putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3457"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71528"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7N4"
FT                   /protein_id="ABL71528.1"
FT                   /translation="MPVEKIDTLVVGGGQAGVAMSEHLGKAGVPHLVLERGRIAERWRS
FT                   ERWDSLVANGPAWHDRFPGMEFPGDPDAFVAKEQVAEYFAAYAEKLGAPIRCGVEVREV
FT                   RRNAGRPGFAVTTSQGVIEANRVVAATGPFQKPLVPALIPADAGVTQLHSSGYRNPDQL
FT                   PPGAVLVIGAGSSGVQIADELMRAGRKVYLSVGPHDRPPRSYRGRDFCWWLGVLGKWDM
FT                   AAPAPGTEHVTIAVSGARGGETVDFRRLGNRGMVLLGRTEGYGDGSLNFSPDLRRNLDR
FT                   GDENYLSLLDEADAHIASNGLDLPEEPEARKREPDPDCVTDPLLELNLAGAGIATVIWA
FT                   TGFAVDFGWIRADAFDERGRPLHQRGVSVQPGLYFLGLPWQSRRGSSFIWGVWHDARHI
FT                   AEQIVIQRKYFDYQGKAQRTLQEA"
FT   gene            601117..602274
FT                   /locus_tag="Pden_3458"
FT   CDS_pept        601117..602274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3458"
FT                   /product="acetylornithine deacetylase ArgE, Metallo
FT                   peptidase, MEROPS family M20A"
FT                   /note="KEGG: rde:RD1_4143 acetylornithine deacetylase,
FT                   putative; TIGRFAM: acetylornithine deacetylase (ArgE);
FT                   PFAM: peptidase M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3458"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71529"
FT                   /db_xref="GOA:A1B7N5"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7N5"
FT                   /protein_id="ABL71529.1"
FT                   /translation="MTEPRPETLALLARLVAFPTVSAESNLALIDFAEHHLRHAGFVTH
FT                   RLPSRDGTKAGLMARLGEGRGGVMLSAHSDVVPAEGQGWSRPPFALSRRGDRLYGRGTT
FT                   DMKGFLAAMLSRAARAGKATPARPLMLAISYDEEVGCTGIREMLPGIEALGWRPELCIV
FT                   GEPTGMRPAIGHKGKAALVATCHGTAGHSSLAPRHVNALHLAAEFIAALRRIQGDYAAS
FT                   ACTDPAYDIPFSTVHAGRMQGGAALNIVPDRAAVEFELRHLPGDALSDFQDRLRCEIAR
FT                   ILAPFRAQDEAADIRIALTNTYPGHDIAPDHPAVQDVVRHCGDPRRIKVAYGTEAGYFA
FT                   RLGIPTVVCGPGDMEGQGHKPDEFLALPQLALCERMLDRLLAGLR"
FT   sig_peptide     601117..601188
FT                   /locus_tag="Pden_3458"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.856) with cleavage site probability 0.655 at
FT                   residue 24"
FT   gene            602523..603659
FT                   /locus_tag="Pden_3459"
FT   CDS_pept        602523..603659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3459"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: rsp:RSP_1882 ABC polyamine/opine transporter,
FT                   ATPase subunit; TIGRFAM: spermidine/putrescine ABC
FT                   transporter ATPase subunit; PFAM: ABC transporter related;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3459"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71530"
FT                   /db_xref="GOA:A1B7N6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7N6"
FT                   /protein_id="ABL71530.1"
FT                   /translation="MSKATAAARADTGAVTANDAFVAFERVQKSYDGETLVVKDLNLAI
FT                   ARGEFLTLLGPSGSGKTTSLMMLAGFETATSGEIRLAGRPINAVPPHRRGIGMVFQNYA
FT                   LFPHMTVGENLAFPLQVRGLGKVEREAKIMRALDMVQMGRFANRRPAQLSGGQQQRIAL
FT                   ARALVFDPDLVLMDEPLGALDKQLREHMQYEIKQLHERIGITVVYVTHDQGEALTMSDR
FT                   VAVFNDGRIQQLAPPAELYERPGNSFVAQFIGENNTLAGTIEQLQGDRALVRLGNGELI
FT                   DATAVDIREVGQVTTVSIRPERVEFKPEMMPPGAHRIAAEVLEVIYMGDVLRTRMKVAG
FT                   ASDFVLKCRNTLGQRKLTPGETIEIGWHPEDARALDPV"
FT   gene            603742..604812
FT                   /locus_tag="Pden_3460"
FT   CDS_pept        603742..604812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3460"
FT                   /product="ABC polyamine/opine transporter, periplasmic
FT                   substrate-binding protein"
FT                   /note="KEGG: rsp:RSP_1883 ABC polyamine/opine transporter,
FT                   periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3460"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71531"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7N7"
FT                   /protein_id="ABL71531.1"
FT                   /translation="MKKLLIMTTALAATAGAAQADITVMSWGGAYEKSQVEAYNRPFAA
FT                   KTGIAVQMLAADNPAAPIKSMVESGNVTLDVADVEATDAARLCDEGLLEEIDPAAFPPA
FT                   PDGTPAVDDFLPGALTECAVASMVFSTVYGYDTNRFPDEKPATIADFFDVEKFPGKRGM
FT                   RKSPKPNLELALMADGVPAAEVYEVLETPEGLDRAFAKLDSIKSHIVWWEAGAQPPQLL
FT                   ADGEVAMTTAYNGRLFSAMVAENKPFAMVWDGQVYEYELFVIPKGAPNLDEAMEYIRFA
FT                   TDTQRLADQTRWISYGPARKSSIPLVGLFEDGKTEMGPHMPTAEPNLANALHSSFEFWV
FT                   DRDMEISERFNTWLVR"
FT   sig_peptide     603742..603804
FT                   /locus_tag="Pden_3460"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 21"
FT   gene            604937..606229
FT                   /locus_tag="Pden_3461"
FT   CDS_pept        604937..606229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3461"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rsp:RSP_1884 ABC
FT                   polyamine/opine transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3461"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71532"
FT                   /db_xref="GOA:A1B7N8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7N8"
FT                   /protein_id="ABL71532.1"
FT                   /translation="MADTSANGVSFAPAPAHRTGLVTADGRPLRSALARSSRRARRRAF
FT                   FLVLPLLLFVLITFVVPIGQMLQRSVKNEGFSANMPQLSAWFHDNPRGTEPDDAAWAAL
FT                   AADLTAAAQARTIGVVGTRINYDMPGTRSLFTSAGRQARGGIEPPYREAILEMDARWGN
FT                   PRLWSVMREAASPYTANFYLAAVDRTRDDQGDIVSAPAQQQIYGKLFLRTFWLSLAITA
FT                   TTFLLGFPVAHLLATLPMRQSNLLMILVLLPFWTSLLVRTTAWIVLLQQQGVVNDVLVW
FT                   LGVIGNNQRLQMIFNQTGTIIAMTHILLPFMILPLYSVMRTINPSYVRAARSLGATSWT
FT                   AFRRIYFPQTLPGLGAGALLVFILAVGYYITPALVGGSSGQLISNMIAMHMTQTLNWSM
FT                   AAALAALLLGGVLILYWVYDRLVGIDNLKLG"
FT   gene            606235..607188
FT                   /locus_tag="Pden_3462"
FT   CDS_pept        606235..607188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3462"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rsp:RSP_1886 ABC
FT                   polyamine/opine transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3462"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71533"
FT                   /db_xref="GOA:A1B3Z7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1B3Z7"
FT                   /protein_id="ABL71533.1"
FT                   /translation="MALPTYASPLEKTWHYAYLAICAAIFFFLIAPIVVVIPLSFNAEP
FT                   YFTFTDRMLSFDPDGYSLRWYDSLLTFGMARPDAPRDLSWWADAWRNAKWVNAAKSSII
FT                   IGFFSTILATVLGTLAALGLSRPEMPYRRAIMAVLISPMIVPIIITATGMFFFYSNPCE
FT                   PLTWIGLDPQCGRLAGTYLGVILAHATLGIPFVIITVTATLIGFDQSLNRAAASLGANP
FT                   RTTFFRITMPLILPGVISGALFAFVTSFDEVVAVLFIAGPDQQTIPRQMWNGIREQISP
FT                   AILAVATLLVIFSIALLTTVEMLRRRSEKLRGLTPG"
FT   gene            607236..608441
FT                   /locus_tag="Pden_3463"
FT   CDS_pept        607236..608441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3463"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: sil:SPO3737 pyridine
FT                   nucleotide-disulphide oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3463"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71534"
FT                   /db_xref="GOA:A1B7P0"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7P0"
FT                   /protein_id="ABL71534.1"
FT                   /translation="MPHVVVIGAGQAGAALAARLRALKFQGEITVIGDEPAPPYQRPPL
FT                   SKAYLLGEMEEERLWLRSADFWAENRITLKLGTPVTAIDPVARTVTVGEEVLAYDELAL
FT                   TTGSVPRRLPAEMGGALGGVHTVRTLADIDAIRAGFVPGRRLVVIGGGYIGLEAAAVAR
FT                   KLGLEVTVIEMAPRILQRVAAPETALYFRKLHAGHGAAIIEGEGVDRILGEGRVAGVRL
FT                   KDGRVLPADFVIAGVGIVPATALAEAAGIALENGIRTDARGRTSAANVWAAGDCASFPL
FT                   DGVQIRLESVGNAIDQAELVAANIMGADKDYVPKPWFWSDQYDCKLQIAGLNAGYDRVV
FT                   ARPGEGEAVSIWYYAGDRLLAVDAMNDPRAFMVGKRLIEAGRTADPRLVADAATDLKAL
FT                   LR"
FT   gene            complement(608674..609030)
FT                   /locus_tag="Pden_3464"
FT   CDS_pept        complement(608674..609030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3464"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: sil:SPO0766 iron-sulfur
FT                   cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3464"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71535"
FT                   /db_xref="GOA:A1B7P1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7P1"
FT                   /protein_id="ABL71535.1"
FT                   /translation="MGAPRRTTERNTVPFITWRDADGTEISANVAAGTNLMRAAVDAGV
FT                   QGIHGDCGGALACATCHVATDTAWAERLGPPGALEDEMLDMVEGERTPTSRLSCQILAR
FT                   DELEGLVLIVPACG"
FT   gene            complement(609104..610258)
FT                   /locus_tag="Pden_3465"
FT   CDS_pept        complement(609104..610258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3465"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   bxe:Bxe_A3468 putative iron-sulphur rieske protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3465"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71536"
FT                   /db_xref="GOA:A1B7P2"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7P2"
FT                   /protein_id="ABL71536.1"
FT                   /translation="MSLAQPLAELLEAADRPLEDARAMPPGVYTNPEFLSHEIETIFSK
FT                   EWICVGRSSRLAKTGDYLTYDLAGQPVVVLRGKDGQLRAFSNVCLHRMSTLVEGCGNKR
FT                   VLVCPYHAWTYDLDGRLRGAPFMTQTTGFCKENYALPPIRCEEWLGWIYITLDKDRPGV
FT                   AAALGPLEKLIAPYEMENYVECFRETHVWDTNWKVLAENFMESYHLPVCHAATVGGHSR
FT                   LEEMECPPGLEAFNYHWITKEASLPMGNAHPDNRRLEGRWRKTTALITLYPSHLITLTP
FT                   GYFWYLSLHPKGTGQVSIVFGGGLSPEFMADPRAEEYVATLKGLLDEVNAEDRGCTEKV
FT                   FRGLSADAARAGHLSYLERPIHDFMRYIAERTGGYRRAFAVAAE"
FT   gene            610387..611307
FT                   /locus_tag="Pden_3466"
FT   CDS_pept        610387..611307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3466"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: csa:Csal_2385 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3466"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71537"
FT                   /db_xref="GOA:A1B7P3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7P3"
FT                   /protein_id="ABL71537.1"
FT                   /translation="MVRFTLRQCAYFRAVAEHGGIAQAARALNISQPSVAQALEKLEDV
FT                   TRLVLFERHHARGLTLTLQGRLFLEHVNRLEEQAGQVEREAAALAAETAGEIRLGVFRT
FT                   LSPFYAAGLIRSFGEAVPGVIVRQREMALANLADALRDGSIDLALTYDRGSDPQGLAFV
FT                   QLAALRPMVVLAADHPLAGRDSIDLADLADEPYVMLEGPGSRSYFEELLAESGISPPVS
FT                   YVSTSLEAVRSAVAAGFGFTLLVMRPPSSMTYDGGEVRTLPITNDLRPLRIVLASRDGA
FT                   HRGLVARRFTQHAIGYFAARHHAPA"
FT   gene            complement(611548..612549)
FT                   /locus_tag="Pden_3467"
FT   CDS_pept        complement(611548..612549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3467"
FT                   /product="proline racemase"
FT                   /EC_number="5.1.1.4"
FT                   /note="PFAM: proline racemase; KEGG: atc:AGR_L_1800
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3467"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71538"
FT                   /db_xref="GOA:A1B7P4"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7P4"
FT                   /protein_id="ABL71538.1"
FT                   /translation="MRHRFFCIDSHTCGNPVRVVAGGAPLLPHLPIFERRNLFLRDHDW
FT                   VRTALMFEPRGHDIMSGAILYPAFREDCDFAALFIEVSGCLPMCGAGTIGLATVAIEEG
FT                   LVTPKTPGRLTIETPAGRVDVEYAMQGERVASVRLFNVPSFLHSADIAVDVPGLGPLVV
FT                   DIAYGGNFYAVIEPQESWAGLDGMSAAEIVTHSRALREALAEIGETVVHPEDDRIRGVH
FT                   HAIWCDGPDGPDCDGRDAVFYGDKAIDRSPGGTGTSARMAQLHGKGRLAVGESFRNKSL
FT                   IGTVFEGRAEQAVTVGAYPGILPSIGGWARITGHNTILVDDDAPLRHGFQIA"
FT   gene            complement(612943..613653)
FT                   /locus_tag="Pden_3468"
FT   CDS_pept        complement(612943..613653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3468"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein,
FT                   Crp; KEGG: sil:SPOA0206 transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3468"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71539"
FT                   /db_xref="GOA:A1B7P5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7P5"
FT                   /protein_id="ABL71539.1"
FT                   /translation="MENMTKIMDLADLPWFAGLPDEVLAGIESGSRRRHADRGQLIIER
FT                   GEPGDSVLFVLSGHVLAVQWTRSGREIVYSEIAPGSAFGELSVLSGMPRSLSLYARTAC
FT                   VLLETPGTLLTGLMDTQPQVRQAVIQDLVRRIHDLTERVQELTALDVEERLRAYLLRVS
FT                   LEHGGLEPGRRMPDPPTHAEMANIIGANREAVSRALAKLSRAGIIESGRKYLRIMQPDA
FT                   LIPDDTGRGDCPSR"
FT   gene            613765..614847
FT                   /locus_tag="Pden_3469"
FT   CDS_pept        613765..614847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2705 response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3469"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71540"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7P6"
FT                   /protein_id="ABL71540.1"
FT                   /translation="MSIRHSAPSFAKEPLPAIRGVLHQLTMAALHVQLRARFQADRPQV
FT                   LARRAGIMAHAAVDGQASLRAMSHYCLEQLMPRVRSLMMQVDAAARLAALPAEVAPGAG
FT                   LAAQLSDIAANLERARETSRGRARTPHKSAGMIRLSEQRLWAALATELQRLEETDGPMS
FT                   HASARIEAAAFELAAAIEAFLERDEGMALAQRHDLAQILIRLESQAATTPLSPGEIAGQ
FT                   LGPAAARLPDLVDLCVDLSRAYQPLREARPQIAMVLSIATQTATQSGATRRLEQAMQDL
FT                   DHLLGGLVSDYRALARSAKRPQGKAAMRRLIAAEASLWHEAARLLAVPLALVPDAPAAR
FT                   PAIQAEAPAGDEHPAIVACA"
FT   gene            complement(615004..615549)
FT                   /locus_tag="Pden_3470"
FT   CDS_pept        complement(615004..615549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PC00193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3470"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71541"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7P7"
FT                   /protein_id="ABL71541.1"
FT                   /translation="MSETLLSPSNLLLFGRVVEDLQIRAPSAQDKRGDPRHGPFPQPRG
FT                   GTPGQLERQLQAEDANFARIYGFAFEGLYRVLPRPALFLVHGPGLEAGQVMSRLHLPQD
FT                   APAGSPPQAAGAGHVLPQPDDLMVWSYDKADYSIRLDIRSGMFEQLLLDPSGAPEARGM
FT                   SVHGMSVRGMSVNSDNKD"
FT   gene            complement(615599..616954)
FT                   /locus_tag="Pden_3471"
FT   CDS_pept        complement(615599..616954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3471"
FT                   /product="TfuA domain protein, core"
FT                   /note="PFAM: TfuA domain protein, core; KEGG: mxa:MXAN_2398
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3471"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71542"
FT                   /db_xref="InterPro:IPR012924"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7P8"
FT                   /protein_id="ABL71542.1"
FT                   /translation="MSVIVFVGPSLRQADRAAFAQFRFLPPVQQGDLYRAARQRPRAIG
FT                   LIDGYFDGVPAVWHKEVLWAISQGIAVFGAASMGALRAAELAPFGMRGVGRIFRDFHEG
FT                   RLTDDDEVALLHGPAETGHAALSEPMVNIRATAAAALAAGILDAPAAAHLLATAKALFY
FT                   QQRDWPAILAAAEQVPATMRDRLAAWLPDGRIDQKRADALEMLHVLQAHVARDEPPPRA
FT                   EFTFEWTEAWASAPWLAAHGDGIEAGDALMLDALRLQGEPYLRLRRAALLRQLAAETAT
FT                   RERRGVQPDHVAEAALAFRLPRGLLRGQDIDRWAAENGLDRPGFDRLMAGLAGLEALAR
FT                   DRDAALAPAILDQLRLEGGYKALRDRTAKAGTADPPLPLPLLLAWHFHTRLGRDLPEDL
FT                   EQYAGSLGFRDLAHFHAALARDHALWLKDGQPAPDGTAGRQSHRQPPPGGLT"
FT   gene            complement(616951..618120)
FT                   /locus_tag="Pden_3472"
FT   CDS_pept        complement(616951..618120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3472"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: uncharacterized domain; PFAM: protein of
FT                   unknown function DUF181; KEGG: ret:RHE_PE00437 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3472"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71543"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7P9"
FT                   /protein_id="ABL71543.1"
FT                   /translation="MAPAETIARVRPLMARMGITRVANVTGLDRIGLPVVMVCRPNARS
FT                   LAVSQGKGLDMDAATASGLMEAAELYHAEHIEAPLKLGSLNELAHSHRMIDLDRLARVS
FT                   DRFHRDLPMLWIQGRDLVSGEERWVPFECVRANYTLPPPPGSGCFLCSSNGLASGNTMA
FT                   EATCHAICELIERDATTLWHQSPPERRAKTGLDLESVADPACRAVLDRLQGAGFDVHAW
FT                   QVASDLGVPAFFCLISDRRDRGAHHGIGAGAHPTRAIALLRALTEAAQVRCTYISGARD
FT                   DLQPEEYGRHALDQKARAAAGMRASHRPMVNFAALDEFVSDDFAEDLDWLLARLRAVGI
FT                   DEAVAVDLRKPGLDLPVVRVVIPGLEAPCDHPAWRPGPRALAAARAAAP"
FT   gene            618747..620537
FT                   /locus_tag="Pden_3473"
FT   CDS_pept        618747..620537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3473"
FT                   /product="adenylyl cyclase class-3/4/guanylyl cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   TPR repeat-containing protein; Tetratricopeptide TPR_2
FT                   repeat protein; SMART: Tetratricopeptide domain protein;
FT                   KEGG: mlo:mll3276 adenylate cyclase cya3 [Sinorhizobium
FT                   meliloti]"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3473"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71544"
FT                   /db_xref="GOA:A1B7Q0"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7Q0"
FT                   /protein_id="ABL71544.1"
FT                   /translation="MPERSLGRAMIAQPGLTGPRLQAVLYADIHGYTRLIEQDEAGTIL
FT                   RLTRSIALIRNLVGDYGGTVVNTAGDGLVAVFQDAPKALHFAIEMQRELSRESAWAEAR
FT                   EPIAWRVGISLGETFEGQEGVYGHSVNLAARIQGFADPGGICVTETVYRIVRDNPELVL
FT                   RSLGRRRLKNISAPVEIYAAAPASPAAAAAVPLRAVPRRVDPGLPDTSLAILPMENLSA
FT                   DPGDQHLCHGIVADLITNLCRFRHLLVIARHSSFLAAAQTSSLREIGRRLGVRYLMTSS
FT                   FRRAGNRLRITVELVEAESENTIWSERYDGVMLDIFDFQDDVTAMTAARVAIQLDANER
FT                   RRLAEQSHPALYAYGLVLRGQDMGLRFLPDANLHARRLFEEARDLDPDYGRSYAAMSRT
FT                   FNVEWRYNWTSNPDAALNQALVLAKRAVQCDALDSRGFSEMGLAHLYKKQHDEALAAYE
FT                   HALALNPNDADLLAYTGDCLAYVRQGERAVQLLERAMRLNPYFPDAYLWFLGDAYFHHG
FT                   DYGKTIETLSRMRDQSEAHRLLAASHALLGQMDEARRHAGAVMRVHPNFTIAHWRKVPP
FT                   LKHAEDLELYVEGLRKAGLT"
FT   gene            620705..622696
FT                   /locus_tag="Pden_3474"
FT   CDS_pept        620705..622696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3474"
FT                   /product="protein of unknown function DUF839"
FT                   /note="PFAM: protein of unknown function DUF839; KEGG:
FT                   rsp:RSP_3051 putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3474"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71545"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7Q1"
FT                   /protein_id="ABL71545.1"
FT                   /translation="MTEQHPSRHVFRTSQLEEADGPGHNPTENRTMGEIIAARFSRRGF
FT                   LKGSMAATAISATVSPFALLAADEARAQDAVEGSAFSFPEVEAGVDADHHVAQGYDADI
FT                   LLRWGDKVFADAPDFDPKNQSEAAQERQFGYNNDFVGFIPLDGADDRGLLVVNHEYTNE
FT                   HLMFPGIVTVEDGKIAVAEATEARVDIEMAAHGGTVIEIRKVDGKWQPVLDGALNRRIT
FT                   AKTPMEICGPATGHARMQTAADPTGTRVLGTINNCAGGVTPWGTYIMAEENIHGYFTGA
FT                   LPEGHREAENYKRMGIPEDSYAWGRFHDRFDIGKEPNEPNRFGWIVEVDVMDPTSTPRK
FT                   RTALGRFKHEGAASALAKDGRVVFYLGDDERFDYVYKFVTAGRYNPDDRAANLDLLDEG
FT                   TLYVARFDEDGSFVWLPLVHGQGPLTAENGFESQADVLIETRRAADLLGATPMDRPEDI
FT                   EPNAETGRAYVMLTNNTKREEANAANPRVENAFGHIIEILEDGGDLAATQGTWEILLQC
FT                   GDPSVAEVGATFSTATTANGWFGMPDNCAIDSDGRLWVSTDGNSPKDTGRTDGLWAVDV
FT                   EGAARGTSRLFYRVPVGAEMCGPCPTPDLTTFFVAVQHPGDGGEDWEGHGRPSYYEDLS
FT                   TRWPDFRDDMPVRPAVVAITKQGGGRIG"
FT   gene            complement(622786..623484)
FT                   /locus_tag="Pden_3475"
FT   CDS_pept        complement(622786..623484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3475"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: bms:BRA0227
FT                   ThiJ/PfpI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3475"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71546"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7Q2"
FT                   /protein_id="ABL71546.1"
FT                   /translation="MAGMGKRILHVVTNRDHYDDPGRPTGLWLSELSHAWDVFAAEGHA
FT                   QDIVSPAGGRSPLEPRALKWPLLDASARGWLNDPARMALLERTAAPDQVDPDAYDAIYF
FT                   TGGHGVMWDFPDNAGLQAIARRIWEKGGIVSSVCHGYCGLLNTRLSDGTLLVAGRQVTG
FT                   FSWTEEILAGVARHMPYDAEAEMKRRGARYGKALLPFVSHVVTDGRLVTGQNPGSAKAI
FT                   ARQVARLLRG"
FT   gene            complement(623489..624766)
FT                   /locus_tag="Pden_3476"
FT   CDS_pept        complement(623489..624766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3476"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   ccr:CC3083 FMN oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3476"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71547"
FT                   /db_xref="GOA:A1B7Q3"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7Q3"
FT                   /protein_id="ABL71547.1"
FT                   /translation="MTATTQTPLFQPLQLPGGQIVKNRIAKAAMEENMADTRHLPGPAL
FT                   RRLYREWAQGGAGLLLTGNVMVAPDAVTGPAGVILDAGQPLGPFREWAQAGRADGARLW
FT                   MQINHPGRQVYAATNPQAIAPSAVPVAIEGYAHLFAQPRAMSDSDIAEVIRRFADTAAL
FT                   AEQAGFDGVQVHAAHGYLLSQFLSPLTNRREDRWGGTLESRARLLVEIVRAIRARVAPG
FT                   FGVGVKLNSSDFQKGGFAAEDAVAVVRMLNELPVDLVELSGGSYESPAMHGRPQQASTR
FT                   QSSLAREAYFVDFARDVVAEARMPVMVTGGIRRRATAEAALAPEDGRAGVAMVGIAQAL
FT                   AYAPDLPNRWHKAEATVTVPMVRWKNRAISGLATMAMTKLQLRRLGAGKAPKPGAWAPL
FT                   VLVRDRIRTALRSRRYRAWLRRRAGA"
FT   gene            624840..625202
FT                   /locus_tag="Pden_3477"
FT   CDS_pept        624840..625202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3477"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: ccr:CC3082
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3477"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71548"
FT                   /db_xref="GOA:A1B7Q4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7Q4"
FT                   /protein_id="ABL71548.1"
FT                   /translation="MKIGDIARAAGVTTSRIRFYEKRGIIAPAVRGPNGYRDYPEELIA
FT                   ILRFIEQAQGLGFSLKEIAGVDVAQGDHPISCDEAIRLLSGKLDSVAALIAEAKERQRR
FT                   IKALIAELQGRKQSAA"
FT   gene            625476..625685
FT                   /pseudo
FT                   /locus_tag="Pden_3478"
FT   gene            complement(625891..626646)
FT                   /locus_tag="Pden_3479"
FT   CDS_pept        complement(625891..626646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_3479"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: rpc:RPC_0118
FT                   transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_3479"
FT                   /db_xref="EnsemblGenomes-Tr:ABL71549"
FT                   /db_xref="GOA:A1B7Q5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1B7Q5"
FT                   /protein_id="ABL71549.1"
FT                   /trans