(data stored in ACNUC13767 zone)

EMBL: CP000492

ID   CP000492; SV 1; circular; genomic DNA; STD; PRO; 3133902 BP.
XX
AC   CP000492; AAIB01000000-AAIB01000077;
XX
PR   Project:PRJNA12609;
XX
DT   12-DEC-2006 (Rel. 90, Created)
DT   09-SEP-2019 (Rel. 142, Last updated, Version 8)
XX
DE   Chlorobium phaeobacteroides DSM 266, complete genome.
XX
KW   .
XX
OS   Chlorobium phaeobacteroides DSM 266
OC   Bacteria; Chlorobi; Chlorobia; Chlorobiales; Chlorobiaceae;
OC   Chlorobium/Pelodictyon group; Chlorobium.
XX
RN   [1]
RP   1-3133902
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Goltsman E.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Mikhailova N., Li T.,
RA   Overmann J., Bryant D.A., Richardson P.;
RT   "Complete sequence of Chlorobium phaeobacteroides DSM 266";
RL   Unpublished.
XX
RN   [2]
RP   1-3133902
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Goltsman E.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Mikhailova N., Li T.,
RA   Overmann J., Bryant D.A., Richardson P.;
RT   ;
RL   Submitted (05-DEC-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 18919065f3ce743ea547000d994664f5.
DR   BioSample; SAMN02598273.
DR   CABRI; DSM 266.
DR   EnsemblGenomes-Gn; Cpha266_R0001.
DR   EnsemblGenomes-Gn; Cpha266_R0002.
DR   EnsemblGenomes-Gn; Cpha266_R0003.
DR   EnsemblGenomes-Gn; Cpha266_R0004.
DR   EnsemblGenomes-Gn; Cpha266_R0005.
DR   EnsemblGenomes-Gn; Cpha266_R0006.
DR   EnsemblGenomes-Gn; Cpha266_R0007.
DR   EnsemblGenomes-Gn; Cpha266_R0008.
DR   EnsemblGenomes-Gn; Cpha266_R0009.
DR   EnsemblGenomes-Gn; Cpha266_R0010.
DR   EnsemblGenomes-Gn; Cpha266_R0011.
DR   EnsemblGenomes-Gn; Cpha266_R0012.
DR   EnsemblGenomes-Gn; Cpha266_R0013.
DR   EnsemblGenomes-Gn; Cpha266_R0014.
DR   EnsemblGenomes-Gn; Cpha266_R0015.
DR   EnsemblGenomes-Gn; Cpha266_R0016.
DR   EnsemblGenomes-Gn; Cpha266_R0017.
DR   EnsemblGenomes-Gn; Cpha266_R0018.
DR   EnsemblGenomes-Gn; Cpha266_R0019.
DR   EnsemblGenomes-Gn; Cpha266_R0020.
DR   EnsemblGenomes-Gn; Cpha266_R0021.
DR   EnsemblGenomes-Gn; Cpha266_R0022.
DR   EnsemblGenomes-Gn; Cpha266_R0023.
DR   EnsemblGenomes-Gn; Cpha266_R0024.
DR   EnsemblGenomes-Gn; Cpha266_R0025.
DR   EnsemblGenomes-Gn; Cpha266_R0026.
DR   EnsemblGenomes-Gn; Cpha266_R0027.
DR   EnsemblGenomes-Gn; Cpha266_R0028.
DR   EnsemblGenomes-Gn; Cpha266_R0029.
DR   EnsemblGenomes-Gn; Cpha266_R0030.
DR   EnsemblGenomes-Gn; Cpha266_R0031.
DR   EnsemblGenomes-Gn; Cpha266_R0032.
DR   EnsemblGenomes-Gn; Cpha266_R0033.
DR   EnsemblGenomes-Gn; Cpha266_R0034.
DR   EnsemblGenomes-Gn; Cpha266_R0035.
DR   EnsemblGenomes-Gn; Cpha266_R0036.
DR   EnsemblGenomes-Gn; Cpha266_R0038.
DR   EnsemblGenomes-Gn; Cpha266_R0039.
DR   EnsemblGenomes-Gn; Cpha266_R0040.
DR   EnsemblGenomes-Gn; Cpha266_R0041.
DR   EnsemblGenomes-Gn; Cpha266_R0042.
DR   EnsemblGenomes-Gn; Cpha266_R0043.
DR   EnsemblGenomes-Gn; Cpha266_R0044.
DR   EnsemblGenomes-Gn; Cpha266_R0045.
DR   EnsemblGenomes-Gn; Cpha266_R0046.
DR   EnsemblGenomes-Gn; Cpha266_R0047.
DR   EnsemblGenomes-Gn; Cpha266_R0048.
DR   EnsemblGenomes-Gn; Cpha266_R0049.
DR   EnsemblGenomes-Gn; Cpha266_R0050.
DR   EnsemblGenomes-Gn; Cpha266_R0051.
DR   EnsemblGenomes-Gn; Cpha266_R0052.
DR   EnsemblGenomes-Gn; Cpha266_R0053.
DR   EnsemblGenomes-Gn; Cpha266_R0054.
DR   EnsemblGenomes-Gn; Cpha266_R0056.
DR   EnsemblGenomes-Gn; EBG00001453508.
DR   EnsemblGenomes-Gn; EBG00001453509.
DR   EnsemblGenomes-Gn; EBG00001453510.
DR   EnsemblGenomes-Gn; EBG00001453511.
DR   EnsemblGenomes-Gn; EBG00001453512.
DR   EnsemblGenomes-Gn; EBG00001453513.
DR   EnsemblGenomes-Gn; EBG00001453514.
DR   EnsemblGenomes-Gn; EBG00001453515.
DR   EnsemblGenomes-Gn; EBG00001453516.
DR   EnsemblGenomes-Gn; EBG00001453517.
DR   EnsemblGenomes-Gn; EBG00001453518.
DR   EnsemblGenomes-Gn; EBG00001453519.
DR   EnsemblGenomes-Gn; EBG00001453520.
DR   EnsemblGenomes-Gn; EBG00001453521.
DR   EnsemblGenomes-Gn; EBG00001453522.
DR   EnsemblGenomes-Gn; EBG00001453523.
DR   EnsemblGenomes-Gn; EBG00001453524.
DR   EnsemblGenomes-Gn; EBG00001453525.
DR   EnsemblGenomes-Gn; EBG00001453526.
DR   EnsemblGenomes-Gn; EBG00001453527.
DR   EnsemblGenomes-Gn; EBG00001453528.
DR   EnsemblGenomes-Gn; EBG00001453529.
DR   EnsemblGenomes-Gn; EBG00001453530.
DR   EnsemblGenomes-Gn; EBG00001453531.
DR   EnsemblGenomes-Gn; EBG00001453532.
DR   EnsemblGenomes-Gn; EBG00001453533.
DR   EnsemblGenomes-Gn; EBG00001453534.
DR   EnsemblGenomes-Gn; EBG00001453535.
DR   EnsemblGenomes-Gn; EBG00001453536.
DR   EnsemblGenomes-Gn; EBG00001453537.
DR   EnsemblGenomes-Gn; EBG00001453538.
DR   EnsemblGenomes-Gn; EBG00001453539.
DR   EnsemblGenomes-Gn; EBG00001453540.
DR   EnsemblGenomes-Gn; EBG00001453541.
DR   EnsemblGenomes-Gn; EBG00001453542.
DR   EnsemblGenomes-Gn; EBG00001453543.
DR   EnsemblGenomes-Gn; EBG00001453544.
DR   EnsemblGenomes-Gn; EBG00001453545.
DR   EnsemblGenomes-Gn; EBG00001453546.
DR   EnsemblGenomes-Gn; EBG00001453547.
DR   EnsemblGenomes-Gn; EBG00001453548.
DR   EnsemblGenomes-Gn; EBG00001453549.
DR   EnsemblGenomes-Gn; EBG00001453550.
DR   EnsemblGenomes-Gn; EBG00001453551.
DR   EnsemblGenomes-Gn; EBG00001453552.
DR   EnsemblGenomes-Gn; EBG00001453553.
DR   EnsemblGenomes-Gn; EBG00001453554.
DR   EnsemblGenomes-Gn; EBG00001453555.
DR   EnsemblGenomes-Gn; EBG00001453556.
DR   EnsemblGenomes-Gn; EBG00001453557.
DR   EnsemblGenomes-Gn; EBG00001453558.
DR   EnsemblGenomes-Gn; EBG00001453559.
DR   EnsemblGenomes-Gn; EBG00001453560.
DR   EnsemblGenomes-Gn; EBG00001453561.
DR   EnsemblGenomes-Gn; EBG00001453562.
DR   EnsemblGenomes-Gn; EBG00001453563.
DR   EnsemblGenomes-Gn; EBG00001453564.
DR   EnsemblGenomes-Gn; EBG00001453565.
DR   EnsemblGenomes-Gn; EBG00001453566.
DR   EnsemblGenomes-Gn; EBG00001453567.
DR   EnsemblGenomes-Gn; EBG00001453568.
DR   EnsemblGenomes-Gn; EBG00001453569.
DR   EnsemblGenomes-Gn; EBG00001453570.
DR   EnsemblGenomes-Gn; EBG00001453571.
DR   EnsemblGenomes-Gn; EBG00001453572.
DR   EnsemblGenomes-Gn; EBG00001453573.
DR   EnsemblGenomes-Gn; EBG00001453574.
DR   EnsemblGenomes-Gn; EBG00001453575.
DR   EnsemblGenomes-Gn; EBG00001453576.
DR   EnsemblGenomes-Gn; EBG00001453577.
DR   EnsemblGenomes-Gn; EBG00001453578.
DR   EnsemblGenomes-Gn; EBG00001453579.
DR   EnsemblGenomes-Gn; EBG00001453580.
DR   EnsemblGenomes-Gn; EBG00001453581.
DR   EnsemblGenomes-Gn; EBG00001453582.
DR   EnsemblGenomes-Gn; EBG00001453583.
DR   EnsemblGenomes-Gn; EBG00001453584.
DR   EnsemblGenomes-Gn; EBG00001453585.
DR   EnsemblGenomes-Gn; EBG00001453586.
DR   EnsemblGenomes-Gn; EBG00001453587.
DR   EnsemblGenomes-Gn; EBG00001453588.
DR   EnsemblGenomes-Gn; EBG00001453589.
DR   EnsemblGenomes-Gn; EBG00001453590.
DR   EnsemblGenomes-Gn; EBG00001453591.
DR   EnsemblGenomes-Gn; EBG00001453592.
DR   EnsemblGenomes-Gn; EBG00001453593.
DR   EnsemblGenomes-Gn; EBG00001453594.
DR   EnsemblGenomes-Gn; EBG00001453595.
DR   EnsemblGenomes-Gn; EBG00001453596.
DR   EnsemblGenomes-Gn; EBG00001453597.
DR   EnsemblGenomes-Gn; EBG00001453598.
DR   EnsemblGenomes-Gn; EBG00001453599.
DR   EnsemblGenomes-Gn; EBG00001453600.
DR   EnsemblGenomes-Gn; EBG00001453601.
DR   EnsemblGenomes-Gn; EBG00001453602.
DR   EnsemblGenomes-Gn; EBG00001453603.
DR   EnsemblGenomes-Gn; EBG00001453604.
DR   EnsemblGenomes-Gn; EBG00001453605.
DR   EnsemblGenomes-Gn; EBG00001453606.
DR   EnsemblGenomes-Gn; EBG00001453607.
DR   EnsemblGenomes-Gn; EBG00001453608.
DR   EnsemblGenomes-Gn; EBG00001453609.
DR   EnsemblGenomes-Gn; EBG00001453610.
DR   EnsemblGenomes-Gn; EBG00001453611.
DR   EnsemblGenomes-Gn; EBG00001453612.
DR   EnsemblGenomes-Gn; EBG00001453613.
DR   EnsemblGenomes-Gn; EBG00001453614.
DR   EnsemblGenomes-Gn; EBG00001453615.
DR   EnsemblGenomes-Gn; EBG00001453616.
DR   EnsemblGenomes-Gn; EBG00001453617.
DR   EnsemblGenomes-Gn; EBG00001453618.
DR   EnsemblGenomes-Tr; Cpha266_R0001-1.
DR   EnsemblGenomes-Tr; Cpha266_R0002-1.
DR   EnsemblGenomes-Tr; Cpha266_R0003-1.
DR   EnsemblGenomes-Tr; Cpha266_R0004-1.
DR   EnsemblGenomes-Tr; Cpha266_R0005-1.
DR   EnsemblGenomes-Tr; Cpha266_R0006-1.
DR   EnsemblGenomes-Tr; Cpha266_R0007-1.
DR   EnsemblGenomes-Tr; Cpha266_R0008-1.
DR   EnsemblGenomes-Tr; Cpha266_R0009-1.
DR   EnsemblGenomes-Tr; Cpha266_R0010-1.
DR   EnsemblGenomes-Tr; Cpha266_R0011-1.
DR   EnsemblGenomes-Tr; Cpha266_R0012-1.
DR   EnsemblGenomes-Tr; Cpha266_R0013-1.
DR   EnsemblGenomes-Tr; Cpha266_R0014-1.
DR   EnsemblGenomes-Tr; Cpha266_R0015-1.
DR   EnsemblGenomes-Tr; Cpha266_R0016-1.
DR   EnsemblGenomes-Tr; Cpha266_R0017-1.
DR   EnsemblGenomes-Tr; Cpha266_R0018-1.
DR   EnsemblGenomes-Tr; Cpha266_R0019-1.
DR   EnsemblGenomes-Tr; Cpha266_R0020-1.
DR   EnsemblGenomes-Tr; Cpha266_R0021-1.
DR   EnsemblGenomes-Tr; Cpha266_R0022-1.
DR   EnsemblGenomes-Tr; Cpha266_R0023-1.
DR   EnsemblGenomes-Tr; Cpha266_R0024-1.
DR   EnsemblGenomes-Tr; Cpha266_R0025-1.
DR   EnsemblGenomes-Tr; Cpha266_R0026-1.
DR   EnsemblGenomes-Tr; Cpha266_R0027-1.
DR   EnsemblGenomes-Tr; Cpha266_R0028-1.
DR   EnsemblGenomes-Tr; Cpha266_R0029-1.
DR   EnsemblGenomes-Tr; Cpha266_R0030-1.
DR   EnsemblGenomes-Tr; Cpha266_R0031-1.
DR   EnsemblGenomes-Tr; Cpha266_R0032-1.
DR   EnsemblGenomes-Tr; Cpha266_R0033-1.
DR   EnsemblGenomes-Tr; Cpha266_R0034-1.
DR   EnsemblGenomes-Tr; Cpha266_R0035-1.
DR   EnsemblGenomes-Tr; Cpha266_R0036-1.
DR   EnsemblGenomes-Tr; Cpha266_R0038-1.
DR   EnsemblGenomes-Tr; Cpha266_R0039-1.
DR   EnsemblGenomes-Tr; Cpha266_R0040-1.
DR   EnsemblGenomes-Tr; Cpha266_R0041-1.
DR   EnsemblGenomes-Tr; Cpha266_R0042-1.
DR   EnsemblGenomes-Tr; Cpha266_R0043-1.
DR   EnsemblGenomes-Tr; Cpha266_R0044-1.
DR   EnsemblGenomes-Tr; Cpha266_R0045-1.
DR   EnsemblGenomes-Tr; Cpha266_R0046-1.
DR   EnsemblGenomes-Tr; Cpha266_R0047-1.
DR   EnsemblGenomes-Tr; Cpha266_R0048-1.
DR   EnsemblGenomes-Tr; Cpha266_R0049-1.
DR   EnsemblGenomes-Tr; Cpha266_R0050-1.
DR   EnsemblGenomes-Tr; Cpha266_R0051-1.
DR   EnsemblGenomes-Tr; Cpha266_R0052-1.
DR   EnsemblGenomes-Tr; Cpha266_R0053-1.
DR   EnsemblGenomes-Tr; Cpha266_R0054-1.
DR   EnsemblGenomes-Tr; Cpha266_R0056-1.
DR   EnsemblGenomes-Tr; EBT00001607305.
DR   EnsemblGenomes-Tr; EBT00001607306.
DR   EnsemblGenomes-Tr; EBT00001607307.
DR   EnsemblGenomes-Tr; EBT00001607308.
DR   EnsemblGenomes-Tr; EBT00001607309.
DR   EnsemblGenomes-Tr; EBT00001607310.
DR   EnsemblGenomes-Tr; EBT00001607311.
DR   EnsemblGenomes-Tr; EBT00001607312.
DR   EnsemblGenomes-Tr; EBT00001607313.
DR   EnsemblGenomes-Tr; EBT00001607314.
DR   EnsemblGenomes-Tr; EBT00001607315.
DR   EnsemblGenomes-Tr; EBT00001607316.
DR   EnsemblGenomes-Tr; EBT00001607317.
DR   EnsemblGenomes-Tr; EBT00001607318.
DR   EnsemblGenomes-Tr; EBT00001607319.
DR   EnsemblGenomes-Tr; EBT00001607320.
DR   EnsemblGenomes-Tr; EBT00001607321.
DR   EnsemblGenomes-Tr; EBT00001607322.
DR   EnsemblGenomes-Tr; EBT00001607323.
DR   EnsemblGenomes-Tr; EBT00001607324.
DR   EnsemblGenomes-Tr; EBT00001607325.
DR   EnsemblGenomes-Tr; EBT00001607326.
DR   EnsemblGenomes-Tr; EBT00001607327.
DR   EnsemblGenomes-Tr; EBT00001607328.
DR   EnsemblGenomes-Tr; EBT00001607329.
DR   EnsemblGenomes-Tr; EBT00001607330.
DR   EnsemblGenomes-Tr; EBT00001607331.
DR   EnsemblGenomes-Tr; EBT00001607332.
DR   EnsemblGenomes-Tr; EBT00001607333.
DR   EnsemblGenomes-Tr; EBT00001607334.
DR   EnsemblGenomes-Tr; EBT00001607335.
DR   EnsemblGenomes-Tr; EBT00001607336.
DR   EnsemblGenomes-Tr; EBT00001607337.
DR   EnsemblGenomes-Tr; EBT00001607338.
DR   EnsemblGenomes-Tr; EBT00001607339.
DR   EnsemblGenomes-Tr; EBT00001607340.
DR   EnsemblGenomes-Tr; EBT00001607341.
DR   EnsemblGenomes-Tr; EBT00001607342.
DR   EnsemblGenomes-Tr; EBT00001607343.
DR   EnsemblGenomes-Tr; EBT00001607344.
DR   EnsemblGenomes-Tr; EBT00001607345.
DR   EnsemblGenomes-Tr; EBT00001607346.
DR   EnsemblGenomes-Tr; EBT00001607347.
DR   EnsemblGenomes-Tr; EBT00001607348.
DR   EnsemblGenomes-Tr; EBT00001607349.
DR   EnsemblGenomes-Tr; EBT00001607350.
DR   EnsemblGenomes-Tr; EBT00001607351.
DR   EnsemblGenomes-Tr; EBT00001607352.
DR   EnsemblGenomes-Tr; EBT00001607353.
DR   EnsemblGenomes-Tr; EBT00001607354.
DR   EnsemblGenomes-Tr; EBT00001607355.
DR   EnsemblGenomes-Tr; EBT00001607356.
DR   EnsemblGenomes-Tr; EBT00001607357.
DR   EnsemblGenomes-Tr; EBT00001607358.
DR   EnsemblGenomes-Tr; EBT00001607359.
DR   EnsemblGenomes-Tr; EBT00001607360.
DR   EnsemblGenomes-Tr; EBT00001607361.
DR   EnsemblGenomes-Tr; EBT00001607362.
DR   EnsemblGenomes-Tr; EBT00001607363.
DR   EnsemblGenomes-Tr; EBT00001607364.
DR   EnsemblGenomes-Tr; EBT00001607365.
DR   EnsemblGenomes-Tr; EBT00001607366.
DR   EnsemblGenomes-Tr; EBT00001607367.
DR   EnsemblGenomes-Tr; EBT00001607368.
DR   EnsemblGenomes-Tr; EBT00001607369.
DR   EnsemblGenomes-Tr; EBT00001607370.
DR   EnsemblGenomes-Tr; EBT00001607371.
DR   EnsemblGenomes-Tr; EBT00001607372.
DR   EnsemblGenomes-Tr; EBT00001607373.
DR   EnsemblGenomes-Tr; EBT00001607374.
DR   EnsemblGenomes-Tr; EBT00001607375.
DR   EnsemblGenomes-Tr; EBT00001607376.
DR   EnsemblGenomes-Tr; EBT00001607377.
DR   EnsemblGenomes-Tr; EBT00001607378.
DR   EnsemblGenomes-Tr; EBT00001607379.
DR   EnsemblGenomes-Tr; EBT00001607380.
DR   EnsemblGenomes-Tr; EBT00001607381.
DR   EnsemblGenomes-Tr; EBT00001607382.
DR   EnsemblGenomes-Tr; EBT00001607383.
DR   EnsemblGenomes-Tr; EBT00001607384.
DR   EnsemblGenomes-Tr; EBT00001607385.
DR   EnsemblGenomes-Tr; EBT00001607386.
DR   EnsemblGenomes-Tr; EBT00001607387.
DR   EnsemblGenomes-Tr; EBT00001607388.
DR   EnsemblGenomes-Tr; EBT00001607389.
DR   EnsemblGenomes-Tr; EBT00001607390.
DR   EnsemblGenomes-Tr; EBT00001607391.
DR   EnsemblGenomes-Tr; EBT00001607392.
DR   EnsemblGenomes-Tr; EBT00001607393.
DR   EnsemblGenomes-Tr; EBT00001607394.
DR   EnsemblGenomes-Tr; EBT00001607395.
DR   EnsemblGenomes-Tr; EBT00001607396.
DR   EnsemblGenomes-Tr; EBT00001607397.
DR   EnsemblGenomes-Tr; EBT00001607398.
DR   EnsemblGenomes-Tr; EBT00001607399.
DR   EnsemblGenomes-Tr; EBT00001607400.
DR   EnsemblGenomes-Tr; EBT00001607401.
DR   EnsemblGenomes-Tr; EBT00001607402.
DR   EnsemblGenomes-Tr; EBT00001607403.
DR   EnsemblGenomes-Tr; EBT00001607404.
DR   EnsemblGenomes-Tr; EBT00001607405.
DR   EnsemblGenomes-Tr; EBT00001607406.
DR   EnsemblGenomes-Tr; EBT00001607407.
DR   EnsemblGenomes-Tr; EBT00001607408.
DR   EnsemblGenomes-Tr; EBT00001607409.
DR   EnsemblGenomes-Tr; EBT00001607410.
DR   EnsemblGenomes-Tr; EBT00001607411.
DR   EnsemblGenomes-Tr; EBT00001607412.
DR   EnsemblGenomes-Tr; EBT00001607413.
DR   EnsemblGenomes-Tr; EBT00001607414.
DR   EnsemblGenomes-Tr; EBT00001607415.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01321; CRISPR-DR8.
DR   RFAM; RF01348; CRISPR-DR38.
DR   RFAM; RF01697; Chlorobi-RRM.
DR   RFAM; RF01711; Lnt.
DR   RFAM; RF01724; SAM-Chlorobi.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   SILVA-LSU; CP000492.
DR   SILVA-SSU; CP000492.
DR   StrainInfo; 156549; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634474
CC   Source DNA and bacteria available from Donald A. Bryant
CC   (dab14@psu.edu)
CC   Bacteria available from DSMZ: DSM 266
CC   Contacts: Donald A. Bryant (dab14@psu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3133902
FT                   /organism="Chlorobium phaeobacteroides DSM 266"
FT                   /strain="DSM 266"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:290317"
FT                   /type_material="type strain of Chlorobium phaeobacteroides"
FT   gene            1..1473
FT                   /locus_tag="Cpha266_0001"
FT   CDS_pept        1..1473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: cch:Cag_0001 chromosomal replication initiator
FT                   protein, DnaA; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA; PFAM: Chromosomal replication initiator, DnaA
FT                   C-terminal domain; Chromosomal replication initiator, DnaA;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64078"
FT                   /db_xref="GOA:A1BCH1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCH1"
FT                   /protein_id="ABL64078.1"
FT                   /translation="MSEATNRVPEVKIPSNLHKPILLEQQVWDSCLEAIREKINPLAYK
FT                   TWFSPIKPVNFSGSELTIQVPSQFFYEWIEENYSSFLKQALKDVIGSEAKLMYSIVMDK
FT                   SQGQPVTIELPHQSTPLSACSSDSSESTQIKNKEAFEKNLQRFETHLNPKYVFETLIRG
FT                   DCNSLAFAASKSVAQNPGLNAFNPLVIYGGVGLGKTHMMQAIGNSVRKNCLSEKVLYVS
FT                   SEKFAVDFVNAIQNGKIQEFSSFYRNIDVLIIDDIQFFAGKEKTQEEIFHIFNTLHQTN
FT                   KQIILSSDRPIKDIKGIEDRLISRFNWGLSADIQPPDYETRKAIILSKLEQSGVNLDES
FT                   VIEFIATNVTENVRELEGCIVKLLAAQSLDNREIDLHFTKSTLKDIIRHTTKQLTLDTI
FT                   EKAVCSFFAITPNDLKGKSKKKEIATGRQIAMYLAKNLTESSLKTIGLHFGGRDHSTVI
FT                   HAVNTVGNRMEQQSDERKKIEELKKRIEILSM"
FT   gene            1895..3025
FT                   /locus_tag="Cpha266_0002"
FT   CDS_pept        1895..3025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: plt:Plut_0001 DNA-directed DNA polymerase;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64079"
FT                   /db_xref="GOA:A1BCH2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCH2"
FT                   /protein_id="ABL64079.1"
FT                   /translation="MNMKFTAPIRLLQDAVNRVSQAIPSKAIDPRFENIHLAIEPGKLT
FT                   LFASDGEMSITAKSEISSEDTGNISIKARTLQDFLRSMYDTEVTFSIERQEISDHGTVS
FT                   ISTDKGKYKIPCFFESKMEIYEKNYVINLDLPSVELQYLIQKTIFACSVDGMRPAMMGV
FT                   LFELESSSITAVSTDGHRLVRCRKSTVIEVEDKQKIVVSARVLSILQKLPLHETVIIQI
FT                   DQDKRFVRFTQNNVVIDASLIVEPYPNYEAVIPVIHDKQVSCDRSNIYDSVKRVGRFSS
FT                   VGDIKMVLADSIIKVMAENTNEGESAQEELPCSYTGEDITIGFNAKFIEAALAHIDEKE
FT                   IIIELKSPTTAVIFKPVQEKETGSLIILVMPVRINA"
FT   gene            3303..4400
FT                   /locus_tag="Cpha266_0003"
FT   CDS_pept        3303..4400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: plt:Plut_0002 RecF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64080"
FT                   /db_xref="GOA:A1BCH3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCH3"
FT                   /protein_id="ABL64080.1"
FT                   /translation="MRLTRITYNNFRNYRKMTFEPNAGITLLYGSNGSGKTNILEGIHY
FT                   CALTKGFTSIADSDCIFDSSDYYALQSTCLGENGSDIEVRISFSREKGKTLFVNNNEIK
FT                   KFSNHVGTIPCITFSPPEISIVSGSPSERRKFIDNIICQSDKKYLKDLLTYRRVLLQRN
FT                   ALLAQISEKKSSINMLPYWSENLSVLAASIVFKRLEFLDKFIDNFRDLFKKLSINEEPG
FT                   IVYRSVLGRYDNIRNIDELAALYYRKYDDNLRYELLRSQTSCGPHRDDLEFYINDKEIK
FT                   KYASQGQLRTFLIGLKLAVYDYLFDTTHEKPICLLDDIFSELDTQRTENILSILQTLGQ
FT                   SIITSTVRRDSDIISSVSVHDLIND"
FT   gene            4411..4704
FT                   /locus_tag="Cpha266_0004"
FT   CDS_pept        4411..4704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT2287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64081"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCH4"
FT                   /protein_id="ABL64081.1"
FT                   /translation="MSRTKSPRILSSVVQDVCRTLGMNKAIDDFRTVQIWKEVVGTTIA
FT                   EITLVERYTDGKLFVRVKSAPWRMELNYRKTEIKNKLNVAIGKEIIEEIIFR"
FT   gene            complement(4906..5004)
FT                   /pseudo
FT                   /locus_tag="Cpha266_0005"
FT   gene            5093..6328
FT                   /locus_tag="Cpha266_0006"
FT   CDS_pept        5093..6328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0006"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: cte:CT0518 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64082"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCH5"
FT                   /protein_id="ABL64082.1"
FT                   /translation="MPPLPSLTSHYHQLLGLPPNWNVENVTLSITGKQIEIRLVYTDKQ
FT                   AECPECGQLCKIYDHTSEQQWRHLDTMQFETIIVARLPRCKCKEHGVKTVRVPWAARHS
FT                   RFTLMFESFAIELLMHCSSIKAASSMLNLNWHAVDEIMRRAVKRGLNRRESEAIAYLGI
FT                   DEKSFKAGQHYVTTLNDLDKGRVLEVVEHRTNEAAKALLESLNKKQQEQVKAVSADMWK
FT                   PYANAVEELLPNADLVHDRFHISKYLSEAVDAVRRKESRELDQAGDKRLVGSKYVWLRN
FT                   PENMREQQKVELSNLMACEFKTSQAWALKNMFRYFWQLGDTDGASFFFEYWSRRVDEVG
FT                   LTPLIDVKELLQRHFDHILTYFKHAITNAVSEGLNSKIQIVKASARGFHRFESYRNRIL
FT                   FYCGKLNMAISS"
FT   gene            complement(6323..6733)
FT                   /locus_tag="Cpha266_0007"
FT   CDS_pept        complement(6323..6733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0007"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spn:SP0811 transposase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64083"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCG6"
FT                   /protein_id="ABL64083.1"
FT                   /translation="MFFTLTLGDSYFPKLAYSCFPITISPQDGVIDWMLGGKMDTVSMG
FT                   AFLRQVSHKHPEEFVMMVVDGAPSHRAEHLRVPKNMVLVKLPPYSPELNPVEHLWDELR
FT                   EKEFANRVFETLGAVIVGSSQNFVESPTAITS"
FT   gene            6781..8352
FT                   /locus_tag="Cpha266_0008"
FT   CDS_pept        6781..8352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0008"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: bfs:BF1534
FT                   putative transposase for insertion sequence element
FT                   IS21-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64084"
FT                   /db_xref="GOA:A1BCG7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCG7"
FT                   /protein_id="ABL64084.1"
FT                   /translation="MRTQLKKLTMYNKVKEFAREGLSIRQISRKTGMDRVTVRKFLRMT
FT                   DEEFSAFLALQKRRLRKLQPYEQFVKDRVTDYPDCSATQVEDWLKEHHPVFPEVTTRTI
FT                   YSFVQWIRKAYDLPKPKGTPRAYHPVEQLPYGEQAQVDFGEYWMASADACKVKVHFMIM
FT                   LLSRSRRKFVSFSQQPITTRFVLEAHEQAFSFFEGIPHTLVYDQDSTIVTDENRGAILY
FT                   TEAFRKYLLHRSLKIHLCRKSDPESKGKIEAGVKYVKYNFLPGRRFVNLEVLNQEALLW
FT                   LERTANAKEHATTRLIPDAEWQVEKQHLRPFEPLPYPISGTVGKEYHVRKDNTISYRGN
FT                   FYSLPVGTYAGPGTLVVLEVRQNTLCLYAQEGRLLANHPIESGKGTVVINNNHRRDTSS
FT                   KLRELQDSLMLLFTNQEHAERFLESIHNRYPRYSRDQFLHVRNAISGCQQKLIDDALAH
FT                   CVDHHLFSSGEFHDILHHYRKQEEKQSHQAVFNTFRPKTLRSDMDRMLSFVPDSSGITT
FT                   YENIFS"
FT   gene            8358..9194
FT                   /locus_tag="Cpha266_0009"
FT   CDS_pept        8358..9194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0009"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: bfs:BF1535 insertion sequence
FT                   IS21-like putative ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64085"
FT                   /db_xref="GOA:A1BCG8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCG8"
FT                   /protein_id="ABL64085.1"
FT                   /translation="MERTITTIQEHARELNLTGLAGTVDLLLEEARKSEPSYSDFALTL
FT                   LESELSCRRKAHLERRRKIANLPLLHDLDHYDSGVQNGISQVQLQQLRQLLWLDQNFNL
FT                   ILIGPSGTGKSYLAGGLCHEALKLGYHALFRTMDDLIQTIRFKEITAAAAREYKRLLSA
FT                   HLLVIDDIMMFPLEKSVAVGLFQLVNQLHEQTSFIITTNKSPKEWAEMLGDEVLATALL
FT                   DRLLYKCEVIKLTGKSYRLEHRTTIFEQQQSPEGGGNRRKKQLPLQKGVGNHCKMT"
FT   gene            complement(9259..9387)
FT                   /pseudo
FT                   /locus_tag="Cpha266_0010"
FT   gene            complement(9405..9935)
FT                   /locus_tag="Cpha266_0011"
FT   CDS_pept        complement(9405..9935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_3862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64086"
FT                   /db_xref="GOA:A1BCG9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCG9"
FT                   /protein_id="ABL64086.1"
FT                   /translation="MARPAVITDEMECLAKKIVKEANTARELRAGLSILIPKTCDITYS
FT                   ETAELLGISVPTVVRIHRDISNQAAGKATPKGSWGGRRRQTLSLDEEARFLAEWVEKAE
FT                   QGGVLVVPPIHTALEQRLGKTVAVSTVYRMLARHGWRKVEPDTCHPKQNMEEQEEFKKN
FT                   SQRYWYKPPSKMY"
FT   gene            10031..10336
FT                   /pseudo
FT                   /locus_tag="Cpha266_0012"
FT   gene            complement(10369..11061)
FT                   /locus_tag="Cpha266_0013"
FT   CDS_pept        complement(10369..11061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0013"
FT                   /product="Rhodopirellula transposase family protein"
FT                   /note="PFAM: Rhodopirellula transposase family protein;
FT                   KEGG: ana:all8069 transposase unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64087"
FT                   /db_xref="InterPro:IPR011518"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCH0"
FT                   /protein_id="ABL64087.1"
FT                   /translation="MNALADGDPETLRLSIDTKATVHVGQYSRGGKSRGIKAVEAWDHD
FT                   MRPKEKLVPGGILEPVSGKSFLFFGSSNKTSDFLVDGLELWWNERKSELYNVKQLVINM
FT                   DNGPECNGRRSQFLYRMTMFADMTGLNIRLIYYPPYHSKYNSIERYWAGLEKSWNGYLL
FT                   ESVTTVINRAGNFAWRGIAAKARLVDTVYQKGVKLCGKDKKNLEKRLMRSPSLHWWDIS
FT                   ISPKTVFL"
FT   gene            complement(11058..11600)
FT                   /locus_tag="Cpha266_0014"
FT   CDS_pept        complement(11058..11600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0014"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:all8069 transposase unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64088"
FT                   /db_xref="InterPro:IPR011518"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCF5"
FT                   /protein_id="ABL64088.1"
FT                   /translation="MKTSVLSRNNISPEVSGLITRLVSLIPWPARRQAMGDVVVTILDS
FT                   KPRVAENEFGWNRSAVALGIKEFESGIVCVNDLTERHKPKSEEKHPELLEAIRKIMEPQ
FT                   SQAEPRLRTTLLYTNMTAQSVYNALLAEGWSEESLPAVRTISNILNRQNYRLRTVQKTK
FT                   VEKKQQKPTPSSKTSGK"
FT   gene            11704..12462
FT                   /locus_tag="Cpha266_0015"
FT   CDS_pept        11704..12462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0015"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   pca:Pcar_0986 ISGsu1, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64089"
FT                   /db_xref="GOA:A1BCF6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCF6"
FT                   /protein_id="ABL64089.1"
FT                   /translation="MDATVIDLCLRVFPWAEFRQRKGAIKLHYLYDHRSSLPAFMVMTD
FT                   GKKSDIRVARSQEKLDFHLLPDSIVSFDRAYIDFEWLYTLDQRKVWFVTRSKANIQYRI
FT                   IGQHQPIKNKQVTRDERIELIIEKSRAKYLKPLRLVCYTDQETGKAYEFITNNIKLAAS
FT                   TIAAIYKSRWQIETFFRWIKQNLKIKSFQGTSQNAVLSQTWIAMCYYLRLSYIKFKTKY
FT                   RHSLQELTRMIAAVLIEHRLLIDISSLRSR"
FT   gene            complement(12481..12588)
FT                   /pseudo
FT                   /locus_tag="Cpha266_0016"
FT   gene            12686..14092
FT                   /locus_tag="Cpha266_0017"
FT   CDS_pept        12686..14092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0017"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   mes:Meso_4308 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64090"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCF7"
FT                   /protein_id="ABL64090.1"
FT                   /translation="MQLPYTNIHTDQPNQQALFPDCFEVSVAPVKGKKVVLDFQGGNAT
FT                   SDAGVLLLKEVESMTRIVPKLADCIADSRRTSSVMHSIPDLIAQRVYQIACGYEDGNDS
FT                   NSMRKDPALKMALNRLPESGDDLASQPTFSRLENMVTRPELYRMAVGFLDHFLDSYTEA
FT                   PRVIVLDFDDTEDVVHGKQQLALFNGYHQETCYQPLHVFEGLTGKLIASILRPGRRPTG
FT                   KEIVSYVKRIVRHIRSRWPETIIVYRGDSHYGVPEVYSFLAREQNCYSVTGLGGNDVLL
FT                   RSVKDIIEEVKKHGAGYRRYHTFQYQARSWKETRRVVAKVEMTEKGLNVRFISTDMQEA
FT                   KAKTLYEQIYSARGNDELYIKAHKTFMKSDRTSCHRFLANQFRVFLHSAAYVLVHAFQT
FT                   NLLRGTALATATFETIRLKLLKIGAKVIEMKTRIKVHLPTSYPYKPILNKCFAVLEHLR
FT                   SVPWPSTAIP"
FT   gene            complement(14359..15489)
FT                   /locus_tag="Cpha266_0018"
FT   CDS_pept        complement(14359..15489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0018"
FT                   /product="Rhodopirellula transposase family protein"
FT                   /note="PFAM: Rhodopirellula transposase family protein;
FT                   KEGG: eba:ebA5952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64091"
FT                   /db_xref="InterPro:IPR011518"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCF9"
FT                   /protein_id="ABL64091.1"
FT                   /translation="MDIHDDDIDLIRIRFEKIEWALDERMRRLFAANEAYALGHGGVTK
FT                   VSQATGVSRRAIHVGLDELVAAKPPVPEQEKRIRKVGGGRKSITKTESGVLIALEQLVE
FT                   PTTRGDPESPLRWTCKSLRTISEELARQGFKVSYPKVADLLRELGYSLQANRKTLEGAD
FT                   HPDRNAQFELINTQTKETIAGGNPVISVDTKKKELVGAFKNNGTNWRPQGEPEEVKVHD
FT                   FIDKDLGRANPYGVYDIGSNTGWVSVGTDHDTASFAVETIRRWWYTMGKPRYADATKIM
FT                   ITADGGGSNGSKVRLWKLELQKLADELRMSIHVSHLPPGTSKWNKIEHRLFSYISMNWR
FT                   GQPLISHEVIVNLIAGTTTKAGLKVYSELDDTTYPE"
FT   gene            16159..17565
FT                   /locus_tag="Cpha266_0019"
FT   CDS_pept        16159..17565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0019"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   mes:Meso_4308 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64092"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCF7"
FT                   /protein_id="ABL64092.1"
FT                   /translation="MQLPYTNIHTDQPNQQALFPDCFEVSVAPVKGKKVVLDFQGGNAT
FT                   SDAGVLLLKEVESMTRIVPKLADCIADSRRTSSVMHSIPDLIAQRVYQIACGYEDGNDS
FT                   NSMRKDPALKMALNRLPESGDDLASQPTFSRLENMVTRPELYRMAVGFLDHFLDSYTEA
FT                   PRVIVLDFDDTEDVVHGKQQLALFNGYHQETCYQPLHVFEGLTGKLIASILRPGRRPTG
FT                   KEIVSYVKRIVRHIRSRWPETIIVYRGDSHYGVPEVYSFLAREQNCYSVTGLGGNDVLL
FT                   RSVKDIIEEVKKHGAGYRRYHTFQYQARSWKETRRVVAKVEMTEKGLNVRFISTDMQEA
FT                   KAKTLYEQIYSARGNDELYIKAHKTFMKSDRTSCHRFLANQFRVFLHSAAYVLVHAFQT
FT                   NLLRGTALATATFETIRLKLLKIGAKVIEMKTRIKVHLPTSYPYKPILNKCFAVLEHLR
FT                   SVPWPSTAIP"
FT   gene            17769..18017
FT                   /locus_tag="Cpha266_0020"
FT   CDS_pept        17769..18017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64093"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCF8"
FT                   /protein_id="ABL64093.1"
FT                   /translation="MASPMAGSFLARDASLLQSHELFRLGREVWIYDKISSDRVYSSGG
FT                   LFIATGASSTSQKTLTIVIKFDDNRKVREFAYHTSRF"
FT   gene            18030..18560
FT                   /locus_tag="Cpha266_0021"
FT   CDS_pept        18030..18560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0172 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64094"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCF1"
FT                   /protein_id="ABL64094.1"
FT                   /translation="MKKIRTLLVLSMLLATGCQSTIPKDALVLNNESLATRQLQTRKYQ
FT                   TKDEAKVLSSVAGVLQDLGFNLNESHSALGVISASKTRSAVNAGQQILAVTFALLGGGV
FT                   SATDDHQVMTASVVTKPVGEKSDYVAVRVTFQRLVYNTNGQVSKAESLQDSEIYQGFFE
FT                   KLSKSIFLEAQEI"
FT   sig_peptide     18030..18092
FT                   /locus_tag="Cpha266_0021"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.870 at
FT                   residue 21"
FT   gene            complement(19639..19869)
FT                   /pseudo
FT                   /locus_tag="Cpha266_0022"
FT   gene            complement(19873..20707)
FT                   /pseudo
FT                   /locus_tag="Cpha266_0023"
FT   gene            complement(20845..22209)
FT                   /locus_tag="Cpha266_0024"
FT   CDS_pept        complement(20845..22209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0024"
FT                   /product="transposase"
FT                   /note="KEGG: eba:ebA562 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64095"
FT                   /db_xref="GOA:A1BCF2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCF2"
FT                   /protein_id="ABL64095.1"
FT                   /translation="MRKSKKAATMSLVHPNAAGIDIGSQFHDVAIPPDRAEETVKSFKS
FT                   FTGDLHAMAKWLTACRIDTIAMESTGVYWIPAFEILENYGFKVFLVNAREAKNVPGRKT
FT                   DSNDAQWLQKLHQLGLLRASFQPTSVIAELRAYLRQREKLLDYKAAHIQHMQKALMQMN
FT                   IQLHHVVSTITGKTGMDIIRAIVAGNRNPQELVKFRDVRCKNSIETMTAALTGNFKPEH
FT                   IFALMQSLELYDIYNEKAEACDREIQAVLDRLQQNSIPPDQPLPKAKYRECNKNAPAFD
FT                   VRQTLFNIIGVDLTQITGLGSYLALKLVSECGADMSKWPTDKHFTSWLCLSPGNKISGG
FT                   KILSSRTRPSSSRAAALLRLAATAIGRTETALGAFYRRLATRTGKAKAVTATARKIAVL
FT                   FYNTLRYGMRYVDPGADYYEEQYKARILGQLRRRADSYGFSLQPMEIPDTAIGVS"
FT   sig_peptide     complement(22153..22209)
FT                   /locus_tag="Cpha266_0024"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.721) with cleavage site probability 0.381 at
FT                   residue 19"
FT   gene            complement(22578..22913)
FT                   /pseudo
FT                   /locus_tag="Cpha266_0025"
FT   gene            complement(23043..24266)
FT                   /locus_tag="Cpha266_0026"
FT   CDS_pept        complement(23043..24266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0026"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   flavodoxin/nitric oxide synthase; KEGG: cte:CT2285
FT                   rubredoxin:oxygen oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64096"
FT                   /db_xref="GOA:A1BCF3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCF3"
FT                   /protein_id="ABL64096.1"
FT                   /translation="MIDNKILPVTQDVTWIGVLDPGLITFDIVMETKYGTTYNSYFINA
FT                   DKKTIVETTKEKFWPIYLDKIKQVTNPEEIEYIIVDHTEPDHSGNVRNLLSVAPHATVV
FT                   GSGNALKFLRDQTGHDFKSLVVKTGDTLDLGNKTLHFINAPNLHWPDTIYTWLEEDRVL
FT                   FTCDSFGSHFCHEGMYDDAVGDFDDAFTYYYDAILRPFSKYMLQAIEKIAPLDIKIICP
FT                   GHGPILRSNWKKYVDLSHRLATKAIALPNEKNILIAYVSAYENTAVLAEKIAEGLRESC
FT                   DFTIEICDIENIHFSKLEDKLAHCYGLIVGSPTINQNILLQIYNLFAAINPIRDKGKLA
FT                   AAFGSYGWSGEGVKMIETNLSMLKLKVFDQNVMVKFKPHEAEFEKCRLFGKSFADKMIE
FT                   MFQLSCNL"
FT   gene            complement(24550..26940)
FT                   /locus_tag="Cpha266_0027"
FT   CDS_pept        complement(24550..26940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0027"
FT                   /product="DNA polymerase B region"
FT                   /note="PFAM: DNA polymerase B, exonuclease; DNA polymerase
FT                   B region; SMART: DNA-directed DNA polymerase B; KEGG:
FT                   plt:Plut_0005 DNA-directed DNA polymerase B"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64097"
FT                   /db_xref="GOA:A1BCF4"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCF4"
FT                   /protein_id="ABL64097.1"
FT                   /translation="MDTLSHEILNNDLLFGKDKEENIVGAYQLSDTHIRLFFRNDEKIS
FT                   HRDEPFYPYFFLSESSLLEGFVPEENRKYWIIKLNGNNFYRFLAIFSSWKDFRSGLDII
FT                   NGKNRAASPEADTTNPAPSFIPLTYSKGDAVTQYFFQSGKTLFKGLDFSRLRRMQLDIE
FT                   TCYDPDKKRTGSGIGDDEIIIVSLSDNTGWEQVIHSKNRGEKKLLEHLVEIIIARDPDV
FT                   IEGHNIFSFDLPYIQKRCDRHNINFAIGRNGTTVRSYPSSIRFAERIIDYPYFEIPGRH
FT                   VIDTLFLVQGYDVSKRAMQSYGLKAVAKYFGFASPDRTYVEYKDIISTWENNPDKLLAY
FT                   ALDDVRETRALASHLSGSNYYLSRMMPYTYAMTSRLGQAAKIEALFIREYLRQKHSIPK
FT                   PSSGQQHSGGYTEVFLKGILGPIVYADVESLYPSIMLTCGICPKTDDLRVFPSVLGNLK
FT                   DLRFKTKKLSGEEKQKGNLQMADNFDAMQGSFKILINAMYGYLGFNNGIFNDFDEADKV
FT                   TTTGQGIAKKMIHEFEARGCKVIEVDTDGILFVPPPGIVTENEERTLVREVSSLMPEGI
FT                   NIGYDGRYKKMISYMKKNYALLDDDNVMIVKGSSLTSRSSEKFGRDFVKRGFEKLLSED
FT                   IAGLHDLYTEYKEKILAHALDIGDFSRTETLKSTMEQYLEDVRSGRRSKSVTYEIALKN
FT                   GKQVTKGERITYYISGTGGINQTFEKGKLASDWKKDNPDDNTVFYLKRLDEHCQKFLPF
FT                   FKPQDYSSIFSSDTLFSFTPEGIELIKEIIHTDTDTTGSAGLY"
FT   gene            complement(27338..29203)
FT                   /locus_tag="Cpha266_0028"
FT   CDS_pept        complement(27338..29203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0028"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG: cch:Cag_2006
FT                   glucose-inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64098"
FT                   /db_xref="GOA:A1BCG1"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BCG1"
FT                   /protein_id="ABL64098.1"
FT                   /translation="MYDIIVAGAGHAGCEAVLAAARTGMSCLLITSDLSAIARMSCNPA
FT                   IGGVAKGQITREIDALGGEMAKAIDETGIQFRMLNKSKGAAMHSPRAQADRALYSVYMR
FT                   KIIEEQDNIDLVQDTVTGLDVESGAVRGAILPSGRIIKGKSVILCCGTFLNGLIHIGMN
FT                   HFPGGRTIAEPPVSGLTENLQSLGFRAGRLKTGTPPRIDSRSVNYSLVEEQSGDPDPRP
FT                   FSFHTDSLGHRAQVSCFVTKTKETTHELLRTGFSRSPLFSGKVQGVGPRYCPSVEDKIF
FT                   RFPDKNSHHIFLEPEGAETNEMYVNGFSTSLPEDIQLLALRSIPGLEHVKMIRPGYAIE
FT                   YDFFFPYQIKNTLETKIIENLYFAGQINGTSGYEEAAAQGLMAGINASLKIQNRKPFVL
FT                   DRSQAYIGVLIDDLVTKDIIEPYRMFTSSAEHRISLRHDNADIRLCRMGHEAGTVDFSS
FT                   FTKTEYKISAIRQLRQLCDTMKLHPDQIISAMAGAAQQPPLQPIAISNLLKRPEIDFEN
FT                   LLVLSEDFRAGVNEITTDPDVFEQVVIDLKYEGYLKRDLLMTEKIARLESHSIPGSFSY
FT                   ATVSGLSNEGREKLTLHKPETIGQASRIPGVSPSDISVLLIKIGR"
FT   gene            29664..30065
FT                   /locus_tag="Cpha266_0029"
FT   CDS_pept        29664..30065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0029"
FT                   /product="thiosulfate-binding protein SoxY"
FT                   /note="KEGG: cch:Cag_1923 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64099"
FT                   /db_xref="InterPro:IPR032711"
FT                   /db_xref="InterPro:IPR038162"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCG2"
FT                   /protein_id="ABL64099.1"
FT                   /translation="MAASISMMPSRLFAAWCEKCFSPCPIDNAFINTLGTRDFVQTDKI
FT                   TIVAPQVASDSSLVPVEIISSIKAERLYLFVEKNISPLVFQCTLYGSAEPYVSLNVKLK
FT                   ESSLVYAVLKEGSRYYRASVHINVLAQAC"
FT   gene            30107..30403
FT                   /locus_tag="Cpha266_0030"
FT   CDS_pept        30107..30403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0030"
FT                   /product="sulfur compound chelating protein SoxZ"
FT                   /note="KEGG: cte:CT1018 sulfur oxidation protein SoxZ"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64100"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR014880"
FT                   /db_xref="InterPro:IPR030995"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCG3"
FT                   /protein_id="ABL64100.1"
FT                   /translation="MRVLARELNGIVLLKIIIEHPSESGTRKDEQGNVIPAHFIREGRI
FT                   ALNGAPLFDLDLGPSVSRDPFFQLKFAGKKGDQIKLEFTDSKFQEFSADCVVT"
FT   gene            30479..30859
FT                   /locus_tag="Cpha266_0031"
FT   CDS_pept        30479..30859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0031"
FT                   /product="sulfide dehydrogenase (flavocytochrome),
FT                   cytochrome c subunit"
FT                   /EC_number="1.8.2.-"
FT                   /note="PFAM: cytochrome c, class I; KEGG: cch:Cag_2005
FT                   sulfide dehydrogenase, cytochrome subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64101"
FT                   /db_xref="GOA:A1BCG4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCG4"
FT                   /protein_id="ABL64101.1"
FT                   /translation="MQAKLRLWLTFCVVTPVLLLFGNAGLAEQTPAPKVLKPVTSKAVG
FT                   VTPRGQVLSLSCSSCHGTDGKSVGIMPSFYGKTPQYIETALLEFKSGKRYSTVMGRHAK
FT                   GYSDDEIHLIAQYCGIKGQKTK"
FT   sig_peptide     30479..30562
FT                   /locus_tag="Cpha266_0031"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.855 at
FT                   residue 28"
FT   gene            30874..32166
FT                   /locus_tag="Cpha266_0032"
FT   CDS_pept        30874..32166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0032"
FT                   /product="sulfide dehydrogenase (flavocytochrome),
FT                   flavoprotein subunit"
FT                   /EC_number="1.8.2.-"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: cch:Cag_2004 sulfide dehydrogenase,
FT                   flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64102"
FT                   /db_xref="GOA:A1BCG5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015323"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037092"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCG5"
FT                   /protein_id="ABL64102.1"
FT                   /translation="MSNKLSRRDFNKLLVSGVAGSAFGVFGGASSAFAAKNRVVVIGGG
FT                   FGGAAAAKYLKKLDPTLSVTLIEPKETFYTCPFSNWVLGGLKTMEDIGQTYTVLKTRYG
FT                   IDVVVDAAAGVDASKNAVTLKSGRVIKYDRLIVSPGIDFKWKAIEGYSQAVSETKMPHA
FT                   YQGGAQTILLHKQLLAMPDGGRVIITAPGNPFRCPPGPYERASLIANYLKKNKPKSKII
FT                   ILDAKDKFSKQALFRKGWEKLYPGMIEWRGSTTGGKISMVDGAAMTVTTEFGVEKGDVI
FT                   NVIAPQQAGKIAFDCGLTDASGWCPVNPITFESTMHPGIHVIGDACIAGAMPKSGFAAS
FT                   SHGKVAAASIIRLFQGKVPAPPSLVNTCYSLLAPGYGISVAGVYKLSAEGIVEIPGSGG
FT                   LTPLDADEEKLGEEATFAQGWYNNIAQDIWG"
FT   sig_peptide     30874..30978
FT                   /locus_tag="Cpha266_0032"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.991 at
FT                   residue 35"
FT   gene            32395..34254
FT                   /locus_tag="Cpha266_0033"
FT   CDS_pept        32395..34254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0033"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="TIGRFAM: protein-export membrane protein, SecD/SecF
FT                   family; protein-export membrane protein SecD; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG: cch:Cag_0026
FT                   SecD export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64103"
FT                   /db_xref="GOA:A1BCH6"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCH6"
FT                   /protein_id="ABL64103.1"
FT                   /translation="MKNKQFPLFLLLAVTAISLWSLWPTWRDYSLTKQIERFSSSEDSL
FT                   KFSLAHRDEIENARRKSLKLGLDLKGGMHLVMEVDQIDLFMQKAWNKDARFFELMDKVK
FT                   QKSVTSDARVIDLIVNEFTKENIRLSRYFYDIRNSDKEIVGKLEKESEDALLRAKEIIR
FT                   NRIDQYGVAEPVITTQGSRRIIIELAGVSDENRVRNLLKGTAKLEFKLLRDPDMLLRAL
FT                   DRVNSALVQASVQKPVVPDSLAVKDSAATASPAVAPPLDATASKQAKTAGPLYDVIGVL
FT                   PNGTVFTPEQSREFVLTLLQRADVQALLPQDSELLLSAKPEVGEKGEKYYPIYLVKKTA
FT                   ELTGGVITEAKATFGSEGVQPEVMMSMNSDGTGKWARITGANIGKRIAIVLDGAVYSAP
FT                   VVQSKIPNGNSVINGIESLEEAKDLEIVLKAGALPAPVRIMEERTVGPSLGADYIRAGM
FT                   LSLLWGFCAVSIFMLVYYRKAGIAADIALLLNILIVLSVLAGFNASLSLPGIAGIVLTM
FT                   GMAVDANVLIYERIREELDEGKPLKSAITLGYDRAFSSILDSHVTTLSAAFLLYTYGIG
FT                   PIQGFALTLMIGTAASLFTAIVVTREIFTILLGRNMMTEKSFG"
FT   sig_peptide     32395..32460
FT                   /locus_tag="Cpha266_0033"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.976 at
FT                   residue 22"
FT   gene            34277..35212
FT                   /locus_tag="Cpha266_0034"
FT   CDS_pept        34277..35212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0034"
FT                   /product="protein translocase subunit secF"
FT                   /note="TIGRFAM: protein-export membrane protein, SecD/SecF
FT                   family; protein-export membrane protein SecF; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG: cch:Cag_0027
FT                   SecF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64104"
FT                   /db_xref="GOA:A1BCH7"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCH7"
FT                   /protein_id="ABL64104.1"
FT                   /translation="MRIFHKTSFDFIKYRKISYAISVFLLLIGIGSLFVKGLNYGIDFR
FT                   GGSEVLIRFEKNIDVAAVRSVLDNTGMSGTLKQYGLDRSFLFSTAFNGQTNELKSLISN
FT                   SLNDRLKGNPHEIVRIDAVGPSIASDLKWSALKALLAALLAILLYVGIRFEIKFATAGV
FT                   VAIFHDIFVVLGLFSLLGGVFDFMPLELDQSIIAAFLTIAGYSITDTVVVYDRIRERIR
FT                   GQKPADYERIFNESMNQTLSRTIITSGTLLISVLVLFVFAGPAIRGFAFAVFMGVFIGT
FT                   YSSIFVAAPIVYDWLKLTKSSVKLRGGSAS"
FT   sig_peptide     34277..34384
FT                   /locus_tag="Cpha266_0034"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.964) with cleavage site probability 0.841 at
FT                   residue 36"
FT   gene            35469..36785
FT                   /locus_tag="Cpha266_0035"
FT   CDS_pept        35469..36785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0035"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: cte:CT2264 peptidyl-prolyl cis-trans isomerase SurA"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64105"
FT                   /db_xref="GOA:A1BCH8"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCH8"
FT                   /protein_id="ABL64105.1"
FT                   /translation="MKKMLTAAVFVMLVAFSFTLGNLHADVADRIVAVVGNEVILKSEI
FT                   DDRALMTVMQYPETQKDTRLKEKILAGIIDQKVILVKARIDSTQVDESTLDALTNERLK
FT                   MLASRFASKEAMEEKFGKSMGVIRQEIRNELKDQQLIETLRKKQLAGITVTHEETVDFY
FT                   RNHKQQLPQVSELVGLSQILKYPDLPQGSKDAALAQMKIVQAELKAGADFAATARKYSQ
FT                   DPGSAKLGGDLGYVQKGELVRSFEDAAFLLKDGKISDIVETRYGYHIIQRLEKKPNAVH
FT                   LRHILIAYDQSKTDEPGTVQLLSRIKSDVLAGRATFADMAKKYSDDPVSGKLGGVILSG
FT                   GSGKTLLPVASLRPQMMQIVGSLRNIGDISDPQKIDFQKGNLFYGIFQLNAKIPVHQLN
FT                   LEQDYASLEELALEAKKQERYNEWLSQLKKEVLVRISDI"
FT   sig_peptide     35469..35546
FT                   /locus_tag="Cpha266_0035"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(36774..38705)
FT                   /locus_tag="Cpha266_0036"
FT   CDS_pept        complement(36774..38705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0036"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: plt:Plut_0010 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64106"
FT                   /db_xref="GOA:A1BCH9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCH9"
FT                   /protein_id="ABL64106.1"
FT                   /translation="MQETVPQAPSPYIASNIQILDGIEHVRKRPAMYIGDIHTRGLHHL
FT                   IYEIVDNSIDETLGGFNEYIFVSLNPDGSVTVIDHGRGIPVDIHPQKQKSALELVMTVI
FT                   GAGGKFDKGSYKVSGGLHGVGASVVNALSEWCEVEVYRDGKAYFQRFERGVPQGNVREI
FT                   GLSDQKGTKTTFKPDNLIFKTTEFRKDIIIDRMRELAFLNKNLSITVQDADGAQEIFHY
FT                   EGGLKEFVRFTDINRLSLIKEPIYFIGERDTTIVEIALQYNDSYQENVFSYVNNINTHE
FT                   GGTHVTGFRKALTRTLNLYAQKNDLLKNLKLSLTGDDFKEGLTAVISVKVEEPQFEGQT
FT                   KTKLGNSETQSIVESIVNELLSEFAESNPNVIKMIIEKVKGAAMSREAARKAKELTRRK
FT                   SVLESSGLPGKLADCSINDPEHCELYIVEGDSAGGSAKQGRDRSFQAILPLKGKILNVE
FT                   KARLHKMLENEEIKTIILALGTSFGEEEFSPEKLRYGKIIIMTDADVDGAHIRTLLLTF
FT                   FFRYMRSLIEAGKVYIAQPPLYLVKSGKDQQYAWDDEERNSITDTLKKMQKGKANIHIQ
FT                   RYKGLGEMNPEQLWSTTMDPAHRSLLQVSVENAREADQIFSTLMGDKVEPRREFIEKNA
FT                   RYVRRLDV"
FT   gene            complement(38787..39170)
FT                   /locus_tag="Cpha266_0037"
FT   CDS_pept        complement(38787..39170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0037"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   cte:CT2262 predicted endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64107"
FT                   /db_xref="GOA:A1BCI0"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BCI0"
FT                   /protein_id="ABL64107.1"
FT                   /translation="MSSDPHMLGIQGEQIAAAYLSRHGYRIIQRNYRYRRNEIDIIAKK
FT                   HATICFIEVKTRASLEKGHPSEAVTPKKQKEIIKAAKSYLFSLGTDRCECRFDVIAILV
FT                   RSMKQEEIGLYDLDHFTDAFQAE"
FT   gene            complement(39180..39797)
FT                   /locus_tag="Cpha266_0038"
FT   CDS_pept        complement(39180..39797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0038"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease HII/HIII; KEGG: cte:CT2261
FT                   ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64108"
FT                   /db_xref="GOA:A1BCI1"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BCI1"
FT                   /protein_id="ABL64108.1"
FT                   /translation="MTTDYEYSLWPTLSLISGIDEAGRGPLAGPVVAAAVIFPRWFRPR
FT                   HAGLDKLDDSKKLSPNLREQLAPTIKTFAAFWAVAVIEPDIIDRINIFQATMQAMNNAV
FT                   ASLHQPPELILVDGNRFMPNAPIPYETIVKGDAKVFSIAAASVLAKTHRDAIMTAYGKE
FT                   YPEYGFERHFGYPTASHIKAIETFGRTPVHRKSFRLKQLGEK"
FT   gene            complement(39830..40219)
FT                   /locus_tag="Cpha266_0039"
FT   CDS_pept        complement(39830..40219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64109"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCI2"
FT                   /protein_id="ABL64109.1"
FT                   /translation="MKDSRDFREFLSGGHAAGKRTFIVVLSLTTHHPLFSERSTRMPSN
FT                   VSFVVTALSFTAQMSINGRQRSLWPLKRDQRDRQGAEAEKLRMNRKVKQAARGMKRING
FT                   PISGKSFDPACRRNHCNEYLQLSEQ"
FT   gene            40727..42424
FT                   /locus_tag="Cpha266_0040"
FT   CDS_pept        40727..42424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0040"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein; KEGG: plt:Plut_0012 ribonuclease
FT                   E and G"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64110"
FT                   /db_xref="GOA:A1BCI3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCI3"
FT                   /protein_id="ABL64110.1"
FT                   /translation="MKKSLNKQLLMNKTGDEIQVALVEEGRLAELIIERPESRRSIGDI
FT                   YLGRVHKVVEGLKAAFVDIGQKSDGFLHFSDVGTTTEDYRALIEDDDDDDTTGTDESDG
FT                   DEIAAVLSQPAVLPEQNGKSSARSGAKRLTAPAQDGEDGGRRQSYTQMIAGKLKPNDSI
FT                   LVQVIKEPISTKGSRLTSDITIAGRFMVLLPFGGGQVAVSRRVIARKERSRLKKLVRSM
FT                   LPDGFGAIIRTVAEMQEETLLKQDLEKLLAKWTQIEEKLQDAVPPQLIFKEDTIISSVL
FT                   RDSLNADVTEIVANSPVIYKETLNYIQWAAPEMEKNVTLYQGKLPLFEGYSIAKDVESI
FT                   FSRKVWLKSGGYIIIEHTEAMVVIDVNSGRYAAKREQEENSLKTNLEAAREIVRQLRLR
FT                   DIGGIIVVDFIDMLDQKNAKKVYDSMRTELRNDRAKSNILPMSDFGIMQITRERIRPSL
FT                   MQRMGDQCPACGGTGVVQARFTTINQIERWLRKYALQNTMKLQQLDLYVSPTVAEPLQQ
FT                   SEMNTELKWFLQHLLFVRVKPDESLRSDDFRFYSRKNNKEITAEYGDL"
FT   gene            42441..43304
FT                   /locus_tag="Cpha266_0041"
FT   CDS_pept        42441..43304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0041"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="KEGG: plt:Plut_0013
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64111"
FT                   /db_xref="GOA:A1BCI4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCI4"
FT                   /protein_id="ABL64111.1"
FT                   /translation="MTSYASLKEEISGLAPLSAVQLADYPDARRVFDDFKKLLNAGTVR
FT                   AAEKKEGEWQVNLWVKEGILLGMRLGRLVESHLVFPETGGGFDFFDKDTYPLRRMTLED
FT                   RVRIVPGGSAVRDGSYLAPSVVMMPPAYVNVGAYVDEGTMIDSHALVGSCAQVGKNVHL
FT                   SAGVQVGGVLEPVGAVPVIIEDDVMVGGNCGIYEGTIVKERAVIGTGVILNGSTPVYDL
FT                   ALETVYRKTSGHPLVIPAGAVVVAGSRRMKGDFALEHGLSLYTPVIIKYRDEKTDSATA
FT                   LEQALR"
FT   gene            43349..45067
FT                   /locus_tag="Cpha266_0042"
FT   CDS_pept        43349..45067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0042"
FT                   /product="C-terminal processing peptidase-3, Serine
FT                   peptidase, MEROPS family S41A"
FT                   /note="KEGG: cte:CT2258 carboxyl-terminal protease;
FT                   TIGRFAM: carboxyl-terminal protease; PFAM: PDZ/DHR/GLGF
FT                   domain protein; peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64112"
FT                   /db_xref="GOA:A1BCI5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCI5"
FT                   /protein_id="ABL64112.1"
FT                   /translation="MTCGKHMRQCLCRALISAGAASLLFVIVPVLGIHAAEHDKEYAET
FT                   GKSIELFGHVVRELSEKYVDTVDVGKLIYIGIDGVLESLDPYTVFLDAGQSEELGEITS
FT                   GQYAGIGLGLSKFGGAAYVTSVVEGYPAWKAGIRTGDRIMAINGVSLSKSNIDNLREMI
FT                   KGPAGGSLTVKIEREKSGRPPAPETVTLVRQAVHLNTVSFAGIVDGVAYIVMDSFSAKS
FT                   AEELSAALQKLMKESEPEGRSLKGVVLDLRGNPGGLLTSAIDVAGLFVEKGSEVLSIRG
FT                   RHPEDRQAYTTQQSPFSSTIPLVVLIDGQSASASEIVSGAIQDLDRGIIIGERSFGKGL
FT                   VQSIVELPFNYSIKLTTAKYYTPSGRLIQKDLHSETELIKEGDVPPAGKEKRAKVYYTA
FT                   KKRSVYGGGGILPDISVSAVMLSEYEKALVKDGLIFRFAISYHSEHAEQPTLPLDHPSL
FT                   LLAFDKFLEDQKFSYTSQPEQEFEKLRTLLIKETPSDGNSEASALLGMKEEIVRRKRLE
FT                   LSRNREHIARLLELEILRHYSETGAKRAGLHDDPVVRTALELLSDKKRYSGILSR"
FT   sig_peptide     43349..43456
FT                   /locus_tag="Cpha266_0042"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.888) with cleavage site probability 0.825 at
FT                   residue 36"
FT   gene            complement(45059..45778)
FT                   /locus_tag="Cpha266_0043"
FT   CDS_pept        complement(45059..45778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64113"
FT                   /db_xref="GOA:A1BCI6"
FT                   /db_xref="InterPro:IPR019634"
FT                   /db_xref="InterPro:IPR021995"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCI6"
FT                   /protein_id="ABL64113.1"
FT                   /translation="MTESPTFIGSIGLLSLPNWIIHLSSTLEWGIAALMMFRYGMITGR
FT                   KDIRMFGISMLPHWVGSFFIIAYHLTGDSIPLLLDLSETVNLFGSAALLYAVLTLLKKT
FT                   SNPTPTGYATCLATIMIAGKPQSYLGEDIFDAILQVSSIVYITFLVLLIVVRKRDPEVF
FT                   SPLTVAGFWFVLVFISFTVFSIYLATEVRGNLSLSHDDLLHGLAESLLTLSNLMIVIGI
FT                   HRQTVWYEKLAKKAESA"
FT   gene            complement(45810..46952)
FT                   /locus_tag="Cpha266_0044"
FT   CDS_pept        complement(45810..46952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0044"
FT                   /product="geranylgeranyl reductase"
FT                   /note="TIGRFAM: geranylgeranyl reductase; PFAM:
FT                   monooxygenase, FAD-binding; FAD dependent oxidoreductase;
FT                   KEGG: cch:Cag_0035 geranylgeranyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64114"
FT                   /db_xref="GOA:A1BCI7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010253"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCI7"
FT                   /protein_id="ABL64114.1"
FT                   /translation="MRFDVAVIGGGPSGAVAAAELARAGIPTVLIERNLDHVKPCGGAI
FT                   PLGLIEEFGIPGELVEKKLSHMRARSPKGRIIEMNMPNGYVGMVRREKFDRYLRSEAER
FT                   AGAVIVEGLVNTIRRSSFGFTISTLNDKVPPIEAHYIIGADGANSKTADELRFPPNELK
FT                   VIAMQQRFKYTPELEQFRDIVEIWFDGEVSPDFYGWIFPKADHLAIGTGTEDRRHSIKE
FT                   LQKRFIEKIGITEAPYLDEAAKIPMKPRKSFTAEGAILVGDAAGLVTPANGEGIFFAMR
FT                   SGKLAAQAMIGHLKHAEPLENYETGFRKLYAPIFFGLEVLQYVYYRNDRLRESFVAICA
FT                   DDDVQQITFDSYLYKKMVPAPWSTQMKIFSKNIYHLVKGS"
FT   sig_peptide     complement(46896..46952)
FT                   /locus_tag="Cpha266_0044"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.935) with cleavage site probability 0.741 at
FT                   residue 19"
FT   gene            complement(46993..48462)
FT                   /locus_tag="Cpha266_0045"
FT   CDS_pept        complement(46993..48462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0045"
FT                   /product="glycyl-tRNA synthetase"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: cch:Cag_0036 glycyl-tRNA synthetase; TIGRFAM:
FT                   glycyl-tRNA synthetase; PFAM: tRNA synthetase, class II (G,
FT                   H, P and S); Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64115"
FT                   /db_xref="GOA:A1BCI8"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCI8"
FT                   /protein_id="ABL64115.1"
FT                   /translation="MSNTDSKRVQNVNLPPEKVMHKLVSLAKRRGFIFPSSEIYEGLSS
FT                   CFDYGPLGSEMKKNIKDLWWNAMTRRHQNIVGIDASIMMNPRVWEASGHVASFNDPMID
FT                   DKATKRRYRADHLIENHIEKLRRDGKDDTALKVQTAYEQASTAADLNRALYDIIIAEGI
FT                   KAQDTGSGEWTEVRQFNLMFQCGMGALADKASIVYLRPETAQGIFVNFHNVRESSRMKV
FT                   PFGIAQIGKAFRNEIVKGNFIFRMVEFEQMEMQYFVKPGTQAEAFEAWREERFNWYTSA
FT                   LGINRDKLHWYKHDKLAHYADLAYDIKFEFPFGIEEIEGIHSRTDFDLKQHQEYSGKNM
FT                   EYIDQLTNERYIPYVVETSAGCDRLFLALLSDAYSEDVVDGEPRISLRFSPKVAPVKAA
FT                   VLPLLKKGEMAEKAARIADDLRQLYMIQQDDAGSIGKRYRRQDEIGTPFCLTIDHETLE
FT                   NDTLTIRHRDTASQERISASSIREFLAAGMV"
FT   gene            complement(48703..49020)
FT                   /locus_tag="Cpha266_0046"
FT   CDS_pept        complement(48703..49020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0046"
FT                   /product="ATP-dependent Clp protease adaptor protein ClpS"
FT                   /note="PFAM: ATP-dependent Clp protease adaptor protein
FT                   ClpS; KEGG: cte:CT2237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64116"
FT                   /db_xref="GOA:A1BCI9"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCI9"
FT                   /protein_id="ABL64116.1"
FT                   /translation="MIFSVSTSLSATRPTPETRQTEQSSGPDLLDAYRVVLYNDEEHTF
FT                   DEVISQIIKAVQCNRQKAERCTWEVHTKGRSVVFVGMIDRCIKVSAVLEEIALKTEIQT
FT                   D"
FT   gene            complement(49083..50054)
FT                   /locus_tag="Cpha266_0047"
FT   CDS_pept        complement(49083..50054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0047"
FT                   /product="Muramoyltetrapeptide carboxypeptidase"
FT                   /EC_number="3.4.17.13"
FT                   /note="PFAM: peptidase U61, LD-carboxypeptidase A; KEGG:
FT                   plt:Plut_0019 muramoyltetrapeptide carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64117"
FT                   /db_xref="GOA:A1BCJ0"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCJ0"
FT                   /protein_id="ABL64117.1"
FT                   /translation="MPRHFFACMKTLLPKALRKGDTIGLISPSSHSAFPERIARAILYL
FT                   EERSFKVKPSTYLNCIDVNPAIADQQKLSDLHAMFEDTEVDAVICLRGGAGATRLLKNI
FT                   DYALIEANPKILIGYSDITALSLAILAYTGLVSFSGPMIATELYEPTPYTEEHFWGMLT
FT                   DPRYALSLKNHSQHRVTCLKPGDASGNLIGGNLSVLCSLIGTPYLPILDDAILFLEDVN
FT                   EPAYRIDRMLSHLLNAGLLSRCRAILFGQFTGTPEKAGEDTRLEHIFDYYATQAHIEGP
FT                   VMTGLSYGHIADLMTLPLGAPFQVTVRPRYFSLEARYPVIHA"
FT   gene            complement(50094..50360)
FT                   /locus_tag="Cpha266_0048"
FT   CDS_pept        complement(50094..50360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0048"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /note="PFAM: H+-transporting two-sector ATPase,
FT                   delta/epsilon subunit; KEGG: plt:Plut_0020 ATP synthase F1,
FT                   epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64118"
FT                   /db_xref="GOA:A1BCJ1"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCJ1"
FT                   /protein_id="ABL64118.1"
FT                   /translation="MASSEKGFDIEIVTPQQQYFSGEIQSIIAPGRDGLFQVLKSHAPL
FT                   LSALKNGTVRLTLANKSEKTFTISDGFFEVSNNKAILLTEEIS"
FT   gene            complement(50376..51764)
FT                   /locus_tag="Cpha266_0049"
FT   CDS_pept        complement(50376..51764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0049"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /EC_number="7.2.2.1"
FT                   /note="KEGG: plt:Plut_0021 ATP synthase subunit B; TIGRFAM:
FT                   ATP synthase F1, beta subunit; PFAM: H+-transporting
FT                   two-sector ATPase, alpha/beta subunit, central region;
FT                   H+-transporting two-sector ATPase, alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64119"
FT                   /db_xref="GOA:A1BCJ2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BCJ2"
FT                   /protein_id="ABL64119.1"
FT                   /translation="MQEGKISQIIGPVVDVDFPEGQLPSILDALTITRPDGTKLVLETQ
FT                   QHLGEERVRTVAMESTDGLIRGLSVTNTERPIQVPVGPEVLGRMLNVVGDPIDGRGSVH
FT                   TSKTYSIHRSAPKFDELSTKTEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIME
FT                   LINNIAKQQSGYSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARARVA
FT                   LTGLSIAEYFRDEENRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGEL
FT                   QDRIVSTKKGSVTSVQAIYVPADDLTDPAPATAFAHLDATTVLSRSIAELGIYPAVDPL
FT                   DSTSRILDPNIVGDDHYDTAQAVKQILQRYKDLQDIIAILGMDELSDEDKLVVSRARKV
FT                   QRFLSQPFFVAEAFTGLAGKYVKLDETIKGFKEIIAGKHDNLPESAFYLVGTIEEAVQK
FT                   AKTL"
FT   gene            complement(51893..51965)
FT                   /locus_tag="Cpha266_R0001"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(51893..51965)
FT                   /locus_tag="Cpha266_R0001"
FT                   /product="tRNA-Thr"
FT   gene            52157..52699
FT                   /locus_tag="Cpha266_0050"
FT   CDS_pept        52157..52699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0050"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: cch:Cag_2013
FT                   thiol:disulfide interchange protein, thioredoxin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64120"
FT                   /db_xref="GOA:A1BCJ3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCJ3"
FT                   /protein_id="ABL64120.1"
FT                   /translation="MNNMNRIITIVAAGFMLLLATVSTAGAAQPGTQYPVAPSFSVTGI
FT                   DNRTITSQSLAGKVYIVNFFASWCPPCRAEIPAMIALQKAYKAKGFTFVGLAVNESGST
FT                   IRKFSLANGINYPVALADSKIIADYGRFIDGGIRAIPTSFIVDKSGRVVGIISGARDKA
FT                   YFEAVILDLLKGTKPTK"
FT   sig_peptide     52157..52240
FT                   /locus_tag="Cpha266_0050"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.750 at
FT                   residue 28"
FT   gene            52835..54700
FT                   /locus_tag="Cpha266_0051"
FT   CDS_pept        52835..54700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0051"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   plt:Plut_0023 phosphoenolpyruvate carboxykinase (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64121"
FT                   /db_xref="GOA:A1BCJ4"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCJ4"
FT                   /protein_id="ABL64121.1"
FT                   /translation="MTLVDINAPDFVVNKKLLQWVQETADLCRPDLVHWCDGSQEEYDL
FT                   LCEQMVESGTFIRLSAEKRPNSFLCRSDPSDVARVEDRTYICSIRKQDAGPTNNWVAPK
FT                   EMKKILAGLYDGCMQGRTMYIIPFSMGPLGSHIAHIGVEITDSPYVVTNMRIMTRMGRK
FT                   VLDVLGANGDFVHCLHSVGAPLKAGDQDVSWPCSETKYIVHFPEERSIMSFGSGYGGNA
FT                   LLGKKCFALRIASAMARDEGWLAEHMLILGVESPDGEKTYVSAAFPSACGKTNFAMLIP
FT                   PESFAGWKVTTIGDDIAWIKPGEDGRLHAINPEYGFFGVAPGTSDKSNPNAMETLKKNC
FT                   IFTNVALTPDGDVWWEGMTDDIPEELTDWRGNPWTPGCGRPSSHPNARFTAPASQCPSI
FT                   DPDWENPHGVPISAFIFGGRRRDTIPLVYQSANWYFGVYMAATMGSEMTAAAAGLIGDV
FT                   RRDPYAMLPFCGYHMGDYFNHWLHIGRTVVDPPRIFGVNWFRKDDDGKFLWPGFGENMR
FT                   VLKWIVDRVRGRAGAVESPLGWMPRYEMLGFEGDDGLTQDQFTKLMSIDREAWKKELFS
FT                   HEELLEKLYDRLPKEFSHIRELMLSTLWMSPEHWELAAERYSEDQ"
FT   gene            54772..55500
FT                   /locus_tag="Cpha266_0052"
FT   CDS_pept        54772..55500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cte:CT1620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64122"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCJ5"
FT                   /protein_id="ABL64122.1"
FT                   /translation="MKINAGLLLLFSVLVISGCSGKTDSAQTGSVLEASSSSVPKRYEL
FT                   KSGIVYYEPTELMGSKSVETLYFDDYGRREARETISDANVMGMKMHSHKMQITDGDYVI
FT                   SYEIENSVNGKDEASKEATRTDMKEFREMAIMMGQTFDPEEMKRNFDYREEGVEEVAGV
FT                   NGTKYSISLNKEKPGERVYGVLYKKISVKSTFGTIVIKAKKIEENVAVPASKFEVPAGY
FT                   TIKDVNLEEEMRKASQSGEE"
FT   sig_peptide     54772..54849
FT                   /locus_tag="Cpha266_0052"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.390 at
FT                   residue 26"
FT   gene            complement(55586..57445)
FT                   /locus_tag="Cpha266_0053"
FT   CDS_pept        complement(55586..57445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0053"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="KEGG: plt:Plut_1667 ATP-requiring DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64123"
FT                   /db_xref="GOA:A1BCJ6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCJ6"
FT                   /protein_id="ABL64123.1"
FT                   /translation="MTTDSLNPEKKRGCSDAALYETLRKVFGFRDFRPNQEMIVRTIIE
FT                   KRDVFAVMPTGGGKSLCYQLPAVLLPGTCMVISPLIALMKDQVDGARANGIRAAFLNSS
FT                   LAPEERTLVLRDLLSNSLDLLYVAPERFTLDQFQEMLKRVNISMAVIDEAHCISEWGHD
FT                   FRPDYLSLSQLVTLFPDLPVAAFTATATHQVQRDILDKLALRNPFVVRASFDRANLYYD
FT                   IRFKENASDQLVALLKQNSGKAGIIYRTSRKSVNETAALLKAKGFRVLPYHAGLGDDER
FT                   KQNQEAFIRDEVDVIVATVAFGMGIDKSNIRFVIHADLPKSIENYYQETGRAGRDGEAA
FT                   RCTLLFSQSDIPKVRFFIDAMQDETERARALGAFSKVISFASTSVCRRKTLLDYFGETY
FT                   PHDNCNSCDICLGTREVVDCSLEAQMLLSAIARTEERFGATHIVDIVTGSANKKIRDFG
FT                   HDRLKTYGVGKGRDKKFWRQLIDELLAQKVIAKSEGLYPTIVLLPKAVQILKNEARVEI
FT                   VRVLEKKSAKAGKQELSGSYDHELFDQLRELRKQIADEQGIPPYVVFSDRTLRDMASIF
FT                   PENNEAMLSVSGVGEVKLDRYGRQFLNLINRYRSDHPERNALS"
FT   gene            complement(59048..59395)
FT                   /locus_tag="Cpha266_0054"
FT   CDS_pept        complement(59048..59395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64124"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCJ7"
FT                   /protein_id="ABL64124.1"
FT                   /translation="MIVSYILSLSEPLSLPSTALLRIEIRDTSLADAPSVTLAETQQTA
FT                   EQVSGKTVVDGAIDLQKSFSPKATITLWAHLSLSGEKRIKKEDFITTRSYPITTIDENG
FT                   QVLAELHPVSR"
FT   gene            complement(59403..60692)
FT                   /locus_tag="Cpha266_0055"
FT   CDS_pept        complement(59403..60692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0055"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mbu:Mbur_1233 Fe-S protein,
FT                   radical SAM family"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64125"
FT                   /db_xref="GOA:A1BCJ8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCJ8"
FT                   /protein_id="ABL64125.1"
FT                   /translation="MHYPYFPFFLSKQDRDTFMASSPYGGFTVNKAGAAILEWSNGSRS
FT                   MGEIVKKLQSRYVAESASIAAKTEQFIHDLAKKGYVLIKEKPMRWFDAPPPQTIFWEIT
FT                   SQCNLQCLHCVVSAGQSTEPDLSTARCFELLDEWAALGVEEITFSGGEPLLREDFFDLA
FT                   AAAAKNNLSISLATNGTLVTREVAKKLKALNVDVQISLDGSTAEIYGRVRGRKEAFNDV
FT                   VQGIRNTLAAGVNLTIGTVVTKNNIDDIPEILKFTERSGVPYFRLIPFVPSGRGKHNRD
FT                   LELDPLQIQTVSRELVEQRDRWSFTILPLEFELTFSPPSGEQADLSRPSECGGATNYCT
FT                   VTPSGEVLPCHYFEGVVADSLRNRSFRDIWRNSRFLNYFRSIEIGDIQGYCHGCDWLSE
FT                   CRGGCKAANFSRGDLFQSNCHCWVVKENHQ"
FT   gene            complement(60768..62186)
FT                   /locus_tag="Cpha266_0056"
FT   CDS_pept        complement(60768..62186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0056"
FT                   /product="peptidase M12A, astacin"
FT                   /note="PFAM: peptidase M12A, astacin; SMART: peptidase,
FT                   metallopeptidases; KEGG: rde:RD1_1303 zinc
FT                   metalloproteinase nas-13 precursor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64126"
FT                   /db_xref="GOA:A1BCJ9"
FT                   /db_xref="InterPro:IPR001506"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR034035"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCJ9"
FT                   /protein_id="ABL64126.1"
FT                   /translation="MARKKNGNTPQEYGEFSPSGKLRTAIIEGNTFGYKSVQYTDVDGM
FT                   AMFEGDIILGKVADVDSKTEQRKREIQQGVTLRGITITGAKYRWPNCKVPYTIDTALPN
FT                   QSRVTDAIAHWEAKTKFRFILRTNANASSYPDWVTFRSGSGCSSYVGKQGGQQYINLAS
FT                   GCSKGNTIHEIGHTIGLWHEHSREDRNAFVTIHWDKIIAGYEHNFNQQISDGDDVGAYD
FT                   YGSIMHYPRTAFSTDGSETITPTDPSASIGQRTALSAGDIAAANSLCPTVSLCPAAPKT
FT                   CPGAPIQVCPVSPKLVCPPGIKLACPPGIKQLCPPGIKQSCPSAPIQVICPPGIKLACP
FT                   PGIKVTCPPVPKIPICPPSPVPGCAAGPTNKPWVGPEGYTTTYRLDPASGAYYSDEAPP
FT                   PGMNQMPPVVININFHGYQPPSIQSDYAQYDPSAYENQDWTATEYPDPGEEADDSITNE
FT                   ESEAPEDFNPECSE"
FT   gene            62761..65244
FT                   /locus_tag="Cpha266_0057"
FT   CDS_pept        62761..65244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64127"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCK0"
FT                   /protein_id="ABL64127.1"
FT                   /translation="MAAYDLLDKSENPHRAAELLLEAGSLVDGEAEPKKWAAFRQLYAQ
FT                   YSETSDPEAAITAYRDALSVWDPVLDRDAWVACHSGIGSLMVNLQPFGPKELDEAVMHL
FT                   ESAVQAQPFLSSMLAVLYRFRSAGDPRENWQKRVHHLRQALLLIDRDEEPCGWAAANNE
FT                   LAIAIGDEPDADFGAALEERLRLHLESFGLLEGNKDDTWIDTCLSLSECYLFRGGIDDR
FT                   ENQEQAERYARLALDAAGTEVSGPLRAEVLLNLARVLMAPGRFFDADRIRQCLSCCDES
FT                   AALIDPVRSPALMASVESFRANALLKLIQNGEPCDEERLAAHAEAALALLPGVEHTSSR
FT                   RSILQVAGEGMLAARHDERAAGYFREALDAAASALLFAESREGRMQRIWEFRDTSALLA
FT                   WSLLKLGDKENALVELEKGKGRFWRTDDEALSVAAIRSIVPSGGALLVANFSCREGAVI
FT                   VVTGERIEIVWLPSFGKDRLMALQRGGLDVASPGGWLRAYHMRNSEHEAWRRMIEETGE
FT                   TLYRELWEPVLDLLQDMGIADDAELVWFPQGGSGVFPVHAAWRQDSDGSKRWLIDRFTV
FT                   RYAPDFQVLLSGESGVGCASGSLLLVANPCGDLDFSELECAWVRQYHTGRELKLLHGID
FT                   ATPDAVLDAIGSAGIVHFSTHAIFDLNRPLCSALLLAGGEPLSLERLIPALEQKAPYLV
FT                   VLSACETAMSRISSTPDEFLGFPAAFLHSGVRTVLATLWPVDDAATAVLTGRFYRELAV
FT                   NNHSPSRALREAQNWIRSVTALELMELMREMKNAPPPAGPLAGRIRTALRAFDPELKPF
FT                   ASPYYWAAFTISGKE"
FT   gene            65249..66577
FT                   /locus_tag="Cpha266_0058"
FT   CDS_pept        65249..66577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0058"
FT                   /product="protein of unknown function DUF900, hydrolase
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF900, hydrolase
FT                   family protein; KEGG: ter:Tery_2076 protein of unknown
FT                   function DUF900, hydrolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64128"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCK1"
FT                   /protein_id="ABL64128.1"
FT                   /translation="MTELVQQLALLDALLSNWDGVLVRMGAPDVLRDEALAALAVKLSS
FT                   AESPDDLDLLLDDLFDLVEDTPAYDYVRGLIARARLDTGTVAKTRGGYAGELVSDDEKS
FT                   LLFGASRLAGRALGNAVSADVEPCQVEVFFATNRKSSDASDLQFTGEHDAGGYTCGVAH
FT                   VTIPVGVHRAGVLEGKRWWHLLREKDDSRRYVVLGSVEKLAEDLFTTRIVEGAPECRDL
FT                   LVFLHGFNVTFEDAARQAAQFAFDLQFQGRVVLYSWPSLGSLAGYCADEERAFLSNGRF
FT                   AGFLGMLEDGPWDKVHILAHSMGNRVMLYGLSGNSWPNGRISQVVFAAADVYVETFREL
FT                   FPKIREKAALYTSYTSKKDRALLISGILHKAKRIGISRGEPFVMDGLETIDASKVDNGF
FT                   PGHGYFAEETKLIEDISQLLGKGLSAGRRKLYQPPSKAYWDFR"
FT   gene            complement(66590..67027)
FT                   /locus_tag="Cpha266_0059"
FT   CDS_pept        complement(66590..67027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0059"
FT                   /product="SH3, type 3 domain protein"
FT                   /note="PFAM: SH3, type 3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64129"
FT                   /db_xref="GOA:A1BCK2"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCK2"
FT                   /protein_id="ABL64129.1"
FT                   /translation="MAEENKNFWGTIPGILTGIGTVLTAATGFYMAISGGSPTAKHKPE
FT                   ASAPPATAVMQATVQTTPAKEEVTPHLQDIFILKAVIDDPDGFTNVRSMKSSSSSIVAK
FT                   VTRNEQFHTYLQDGSWWQVKTADGKIGYMHTGHIRILQDPR"
FT   gene            67352..68095
FT                   /locus_tag="Cpha266_0060"
FT   CDS_pept        67352..68095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0060"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: sma:SAV1468
FT                   TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64130"
FT                   /db_xref="GOA:A1BCK3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCK3"
FT                   /protein_id="ABL64130.1"
FT                   /translation="MTTMARPFKALQMPNLSESIKEAAWRQINEFGASSLSLRKIAREL
FT                   GITAPAIYNYFPDRDALVTALIIDAYASFGDCQHEAGQAHPGQGREIERLKATGLAYRK
FT                   WALVHPLRYLLIFGNPVPGYVPPMQKLLPVMMRSLGTLVGIIAELHVLGRLHIEGVPLP
FT                   MLKPGNRFFALMETADEGMHAVYAVAMLIWSRVHGLVSLEITGQQLPFAEDGAALYLFE
FT                   LDSICRQFVRSPESAPDATGFSSNH"
FT   gene            68108..68572
FT                   /locus_tag="Cpha266_0061"
FT   CDS_pept        68108..68572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0061"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0451 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64131"
FT                   /db_xref="GOA:A1BCK4"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCK4"
FT                   /protein_id="ABL64131.1"
FT                   /translation="MKKTIVAGLAGGMAMNLAMLLTFRTLGFGWDGKGILLTSPMQSHK
FT                   LIAVWTEIQPLPLVVNTPLPIILGLMLFGIGHAFIYRSVASAWPAGVLPRAMRMSGLIF
FT                   FMTFLFWEFFTPFNQFGEPLPLIALELSFWVVIATAEGIAIAWVMERRTA"
FT   sig_peptide     68108..68170
FT                   /locus_tag="Cpha266_0061"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.952) with cleavage site probability 0.305 at
FT                   residue 21"
FT   gene            68569..69876
FT                   /locus_tag="Cpha266_0062"
FT   CDS_pept        68569..69876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0062"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   cac:CAC0756 multimeric flavodoxin WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64132"
FT                   /db_xref="GOA:A1BCK5"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCK5"
FT                   /protein_id="ABL64132.1"
FT                   /translation="MKALIFDGSPEGDSTGGRLAEVLAELLAAKGYETGHIVLRQKTIG
FT                   NCNGCFQCWLKTPGICVLDDDNRELSQRFIGSDLLILLTPVTFGGYSPELKRMLDHFIA
FT                   NVSPFFMTVNGETHHRNRYAAYPDLLVIGWLDQPDRVQESLFNHLAWRNSINFYAKRSS
FT                   WGIIERSAGSVVLRQKLADLFQGLDSPAERVEMKLPDVAAVSGKSGPPRKALLLCGSPR
FT                   MAKSTSDSLGGYLLDRLEAQGVETQTIYIYKMLHDGRKVQQMLDAVDSTDLCILAFPLY
FT                   IDSLPAPVLSALRMIKEHRKARPAQGGFAAIANCGFIESAQNENALAACEAFAGASGFN
FT                   WMGSVSVGGGEGLVHGRPLAELGGPAIPYRRALDSVAQFLAAGKPVPEDARRQLGRPFV
FT                   QSWIFRFFGSRNWKKRARQNGVLHKLNDCPYQPSAR"
FT   gene            70230..72956
FT                   /locus_tag="Cpha266_0063"
FT   CDS_pept        70230..72956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aor:AO090010000188 predicted protein Pfam:
FT                   MACPF CHMI PROSITE: SER_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64133"
FT                   /db_xref="InterPro:IPR020864"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCK6"
FT                   /protein_id="ABL64133.1"
FT                   /translation="MPKKNAGTPAKKVKDALPSAGSSTAVKLATGSSGTPAAPSAGSSA
FT                   TVKPATGSSGTPAAPSTGSSTTGKPASGSPATGTPATGAQSSGTPPSGTGTAPAAVASQ
FT                   TTAGAWLSKNQAADYIQRFQDAGYDDLSDLLPEIIRTVLQSEKPGVVDRLVRIRTQELR
FT                   QPQPLPAPALKPGMEMDLSAPVLKGMDGISIKLPDLGFAPGPDKRGDVVSPASMTDEDW
FT                   LALAINSDMLMGLDLENFFEGESSTPQECFAPALWWKVPASREFFNCEHLSAKINTEIT
FT                   YTSKSATMVSAGFTSVTASVSTPWVSASVSHEKSYRNAQSSKISTLYIVGMYDLDRVRV
FT                   DLDECTVVSPRFVAAVENALADPNPKDALAKVFQKYGQIIGRQITLGGRLFFVHVKEEM
FT                   ENSRIETLKSTTSAAIAGAYGAFGGSGSVSFGSSSEKQESSQSMNEKIAFQAIGGDVTL
FT                   ANEPEKWKDTIKSPAMWEVIRYDKIRYTYELLSPELRELVLMYWERPMGSDEGPIVLPK
FT                   AKVETMKSSDGVAITGFKIHFGQKVPGLSMRYYATSEDGSFYDWVNEGKLCGTESNGAS
FT                   PLQDFLVELTGGLARRYELHYRAMRADDTFTEWVSGTKICGAKGMKIKDIQAVLSPLGG
FT                   GIVRIPAESFIPSEGKGTYDIGKYGTGIVNAAVPGEWVLTYQCQYTGSKPVRRRLEALF
FT                   ASANESRPVKVEFNGAIVNGAALEYATGAWDTSGLRTARIGTVTLLPGMNTLKISRPGP
FT                   GSPHMKEFRLVAEVIDIPATSFIGTTPLGKNNYGLGVIDSGACGNSVTVPYEFTFTGKK
FT                   PTTLMLEGVYTAMDSRPVDIVINPEDEKPQTFSKVMATVTGSWWKDRQRVETIGDVIVR
FT                   PGKNTLMLRTTKNALPHIQEFRLVSKETFFDFDPDAD"
FT   gene            73902..74390
FT                   /locus_tag="Cpha266_0064"
FT   CDS_pept        73902..74390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0064"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64134"
FT                   /db_xref="GOA:A1BCK7"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR025517"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCK7"
FT                   /protein_id="ABL64134.1"
FT                   /translation="MSVSMKSWATPLAIGSFIILAVTGILMFFKIEGGYIKPVHEWLSW
FT                   AMVAGVLLHIFANWKSFLAYFSKIPAVSIISIGVIVTALAVFMPASRDGGNPKMKMMKA
FT                   IESARLETVAEISGKESSEIVAALKEKGIMVDDPTMTVRQIARTNNKEAMEVLGVVFR"
FT   sig_peptide     73902..73967
FT                   /locus_tag="Cpha266_0064"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.702) with cleavage site probability 0.686 at
FT                   residue 22"
FT   gene            74997..75524
FT                   /locus_tag="Cpha266_0065"
FT   CDS_pept        74997..75524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:gll3454 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64135"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCK8"
FT                   /protein_id="ABL64135.1"
FT                   /translation="MKRALSAIGFHGTSKSNYEGIKRQGFLLSDNSYDWLGVGFYFFQD
FT                   APNRAKEWAKRHEDPIIIGAEISLDHCMDLLDNVWYELLHRVFIAYEGACRKKNIPMAI
FT                   QTPGNHRRDKIVIDMAVRALAERGFSVKTVRSVFKEGPECFQNSALTTQNHVQIAVRDI
FT                   STIVDFWSEELN"
FT   gene            75533..76708
FT                   /locus_tag="Cpha266_0066"
FT   CDS_pept        75533..76708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64136"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCK9"
FT                   /protein_id="ABL64136.1"
FT                   /translation="MDHNEIQNIVLDYVNSLSKDELERYNHDPKYDGEDAGAFGLAEYS
FT                   LEQKYDRCKKVLSITRSAVCANQGQLVQFMFLAAEKHKALRVLMQAPQRRDAGLIKEKI
FT                   LELRDYIDFHLKKNIDRNIEYIYQYFDGRCDIKPRICIKGKSVVDKKHQIIRIFSDKSL
FT                   QYNSNVDIDKSSAYKYIKDNGRYYLQNDIPGSVKRNTYENSRLDIDKINHYMSIDADLN
FT                   SVWSNCWKNSPIDERNGLSFYKSTLIIPVTLLNNALDKEFVYEFNSKIDKEVGESVINP
FT                   NEIERTIFAFLCIDHVEKWYFDEEDDVRIGYMIADLISFYLFLRVMYIEISDVFANACQ
FT                   YLNECGVDITINKHVYAPVDEDLSAECVTGEDEYSKTNNNLIASISGLIAD"
FT   gene            76875..77174
FT                   /locus_tag="Cpha266_0067"
FT   CDS_pept        76875..77174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64137"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCL0"
FT                   /protein_id="ABL64137.1"
FT                   /translation="MRTRLRNCTISDIVLVCRSIFTSCQKSCELYSFSRDLNTSLFQKA
FT                   LIIEAAGNFKGLFCLLCVKSRCFPAVLVIKKAFSVSLQFVKKVWLAERLHQQQG"
FT   gene            complement(77474..81076)
FT                   /locus_tag="Cpha266_0068"
FT   CDS_pept        complement(77474..81076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0068"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: metallophosphoesterase; protein of unknown
FT                   function DUF323; NACHT nucleoside triphosphatase; KEGG:
FT                   cch:Cag_0856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64138"
FT                   /db_xref="GOA:A1BCL1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCL1"
FT                   /protein_id="ABL64138.1"
FT                   /translation="MAVTWLHVSDFHLSDKGPYDQEVILRSLVESIRHFRENENREPDL
FT                   IFATGDIAQYGKAKEYEKATNFFDDLLDAAGLNRDRLFIVPGNHDVERKMGKGLTRTLE
FT                   TNDDADEYFDPNTPTPHLTQKFHAFSEWYNDYFKTIRSFPTNTTCSPVELVTINGLRLA
FT                   VLPLNSALFCIDDHDHKKLFIGRRCLDAARKLLEAADLKVALIHHPLDWLSPIEQSNIE
FT                   AKLEESVDILLQGHYHQTSTKSIIAENGGYLKLAAGAAYQTRQWPNTAMYATFDGSGVT
FT                   IFPIRYEDKPKERWTLDTSLYPSPSYTRQYPIPGRVASRQDSLLPSCACDRGMNPDTGC
FT                   PEIKSYERYREALRNLFGIVASRGLDNYQDIEIPLEDVFIDLHIRELCGNVDAHDKGHT
FT                   IETKKMSQDALLQEIFHGNARTNVLLLIGDPGSGKTTLLQHYAMLCLEGDHGRLFPEAA
FT                   SVRVLFLELRKLNFDAHNKPVRLAAQIVELNRSLSLAADEAETWWREMSERERVLVLLD
FT                   GLDEVTELEKRKAICQWIDEEGHAYPNRFFIVTTRKTGYVTSDGVELIQSHRRAALDDL
FT                   LPDQQWDFLLKWFRAASKFEKERGFTIHDNTPPDDKARELYAYLYPQEGDKGEEMSSEE
FT                   TEKKKKGLQQIAGIPLLLKLMALLYKLRDFKPDSRIALYRVVIVYLLHGRDNARQISYG
FT                   IDPEQSATVLGLLAYTMQKKTCLDLSEGEMKEIMESRFRLLTTTVGLDTFFGFMVNRSG
FT                   ILKPNGKAFRFWHKTFQEYLASLEMLRCSKSDAFIRSIVQHYDDRKWEWDETLRFYFAQ
FT                   IDADIFDSFMNQLFNPEITTDVLQRKLQLMKTLIRESRECSTGALCQKLKDSKLSLGVQ
FT                   WHVLDCLEVINKSAALDAVRNFHERTKQTYEPDDNLKQRVLDKADGLINQLERTAGINR
FT                   NLPPKEKEKTKHDSQPKQRPRIISNTYEDDAQYILIPKTNEEKREESIYFSKYPVTNKR
FT                   YRSFIAALKKDAALQKQINDIAQNNRWDSKFAPWLKEGKNDLVALFRSKYDEDRKFGGD
FT                   EQPVVGITWYAARTYCLWLSLMASNGQDTSRYRLPTEWEWEYAAAGKEKRAYPWPKKKG
FT                   EPNSTLLNYNDNVGATTPVGSYPEGATPEGLYDMAGNVWEWTDSWWDDTTRSTRVLRGG
FT                   GWNDDARHCRSAYRILVTPDLRLNIAGFRLAFVP"
FT   gene            complement(81122..81469)
FT                   /locus_tag="Cpha266_0069"
FT   CDS_pept        complement(81122..81469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64139"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCL2"
FT                   /protein_id="ABL64139.1"
FT                   /translation="MKKSISGSNRRGKAGDITMQFKPVHYLGKVPMSGETGVPLFAVVM
FT                   AERSFSSFAGLGASPGFLNRRMNCRLAAQKTLIPASLLACMIDNRRINKRLYSFMQLRP
FT                   PCFTLCFLSQP"
FT   gene            81714..81941
FT                   /locus_tag="Cpha266_0070"
FT   CDS_pept        81714..81941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0070"
FT                   /product="helix-turn-helix protein, CopG family"
FT                   /note="KEGG: pol:Bpro_0451 helix-turn-helix protein, CopG
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64140"
FT                   /db_xref="InterPro:IPR022148"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCL3"
FT                   /protein_id="ABL64140.1"
FT                   /translation="MKTKEFDKAFDQGKDVTVYLDLGKASRVKQQHKRVNVDFPVWMID
FT                   SLDKEATRLGVSRQSVIKVWLAERLQQQKG"
FT   gene            complement(82008..83015)
FT                   /locus_tag="Cpha266_0071"
FT   CDS_pept        complement(82008..83015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0071"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   dsy:DSY4506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64141"
FT                   /db_xref="GOA:A1BCL4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCL4"
FT                   /protein_id="ABL64141.1"
FT                   /translation="MKSPMSGREMTLIKEARTMIFRKKEYPVCYHVYHCNDTQQQFTST
FT                   ELDEINLVQVYNQYRDEHNLPFPEEIRSIREAYGLSAAKMAEVLGLGTNTYRNYEQGEV
FT                   PSESNARLIQVAQDPEEFRKIVCLSCALKGNQLEKLNARIQHLIENRKKTTCIDIEEYL
FT                   MGSKLPDEYSGYLKPSLEKLGEMVVFFAEKLKPWKTKLNKLLFYADFLHFKRSGFSISG
FT                   TRYCAIPLGPVPDNFNSIFEWMEKKGALAIIEQEFPDGGTGERFFPAESRSFDERKFSA
FT                   KELDTLNTVAFAFLKTGTKEIIAISHNENAWIENIHAGNGMISYLRYGFDLKAL"
FT   gene            complement(82993..83373)
FT                   /locus_tag="Cpha266_0072"
FT   CDS_pept        complement(82993..83373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64142"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCL5"
FT                   /protein_id="ABL64142.1"
FT                   /translation="MTATKHQVHAFLRDFKNKLKIWSIVFRDDRGKNAQTLLDLEIRPV
FT                   DRQKIIEDLDAEDYSEGPIDDIMNKGPEMWVFGKEVKRCEIYIKITKVSPDASVICISF
FT                   HIAEHRISYPLKTQCHEKPDER"
FT   gene            83897..85186
FT                   /locus_tag="Cpha266_0073"
FT   CDS_pept        83897..85186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0073"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   cch:Cag_1099 DNA modification methylase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64143"
FT                   /db_xref="GOA:A1BCL6"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCL6"
FT                   /protein_id="ABL64143.1"
FT                   /translation="MNLLPDSSVHLIITSPPYWQLKDYGTENQIGFHDSYESYINNLNL
FT                   VWSECERVLHPGCRLCINIGDQFARSVYYGRYKVIPIRTEIIRFCETIGFDYMGAVIWQ
FT                   KVTTTNTTGGASIMGSFPYPRNGILKLDYEFILLFKKQGDAPKPSKELKERSAMTTEEW
FT                   NTCFSGHWNFAGAKQDGHIAVFPEDLPHRLIRMFAFVGETVLDPFMGSGTTSLAAKNLD
FT                   RNSVGYEINPEFIGIAREKLNSNQTDFAGTEYVFQHDTLKGDISEMIERLPYRFQDPHK
FT                   LDKKIDPRKLTFGSRVEKGGGAKQEETFIVREILSPEMVRLSNGLTVRLIGVKEDPFTR
FT                   EKAVGYLVDKIKGKRIFMKYDSMKYDGRNNLLCYLYLENRTFVNAHLIRSGLVGIDGSY
FT                   EYRYKQKFLAFSDENSTLVQTGRWSGIAAK"
FT   gene            complement(85239..85511)
FT                   /locus_tag="Cpha266_0074"
FT   CDS_pept        complement(85239..85511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64144"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCL7"
FT                   /protein_id="ABL64144.1"
FT                   /translation="MRIENLDDVAEFARTVILNGVNLHPDDDFRNYVNIETGQPTYTEE
FT                   EASAYNRNMANAFSICDKCGVDIYGFMQKIFLVETGLDKVIPMPD"
FT   gene            complement(85805..86278)
FT                   /locus_tag="Cpha266_0075"
FT   CDS_pept        complement(85805..86278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64145"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCL8"
FT                   /protein_id="ABL64145.1"
FT                   /translation="MKMPSTAKLIADLLYDYENEPETTFGDLVDGIEDLSIETGDLELS
FT                   LAISKYRIEERYDRKYLGMRGDMDSVEADFIEAVRLLAFGRTFSEDRNASANFDNWDYT
FT                   LINSTIEKGQPYPAVLIYKVIGAREHELPLLEKAGYTLFNDTYLPPSAGKTSD"
FT   gene            86782..88353
FT                   /locus_tag="Cpha266_0076"
FT   CDS_pept        86782..88353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0076"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: bfs:BF1534
FT                   putative transposase for insertion sequence element
FT                   IS21-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64146"
FT                   /db_xref="GOA:A1BCG7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCG7"
FT                   /protein_id="ABL64146.1"
FT                   /translation="MRTQLKKLTMYNKVKEFAREGLSIRQISRKTGMDRVTVRKFLRMT
FT                   DEEFSAFLALQKRRLRKLQPYEQFVKDRVTDYPDCSATQVEDWLKEHHPVFPEVTTRTI
FT                   YSFVQWIRKAYDLPKPKGTPRAYHPVEQLPYGEQAQVDFGEYWMASADACKVKVHFMIM
FT                   LLSRSRRKFVSFSQQPITTRFVLEAHEQAFSFFEGIPHTLVYDQDSTIVTDENRGAILY
FT                   TEAFRKYLLHRSLKIHLCRKSDPESKGKIEAGVKYVKYNFLPGRRFVNLEVLNQEALLW
FT                   LERTANAKEHATTRLIPDAEWQVEKQHLRPFEPLPYPISGTVGKEYHVRKDNTISYRGN
FT                   FYSLPVGTYAGPGTLVVLEVRQNTLCLYAQEGRLLANHPIESGKGTVVINNNHRRDTSS
FT                   KLRELQDSLMLLFTNQEHAERFLESIHNRYPRYSRDQFLHVRNAISGCQQKLIDDALAH
FT                   CVDHHLFSSGEFHDILHHYRKQEEKQSHQAVFNTFRPKTLRSDMDRMLSFVPDSSGITT
FT                   YENIFS"
FT   gene            88359..89195
FT                   /locus_tag="Cpha266_0077"
FT   CDS_pept        88359..89195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0077"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: bfs:BF1535 insertion sequence
FT                   IS21-like putative ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64147"
FT                   /db_xref="GOA:A1BCG8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCG8"
FT                   /protein_id="ABL64147.1"
FT                   /translation="MERTITTIQEHARELNLTGLAGTVDLLLEEARKSEPSYSDFALTL
FT                   LESELSCRRKAHLERRRKIANLPLLHDLDHYDSGVQNGISQVQLQQLRQLLWLDQNFNL
FT                   ILIGPSGTGKSYLAGGLCHEALKLGYHALFRTMDDLIQTIRFKEITAAAAREYKRLLSA
FT                   HLLVIDDIMMFPLEKSVAVGLFQLVNQLHEQTSFIITTNKSPKEWAEMLGDEVLATALL
FT                   DRLLYKCEVIKLTGKSYRLEHRTTIFEQQQSPEGGGNRRKKQLPLQKGVGNHCKMT"
FT   gene            complement(89710..91446)
FT                   /locus_tag="Cpha266_0078"
FT   CDS_pept        complement(89710..91446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecp:ECP_4570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64148"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCM1"
FT                   /protein_id="ABL64148.1"
FT                   /translation="MTIMSEITSSFNDFILKSVSRYLQTVVLIDDKIYPPKAVRTPTDL
FT                   QEPPSRHRKAASKSAEPVLEKKEVIDKLAEEIDQSEEVSFHDIQNSFAEKRIICSLYQP
FT                   KQGASFNSSSDVYNLCSVADVVVVDWDIHGDSGKKATELVVTLIEQSMKEVPHQLRLVL
FT                   IYTMDPNLGSVANSVYEAFSSQIDTALIDVLEDGNGLVFTSENARVVVLGKKINTAFLQ
FT                   YSDFFVPEKDLAERTINEFSHLASGLLQCIILQGIASLRENNRRILMRFHKGLDAAFLA
FT                   HRALLMPDEAFGQIIPMLTDELRAVLEDNLGEHPLGDEIISKEIISDWCNKHWKPVTVS
FT                   DLQIGSSVDPTAFAIDVFCNGSNIADYSKYRGSRISGMLEMKDGLNKWKEKKCDLLAEY
FT                   LSSDEKGNFSHEMLSALMSQRIAYENSRKSLRLGVILRIKITEKPRYMLCLQPVCDSVR
FT                   VNEKGTPFIFCLLDVPNNGSIFTHTVKDSSDSTIRLVYKAKVTNCYISLFSSNTGVVCA
FT                   SENGEGQFIFKDTEDKEYEWVAELKIEHAQRAAEEFGRILSRVGLNESEWLRLKTKQLN
FT                   NQ"
FT   gene            complement(91430..94393)
FT                   /locus_tag="Cpha266_0079"
FT   CDS_pept        complement(91430..94393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0079"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; KEGG: ecp:ECP_4571 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64149"
FT                   /db_xref="GOA:A1BCM2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCM2"
FT                   /protein_id="ABL64149.1"
FT                   /translation="MAKFRTKARAVDMLGRQQIADASTAISELFKNAHDAYADNVEVDL
FT                   FKSDSLLVIRDDGIGMSPSEFEANWLVLGTDSKFSSAGKLHAYRPSNKPERAVMGEKGI
FT                   GRLAIAFLGPQVLVLTRSEKLDHNDTLTMCYLHWGLFEQQALNLDDIDIPVKSISGGEL
FT                   PSLQDVSELLLENTRNVEQLQKRFPQCDLCSIIDDLSDFQVDPRDFEKSVQGLSLSDHK
FT                   CGTHFYIATANEVIIADIVAEKYTLTKEFTKCLLGFCNSTFAETSPPPIQTKFRYWPTD
FT                   NRYEDLIAPNEFFTTDDLALSDHFVSGEIDEYGQFNGIVRVYDQEYPDHVISWKEGGGK
FT                   PTECGPFRVEFGYLQGAHRESMADPDDWSILDSKLKQIGGLYVYRDRIRILPYGNSNVD
FT                   WLDIELRRNKGMGYYYFSYRRIYGAICTTRKENATLREKAGREGFQKDKAYRQLKSVLE
FT                   NLFIQLAADFFRKDATHGDYFQERKDELDRLERARRKREQQITTKRTKLSDTLDVFFSK
FT                   VNERIPESEIATLSHHVQSRMQSASFMMDSDTASQELLDAEREANEKLALLRTTYTLIR
FT                   PRGVGLTKQLTRDWDAYQREHNRLEIEVFEPFVKDVGKKLGSMAAQAKIYIDQRRRLQE
FT                   LIKNVADEQNANVKNESKVLQETSSQTRRAAVNTARSAMKELRDTIEAVNADLAHRDLN
FT                   DLLPEQIEEIRSTYEKRIDSVASRNAETLGSVRELLAGIVESLENNMQNSQLDIVEAMD
FT                   TELESLREQAETDEELVQLGLAVAVINHEFVAAIKMIRGQLRELRSWAMVNKDLLPVYQ
FT                   EIRTNFDHLDAHLNLFTPLQRRLYKKRVNIEGKEIIHYVRALFNVRFERHKIHLEATQA
FT                   FLDSHVTSYPSTIYPVFVNLIDNFIFWLKDKQGDRLISLDCTDNSYHIKNNGPAINRRD
FT                   AESIFEQGFSRKPGGRGLGLYISKKVLEKEGMTLALDKTLTMDSGVSFNLSWSDNNE"
FT   gene            complement(94386..95501)
FT                   /locus_tag="Cpha266_0080"
FT   CDS_pept        complement(94386..95501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0080"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="KEGG: ecp:ECP_4572 modification methylase; TIGRFAM:
FT                   DNA-cytosine methyltransferase; PFAM: C-5 cytosine-specific
FT                   DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64150"
FT                   /db_xref="GOA:A1BCM3"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCM3"
FT                   /protein_id="ABL64150.1"
FT                   /translation="MNQQSEPTCSKIRVYDFFSGCGGTSVGFGRAGIQHALAVDSCSDA
FT                   ISTYQKNFIGVPVITDPIETLNVDRIQNYFSHNPEVKLFCGCAPCQPFTKQKTNTKKDA
FT                   ASDDRRGLLIYFSDIVHACLPELVFVENVPGLQKFSLEDGGPLAMFISRLKQNDYFVDF
FT                   DVIAAQDYGSPQVRRRFVLIASRLGKITLPAPTHGPNTKNSYVTVHDAIGNLPSVKHGT
FT                   EHPDNQNYPNHRAAMLSALNLERIRHTGANGRRDWPERLLPKCYAQKKDGKRYEGHSDC
FT                   YTRLAWGEPAPGLTTRCISYSNGRFGHPEQDRAITIREAAKLQGFPDDFIFTGSLNSMA
FT                   RQIGNAVPVSVAEVFGRHFLNHVKAMESTNG"
FT   gene            complement(95816..97117)
FT                   /locus_tag="Cpha266_0081"
FT   CDS_pept        complement(95816..97117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lpf:lpl0144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64151"
FT                   /db_xref="InterPro:IPR029127"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCM4"
FT                   /protein_id="ABL64151.1"
FT                   /translation="MKNKGCRTIYAKVLAANDNRKQQVYFGGDFQAINIIPFDTIAPDP
FT                   DKPHIFKAPLNFWWLSDDESLHNASRAQLILYPQYPEVRFSGFLQGCSAAPSELMDERL
FT                   RLAGRILFLGISPDGRIIGYLCHPESELAREFVSLGELPRSGVFLEPGLGTGVLDDRSL
FT                   LIEKLRVIHQKGWIRSRKLGSNGVILPCEAPNCGGMTLEAELDIIPNSRSEPDWLGYEV
FT                   KQYNVTNFQRINSGVLTLMTPEPTGGYYRSAGIEAFIRKFGYPDMTGAADRGDRLNFGG
FT                   IHKVGEYHRLTSLQIVLKGFDAIKGKITDATGGISLMNIEGEEAAVWGYAEVMAKWNRK
FT                   HNKAVYIPSRCVQSPERRYWYGNLIRIGTGTDFLKYLQAMAEGKVYYDPGIKLENASTT
FT                   PRTKQRSQFRIKSSNLPALYHSMDIVDLNEEQSE"
FT   gene            complement(97065..97595)
FT                   /locus_tag="Cpha266_0082"
FT   CDS_pept        complement(97065..97595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0082"
FT                   /product="T/G mismatch-specific endonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /note="PFAM: DNA mismatch endonuclease vsr; KEGG:
FT                   mmr:Mmar10_3056 DNA mismatch endonuclease vsr"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64152"
FT                   /db_xref="GOA:A1BCM5"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCM5"
FT                   /protein_id="ABL64152.1"
FT                   /translation="MADVVSPETRSRMMSGIRSENTVPEMRVRRGLHARGFRFRLHCGG
FT                   LPGKPDIVFPKYRAVIFIHGCFWHAHECPLFKWPKTREDFWKKKIGKNRIRDLAVMDEL
FT                   ARQGWRVLIVWECALKGKGRRPIDEVVDSCAEWLLSSSTKREIRGQHEIIDITIDHEKQ
FT                   GLPDDLREGTRRK"
FT   gene            complement(97588..98865)
FT                   /locus_tag="Cpha266_0083"
FT   CDS_pept        complement(97588..98865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0083"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="KEGG: lpf:lpl0145 DNA
FT                   (cytosine-5-)-methyltransferase; TIGRFAM: DNA-cytosine
FT                   methyltransferase; PFAM: C-5 cytosine-specific DNA
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64153"
FT                   /db_xref="GOA:A1BCM6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCM6"
FT                   /protein_id="ABL64153.1"
FT                   /translation="MNTTQSFSVLRQQAGLSIDKIAHITGYSQREVYRWEKNEVVPRKM
FT                   VLDQLTRIAQPLSTYGKDSSSFTFIDLFAGIGGMRKAFEELGGRCVFTSEWDKYSRQTY
FT                   CANFDCDHEIGGDITKIDARDIPSHDILVAGFPCQPFSIAGVSKKNALGKPHGFADKTQ
FT                   GTLFFDVARVIEYHQPKAILLENVKNLQRHDKGKTFAVIKETLTELGYYFDWKIIDAGN
FT                   WVPQHRERIFIAGFREDCGFSFDRFDLPHGNERPVIETILHPENGMEDEEPPYTVGPLA
FT                   RISDRYTLSDHLWEYLQKYAEKHRAKGNGFGFGLVGPHDVARTLSARYYKDGSEILVKQ
FT                   EGKNPRRLTPRECARLMGFDTPNGNSFVIPVSDTQAYRQFGNAVVVPVVMSVARYMLEY
FT                   LMDGVSSDQLRFDFGILMADNAVQYG"
FT   gene            complement(99268..100713)
FT                   /locus_tag="Cpha266_0084"
FT   CDS_pept        complement(99268..100713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lpn:lpg2913 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64154"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCM7"
FT                   /protein_id="ABL64154.1"
FT                   /translation="MIINSSELTGVLRQYNPWWSGNRFPDLPAWKRAAFHEIAHWVENP
FT                   PAGRALLLSGARQVGKTTLFLQAIDELLAKGIPPGNILYATFDHPLLKLAGLDGLLRLW
FT                   DEAEPSKQGTEYLFLDEIQSIKEWQVWLKHQVDFEKRRRIAVTGSATPLAMEGQESGVG
FT                   RWHTIKLATLSFYEYLKLRNDPVPKLPAISSLADLFDMTPAWFSKTGSEARILTGFFHE
FT                   YLLRGGFPQTATVSSIPLAQKLLREDIVDKILKRDMTALFGVRRIIELEQTFLYLCLHD
FT                   GGMLDMQELSKNLEVKRPTAMSFISILEATHLIYRLQPFGYGKEILRGKHKIYLADPAI
FT                   APGVLLKGISLLDNPTLLGQAAETAFFKHVFSRYYARSIAFSYWRGGKKGLEVDIIADI
FT                   GGRYVPFEVKYRSTAVETADLKGLTEFCRTRAVNKSCVITRNMEDFGIIPLTGDNNIQA
FT                   LKIPAPLVCYWLGESETTSAVGS"
FT   gene            complement(100871..101596)
FT                   /locus_tag="Cpha266_0085"
FT   CDS_pept        complement(100871..101596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0085"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase; KEGG:
FT                   cte:CT2196 EntD/Gsp/HetI/Sfp family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64155"
FT                   /db_xref="GOA:A1BCM8"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCM8"
FT                   /protein_id="ABL64155.1"
FT                   /translation="MIIAKETVTLIHTDTKIHGLPETELYESLSDDEKTRAGRIHAASE
FT                   RQNFIVRRGILRSLLGTTFGIEPFRIRFAATPVGKPFVAFPGNSGIFFNLSHSGNDIVY
FT                   AFSGHPETGIDIERIRTLEDIDELARNYFSAEEYAILMNQPGWKKNNAFIRIWSLKEAL
FT                   IKASGWPLEQGLAAFDVAAYCQMNRFELPFGDIHTFTCIAPVFDYICGFATALAIRLDR
FT                   NEPLNIKRYSLQGGQFFEL"
FT   gene            complement(102059..102997)
FT                   /locus_tag="Cpha266_0086"
FT   CDS_pept        complement(102059..102997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cte:CT1464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64156"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCM9"
FT                   /protein_id="ABL64156.1"
FT                   /translation="MKRITIPALLAIMLLLCQSLSFAAVSQFTGTWKNTDPNTAGVTKL
FT                   SITGNGNSLRMRAWGKCHPQDCDWGEVNAYAYAPGVSSDIDQNAQAVSALFTTGFSQTL
FT                   VIVRPISRSSIRADIYTRFTDNSGRSNYTASYTFNRQLIVGPIGPIGPIGPIRPMPSVE
FT                   EDCISFNPSTVTVKNLDGRWTIVDGNHLMFNFGPNRTEALQALRIIKHYRMNSSCFVGR
FT                   PDPSFQYLLVNGRAPQGNMPGEDCVSFNPNTIEVRNIGGSWKIVDGSHWVFDFGSKEDE
FT                   ARKAFAIIKKYGFTRSCFVGRPDPSFQYLKK"
FT   sig_peptide     complement(102926..102997)
FT                   /locus_tag="Cpha266_0086"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.987 at
FT                   residue 24"
FT   gene            103347..104657
FT                   /locus_tag="Cpha266_0087"
FT   CDS_pept        103347..104657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0087"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF894, DitE;
FT                   major facilitator superfamily MFS_1; KEGG: cte:CT0102
FT                   transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64157"
FT                   /db_xref="GOA:A1BCN0"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCN0"
FT                   /protein_id="ABL64157.1"
FT                   /translation="MSNADESINGNDNSPAEQSPTTLKEKVLSAFPAFRSRNFRLYFIG
FT                   QIVSMVGTWLQMVAQGWLVLEMTGSAFWVGVAAAASSLPTLFLSLIGGVIVDRYNRKTI
FT                   LLWTQSASMVLALVLGIITLTGSVTLAVILALAFLLGCVAAVATPAIQAFLSEMVDRDQ
FT                   LHSAVALNAAIFNASRVIGPAIAGLMIAWIGTGGAFIANGLSYFAVIAALLAITIATPR
FT                   KIPAVHQPPLQSIRDGIVYTWEHPVIRTIVMFVSVVSIFGWSFMSMLPVVAKQTYGLGS
FT                   DGMGYLFSAFGLGSLSGTVVVSMSSGKIRSSAMVIGGILVFSLALTAFTFASDERVAMA
FT                   FLFIAGIGMLSAFATMTATVQRLVEDSYRGRVMSIYLMVLMGFMPLGNLQVGFLSEQFG
FT                   TAIAIRIGSIVVLLATIFLFSYRKEIQSAWHEYRMQE"
FT   gene            complement(104732..105310)
FT                   /locus_tag="Cpha266_0088"
FT   CDS_pept        complement(104732..105310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eli:ELI_01410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64158"
FT                   /db_xref="GOA:A1BCN1"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCN1"
FT                   /protein_id="ABL64158.1"
FT                   /translation="MQFGKTFQIPALIAVSCALVAPAPAMAEHGRNTRTVAAAVAAAAI
FT                   VGLAINAANHQGHYKDGRRYDNDRDSGEFDRGYRDGLYDTNRNNYNHTDAYRDGYRAGQ
FT                   DERELRVSHNQSNRWEQGRHVADSNMMYKATDEAERYWNLPRGSATPVRSSYNEDSGNY
FT                   RVAVAAGYLRGVCVLDRYGRVIRFEDKRD"
FT   sig_peptide     complement(105227..105310)
FT                   /locus_tag="Cpha266_0088"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            complement(105373..105780)
FT                   /locus_tag="Cpha266_0089"
FT   CDS_pept        complement(105373..105780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0089"
FT                   /product="putative hypothetical Gifsy-1 prophage protein"
FT                   /note="KEGG: rsp:RSP_2032 putative hypothetical Gifsy-1
FT                   prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64159"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCN2"
FT                   /protein_id="ABL64159.1"
FT                   /translation="MKTKSLVFLLLFTLFSIRAYAADDRYEQVKFPRGASGTSIKSSIV
FT                   GYQGVNYTLDAKAGQTMTVKLQSSNLSNYFNIYAPGKGPGDEAMVIGDINGNSYSGVLP
FT                   STGTYTIQVFLMRNAARRNEKASYTLDISVK"
FT   sig_peptide     complement(105715..105780)
FT                   /locus_tag="Cpha266_0089"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            106136..106678
FT                   /locus_tag="Cpha266_0090"
FT   CDS_pept        106136..106678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0090"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="KEGG: cte:CT0103 PilB-related protein; TIGRFAM:
FT                   methionine-R-sulfoxide reductase; PFAM: Methionine
FT                   sulfoxide reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64160"
FT                   /db_xref="GOA:A1BCN3"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCN3"
FT                   /protein_id="ABL64160.1"
FT                   /translation="MHRMLMFIFFATVGLFACSGEPTSPKFSPSKAMSDSRALNPYYSR
FT                   TDTTKLDLPDSVWKKVLPPEVYEVARKAGTERAFTGKLWDFEGIGTYYCAACGNALFRS
FT                   DAKFASTCGWPSFFETVRPGSVEYRTDMAFGMARTEVLCGRCGAHLGHVFDDGPPPTGK
FT                   RFCMNSIVLDFEPDEGD"
FT   sig_peptide     106136..106195
FT                   /locus_tag="Cpha266_0090"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.716 at
FT                   residue 20"
FT   gene            complement(106689..107087)
FT                   /locus_tag="Cpha266_0091"
FT   CDS_pept        complement(106689..107087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0091"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG: eba:ebB17
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64161"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCN4"
FT                   /protein_id="ABL64161.1"
FT                   /translation="MRYLLDTNICIYIINSRPADVLKRFRQEQIGTIGISSITAAELTF
FT                   GVIKSGSEKNRRALEMFFTPLEILPFDGSIIWHYGRLRYYLEKLGQPIGALDTMIASHA
FT                   LALDTVLVTNNVREFMRVPGLRYENWAE"
FT   gene            complement(107084..107362)
FT                   /locus_tag="Cpha266_0092"
FT   CDS_pept        complement(107084..107362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0092"
FT                   /product="virulence associated protein B"
FT                   /note="KEGG: eba:ebD28 virulence associated protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64162"
FT                   /db_xref="GOA:A1BCN5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCN5"
FT                   /protein_id="ABL64162.1"
FT                   /translation="MYRGDPNDKERISIPMETAKIFQSGRSQAVRLPKEFRFQGKEVLI
FT                   SHFADGVLLLPIDKSWATLEAALEEFEPEFKLEREQPEAEKREAIAS"
FT   gene            complement(107423..108994)
FT                   /locus_tag="Cpha266_0093"
FT   CDS_pept        complement(107423..108994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0093"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cch:Cag_0039 drug resistance transporter EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64163"
FT                   /db_xref="GOA:A1BCN6"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCN6"
FT                   /protein_id="ABL64163.1"
FT                   /translation="MLPAAHAYETGSRRIIITLTVIVSAMLELIDTTIVNVAITEISGN
FT                   LGASIEDVAWVVTSYAIANVIVIPLSGFLGNLLGRRNYYIGSILLFTAASLLCGIATDI
FT                   WTLVFFRFLQGIGGGALLPTSQAILYETYPPEDRGKATGIFSMGLVLGPTFGPLLGGFL
FT                   VDNFSWEWCFFVNIPVGLLAAWSAFTFIKEPKTVHKVVKIDWAGIGLLTIGIGSLQFIL
FT                   ERGESKDWFETPYITWFTIIAIVSLMLFVWWELRVEEPAVDLSVLARSHNLAIAAVLTF
FT                   VVGYGLYGSLFVFPVFVQRLLGFSALLTGTVLFPSALVTGIIALPLGIALQKGASAKIL
FT                   MTVGMAAFSIFCWELGQQTMQSGAGNFFWILLLRGVALGFIFIPVTMLAVAGLHGKDIG
FT                   QATGLNNMVRQLGGSFGIALTNTYIVKRVAEHRNEILSNLSPYDPAAVERLNAIGQAAQ
FT                   SRMISPVEAEQVALRALEGTVTAQSYHLAYMDAFMLIALLFALCMPLLFFIRIKKGEKA
FT                   DLSQAH"
FT   gene            complement(109147..110133)
FT                   /locus_tag="Cpha266_0094"
FT   CDS_pept        complement(109147..110133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0094"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   cte:CT0105 multidrug resistance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64164"
FT                   /db_xref="GOA:A1BCN7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCN7"
FT                   /protein_id="ABL64164.1"
FT                   /translation="MAEQEKNIGTAEKPEEKATNPLRLVITVLLVLAAVVWGGSKIRHS
FT                   FLYVETDNAQIEGDVYPVISKVPGTVQSVLVRTNQEVRRGDTLVLLDPADYKVKRDMAE
FT                   AALQNARASVSAAGEAATAAAATGQKLKSDLARSQNLRRQDVISPSEFDAVKAAALSSS
FT                   AQSAAAESQHRGAAAQVTMRQAELRNADLQLSYTTITAPAAGHVSKKNVQPGQYVAPGQ
FT                   QLIALVGSSELWVVANFKETQLENIRTGQPVTIRVDAYPGKEFEGRVESISSGTGARFA
FT                   LLPPDNASGNFVKVAQRVPVKILFTGKPDKDHKLAAGMNVVVEIKVK"
FT   gene            complement(110135..110608)
FT                   /locus_tag="Cpha266_0095"
FT   CDS_pept        complement(110135..110608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0095"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: cte:CT0106
FT                   universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64165"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCN8"
FT                   /protein_id="ABL64165.1"
FT                   /translation="MKTKPKKIICAVDFSPLSDNLVTYAAGLRPYDAELTLLYIEKEGK
FT                   RTLNMLQNRLHAFSRYSELLVQANRSARFAVECGDPAAEILAYADRVHADLLLLGSHGS
FT                   TAFTRLLMGSTAETVLRRAACPVAIYKVPDRRTPARKRQEATTLLLKDNKQTA"
FT   gene            complement(110611..111936)
FT                   /locus_tag="Cpha266_0096"
FT   CDS_pept        complement(110611..111936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0096"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   cch:Cag_0041 outer membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64166"
FT                   /db_xref="GOA:A1BCN9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR028351"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCN9"
FT                   /protein_id="ABL64166.1"
FT                   /translation="MKKTLKIHACIATAALMLAIPHRTDAVMPPPGAPMTLEETIMLVK
FT                   ENNPALKAAAEEVNAADARIRQQKSAYYPQISASAGYRYIDPVSEMGFGGSEPLQFMPN
FT                   NNYEAKISAKATLLDFGRRGVEIDLAESGKNSAVHTLTLTRRDLSFSTVELFYGILFLR
FT                   ESIRVEEKEITALQKAFDYTSKRYQAGTATRFDVLTTDVRIQAARSKKLNLEHQVRRNE
FT                   LALYRLTGIATDRPLELKGSFSVHPARPLESTLVAEAMKQRPEVQLAGENEQSAKLRRS
FT                   LAVKAGLPVVSATASWGAANGYQPDIDEIRENIAAGIHIELPIFTGFRTTAERQEASAR
FT                   LRAATLRKLDTEEQVKTDVEETLHALETARKNILTTQSQVQLANLAAEHARARYQNGIA
FT                   TTLDLLDTESSLAQAELSRLQAAYDYVMNSYTLKRATGETFW"
FT   sig_peptide     complement(111856..111936)
FT                   /locus_tag="Cpha266_0096"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            112186..114285
FT                   /locus_tag="Cpha266_0097"
FT   CDS_pept        112186..114285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0097"
FT                   /product="DNA-binding protein Fis / transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; GAF domain protein;
FT                   ATPase associated with various cellular activities, AAA_5;
FT                   SMART: AAA ATPase; KEGG: plt:Plut_0058 transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64167"
FT                   /db_xref="GOA:A1BCP0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCP0"
FT                   /protein_id="ABL64167.1"
FT                   /translation="MQNIAVHEASTLMRYISNAIGSIRDPQELFRTVTDKLRLVFEFDS
FT                   AFIITLDRDRRFINVVFEMVRFDLPDTIQRKKRPVAGSWIESHLGDEGVSVVAIEGEMD
FT                   RYPADFPVPRMLYDLGMRQVVLSPLRSGGKVIGFLNFVSREQKQWKESDKELLSTLSSP
FT                   VAVALSSALAYEELRQREAQTAMQLAVNNALLTIKDRSRMLLAVCEQIDKLVPCTFLGI
FT                   RVMDRDGNFRIFDNFMRETPSGFFPVSAHEKLDVPDFAEMARESFSLITSPGCFSGEAF
FT                   QLLCDKYRLVGLVREKFNICSLISVRLWDLPGSCAGLIISDTSRAFDEHDQETVGLIVP
FT                   QLSLALQNYLAFEEIDKLRRKLEGEKAYLFEEIKATHDFEEIKGESAVLASVLHRVSQV
FT                   APTDATVLIQGETGTGKELFARALHNLSRRRNRMLVKVNCAALPATLIESELFGHEKGS
FT                   FTGAIERRIGKFELAEGGTVFLDEVGELPLELQAKLLRVLQERELERLGGRGVISVDVR
FT                   VLAATNRNLEKEVAEGRFREDLFFRLNVFPLFVPPLRERREDIPLLALYFAAKFARLMG
FT                   KPHCEFRESDMLLLKAREWKGNIRELAHLVEQAVIVSDGRWLDFSTMLSPSLAFTEPRE
FT                   QGQLKSMREFEEQVAMMERELILEVLSQSNGRVSGEGGAAEKLGMHPKTLYSRIEKLEI
FT                   RKRYR"
FT   gene            complement(114296..115678)
FT                   /locus_tag="Cpha266_0098"
FT   CDS_pept        complement(114296..115678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0098"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: plt:Plut_2077 CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64168"
FT                   /db_xref="GOA:A1BCP1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCP1"
FT                   /protein_id="ABL64168.1"
FT                   /translation="MKRHTEHEFREPDNLSMEILFLLFLIIINGIFAMSEIALITTKRT
FT                   RLTKLAESGDKSAAAALKLGHEPTTFLSTIQIGITSIGILNGIVGQGALAEPFAVWLES
FT                   LGMAHDASHIGATAVVVISITYITIVVGELVPKRLGQFNPEGAARLFARPMLMLATIAR
FT                   PFVRLLSVSTDTLLRLMGKSPQAMPSVTEEEIHAMLEEGSEAGVIEQQEHDMVRNVFRL
FT                   DDRQLGSLMVPRADIVYLDITRPLEENILRVTESEHSRFPVCNGGMQSLLGVVNAKQLL
FT                   SQTLKGGLNDFTSQLQPYVYVPETLTGMELLDHFRTSGTQMVFVVDEYGEVQGLVTLQD
FT                   MLEAVTGEFVPRNLEDSWAVEREDGSWLLDGLIPVPELKDKLELLSVPEEDKGLYHTLS
FT                   GLLMWSLGRMPQTGDVATWENWRLEIVDLDGNRIDKVLASKIPPPDTNGLKQNGSAAGE
FT                   KN"
FT   gene            complement(115662..115976)
FT                   /locus_tag="Cpha266_0099"
FT   CDS_pept        complement(115662..115976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64169"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCP2"
FT                   /protein_id="ABL64169.1"
FT                   /translation="MPWYIAYRVRHKSMRFLRDSPMIFSCLNLFVRQYVIINEFLTATL
FT                   TSFGSELLLSGIFDPDEQRRKEPWKGRKKKCGKNIPEKSYLYPETTGFPVRLLINETPH
FT                   "
FT   gene            complement(116027..116800)
FT                   /locus_tag="Cpha266_0100"
FT   CDS_pept        complement(116027..116800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0100"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: plt:Plut_2080 succinate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64170"
FT                   /db_xref="GOA:A1BCP3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCP3"
FT                   /protein_id="ABL64170.1"
FT                   /translation="MNFTLKIWRQSNTKAKGGLVTYNVADISAECSFFEMLDILNQQLI
FT                   TSGNDPVSFDHDCREGICGTCSLYINGRPHGPLKGITTCQLHMRSFSDGDTITIEPWRA
FT                   KAFPIVRDLIVDRSALDKIIQAGGYISVNTGGIPDANTLPVQKERSDASFDAAACIGCG
FT                   ACVAACPNASAMLFAGAKVSHLSLLPQGKIEAARRVRNMVACMDELGFGNCSNSYACEA
FT                   ECPKGISVSVIARMNREFLGAKLFSEKDKAIRNAL"
FT   gene            complement(116807..118783)
FT                   /locus_tag="Cpha266_0101"
FT   CDS_pept        complement(116807..118783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0101"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: plt:Plut_2081 succinate dehydrogenase;
FT                   TIGRFAM: succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunit; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64171"
FT                   /db_xref="GOA:A1BCP4"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011280"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCP4"
FT                   /protein_id="ABL64171.1"
FT                   /translation="MKALFNDKHDSLMIPLAAGIPEGPISEKWTSYKSGARLVNPNNKR
FT                   KLDIIVVGTGLAGASAAATLGQLGYRVKVFCYQDTPRRAHSIAAQGGINAAKNYQNDGD
FT                   SVYRLFYDTIKGGDYRAREANVYRLAEVSREIIDLCVAQGVPFAREYGGLLANRSFGGA
FT                   QVSRTFYARGQTGQQLLLGAYGALSRQIAAGTVTLYNRRDVLDMVIEEGKARGIIARNL
FT                   VTGEIESHSAHAVVLASGGYGNVFYLSTNAMGSNVTPAWSAYKKGAFFANPAFTQIHPT
FT                   CIPVHGDFQSKLTLMSESLRNDGRIWVPTDKAIAEKLRKNEITPLDVAEKDRDYYLERR
FT                   YPAFGNLVPRDVASRAAKERCDAGNGVGITGMAVYLDFADAIKRKGHDTIDALYGNLFQ
FT                   MYEQISADDPYKTPMKIYPAVHYTMGGLWVDYNLMTTVPGLFSIGECNFSDHGANRLGA
FT                   SALMQGLADGYFILPYTIGNYLASEIHTPRIETGCSAFELAAQSVNDRLSRLMHTGGKQ
FT                   SVDYFHRKLGLIMWEYCGMARTREGLIKALDLINELKTAFALDVRIPGGMQEYNPELEK
FT                   ACRVADFIELGELMVRDALQRNESCGGHFREEFQTPEGEALRNDEEFAFVGAWMYNGPD
FT                   TKPSLHRENLQFSEIKLSQRCYK"
FT   gene            complement(118798..119526)
FT                   /locus_tag="Cpha266_0102"
FT   CDS_pept        complement(118798..119526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0102"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase (or fumarate
FT                   reductase) cytochrome b subunit, b558 family; KEGG:
FT                   cte:CT2268 succinate dehydrogenase, cytochrome subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64172"
FT                   /db_xref="GOA:A1BCP5"
FT                   /db_xref="InterPro:IPR011138"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCP5"
FT                   /protein_id="ABL64172.1"
FT                   /translation="MVLPSPAGKTFLCSFSSEKTIVMNKSALLSSITKKVVMALAGLFL
FT                   ATFLFVHLFINLMLLLDDGGQAFTTAASFMGTNPVIRIFEQVLFAGFLLHIVFGILVSI
FT                   QNRQSRPVSYSYSNRSDTSFLSKYMFHSGIVVLIFLLLHFFDFYFIKVGLVAPPPGVEA
FT                   HDFYHRSILLFSNNLYASFYLISFLFLGFHLNHATQSAFQSMGWNHSRYTGALKVIGTI
FT                   YAVVISGGFMAIPIFFLLFR"
FT   gene            complement(119559..120194)
FT                   /locus_tag="Cpha266_0103"
FT   CDS_pept        complement(119559..120194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0103"
FT                   /product="Kynurenine formamidase"
FT                   /EC_number="3.5.1.9"
FT                   /note="PFAM: cyclase family protein; KEGG: cch:Cag_1936
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64173"
FT                   /db_xref="GOA:A1BCP6"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCP6"
FT                   /protein_id="ABL64173.1"
FT                   /translation="MNIIDLTHSLEPGMPVYPGTPPPLFQELFSFADQGFRERQITLTT
FT                   HTGTHLDVPSHILERGDDLDSFSVQHFAGPAAVISLNCSPTTRLAIGDLEAHLPSLRGC
FT                   DFLLLSSGWSRYWGSEKYFTGYPVLSMEAASALAGLGLKGIGVDMISVDDPDAHDLPVH
FT                   RIFLEKRIILVENLANLEQLPPVGFDFFCMPLKLSHSEASPVRAIAII"
FT   gene            120331..120849
FT                   /locus_tag="Cpha266_0104"
FT   CDS_pept        120331..120849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT0059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64174"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCP7"
FT                   /protein_id="ABL64174.1"
FT                   /translation="MQYFMNLRSAGRLLTVVGFLLPLLSCGKSPEEKLMEKVIEHSTGQ
FT                   KVDIDADGNKLTIESDGQKMEFQQQQKGVWPADIPSDVPEFSRGKIVAVTRASIPENES
FT                   WSVVYEDVKTSDIKEYEPRLKERGFTTSATFFSSDEGEHGTVSGQKGKLNVAVMAGSGK
FT                   ASLSVVSEK"
FT   gene            120911..121306
FT                   /locus_tag="Cpha266_0105"
FT   CDS_pept        120911..121306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0105"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   plt:Plut_2076 Hit family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64175"
FT                   /db_xref="GOA:A1BCP8"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCP8"
FT                   /protein_id="ABL64175.1"
FT                   /translation="MIAMHNSFYNPDCLFCRIAAGEIPADIVYRDEHVLAFRDINPAAP
FT                   EHLLIIPLKHIASLNELQSEDKEIAGHLLLAAGEVARRAGLYDSGYRMVFNTGADALQS
FT                   VFHIHGHLIGGCRMGWPPFPGEVVGHG"
FT   gene            121365..124133
FT                   /locus_tag="Cpha266_0106"
FT   CDS_pept        121365..124133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0106"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /note="TIGRFAM: aconitate hydratase 1; PFAM: aconitate
FT                   hydratase domain protein; KEGG: dge:Dgeo_1682 aconitate
FT                   hydratase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64176"
FT                   /db_xref="GOA:A1BCP9"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCP9"
FT                   /protein_id="ABL64176.1"
FT                   /translation="MRSQKDPSGVTRSLQTGDGTVLYCSLSALETSGFGAVSRLPKSMK
FT                   VLLESALRNVDDETVRQSDVMLLAEGACAGVKAVEVPFKPARVLLQDFTGVPALVDLAS
FT                   LREACLLSGGDPERINPVVPCDLVIDHSLQVDAYGTSDALKINLDLEFDRNRERYAFLK
FT                   WAERAFRNFRVVPPGTGIVHQVNLEYLSRVVCVENGIAFPDSLVGTDSHTTMINGLGVT
FT                   GWGVGGIEAEAVMLGQPVYLLRPSVTGVRVHGELVAGVTATDLVLTMTERLRRVGVVND
FT                   FVEFFGPGLDLLSLPDRATIANMAPEYGATMGFFPVDAVTLDYLHMTGRGSCCDLVERY
FT                   SKEQGLWRDPASDPLFTRVVDFDLGTVVPSVAGPGRPQDRIALSMVKESWLRGFAELYG
FT                   RQPKVRFPGARVMDNEEGKFFLPDAKPEGDGAGEGRHGFSLDDGAVVIAAITSCTNTSN
FT                   PSVMIAAGLLAKAAVSRGLAVKPWVKTSMAPGSRVVSDYLEQSGLAVPLDALGFNIIGY
FT                   GCTTCIGNSGPLPENVARAIDAKGVVAAAVLSGNRNFEGRIQSQVRANYLMSPPLVVAY
FT                   AIAGTMAIDLLTEPMGTDHDGIPVYLRDLWPTQGEVNSVRERSVRQKMYADNYNDVFKG
FT                   TTQWAEIPASEECLYRWDERSTYICRPPFLDRVAEVPPIPAPVLGARCLVLFGDSITTD
FT                   HISPAGSIGASRPAGLYLQSLGVPPGEFNSFGSRRGNHEVMTRGTFDNIRIRNRLAPGM
FT                   EAGMTTWFSSDGSRREAMPIFDAAMRYLAENVPLVVIAGRDYGMGSSRDWAAKGTLLLG
FT                   VRAVVARSFERIHRANLVRMGVLPLEFADAGSPESIGLKGDEFFEIPLGGTITPRERIT
FT                   VTATDPLSLEKKQFSVISRIDTPVEADYFRNGGILPAVLRKILKDEHKTEG"
FT   gene            124222..124515
FT                   /locus_tag="Cpha266_0107"
FT   CDS_pept        124222..124515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0107"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: plt:Plut_2075
FT                   ferrous iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64177"
FT                   /db_xref="GOA:A1BCQ0"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCQ0"
FT                   /protein_id="ABL64177.1"
FT                   /translation="MNLSELQVGDKAEVTAVKAESAVRRRILDMGLIKGTCFKVLRVAP
FT                   LGDPMEIYFKGMYLSLRKKEAEGILVIKTGEHGDGVPMSRNRKTCCSAGDGG"
FT   gene            124512..126650
FT                   /locus_tag="Cpha266_0108"
FT   CDS_pept        124512..126650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0108"
FT                   /product="ferrous iron transport protein B"
FT                   /note="TIGRFAM: ferrous iron transport protein B; small
FT                   GTP-binding protein; PFAM: GTP-binding protein,
FT                   HSR1-related; Ferrous iron transport protein B domain
FT                   protein; Ferrous iron transport B domain protein;
FT                   nucleoside recognition domain protein; KEGG: cch:Cag_1929
FT                   ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64178"
FT                   /db_xref="GOA:A1BCQ1"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCQ1"
FT                   /protein_id="ABL64178.1"
FT                   /translation="MIEKKGISVALAGNPNCGKSSLFNVLTGARQKVGNFSGVTIEKHE
FT                   GFLDFKGYSLKVVDLPGIYSLTPYSPEEIVTRRYLIDEKPDVVVNVIEGPNLERNLLLT
FT                   TQMMEMEVDFVVALNMIDEVEEKGISIDVKQLQKLLGCHIIPTSAKKKTGIDSLLDHVV
FT                   RAYRKDIDLKKNKLSFRPEVEESVHAIAALLMHQPELERFNPRWLAIKLLENDREVYHQ
FT                   VQQLPVWIKVELLLQDAIRIAARLFDSDPEVLITEDRHAFIRGAMKECVRQRSPERATM
FT                   TDVIDSVVLNRVLGLPIFLFVVWAMFQLTFTLGSPLMDGLEYLFGLLGSSIEPYLGNKI
FT                   LKSIIIDGIIAGVGGVLVFLPNIVLLFIALSFLEASGYMARAAFVIDKVMHRIGLHGKS
FT                   FIPMITGFGCSIPAIMATRTLKSPTDRLTTILVIPFMSCGAKLPVYVLLAGAFFPPDVA
FT                   ANVLFGIYMLGIGVGLWTAWLLKSTVLKSDSEPFVMELPPYRWPALHAVFFQAKVKAMM
FT                   YLKKAGTLILGAVMLIWGVSNYPRNPVLDQWLASETSRIGALHMTPVEKTSAIDAVRQQ
FT                   VQADQLEYSVAGRAGKMIEPLIKPLGFDWRIGIALVTGLVAKEVVVSTMGTIYALGQTD
FT                   ESSAELKSILKNDPGFSQATALSLMVFVLLYIPCVAAVGVMKKEIGRWKPVLLYSVYVL
FT                   AVSWILSFVTYRLALILL"
FT   gene            complement(126637..129036)
FT                   /locus_tag="Cpha266_0109"
FT   CDS_pept        complement(126637..129036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0109"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.6.2.2"
FT                   /note="KEGG: cte:CT0055 DNA topoisomerase I; TIGRFAM: DNA
FT                   topoisomerase I; PFAM: TOPRIM domain protein; DNA
FT                   topoisomerase, type IA, central domain protein; DNA
FT                   topoisomerase, type IA, zn finger domain protein; SMART:
FT                   DNA topoisomerase I, ATP-binding; DNA topoisomerase I,
FT                   DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64179"
FT                   /db_xref="GOA:A1BCQ2"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCQ2"
FT                   /protein_id="ABL64179.1"
FT                   /translation="MALKSPAASARNRTLIVVESPSKAKTINKYLGDKYTVFASVGHIK
FT                   DLPKKEIGLDFDHHYEPRYEVIAGKEKVVRQLKKLADESNEILIATDPDREGEAIAWHI
FT                   ANEVEFAHKPVFRVLFNEITKTAIIAAIQQPRQIDYRLVRSQQTRQGLDKIVGYKISPF
FT                   LWNVVLRGLSAGRVQSVALRLICEREAEINGFQIQEYWSIAADFKTDLNETFRTKLIKI
FT                   KGDKPELSNQKKAETAAAEISERLFAVKEITTRVQQRKPPFPFTTSLLQQAASNQLGFG
FT                   SQKTMRIAQQLYEGIELGDEGATGLITYMRTDSIRIGTEATAEARNYITAQFGKEYVGY
FT                   GGAAKAGKNAQDAHEAIRPTSLLRKPESVKHFLSSDQFRLYELIWRRLLTAMMAPAKIE
FT                   QTRVDVEDREKEFTFRANGSRVLFAGFMRVYDDQQELDYEAQSSTRDDVEKEQTVQLPE
FT                   KLKEQDKLGLAGLDSKQSFTRPPARYSEATLVKDLDNYGIGRPSTYASIFSTLQDRRYV
FT                   ELQKKKIIPTELGKDVSLILVANFPELFNVGFTAHMEDELDKVASGDDEYEAVLEKFYR
FT                   PLETALSLRKSDPIIPQNSATETCDKCGKGQMTVKWTASGKFLGCSRYPSCKNIKPLSS
FT                   SKAKPKDTGIQCPSCKEGHMLLRDGRLGPFLACSSYPKCNTLLNLGKQRQVEPMKIPPL
FT                   LTTLVCPKCGAPMNLRSGKRGLWLGCSKFPKCRGRLAWGTLDEEVQRHWETLMTEHQKA
FT                   HPTVALTMIDGRPVPLTLSVDDIITRAEEAGLIAAVPEEQQELTAE"
FT   gene            129197..130975
FT                   /locus_tag="Cpha266_0110"
FT   CDS_pept        129197..130975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0110"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="PFAM: cell wall hydrolase/autolysin; KEGG:
FT                   plt:Plut_2072 N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64180"
FT                   /db_xref="GOA:A1BCQ3"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCQ3"
FT                   /protein_id="ABL64180.1"
FT                   /translation="MVTGFVIRQYFLFIIMSSFGFRLFRLFFCQLCLVLALVSMALLDA
FT                   EGVVRPESATLSLQVSKGNGEGYRIKVFALRKAGNILIDVESFARALRLGFRQSNGFLV
FT                   IDEAETLSGSSCQLRDGNNFVSIVSKDPRQEPGTMQLQATPVQIASKLYLPVSQACRFF
FT                   SLWLQREVRYDPATGLISAILWGERPAYSLKKFSSSIQDEPEPVGSNGKRAASSEALTV
FT                   ISGVSVENRENGALISFSAVGNSVRTLLMKPDKNGIAYLTFQNATGNVDEMTKSFGVGI
FT                   VQAVKAKRFQKGGFQVALSMDNRSYRINSMEVKRDDINNRYLVYVAGEPDTGGGGMREK
FT                   ESQISRVIERDIEKWKFDTVVLDAGHGGKDPGAIGGHGTMEKDVVLNIVRDLGSIIARQ
FT                   WPDIKVVYTRNSDVFIPLHERGKIANRSGGKLFVSIHCNANSKSHIRGQEVYILGPHRT
FT                   QKSLEVAMFENSVITREADYRERYKGFSTEYLIMSSMAQNAFAKQSTTLAQDVLKRIER
FT                   KGGTTSRGVHQAGFMVLWTPSMPSILIETGYLSNPEEERILRERKEQIRIAEAVFQGLD
FT                   RYRRNNETARLSAVER"
FT   sig_peptide     129197..129334
FT                   /locus_tag="Cpha266_0110"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.604) with cleavage site probability 0.361 at
FT                   residue 46"
FT   gene            131086..132072
FT                   /locus_tag="Cpha266_0111"
FT   CDS_pept        131086..132072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0111"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="KEGG: cch:Cag_0077 biotin--acetyl-CoA-carboxylase
FT                   ligase; TIGRFAM: biotin--acetyl-CoA-carboxylase ligase;
FT                   PFAM: biotin/lipoate A/B protein ligase; Helix-turn-helix,
FT                   type 11 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64181"
FT                   /db_xref="GOA:A1BCQ4"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCQ4"
FT                   /protein_id="ABL64181.1"
FT                   /translation="MNQISSSILHHLRLSGGFLSGEDISVSLGITRSAVWKHIGALRRE
FT                   GYRIDAVSGQGYRLFSLSGRPVHEEVSPWLTTRFIGRDLHYHELLESTNFSARVLAGTG
FT                   TREGSVVVADAQSGGRGRMMRSWVSPGGVNLYFSLILRPRVPGIRVPQLTLLAAAAVHQ
FT                   ALCSCVPEIASRIKWPNDIMVGEKKLCGVLCEMQSEPDMTHFVIIGIGINVNIGEFPDE
FT                   LRNIATSLFLESGRMVSRPELLASVLNHFESLYEAWLLHDDLGFVLPYLHEYSLVYRRQ
FT                   VIIRQTTGDVCGTVSGIARGGELMLDLDDARTVLISSGDCLLCRQSP"
FT   gene            132085..133098
FT                   /locus_tag="Cpha266_0112"
FT   CDS_pept        132085..133098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0112"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: plt:Plut_2070 biotin synthase; PFAM: Radical
FT                   SAM domain protein; biotin and thiamin synthesis
FT                   associated; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64182"
FT                   /db_xref="GOA:A1BCQ5"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BCQ5"
FT                   /protein_id="ABL64182.1"
FT                   /translation="MTRMRPVPLHPDILQAYAVLETGEPVCRELAFALGELHGPDVLDL
FT                   ASLAHKVKLRHGGSSGSIHACSIMNARSGVCSENCRFCAQSAHHQAAIDVYGLVDVDAV
FT                   LFHARQTASEGISHFGIVTSGFGYKTLSKEFRQILAMIDRLHQELPDLEICASLGVLGE
FT                   EPALELARHGIAQYNINIQVAPRRYGELIADTHSVDDRIDTIKRLRRNNIDVCCGGIIG
FT                   VGEQMKERVEMIFAFADLDVSVIPLNILVPIDGTPLEGSPGIPLDDIVKTFALCRLVHP
FT                   RKIIKIAAGRETVMKDFQGLLMLSGADGLLTGGYLTTRGRATADDRMFMRQLQWFN"
FT   gene            133086..134270
FT                   /locus_tag="Cpha266_0113"
FT   CDS_pept        133086..134270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0113"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="PFAM: aminotransferase, class I and II;
FT                   aminotransferase class-III; KEGG: cch:Cag_0079
FT                   8-amino-7-oxononanoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64183"
FT                   /db_xref="GOA:A1BCQ6"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCQ6"
FT                   /protein_id="ABL64183.1"
FT                   /translation="MVQLSGSMMPIRESIERELLALRQKGRYRELPSVTQRSGNRIRIG
FT                   GKLLLNLSSNDYLGLGDRREMLDRYLVTLREAGYAMTSSSSRLLTGNHPLYGELEQTLA
FT                   DLYGREAALVFNSGYHANTGILPALSTRHDLILCDRLNHASIIDGLMIAAAPYIRYRHG
FT                   DYQHLEELLSDAAGRYRQLFIISESVFSMDGDLADLERLVALKKRYGAFLIIDEAHGVG
FT                   VFGQKGLGLCEVAGMVEGIDMIVGTFGKAFASVGAYAVMDTLFREYLINTMRPLIFTTA
FT                   LPPAILGWSLAVVRQQAVMSDERNRLQALAARLRNALRERGLAVAGESQIVPVVAGGDR
FT                   QAVLLAEKLAAAGILALPVRPPTVPENSARLRLSLRADLQWEDIESVPELLQGL"
FT   gene            134275..134961
FT                   /locus_tag="Cpha266_0114"
FT   CDS_pept        134275..134961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0114"
FT                   /product="protein of unknown function DUF452"
FT                   /note="PFAM: protein of unknown function DUF452; KEGG:
FT                   plt:Plut_2068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64184"
FT                   /db_xref="InterPro:IPR007398"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCQ7"
FT                   /protein_id="ABL64184.1"
FT                   /translation="MKTAWISRTGELELLLFFAGWGMDSALAEHLWAHDDKEGFGMDIL
FT                   AFHDYGSLEISPGIREHFESYSKITLIAWSLGVWAAAHAALPRVDRAVALNGTLRPLSE
FT                   RYGISPEVFFATHAGWSEQNRTRFYRRMCGSGEALDHFLSMAPLRSPADQKEELGFLGE
FT                   SLIASENSPLPWGYDQIIIGDRDMVFPFQRQVIAWDGFGVSLVEGMPHFPFFHLKSFRE
FT                   VLLCCK"
FT   gene            134949..135731
FT                   /locus_tag="Cpha266_0115"
FT   CDS_pept        134949..135731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0115"
FT                   /product="biotin biosynthesis protein BioC"
FT                   /note="TIGRFAM: biotin biosynthesis protein BioC; PFAM:
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   plt:Plut_2067 biotin biosynthesis protein BioC"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64185"
FT                   /db_xref="GOA:A1BCQ8"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCQ8"
FT                   /protein_id="ABL64185.1"
FT                   /translation="MLQVIDKGLVRERFSRTLHSYGSNAPVQNAMAVELARLICREEPT
FT                   CRFERVLEVGAGTGALTAELLKRCRISLYVANDLVGESLRYISREIEPWQPEAFRFLEG
FT                   DVETLTELPDRLDLVLSNAALQWLSDLEGFFRRVSALLKPGGLFAFTTFSARNMEELSS
FT                   IQKVGLAYPTALDIERFASGSFTPLLIREDRKRLEFASPEEVLRHLSRTGVNGISRHAW
FT                   TKSSYERFLHRYRQEFSSGGKVYLTYNPLYCCFRKRLS"
FT   gene            135728..136402
FT                   /locus_tag="Cpha266_0116"
FT   CDS_pept        135728..136402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0116"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG: cch:Cag_0082
FT                   dithiobiotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64186"
FT                   /db_xref="GOA:A1BCQ9"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCQ9"
FT                   /protein_id="ABL64186.1"
FT                   /translation="MKGSVTAISGIGTGVGKTVVTGLLAQGLQKCDRKVVTQKIVQTGC
FT                   TGISSDILEHRRLMGSSLIDVDYEGVTCPYSFGYPASPHLAARLEGAAVEVMTLRRATF
FT                   TLQKQFDHVLLEGVGGLLVPLAPDLLFADYIRDAGYPLILVTATGLGSINHTLLSLEAC
FT                   IARRITLKAVICNRFGEIDTLIGDDTVEMTRHYLKKYGLRAPLFTLVGDTLDCGCIESL
FT                   FL"
FT   gene            136426..137730
FT                   /locus_tag="Cpha266_0117"
FT   CDS_pept        136426..137730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0117"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   cte:CT0047 adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64187"
FT                   /db_xref="GOA:A1BCR0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCR0"
FT                   /protein_id="ABL64187.1"
FT                   /translation="MTLPLPVIDLAFDRSHIWHPYTSLADPLPVYPVTGARGVYLELAD
FT                   GRRLVDGMSSWWAAIHGYNHPVLNQAVTTQLERMSHVMFGGLTHEPAITLAEQLAELTP
FT                   EPLQKVFFSDSGSVSVEVAIKMAIQYWATLGETRKTRLLTVRSGYHGDTFAAMSVSDPV
FT                   TGMHRLFSGVLQRQIFAESPSCAFHDPWNEECIGDLRRKLERHADEIAAVIIEPVVQGA
FT                   GGMRFYAPRYLGRLRELCDEFGVLLIFDEIATGFGRSGKLFALEHAEVSPDILCVGKAL
FT                   TGGYMTLAATLTTGVVAETISSGNPGLFMHGPTFMANPLACAVAAANIRLLLSYDWKSK
FT                   VAGIERGLESALSPCRTMEGVVDVRVLGAIGVVELENPVEMGLIQKKFVDRGVWVRPFG
FT                   RLVYLMPPYIITDEELGLLADAVTEVVYETLAESR"
FT   gene            complement(138482..138694)
FT                   /locus_tag="Cpha266_0118"
FT   CDS_pept        complement(138482..138694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0118"
FT                   /product="protein of unknown function DUF1458"
FT                   /note="PFAM: protein of unknown function DUF1458; KEGG:
FT                   cte:CT2229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64188"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCR1"
FT                   /protein_id="ABL64188.1"
FT                   /translation="MSSHIYKKIELVGSSPTSIEEAVNNAIEKASESIRNIRWVEILET
FT                   RCHVENQKLMYWQVTVKIGFTLDDN"
FT   gene            139074..140627
FT                   /locus_tag="Cpha266_0119"
FT   CDS_pept        139074..140627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0119"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; Polysulphide reductase, NrfD; KEGG: cch:Cag_1965
FT                   Fe-S-cluster-containing hydrogenase components 1-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64189"
FT                   /db_xref="GOA:A1BCR2"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCR2"
FT                   /protein_id="ABL64189.1"
FT                   /translation="MNYGFVIDARKCIGCHACTVACKSENQVPLGVNRTWVKYVEKGSF
FT                   PETRRYFTVLRCNHCAEPPCVAICPVEALQKREDGIVDFDGRRCIGCKACAQACPYNAL
FT                   YIDPETHTSAKCNYCAHRKEVGLQPACVAICPQQAIVSGDLDDPSSKIAALVAGEQTVV
FT                   RKPEKGTSPKLFYINGDGASLDPLQVSLEKEYHWSAQARGVGHFADKQKGAPAIEKPHH
FT                   EAPATGPAMRRVYDIPSKGAVWGWEVPAYVSAKAVSSGVFLLFFALTALLGQELSGMMQ
FT                   WAAWATSLVFLGLTGGFLIKDLDRPDRFSSVMLRPQFGSWLVKGGLTITGYGAFLALWG
FT                   ASRFLQIPALERVALWGGALFALITAIYTAFLFGSAKGRDFWQSPMLLLHMLLNALLAG
FT                   GSTMLLLGFGTGASVELFALLKQLLAAGFSLHLVIMLLELYGKHPSLQAERTAEIIRSG
FT                   SLKNEFWIGSFIAGNLLPLILSILSSDPLMLAAAAILGLCGVFYTEKVWVQAPQRVPLS
FT                   "
FT   gene            140647..143508
FT                   /locus_tag="Cpha266_0120"
FT   CDS_pept        140647..143508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0120"
FT                   /product="Formate dehydrogenase"
FT                   /EC_number="1.17.1.9"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: plt:Plut_0027 molybdenum enzyme related
FT                   to thiosulfate reductase and polysulfide reductase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64190"
FT                   /db_xref="GOA:A1BCR3"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCR3"
FT                   /protein_id="ABL64190.1"
FT                   /translation="MSYTHKPTVIESIAEKLHLIPDLHKENVRDGARRAAEEGSEISCP
FT                   PPSQWDNWVEYDSKSWPERKATEYMLVPTACFNCEAGCGLLAYVDKENMKIRKLVGNPY
FT                   HPASRGRNCAKGPATLNQIEDSDRVLYPMKRTGKRGEGKWARVTWDSVLDDIAGRMRKA
FT                   ILEGRNNEISYHVGRPGHDGFMEWILRAWNVDGHNSHTNVCSSGARFGYAIWEGFDRPS
FT                   PDHANAKFILLVSAHLESGHYFNPHSQRIIEARMKGAKLAVLDPRLSNTASMSDYWMPS
FT                   YPGSEPAILLAMAKIIIDEGIYNRDYLENWVNWQAYLQTEYPGTPVTFENFIDALKKEY
FT                   SEYTPEYASKESGVDAAAIVEVARKIGEAGTQFSTHVWRSASSGNLGGWAVSRTLHFLN
FT                   VLTGSVGTPGGTSPSAWNKFKPTVHAEPKPQTYWNTLQLPDEYPLAHFEMSFLLPHFLK
FT                   EGRGKLDVYFTRVFNPVWTYPDGFSWIEALEDESKIGLHAALTPTWSETAYFADYVLPM
FT                   GHSAERHDLLSYETHAGKWIAYRQPVLRTALKRMGKPVKYTWEANPGEVWEEDEFWIEL
FT                   TWRIDPDGTMGIRQYCMSPYRPGEKITIEEYYRYVFEHTHGLPEKAAEEGLTAYDYMQK
FT                   YGAFEVESNVYSLNEKPVAPADLQGSEVHQQSGLITKNGKAVGVEVNGRSCTGFPTPSR
FT                   KQEFFSQTMVDWKWPEYRVPGYIKSHIHQEIMNRSKGEFVLVPTFRLPVLIHSRSGNAK
FT                   WLAEIAHRNPVWINAADGAALHIENGDLIRVNTDIGFFVNRAWVTEGIRPGVVACSHHI
FT                   GRWRRDQDPEANRWATNRVQISKEGKGKWKMRVEESIQPYESNDPDSSRIFWSDGGVHQ
FT                   NITFPVHPDPISGMHCWHQKVRIEKAQDGDCYGDVFVDTERSFAIYKEWLAMTRPAPGP
FT                   GGLRRPLWLNRPFRPDEKTYYLQ"
FT   gene            143666..144622
FT                   /locus_tag="Cpha266_0121"
FT   CDS_pept        143666..144622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0121"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   cte:CT0859 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64191"
FT                   /db_xref="GOA:A1BCR4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCR4"
FT                   /protein_id="ABL64191.1"
FT                   /translation="MSSAAKKLLLKTAGTAGASILFFIIPGILYAFPADQTGQMAWWVW
FT                   VILLFAFSFILGIFSVLAGVGGGVLFVPIVSGFFPFHLDFIRGAGLVVALTGALSAGAP
FT                   LMRKGLADLKLGLPMALVGSISSIAGALAGLAMPVAMVQLLLGLSIMFIAGIMIKSGKS
FT                   GYPEVKEPDTLSKILHISGIYHDEAMSKDIAWQIHRTPIGLFLFMIIGFIGGMFGMGAG
FT                   WANVPVFNLLMGVPLKVAVATSGLVLSINGAAAAWIYIFKGALLPLIAVPAVAGIMLGS
FT                   KIGAGLLTKVNTRSVRLIVISMLLLAGLRSLLKGFGI"
FT   sig_peptide     143666..143761
FT                   /locus_tag="Cpha266_0121"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.997 at
FT                   residue 32"
FT   gene            144619..145047
FT                   /locus_tag="Cpha266_0122"
FT   CDS_pept        144619..145047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT0860 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64192"
FT                   /db_xref="GOA:A1BCR5"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCR5"
FT                   /protein_id="ABL64192.1"
FT                   /translation="MKDTNREKPDEGDVQFVYAKVLDFVSHAGMVFIAAGYLIYVMQLL
FT                   PLSVSIRAVADNWHLSASDMQQKLHVPSGWSFMGSMADALHGDVVSYMSILFLCMATIL
FT                   CLVFAVKVFFREKNYIYTAITFLQALVLLVAASGVISR"
FT   gene            145415..145924
FT                   /locus_tag="Cpha266_0123"
FT   CDS_pept        145415..145924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0123"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_0031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64193"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCR6"
FT                   /protein_id="ABL64193.1"
FT                   /translation="MAETKKLAIIASQGTLDWAYPPFILASTAAAMDMEAVIFFTFYGL
FT                   PLLKKEIDAKVAPHTNPAMPMKMPFGSKEFQSYNWPIPNFISGNVPGFDSMATSLMKET
FT                   FKKKGVATIEQLRGMCQEFGVRFIACQMTMEVFGFEKEEFIEGVEYGGAATFLEYAADA
FT                   NISLFI"
FT   gene            146008..146487
FT                   /locus_tag="Cpha266_0124"
FT   CDS_pept        146008..146487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0124"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: cte:CT0843
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64194"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCR7"
FT                   /protein_id="ABL64194.1"
FT                   /translation="MRRFIELIRNCLTDVREIMPWELVDRMRLNPELMILDVREPAEFD
FT                   AMHISGSLCVPRGILESACEWDHDETVPELVKAREREIVVVCRSGHRSVLAAHSMQVLG
FT                   FEDVVSLRTGLRGWNDYEEPLRNSAGEVVDSEVADAFFTSKLREDQKRPAEKHQA"
FT   gene            146655..146891
FT                   /locus_tag="Cpha266_0125"
FT   CDS_pept        146655..146891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0125"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: cte:CT0847
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64195"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCR8"
FT                   /protein_id="ABL64195.1"
FT                   /translation="MSDIASNMDLNCEGLNCPLPILKTKKAVDGLQSGEVLKMTATDPG
FT                   SINDMASWAKRTGNELVSHTEQAGVHTFYIRKK"
FT   gene            147068..148495
FT                   /locus_tag="Cpha266_0126"
FT   CDS_pept        147068..148495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0126"
FT                   /product="cobyrinate a,c-diamide synthase"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: cobyrinic acid a,c-diamide synthase; PFAM:
FT                   Cobyrinic acid a,c-diamide synthase; CobB/CobQ domain
FT                   protein glutamine amidotransferase; KEGG: plt:Plut_0034
FT                   cobyrinic acid a,c-diamide synthase CbiA"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64196"
FT                   /db_xref="GOA:A1BCR9"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCR9"
FT                   /protein_id="ABL64196.1"
FT                   /translation="MDAVTLPRLMISAAQKSSGKTTISLGLLSHLKSRGVAVRSFKKGP
FT                   DYIDPMWHKLASGSECYNLDPYLMGQEGCLDSFFKNSRNGNSDFCLIEGNHGLHDGLSL
FT                   DGSDSSAGLASMLKTPVLLVVDSRKTNRGVAALVMGMQAMQPQADIAGVILNQVQSARQ
FT                   AAKQKLAIEHYCKVPVFGAIPVDEELVIPERHLGLTTVGETADAAKFITGAAERLERYC
FT                   DMAAIRALFSMASPIGMPPLETRGINPVARARVGVFRDAAFCFYYPDNLAALQEHGAEL
FT                   IFIDSMSESSLPDIDGLYLGGGFPESFFDAISSRRGLLRDVRERVKSGMPLYAECGGLI
FT                   YLSRSAEYGGKRYDLAGVLPLDIGFQQRPAGHGYLDLRSSAESAWFKTGERIRAHEFHY
FT                   SRPLLSSGACSYQFEVLRGYGVTGERDGAVDNHVFASFAHVHALSTPGWAPKFVSLASI
FT                   YKDRCLSGWAVPPQRQD"
FT   gene            149068..149403
FT                   /locus_tag="Cpha266_0127"
FT   CDS_pept        149068..149403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0127"
FT                   /product="DsrC family protein"
FT                   /note="PFAM: DsrC family protein; KEGG: cch:Cag_1957
FT                   sulfite reductase, dissimilatory-type, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64197"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCS0"
FT                   /protein_id="ABL64197.1"
FT                   /translation="MAIVVNGVSCETDENGYLVNLEDWTEDVAKVLAEGEEIEMTEAHW
FT                   DLVKFLRGYYDEYQIAPAVKVLTKAIAAEKDMDKKNASEFLYGLFPKGPGLQACKIAGL
FT                   PKPTGCV"
FT   gene            149458..150711
FT                   /locus_tag="Cpha266_0128"
FT   CDS_pept        149458..150711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0128"
FT                   /product="dissimilatory sulfite reductase alpha subunit"
FT                   /note="KEGG: plt:Plut_0036 sulfite reductase,
FT                   dissimilatory-type alpha subunit; TIGRFAM: sulfite
FT                   reductase, dissimilatory-type alpha subunit; PFAM: nitrite
FT                   and sulphite reductase 4Fe-4S region"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64198"
FT                   /db_xref="GOA:A1BCS1"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011806"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCS1"
FT                   /protein_id="ABL64198.1"
FT                   /translation="MDGAEGAASKEVHHCNECGAHSGEKFLNPTPMLDELEKGPWPSFI
FT                   SGFKELAERTKKPMLRGVMDQLEYSYNTKMGYWKGGLVTVDGYGAGIITRYSMIKDKFP
FT                   EASEFHTMRIQPAPGLHYNTAMLRELCDIWEKYGSGLIALHGQTGDIMLQGIEQDKVQA
FT                   CFDELNQAGWDLGGAGAGMRTAVSCIGPGRCENACYDNLKLHLHALKHFVGVLHRPEWN
FT                   YKLKFKFSGCPNDCTNSIMRSDLAVIGTWRDAIQVDRDEVKAWIEKKGVDALVNQVINH
FT                   CPTKAISLKDGEMVIETRDCVRCMHCLNAMPKALSPGKDRGISLLMGGKNTLKVGVNMG
FT                   SLIIPFMKMESEEDIEAFIEQIEAIIDWWDDSGLDHERIGETIERVGLKQFIEGIGLEA
FT                   DINMVSRPRDNPYFKARY"
FT   gene            150794..151873
FT                   /locus_tag="Cpha266_0129"
FT   CDS_pept        150794..151873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0129"
FT                   /product="dissimilatory sulfite reductase beta subunit"
FT                   /note="KEGG: plt:Plut_0037 sulfite reductase,
FT                   dissimilatory-type beta subunit; TIGRFAM: sulfite
FT                   reductase, dissimilatory-type beta subunit; PFAM: 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain protein;
FT                   nitrite/sulfite reductase, hemoprotein beta-component,
FT                   ferrodoxin domain protein; nitrite and sulphite reductase
FT                   4Fe-4S region"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64199"
FT                   /db_xref="GOA:A1BCS2"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011808"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCS2"
FT                   /protein_id="ABL64199.1"
FT                   /translation="MSSPEKKWKTVESGPHTYEEALHPVVRKNYGKWKYHEIPKPGVLV
FT                   HVAESGDSLYTVRAGTPRQDTVDMIRRLCDIADKYCDGYLRFTVRNNVEFLTPKQENVE
FT                   PMIRELESMGLPVGGTGMCVSSVSHTQGWLHCDIPATDASGVVKSMMDTLYAEFRGMQM
FT                   PNKVRLSTSCCSINCGGQADIAVVVKHTRPPRVNHDHLAMICELPKAVARCPVAAIRPT
FT                   VVNGKRSLMVDEEKCICCGACFGACPAMEINHPEHSKFAIWVGGKNSNARSKPSTMSIV
FT                   AHNLPNNPPRWPEVTDAVGKILLAYKEGGRPWERIGEWINRIGWKRFFEETGLTFDEDM
FT                   IDSYRHARTTFNQSAHVRF"
FT   gene            151889..153625
FT                   /locus_tag="Cpha266_0130"
FT   CDS_pept        151889..153625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0130"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; 4Fe-4S ferredoxin, iron-sulfur binding
FT                   domain protein; KEGG: cch:Cag_1954 iron-sulfur
FT                   cluster-binding protein, GltD family"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64200"
FT                   /db_xref="GOA:A1BCS3"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCS3"
FT                   /protein_id="ABL64200.1"
FT                   /translation="MKVESNPILDYALNYEFPEFTELQGTEKIVAFGDHSHKCPVYVRQ
FT                   VPPCSAECPAGEDIRGYQRFLNGVEKSEDPWKSAWETIVDTNPFPAVMGRICPHPCQGG
FT                   CNRQYHDESVAINAVEQVVGNYGIEHNLQLPGPGEDTGKRVAVIGGGPAGLSAAYQLRR
FT                   KGHAVTIFDANEKLGGMVLYGIMGYRVDRAVLEAEIQRIISLGVETKMGVRIGTDITLD
FT                   QLEKEYDAVFVGIGAQVGRSLPITGSADTKGVTNAIDFLKNYEVEGDSIAVGKKVVVIG
FT                   DGNVAMDVARLALRLGSEAVLISGVPREEMACFANEFDDAIREGSAIHYMTGTVEVLKG
FT                   EEGVRGLLCSKMVKKEKGEEGWNSPIPFLRYKSTDETFEIPCDMVVAAIGQTTNMEGFE
FT                   SVAGDRPWLKVDRYFRLPGKENVFGGGDAIKVDLITTAVGHGRKAAMAIDAFVKGDSFA
FT                   EQGYREVAKVQKQDILYFYHSPQAKRETIELENVVGNHQELLEALSREEAKAESERCMS
FT                   CGLCFDCKQCVSFCPQEAVKRFRDNPPGEVVYTDYSKCVGCHICSLVCPSGYIQMGMGE
FT                   GL"
FT   gene            153669..154037
FT                   /locus_tag="Cpha266_0131"
FT   CDS_pept        153669..154037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT2246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64201"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCS4"
FT                   /protein_id="ABL64201.1"
FT                   /translation="MSEDLIRRVEEAIACSRNWAEKGWPVTFGSRNVAVSSLKEAKALP
FT                   SSFLYRQEALNYWNQARLMGNDAGDAGAKALDALKSGNMRAAHDALYLSQYIEKPLAEN
FT                   ARTWHPLYEAFTAEISSC"
FT   gene            154089..154448
FT                   /locus_tag="Cpha266_0132"
FT   CDS_pept        154089..154448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0132"
FT                   /product="DsrE family protein"
FT                   /note="PFAM: DsrE family protein; KEGG: cch:Cag_1952 DsrE
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64202"
FT                   /db_xref="GOA:A1BCS5"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017463"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCS5"
FT                   /protein_id="ABL64202.1"
FT                   /translation="MKIGILLKEGPYNHQASDTAYKFAEAAIKKGHTIDAVFLYNDGVG
FT                   NVTKMMDPPQDDRNIAARWDALSKQHGVEILACIAASKRRGINDDVIIEGGTITGLGTL
FT                   TDIAIRNDRLITFGD"
FT   gene            154452..154841
FT                   /locus_tag="Cpha266_0133"
FT   CDS_pept        154452..154841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0133"
FT                   /product="DsrE family protein"
FT                   /note="PFAM: DsrE family protein; KEGG: cch:Cag_1951 DsrF
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64203"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017462"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCS6"
FT                   /protein_id="ABL64203.1"
FT                   /translation="MGNMDIEENTDIKKIMHVMRHAPHGTIYSYEGLEMILIMAAYEQD
FT                   LSVVFIGDGIYALKKNQDTHAIGIKGFSKTFMALDGYDVEKLYVDRVSLEERGLTEDDL
FT                   VVPVEVLTSAEIGGLMREQDVIIHH"
FT   gene            154917..155210
FT                   /locus_tag="Cpha266_0134"
FT   CDS_pept        154917..155210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0134"
FT                   /product="DsrH family protein"
FT                   /note="PFAM: DsrH family protein; KEGG: cte:CT0857 DsrH
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64204"
FT                   /db_xref="GOA:A1BCS7"
FT                   /db_xref="InterPro:IPR007215"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCS7"
FT                   /protein_id="ABL64204.1"
FT                   /translation="MLHTINKSPFASDTFDTCGRFLLPGDPVLFIEDGVYAVQAGNRFS
FT                   SMIETIQKTNPVFALRPDLDARGIAAVDEGVTLVDYEGFVELVENHQVNSWL"
FT   gene            155257..155703
FT                   /locus_tag="Cpha266_0135"
FT   CDS_pept        155257..155703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_0043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64205"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCS8"
FT                   /protein_id="ABL64205.1"
FT                   /translation="MTKALDRVIQQNRKEILDRWHGQALALFSEKMARGTPIFDLLNES
FT                   MGMILDGFEEGSESCLEGVDSFARIFAVHPFPPSGSMRLFFELQFILAAFCPDEESRDA
FT                   MQTRIQAIMLDACDDFMAHREKIYQLKVEERQRSMYMALRRAEG"
FT   gene            155700..156695
FT                   /locus_tag="Cpha266_0136"
FT   CDS_pept        155700..156695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0136"
FT                   /product="putative sulfite reductase-associated electron
FT                   transfer protein DsrM"
FT                   /note="PFAM: Nitrate reductase, gamma subunit; KEGG:
FT                   plt:Plut_0044 DsrM protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64206"
FT                   /db_xref="GOA:A1BCS9"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCS9"
FT                   /protein_id="ABL64206.1"
FT                   /translation="MKKVLMPIVMVAVLGLIPFIGVTYAGLDYLFGVIIPYASVLIFIA
FT                   GFVYRLVDWLKRPVPFRITTTCGQEKSLDWIKQNKLDSPSRAWHAAFRVLFEVFFFRSL
FT                   FRNTRSELREGPSLVHGSSKWLWMGGLVFHWSLLVIGLRHARYFFVMVPDFIQLVEGAD
FT                   RFFDLALPAFYLTDALVLSAVTFLFVRRMSDAKMRIISLQTDYFPLFLITGIVLVGIIM
FT                   RYIVKVDVMPVKDQMLRLVAFNFEAPAPIGALFYVHLFLVCVLAVYFPFSKLMHMGAIF
FT                   LSPTRNLCNNSREKRHVNPWNAAIKFRTYTEYEDEYREKMKKAKLPVEKQ"
FT   sig_peptide     155700..155777
FT                   /locus_tag="Cpha266_0136"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.973 at
FT                   residue 26"
FT   gene            156698..158347
FT                   /locus_tag="Cpha266_0137"
FT   CDS_pept        156698..158347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0137"
FT                   /product="putative sulfite reductase-associated electron
FT                   transfer protein DsrK"
FT                   /note="KEGG: plt:Plut_0045 DsrK protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64207"
FT                   /db_xref="GOA:A1BCT0"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCT0"
FT                   /protein_id="ABL64207.1"
FT                   /translation="MSKYLPKLSDLKKDFEEKPSILKGDYSKKEWWDTPFEFRDGNWSF
FT                   PAKPEVVEELGFPNSRKWSALDQDWKLPADWQKTISEGLKVRLKKFRSLKLYLDSCVRC
FT                   GACADKCHFFLGTGDPRNMPVLRAELLRSVYRNDFPLVEKILKGFSGSRKLTAEVIKEW
FT                   HMYYYQCTECRRCSVFCPLGIDTAEITMVARELLNLIGVNNNWILAPVANCNRTGNHLG
FT                   IEPHTFVQNIESLVEDIEDMTGVRVNPTFNRKGAEILFITPSGDVFGDPGVYTMMGYLL
FT                   LFHHIGLDYTISTYASEGGNFGMFTSNDMMKKLNAKMYHEAERLKVKWILGGECGHMWR
FT                   VVHQYMNTMNGPADFLEVPVSPVTGTKFSNAAATKMVHIAEFTADLIYHKKLKLDPRRN
FT                   DHLKTTFHDSCNVARGMGMFEEPRFVLNNVCNSFHEMPENTIREQTFCCGSGSGINSEE
FT                   NMEMRMRGGFPRANAVRHVRNQHQVDSLVTICAIDRASLPALMKYWNPGVTVYGLHELV
FT                   GNALVMQGEKKRKEDLREHPMKGFDDEEGDVD"
FT   gene            158337..158732
FT                   /locus_tag="Cpha266_0138"
FT   CDS_pept        158337..158732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0138"
FT                   /product="putative sulfite reductase-associated electron
FT                   transfer protein DsrJ"
FT                   /note="KEGG: cte:CT2242 cytochrome DsrJ"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64208"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCT1"
FT                   /protein_id="ABL64208.1"
FT                   /translation="MSIKKNHIIFSLLALLLLAGSYAFMHVVQAADPVPPTPRPAASAA
FT                   IDSSKCIMPTAYMKANHMRVLHEWRNSSVRDGNRVHVAPNGSKFDKSLNTCLGCHANNR
FT                   LFCFNCHMYANVKPKCWNCHISPMETP"
FT   sig_peptide     158337..158429
FT                   /locus_tag="Cpha266_0138"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 31"
FT   gene            158732..159508
FT                   /locus_tag="Cpha266_0139"
FT   CDS_pept        158732..159508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0139"
FT                   /product="putative sulfite reductase-associated electron
FT                   transfer protein DsrO"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: cte:CT2241 polysulfide reductase, subunit B,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64209"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCT2"
FT                   /protein_id="ABL64209.1"
FT                   /translation="MNEQRRDFIRKTGLGVLAGLGVASGLFAESSFEKTVLPAWDEKPV
FT                   AGKIRWGMLVDTRTCNESCQECVLTCHHVHNVPDFGSRKDEVKWIWKSPYEKAFPTASQ
FT                   QFQNKETRDRSCLTLCNHCAESPCTKACPTEATFKRWDGIVAMDYHRCIGCRFCMAACP
FT                   YGSRSFNWQDPRMAIKNPSADYPTRMQGVVEKCNFCSERLVKGLKPACVESCPNQALTF
FT                   GDLNDPESDIRKLLENNQTMQRKPELGTLPSVFYII"
FT   sig_peptide     158732..158818
FT                   /locus_tag="Cpha266_0139"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.960 at
FT                   residue 29"
FT   gene            159518..160669
FT                   /locus_tag="Cpha266_0140"
FT   CDS_pept        159518..160669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0140"
FT                   /product="putative sulfite reductase-associated electron
FT                   transfer protein DsrP"
FT                   /note="PFAM: Polysulphide reductase, NrfD; KEGG: cte:CT2240
FT                   polysulfide reductase, subunit C, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64210"
FT                   /db_xref="GOA:A1BCT3"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCT3"
FT                   /protein_id="ABL64210.1"
FT                   /translation="MIEKALKGNRNYWLWIAFLCLVIGSGLFAYSQQRWFGLTVTGMGR
FT                   DVSWGLYIAQFTFLVGVAASAVMVVLPYYLHNQKAFAKTVIIGEFMAVSATMMCLLFIL
FT                   ADMGRPDRVLNVLLYPSPHAMVFWDVLVLNGYLVINFVSAWTVLGAERKGVPPPAWIKP
FT                   VIYLSIPWAVSIHTVTAFLYAGLPGRHLWLTAVLAPRFLASAFAAGTALLILVTLILKK
FT                   TTGFDAGKEAREKLAVLVIYAGLVNFFLIGTEFFTAFYSNVPAHMQSLQYLFFGLEGKS
FT                   QLVPWMWVSLLAGIGALAMLFSQKRKSSNLWLAAASGAMVLSIWIDKGVGLIIGGFVPS
FT                   PLEEIVEYSPTVTEIVITLGIWAIGTLLLTVLLKVAVAVKTMD"
FT   sig_peptide     159518..159607
FT                   /locus_tag="Cpha266_0140"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.984) with cleavage site probability 0.660 at
FT                   residue 30"
FT   gene            160906..161358
FT                   /locus_tag="Cpha266_0141"
FT   CDS_pept        160906..161358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0141"
FT                   /product="porphyrin biosynthesis protein, putative"
FT                   /note="KEGG: cte:CT2239 porphyrin biosynthesis protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64211"
FT                   /db_xref="GOA:A1BCT4"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCT4"
FT                   /protein_id="ABL64211.1"
FT                   /translation="MKIMKVFLPVNIRIDDKKILFVGGGSIAMHKMQTVEQYARNITIL
FT                   APRIDDKLKAKGFCEIRKEYEKTDLEGFFLVYACTNDLEVNRRIKKDAEELRVLVNVAD
FT                   NSELSDFISPAVFKLDEMTVAISSNGQNAKKSVEWRNRIKAMLQES"
FT   gene            161397..162785
FT                   /locus_tag="Cpha266_0142"
FT   CDS_pept        161397..162785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0142"
FT                   /product="uroporphyrinogen-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: plt:Plut_0050 uroporphyrin-III
FT                   C-methyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64212"
FT                   /db_xref="GOA:A1BCT5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCT5"
FT                   /protein_id="ABL64212.1"
FT                   /translation="MTKSDHSQRVDVSEKGYVYIIGAGPGDPELLTIKAERALQEADVL
FT                   LYDDLVSGELVDQFQGIKIYTGKRKDSHHFEQDEINSEIVRHALMGKKVARLKGGDPFV
FT                   FGRGGEEIEVLRKNGIRYEIIPGITAAYGASAYTEIPLTMRKISSSVAFCTGHPVNKIQ
FT                   VPDADTLVYYMVASTVHDVLDAVVSKGRSENTKVAIVQNATRYNQKIFTGTLGELRRRE
FT                   KAVYSPALLIIGDNINQFIEKNWFSGKRKVLLTGGDAKRYNAMEHIMVHFPCRQVDGAD
FT                   RERVKEYFDDFSPYSTLLFTSKFSVKYFFASLFEYGKDVRHLAAATICATGKAAALELQ
FT                   KHGVIPDLFFEPDGCADIVTMFRERGMTDEHILLPGSNLVDEYLVRELTTLRNRVTPLC
FT                   VYMHEAQEHAESIDLAFIDEIYFASPSCVNNFRTLYSSIPENITVTAADTRTEKEYRSL
FT                   FGES"
FT   gene            162814..163638
FT                   /locus_tag="Cpha266_0143"
FT   CDS_pept        162814..163638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0143"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   rpc:RPC_4497 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64213"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR014433"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCT6"
FT                   /protein_id="ABL64213.1"
FT                   /translation="MKRSKAVFKFSNSDPMKIAVSGKGGVGKTTISSLIALGLAEKGKK
FT                   VLAIDADPNGNLAEALGYNSGESGRITPLIERKALIEERTGARPGEMGGYFVLNPKVDD
FT                   FVERFSVPVGGLRTMVMGELKEALSGCYCAENALLRSFLRHLMVDRDEWVVLDMEAGFE
FT                   HLTRGTAQSVDLLLIVVEPGARSIATAHKLQRLALQSGIPRTGFLVNKLYSPSQKEQII
FT                   PELEGGEILASIPFDEMAVEADLAARSPFGSCSLMKESLRPLIEALSDNSTG"
FT   gene            164039..165280
FT                   /locus_tag="Cpha266_0144"
FT   CDS_pept        164039..165280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0144"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /note="KEGG: rpb:RPB_0308 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64214"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCT7"
FT                   /protein_id="ABL64214.1"
FT                   /translation="MSNEQKPTSRREFLRSSAFGLSAVLGGLPLIQGCSKESGQEKGAP
FT                   NIGTSGKKLKSSYLPITDATPIILAHELGFYKELGIDSEKPVLIRGWAPMAEAFMAGRF
FT                   NLTHLLAPIPIYMRYSKGFPVKVVAWDHINGSALTVGKESGIKSCADLGGKQIAIPYWY
FT                   SMHNIILQMIAREHGIEPVIQSKTAPLTSKQMNLFVMAPPDMPTAIASKAIDGYIVAEP
FT                   FNAAGEVLAGGRIVRFTGDVWKNHPCCVAVMNEKELEDKEWSHKVIQALVKAELWALNN
FT                   VEEAAHILSKDGAQYLPLPEKIVKRAMMKYDLETYGAGSGTGAIQNPDWHASRISYEPY
FT                   QFESATRHIVEMLKQTRVDGDAAFLKALDPGKVHKELMYTAGVEAAAAALGGLGQFAGV
FT                   NSASPLVREEVIKV"
FT   gene            165457..166257
FT                   /locus_tag="Cpha266_0145"
FT   CDS_pept        165457..166257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0145"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pau:PA14_34520 putative
FT                   sulfonate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64215"
FT                   /db_xref="GOA:A1BCT8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCT8"
FT                   /protein_id="ABL64215.1"
FT                   /translation="MAKQNDTSNKGSQEMTARLADRGFYLLGVVLFMIVWQIASALKLF
FT                   GADFSESFSPLAAMLALFEMIKNGELIHHALPSLRRVLTGLSLAVVVALPLGVLVGYFK
FT                   RIEQLTYVVFQFMRMISPLAWMPIAIIIFGVGDVAVIFLLWLVAIWPLILNTSHGAGRV
FT                   SPLWVNMAKTMGAKDSGILRKVIIPAAVPDMLTGLRLAVGVSWIILVPAEMLGVPDGLG
FT                   YFILDTRDRFRYDQLMATIMAIGMIGYLLDSANRWLIHKFSWKM"
FT   gene            166278..167090
FT                   /locus_tag="Cpha266_0146"
FT   CDS_pept        166278..167090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0146"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mja:MJ0412 putative taurine transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64216"
FT                   /db_xref="GOA:A1BCT9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCT9"
FT                   /protein_id="ABL64216.1"
FT                   /translation="MTSGRQVLISVQHVSKTYKKGGREFHALRDCTFDILKNEFLVVVG
FT                   PTGCGKSTLLNLLAGIEFPTSGSILLNGAPVTGPGADRGMIFQDYALLPWRSVLKNAEL
FT                   GFEFMKKPMKGDQIKAEAMRYLEMVGLGYAVNKHPGELSGGMKRRASLAMILAIKPVIL
FT                   LMDGAFNALDSKTKMTMHQEITRIWETEKNTVVFVTSDLDEAVKLADRIIVLNKDGALE
FT                   AILVNELPRPRLGSAARDPDFHHRFIAFRETVMNVIKKDAGLRTCAIS"
FT   gene            167113..167934
FT                   /locus_tag="Cpha266_0147"
FT   CDS_pept        167113..167934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0147"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mja:MJ0412 putative taurine transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64217"
FT                   /db_xref="GOA:A1BCU0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCU0"
FT                   /protein_id="ABL64217.1"
FT                   /translation="MKTTMNGIAAPEKPLLEIRDVSKTFMKDGKEFLVLERVNLSINEG
FT                   EFVCILGPTGCGKSVTLQIVAGLLEQSSGSVILDGKEEHGPGPHKGMVFQEYALLPWRT
FT                   VVENVEIGLELKGISKKERRRIAEEQLDLVGLKGAESRMVHEISGGMRQRAAIARALAN
FT                   RPKILLMDEPFEALDALTKEEMQIQILKAWEKTKTTIFFVTHDVDEAIFLSDKLCVMDI
FT                   NPGRVKKIITNTLPRPRHELVCRTDKAFCEMRDQIIQLYSSLKDEELDLVF"
FT   gene            167957..168703
FT                   /locus_tag="Cpha266_0148"
FT   CDS_pept        167957..168703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0148"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: sus:Acid_3506
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64218"
FT                   /db_xref="GOA:A1BCU1"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCU1"
FT                   /protein_id="ABL64218.1"
FT                   /translation="MKTNNAGLRPFARAVLIGSAMISGMLTGCSEKKTVETPPKEPEKT
FT                   VAASNESPLKGLRLYLGYCFICHGQTGRGDGPYAASLTAKPADLTNRGYFSARTDQQIY
FT                   DFISKGGIAHGKSIHMRPFGMQLTRQQIMGLVSYVRVLNEGRTVDLEKSSGNTADDIYG
FT                   MSCIMCHGSDGNGDGEIARKLNIAIRPLGSKAVQDMSDQQLYAIISGGITDTARVNASY
FT                   MPAWSNSLTKEQIDELVAYIRELGKP"
FT   sig_peptide     167957..168043
FT                   /locus_tag="Cpha266_0148"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.666) with cleavage site probability 0.553 at
FT                   residue 29"
FT   gene            168834..170876
FT                   /locus_tag="Cpha266_0149"
FT   CDS_pept        168834..170876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0149"
FT                   /product="Carbon-monoxide dehydrogenase (acceptor)"
FT                   /EC_number="1.2.7.4"
FT                   /note="PFAM: Prismane; KEGG: gme:Gmet_1902 carbon-monoxide
FT                   dehydrogenase, catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64219"
FT                   /db_xref="GOA:A1BCU2"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016101"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCU2"
FT                   /protein_id="ABL64219.1"
FT                   /translation="MSLKERIKLVHRLNYSKEEVIKHTANKAVAEMVEHMDKEAISNTF
FT                   DRFAQQHPQCGYGLTGACCAFCSYGPCRVTEKTLYSVCGKDVDLIVAGNALRRLASGMA
FT                   AHGAHAREVFIALKAAAEGSAPIPIKCPEKGVAVARALGIETEGKTIEAICGEIADIFI
FT                   DDLQRSLPKRHETLHALAPKERAELWERLGIIPISAYHECFEVNNLTSHGTDSDFESHM
FT                   QAFLRTVLAYAITTVTSTSLATDIVYGLPRRSKLNVNLGSIVPDGCVNIGINGHAPMVA
FT                   FAICDIVGTPKIMEKVKRAGADTIRLYGMCCTGGEFIERDLNIPLVAMASSAEMAVATG
FT                   AFDAIVVDQQDVLPGMMHVARQFHTRVITTSPSGRKEGAIVLELDYYLKNLDKIYELAE
FT                   EILDIAIDNYRNRESKKVHVPNIRAKVELGFSVEEVMKLFNGSMPDKKIHGLAALLKAG
FT                   KIRGIVNFGSCGNVRGAVFERNQIIIAKQLIKNDVLVTAHGCSGMGLLFAGLAHPDASV
FT                   LCGTGLREVVQAKDIPPVLHVGACTDSTRASQIMAYTANAAAQPNPAMPFAMVAADPAA
FT                   EKTMGARYAFVLNGIETYSCVQDNTLASDRFIDYVSNRLRTIVGAAMNWNPDPYRTSED
FT                   ILCMLDEKRAALGWPVRDYTIGTKEEIEDKIPDTVEIGRSICTII"
FT   gene            170931..171131
FT                   /locus_tag="Cpha266_0150"
FT   CDS_pept        170931..171131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64220"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCU3"
FT                   /protein_id="ABL64220.1"
FT                   /translation="MLFDCEKQAMERWTIAEHKVCDGCPYRGSVAGEPPFCIMRQNPPE
FT                   CFVARLSGRAAVTGQDKPSGA"
FT   gene            complement(171220..172038)
FT                   /locus_tag="Cpha266_0151"
FT   CDS_pept        complement(171220..172038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0151"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; KEGG: cte:CT2086 MazG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64221"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCU4"
FT                   /protein_id="ABL64221.1"
FT                   /translation="MPIPRNTTTEERKAAILAKRERSLSEHFERVVSLVDVLRNECPWD
FT                   RKQTPASLAHLLLEESYELVHAIDENDDIELKKELGDLFLHLCFQVILAEETQKFTFSD
FT                   VFEALSAKLIGRHPHVFGDTVADTEQEVLKNWETLKLQEGRKKLLDGVPKAMSELLRAY
FT                   RVQKKVSGVGFDWQNDEGVLDKLVEEIAELKNAATKEEQEEEFGDLLFTVVNYSRFIGA
FT                   NPEDALRKATNKFMKRFEAVEATVQQSGRNWQAFSAEELDLLWQKAKNEL"
FT   gene            172146..172817
FT                   /locus_tag="Cpha266_0152"
FT   CDS_pept        172146..172817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0152"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: cte:CT2085 oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64222"
FT                   /db_xref="GOA:A1BCU5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCU5"
FT                   /protein_id="ABL64222.1"
FT                   /translation="MELKGSIAVVTGSSTGIGYHTARLLLEKGAEVYGLSRRATAVRHD
FT                   RFHWLQCDVTIAEEIDRAFDAVLERHGCVDILVNNAGFGLFGDLETLQPDEWHRLLATN
FT                   LTAVFLCTRRVIPSMKERRRGMILNIGSVAGKRGFKGGAAYSATKFAINGLSESLMDDL
FT                   REFGIRVSCVNPGSVETEFFDRAGMQPKKAMDPAHLAGFLVSIIELPDSMLPDQITVRP
FT                   L"
FT   gene            172835..174262
FT                   /locus_tag="Cpha266_0153"
FT   CDS_pept        172835..174262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0153"
FT                   /product="tRNA modification GTPase trmE"
FT                   /note="TIGRFAM: tRNA modification GTPase TrmE; small
FT                   GTP-binding protein; PFAM: GTP-binding protein,
FT                   HSR1-related; KEGG: cte:CT2084 thiophene/furan oxidation
FT                   protein ThdF"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64223"
FT                   /db_xref="GOA:A1BCU6"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BCU6"
FT                   /protein_id="ABL64223.1"
FT                   /translation="MQQETGIHPIVQCDPIAAIATPLGVGALAVVRISGATAFDIAGRV
FT                   FRKARDPHQPLSETPGYTAHFGRLYDGLTLIDEVIALVFRSPSSFTAEDMVEFTCHGGP
FT                   VVTRHVLQLLLDNGCRLAEPGEFTRRAFLNGKIDLLQAEAIGEMIHARSESAYRTAVIQ
FT                   MKGDLSATLGALREKLLRSCALLELELDFSEEDVEFQSREELRVEIASLQSEVARLVDS
FT                   YQHGRLLTEGVATVIAGRPNAGKSTLLNTLLGEERAIVSHMPGTTRDYIEECFIHDKTM
FT                   FRLTDTAGLRETGEEIEHEGVRRSRMKMAEADLLLYLLDLSREGMAEEIKEIVALKAAH
FT                   ASSKFLVVANKIDLVPDATTLLCRLGEEAGCEAIGISARQKLGIDELKSRMSSMVEGLD
FT                   KLHEASVLVTSLRHYEALRNAGDALRNAQNLLDEQADTELIAFELRAALDYVGEITGKV
FT                   VNEEILHAIFERFCIGK"
FT   gene            174413..174754
FT                   /locus_tag="Cpha266_0154"
FT   CDS_pept        174413..174754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0154"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: plt:Plut_0533
FT                   rhodanese-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64224"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCU7"
FT                   /protein_id="ABL64224.1"
FT                   /translation="MIQKGALLVDVREPHEVARKSFDVPDSMLIPLSQLHKRFKEIPAK
FT                   RQTVIACRSGNRSVTAVRFLMSHGYSKAVNLQDGIIRWEKEGLPVRRPLKQKSGSWFTR
FT                   LFGRKSPVQ"
FT   gene            complement(175164..175500)
FT                   /pseudo
FT                   /locus_tag="Cpha266_0155"
FT   gene            complement(175509..176249)
FT                   /locus_tag="Cpha266_0156"
FT   CDS_pept        complement(175509..176249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0156"
FT                   /product="protein of unknown function DUF169"
FT                   /note="PFAM: protein of unknown function DUF169; KEGG:
FT                   mma:MM2037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64225"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCU8"
FT                   /protein_id="ABL64225.1"
FT                   /translation="MTPEQLSQTLVTSEELVYHPIAVKFVTSLSELPEGIHKFGASSGE
FT                   RLPKSFLCAMWGDCLRGAAPFYTTREHQLCGGGAIAAGFGSLLPLEVAEKFMIGDGKLF
FT                   GTMKALRCSMESTMPFEDGEFEAQIIGPLSAMNNDTLRPDVVLIVCKPYQGQHILRAYG
FT                   FDSGELVHGIAGGSTCEMVSSYVKKTGKPTFTLGDTGGNAGLSLEPDELLLAFPYDKLE
FT                   TAVSNLSRICRTSTMHRHTIVHER"
FT   gene            176617..177366
FT                   /locus_tag="Cpha266_0157"
FT   CDS_pept        176617..177366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0157"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bld:BLi02990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64226"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCU9"
FT                   /protein_id="ABL64226.1"
FT                   /translation="MKRVIIIGATSGIGRALASLYIAEGWTTGLCGRRTAFLEDLRSVA
FT                   GKQVLVRAMDVTDTVAARKVFVELVQVMGGVDLVIISAGTGYLDPSFPWEKELETLKTN
FT                   VTGFAAIAHAAFEVFRHQGFGHLAGISSIAAIRGGSVPAYHASKAFVSNYLQGVRCLAA
FT                   ASGLQIHVTDILPGFVDTAMAKGDGLFWVASPEKAALQIFRAISKKKYRVCITKRWQII
FT                   AILLRVMPSGVYNGLLCRKKGKVDRGM"
FT   sig_peptide     176617..176673
FT                   /locus_tag="Cpha266_0157"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.811) with cleavage site probability 0.735 at
FT                   residue 19"
FT   gene            complement(177557..177979)
FT                   /pseudo
FT                   /locus_tag="Cpha266_0158"
FT   gene            178019..178270
FT                   /pseudo
FT                   /locus_tag="Cpha266_0159"
FT   gene            178891..181584
FT                   /locus_tag="Cpha266_0160"
FT   CDS_pept        178891..181584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0160"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART: TIR
FT                   protein; Tetratricopeptide domain protein; KEGG: ccr:CC1413
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64227"
FT                   /db_xref="GOA:A1BCV0"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCV0"
FT                   /protein_id="ABL64227.1"
FT                   /translation="MTTTRLRRQYQYFAFISYSHTDAKVAEWLHRKLESYRLPNAVLRK
FT                   SDGQLPRHVRPIFRDIADLSSGSLARTLREEIGQSQFLIVICSPDSAKSEWVEMEVSHF
FT                   LTLRGHEFVIPVIIKGTPYAKDAVDECLPLSLLRTEVDLLGISFAGQSKEQVLLKTVSA
FT                   LLDIKYDSLYDRHRRRQRRQRMFAATVVTVMFVVVLTASLFSFIQWNRAEQRRAEAEQL
FT                   LNYLLLDLHPKLKQFGRLDILESVAEKSREYIDYISTDVRDPIDAIQAISLRRNMAEVY
FT                   QSVGKLENAEALHLKNISVLKKLEQIDPKMEIIHLLKGEEHQALASIRKTEGRFQDALH
FT                   ESLTAFSVFKSFVSVKSDARWRSAKASSEQRLSDAYYDLGMGKQAAWHINSAVSDFRRI
FT                   LHEHSAGDNSYKADLAYALVSKSRVEVKWGTTSRAYSVFVEASELFRQHLEEHPEDREV
FT                   RASFANVVSDLAAMLKDMGRLEDALIYWDLAIDAERELVTFEPLNVRWHADLSETMMNK
FT                   ANALGRLGRTGEGFLLYEEVSRHQRKLIALQPKVARWRATYAWCRHNMAIEYARLGKNK
FT                   GAIDLWNDAIATIEQLRKDGRAKREWLLDLCNMLDQRATITAENGNFEKAEQDIKASQA
FT                   IRASLISDSNSSPDELSQMGLNQARKALLDYYRKDYSHAMVSIKAAEGYLRRAVKLDEA
FT                   NCEWRAHLAGTLRNSSVIHRAAGFPDKAKRAIDECIVILEKLRIRQPSDKKIRVDLSQA
FT                   YNNQGNLYNDFGSIKSSVSAWEKSLTLDSDPAQREFLATRLGTLAYQYILLQDPGKSEM
FT                   SARKALEVDAAPWIQINLGHALFLQDMREAAKAQYLNAMRKDGKILASISADFVDMENH
FT                   GIHVRNAIQMLDELRGAALETNNEKQ"
FT   gene            complement(181999..182385)
FT                   /locus_tag="Cpha266_0161"
FT   CDS_pept        complement(181999..182385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT0487 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64228"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCV1"
FT                   /protein_id="ABL64228.1"
FT                   /translation="MKSFIDAVKNNKTGFVIKNSVFLPFHCEILTIWLGKEMSLLSTPD
FT                   LITDLTDAEILGIREGNYYTNLVFRKRGDLAKELGHHKGHIILRAAEKGADIFQVENIH
FT                   YVRIGFHDHHKELSLEMIDNPFDL"
FT   gene            complement(182418..183893)
FT                   /locus_tag="Cpha266_0162"
FT   CDS_pept        complement(182418..183893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0162"
FT                   /product="transporter, UIT6 family"
FT                   /note="KEGG: plt:Plut_1726 hypothetical protein; TC 9.B.53"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64229"
FT                   /db_xref="GOA:A1BCV2"
FT                   /db_xref="InterPro:IPR031566"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCV2"
FT                   /protein_id="ABL64229.1"
FT                   /translation="MLPTLTRHALCLLVFVLVVAGVTGISGILIAAEAFDINAAASPVA
FT                   IENNLPPVWLVAPFATLLVMIATGPLLFHRFWEQHYPKVSTGLGFIVAVYYVFMIENGL
FT                   QVLEHTLEEYLSFIALISSLFVVAGGILIRIERRGTPLINASLLFIGAVISNLVGTTGA
FT                   SMLLIRPYMRINAGRIKAFHIVFFIIIVSNIGGALTPVGDPPLFLGFLKGVPFFWVFPK
FT                   LILPWIITIAGLLFIFIFLDAKAGHGKMKGTEPDGEISITGKRNFFFLAIIITSVFLDP
FT                   AVIEGVPSLQKLFHLPFGIRELIMFIVAVTAYKYSNPAAFKGNEFNFEPIKEVAFLFIG
FT                   IFATMIPALELIGNYAETHAEVFSVSRFYWLTGVLSGVLDNAPTYLNFFAGALGKFGLD
FT                   IDIPEDIILFANGVNSAIQGDVSSDIYLMAISVASVFFGALTYIGNAPNFMVKNIAAQA
FT                   DVDVPDFLEYIYKYSIPILLPFLMLIWVLFFNY"
FT   sig_peptide     complement(183798..183893)
FT                   /locus_tag="Cpha266_0162"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.963 at
FT                   residue 32"
FT   gene            complement(183989..184252)
FT                   /locus_tag="Cpha266_0163"
FT   CDS_pept        complement(183989..184252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64230"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCV3"
FT                   /protein_id="ABL64230.1"
FT                   /translation="MIEKRKNKPNQTETISSILFSASASTDFTNSRAKENPFIPTVNNV
FT                   NNRYAIAQHQMAQEALSFQYRSSPDCFIKAVSVACRIRELLT"
FT   sig_peptide     complement(184151..184252)
FT                   /locus_tag="Cpha266_0163"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.882) with cleavage site probability 0.774 at
FT                   residue 34"
FT   gene            184699..186093
FT                   /locus_tag="Cpha266_0164"
FT   CDS_pept        184699..186093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0164"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; KEGG:
FT                   rba:RB3371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64231"
FT                   /db_xref="GOA:A1BCV4"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCV4"
FT                   /protein_id="ABL64231.1"
FT                   /translation="MSLKFSSSFLLNSIDAWEEDRKDRFDLDALTQSFHESVPALGFID
FT                   WKITVVERGYAETVLPLTPNSSNQYIAHQGPLMLLAAEYTGGLALTSLFHRVPIIGFWP
FT                   SVDENAGYMWGAKASIKWITPSCHNLTCKARIEKERWEGLAKRFANSNKVVVTIPVKMF
FT                   NGDKLVAVADFTYWAQDINSLKRNAYDVEKIDLLYEHKTKTTAKLIVGLRALEQEKPID
FT                   QRRFDDPYAFMLAGKHGITLARRFSVATPQLQNMISARTQHLDECVKQFSLGKTKFNVV
FT                   NIGAGYDSRFWRLNIANAVIYDLDLPVMLHERKRIFDYSRNNAIHNVDIDLEIQSIDQA
FT                   LLEKSDFDSELPTFFIWEGGSMYFMDENIESILGSIRRIVNQDSRIWLDYVSKDLVEIS
FT                   TGIPEAEGFIYNIRKMGEPFINGYNDIGVLAGKYDLVIAQNIRSGELLNIEEDVYSHYS
FT                   FCVLKS"
FT   gene            186106..188586
FT                   /locus_tag="Cpha266_0165"
FT   CDS_pept        186106..188586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0165"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; Hpt domain
FT                   protein; KEGG: bxe:Bxe_B2006 periplasmic sensor hybrid
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64232"
FT                   /db_xref="GOA:A1BCV5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCV5"
FT                   /protein_id="ABL64232.1"
FT                   /translation="MPASYSSRPSVLKRGVDFFQNDYERNKLTIDYIRYIGLWGHPLYY
FT                   LLCAFIFPQPYESFELRFASAISFIPILFHQRYPEKFRSLLMLYWYLWLTFTFPVVFTY
FT                   LMLMNDFSGLWLVAETVMLFVFIIFITNYFLLFVLFFSGILIAYAGFVLDTGAHLLITK
FT                   EIIEYFVSIPIAILLGLLVNSTNKKGELAQERNSVLQSLAGSIAHEMRNPLGQIRHCLY
FT                   SIQNLLPQVNPEECDKPLGKEKLETLYERVSRGQLAVKRGAQVIDMVLSEVRERPIGPE
FT                   SFTYLSATRVTRNALDEFGYESEQDRRRVHLETKDSFIFHINETLFVFVLFNLLKNALF
FT                   YFKTHPHSEISVRLERGERFNYLYFRDTGPGISSETLPFIFDSFYTTGKASGTGLGLSY
FT                   CKRIMTAFGGSITCKSVEGEYSEFILSFPVISEQDMNLYTERVIAVGQADFQGKRLLIV
FT                   DDSALYRSILKKYFAPLQVEIDEAAGGREALDLLSIRRYDLVIMDLNMPSMSGYETVER
FT                   LRRGEAGPQSCSVPVVAHSSESVMTARSKSENAGMQAFIAKPCSQAELISSLRSVLDTI
FT                   PERNYPGSPFSGRKVLLVDDSALNRDLLAMYLRDSGIEVTVSDSGAEALNILRNQDFEL
FT                   LITDIHMPGMDGLELTRTIRSSRSEQLCRLPIIGLSGAVEEEVVARKAGMNDFRIKTDS
FT                   PNLLLASIGRQLSVSGAEPIREKVVKEYPQAVKVTSPYGLSASESEELRQIFLEEFRDT
FT                   PVNLRRALKENDMRSLKEESHKLKGSAAILGAMALSKAAEELELHCRFERRDDPAPKIE
FT                   RIIEALDELSARND"
FT   gene            188924..189253
FT                   /locus_tag="Cpha266_0166"
FT   CDS_pept        188924..189253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0166"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: pmt:PMT0296 TPR
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64233"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCV6"
FT                   /protein_id="ABL64233.1"
FT                   /translation="MMVRRICFFSLMLSLVFFMSGADNVGPLTAEDYYKSGKIKYHKDD
FT                   YSGAIEDYNKAAELAPDVAKIFGSRGAARRKLGDREGAIADAQKAARLGDKDAQRILRM
FT                   LDLGW"
FT   sig_peptide     188924..188992
FT                   /locus_tag="Cpha266_0166"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.559 at
FT                   residue 23"
FT   gene            complement(189446..190774)
FT                   /locus_tag="Cpha266_0167"
FT   CDS_pept        complement(189446..190774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0167"
FT                   /product="glutamate dehydrogenase (NAD/NADP)"
FT                   /EC_number="1.4.1.3"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase, C terminal;
FT                   Glu/Leu/Phe/Val dehydrogenase, dimerisation region; KEGG:
FT                   cte:CT2023 glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64234"
FT                   /db_xref="GOA:A1BCV7"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCV7"
FT                   /protein_id="ABL64234.1"
FT                   /translation="MTTWPLMSERKESCECAIPYDIIETGIHSKPNPFKTAQRQLDEAA
FT                   ALIGLDPAAHQLLRWPLRELHVAMPVKMDDGSTKVFRGFRVQYNDARGPNKGGIRFHAE
FT                   ETIDTIRALAAWMTWKTAVLDLPLGGAKGGVICNPKSMSPGELERLSRAYIRQAGRILG
FT                   LEKDVAAPDIYTTPQIMAWMADEYSFMQGNNEFGVISGKPLALGGSAGRNDATARGGIA
FT                   CVIEAAKELGIELQGATAAIQGYGNVGSFAHKLATELLGMKIIAVSDSGGGIYNPDGLL
FT                   YDEVKAHKEKTGSVTGFPGSDSVSDETLLELNVTVLFPSALEQVITEHNAQNIRAGIIA
FT                   ELANGPTTPEADKILFENGCYVIPDFLCNAGGVTVSYFEMVQNTYGYYWEEDDVRKRLE
FT                   KKMKTAFHSVHETSRKYKVHNRLGACIVAIERVAEAMKLRGWY"
FT   gene            complement(190837..191235)
FT                   /locus_tag="Cpha266_0168"
FT   CDS_pept        complement(190837..191235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64235"
FT                   /db_xref="GOA:A1BCV8"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCV8"
FT                   /protein_id="ABL64235.1"
FT                   /translation="MTEIKRKGLFSKIESRIDAIVLVEETTIGFFFVAGLQAILSIWQG
FT                   LPVLVDAAIFALSSLFIRQFQSRVAAITLTLYAAVSVALAATNTAGAYFGGNNNIFLSA
FT                   ILLWASIRAAEATIKLHGKFAIPENPKK"
FT   gene            complement(191334..192296)
FT                   /locus_tag="Cpha266_0169"
FT   CDS_pept        complement(191334..192296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0169"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr7467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64236"
FT                   /db_xref="GOA:A1BCV9"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCV9"
FT                   /protein_id="ABL64236.1"
FT                   /translation="MNLQLGQAIKIVAQTKVYLLYRTMVYGAIVGVVAIVLGILVLIGT
FT                   VFGSGAAFVLFLITLFAGSFGFRLLRDYVLYLLQAGHIALITEIAETGTLPPGISQTSW
FT                   AKEKVMKYYKEVSVLALVDQLVKGVLVTLNRTIFNVFNALPIPALEGLAGIVQRIVNFS
FT                   LTYIDESVIAYTFRTRNENVFDAAKSGILVYCQSWKAVLMNAVALTVLSYLFVILMTTL
FT                   FMIPLGAVSLMLPSSWSFVKFALFVLALFLGISTKWILFDPIACTSTLLTFLNEAETTK
FT                   PDPAWESKIEMVSDQFRTLKTKAGEMMRGTAKSREAQST"
FT   gene            complement(192336..193247)
FT                   /locus_tag="Cpha266_0170"
FT   CDS_pept        complement(192336..193247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0170"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="TIGRFAM: monofunctional biosynthetic peptidoglycan
FT                   transglycosylase; PFAM: glycosyl transferase, family 51;
FT                   KEGG: cch:Cag_0146 monofunctional biosynthetic
FT                   peptidoglycan transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64237"
FT                   /db_xref="GOA:A1BCW0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCW0"
FT                   /protein_id="ABL64237.1"
FT                   /translation="MKLVKNLFILLLLFFIADIARYAFYPDIGRLAYENPKKSAFMLYR
FT                   EAEWEKQGLYEKTVKQQWVPIEKVSPNLIKAVLIAEDDKFWQHEGFDYKAIGVALEKNI
FT                   AEKKFKMGGSTISQQLAKNLFLSPSKNPIRKIKEAILTWRIEKTLTKRRILEIYINVAE
FT                   WGDGIFGIEQASRHYYGVSAARLTAQQASKLASVLPNPIRYSPKGSSSYVHNRSRKILA
FT                   IMKKRGIVLPDYDAVMTTAQPDTTTVDSVTIGIPQELIDQAASPDSSIDKTIEADHAPH
FT                   DGAPGQKENTAIPDSPNSEKQP"
FT   gene            193428..193844
FT                   /locus_tag="Cpha266_0171"
FT   CDS_pept        193428..193844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0171"
FT                   /product="C-type cytochrome, putative"
FT                   /note="KEGG: plt:Plut_1980 C-type cytochrome, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64238"
FT                   /db_xref="GOA:A1BCW1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCW1"
FT                   /protein_id="ABL64238.1"
FT                   /translation="MKRVFIGLVTGLLCFPVAQSRAATPDGKEVFERNCSVCHSVNPPS
FT                   KSAPPILPISGRYHMQFSTKSAGVAAMAAFMKAPSKQKSVIEPEAITRFGLMPPMALGD
FT                   AELTAVAGWVWDQGGSASGRGSGRGAGQGAGGCN"
FT   sig_peptide     193428..193496
FT                   /locus_tag="Cpha266_0171"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.984 at
FT                   residue 23"
FT   gene            complement(193926..194001)
FT                   /locus_tag="Cpha266_R0002"
FT                   /note="tRNA-Arg4"
FT   tRNA            complement(193926..194001)
FT                   /locus_tag="Cpha266_R0002"
FT                   /product="tRNA-Arg"
FT   gene            complement(194046..195920)
FT                   /locus_tag="Cpha266_0172"
FT   CDS_pept        complement(194046..195920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0172"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   DNA mismatch repair protein, C-terminal domain protein;
FT                   KEGG: plt:Plut_1981 DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64239"
FT                   /db_xref="GOA:A1BCW2"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BCW2"
FT                   /protein_id="ABL64239.1"
FT                   /translation="MAKIARLPDNVANKISAGEVVQRPASVIKELLENAIDACASKITV
FT                   TIKDAGKELVQIVDNGIGMSRQDALLSVERFATSKISGVEDLDSLMSLGFRGEALPSIA
FT                   SVSQFELKTKPEGALLGFRFRCDGGEPVEESEVNAEKGTTITVRNLFYNVPARRKFLKS
FT                   NATEFRHIFESVKSLALAYPEIEWKMVSDDEELFHFRTPDIYERLDAFYGENFSLSLIP
FT                   VSEENDYLSISGFLGKPGMQKRQKLDQYIYVNRRIIQNRMLSQALQQAYGELLVERQAP
FT                   FALLFLGIDPSRIDVNVHPAKLEVKFEDERSVRTMFYPVIKRTIQLHDFSPDAAEKEPC
FT                   SIKEGTLDCSSRKLGFQDIAEPASTTSTLYANYRQGAFGDTPFERPAYAEKEPRPSSIN
FT                   TGFERFEPDLREGGDLFSTTLQARPYEDDNTPDPGENDPKIWQLHNKYIICQIKTGMMI
FT                   IDQHVAHERVLYERAVDVMNQNVPNSQQLLFPQKIELRAWEYEVFEEIRDDLYRLGFNL
FT                   RSFGAKTVMIEGIPQDVRPGTEVTILQDMITEFQENSSKLKLERRENLARSYSCRNAIM
FT                   AGQKLSLEEMRSLIDNLFATRVPYTCPHGRPVIIKLSLDQLDRMFGRK"
FT   gene            196237..198909
FT                   /locus_tag="Cpha266_0173"
FT   CDS_pept        196237..198909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0173"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: cation transporting ATPase
FT                   domain protein domain protein; Haloacid dehalogenase domain
FT                   protein hydrolase; cation transporting ATPase domain
FT                   protein; E1-E2 ATPase-associated domain protein; KEGG:
FT                   plt:Plut_1234 ATPase, E1-E2 type"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64240"
FT                   /db_xref="GOA:A1BCW3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCW3"
FT                   /protein_id="ABL64240.1"
FT                   /translation="MKTGHLTCWHCLTTEDVFNKLQTTSGGLSSSEAFRLLGVYGPNRI
FT                   HAERRTSPLKLLVAQFKNVLILTLLIATLLSVYLGHGFEAVAIAVIVLFAVLLGFVQEF
FT                   RAEKAIEALREMAAPLARVMRDGKEAVINASELVPGDILLLAVGDRVAADARLLQASNL
FT                   RADEASLTGESLPSEKDVEAVLSEDAAPGDQKNMVFAGTSISYGRASAVVVSTGMATEF
FT                   GRIAAMLQNVETEKTPLQKNLDKVGSALAGVALLIVLVIVVFGLFRGQSFIEMLIFGIA
FT                   LAVAVVPEALPAVVTISLALGVQRMVKRNALMRRLPVVETLGSTTVICSDKTGTLTRDE
FT                   MTVRTLYSSGVFIDVNGSGYNPEGSLAVVDGGSLPESLNELLLAGVLCNDARIVKSDSG
FT                   FWGVAGDPTEGALLVVARKAGLNELTLRQLYERLDERPFSSETKKMMTLHRMGETTKAF
FT                   IKGAPEVLLADSVAVRCSEGVKALDDPLRAALLAEADNLGKRALRVLAFAVKDGADMSS
FT                   AGDGMTFLGFAGMIDPPRAEAGDAVRQCLAAGIRPVMITGDHPLTAEAIARELGILRDG
FT                   KVVTGAMLQTMSAEELRHSVGSVSVFARVAPEHKLRIVEALQMNGEVVAMTGDGVNDAP
FT                   ALKKADIGISMGLTGTDVSKEASAMMLMDDNFATIVAAVEEGRGIYDNIKKYLTYLLSS
FT                   NIGELGLMAGATLMGIPLPLSAVQILYVNLATDGFPALALAVDPSERDIMLRSPNNPKK
FT                   GIFTPSVLAFMLTGGIWSTMVNLSLFLWAFASGRTLQESMTMTFVSLVLIQFFKAYNFR
FT                   SEKVSLFVRPFANRWLNLAIVWELVMLIAIINVPFLQRLFGTCLLTPEDWVIVIGSAMT
FT                   VVPIIELLKWLMRSGRFGF"
FT   gene            complement(198999..200054)
FT                   /locus_tag="Cpha266_0174"
FT   CDS_pept        complement(198999..200054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0174"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: plt:Plut_1992 uroporphyrinogen decarboxylase
FT                   HemE; TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64241"
FT                   /db_xref="GOA:A1BCW4"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BCW4"
FT                   /protein_id="ABL64241.1"
FT                   /translation="MLKNDLFLRALKRQPCSRTPIWVMRQAGRYLPEYRAVREKTDFLT
FT                   LCKTPELAAEVTIQPVDLMGVDAAIIFSDILVVNEAMGMDVEIIESKGIRLSPAIRSQV
FT                   DIDRLIIPDINEKLGYVMDAIRLTKKELDNRVPLIGFSGAAWTLFTYAVEGGGSKNYAF
FT                   AKKMMYREPKMAHMLLSKISSVITEYVLMQIEAGADAIQIFDSWASALSEDDYREFALP
FT                   YIKENVQAIKTKYPDTPVIVFSKDCNTILSEIADTGCDAMGLGWNMDIAKARKELNDRV
FT                   CIQGNMDPTVLYGTPDKIRSEAAKILKQFGQHTATSGHVFNLGHGILPDVDPANLKLLV
FT                   EFVKEESVKYH"
FT   gene            complement(200220..201068)
FT                   /locus_tag="Cpha266_0175"
FT   CDS_pept        complement(200220..201068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0175"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /note="PFAM: protein of unknown function DUF224,
FT                   cysteine-rich region domain protein; KEGG: plt:Plut_1993
FT                   succinate/fumarate oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64242"
FT                   /db_xref="GOA:A1BCW5"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCW5"
FT                   /protein_id="ABL64242.1"
FT                   /translation="MKRYAYYLSCINESMTKELDRSIDLWQKDLDLELIKLHESTCCGG
FT                   SNLEYVSPKHFALVNARNIAHAEKLGLDLVVSCNTCLMTIRTAKKKLDSSAELKCEVNE
FT                   ILKKEGLEYKGTSEVRHLLWILIEDVGLDVIKSKVKVPLKNYKIAPFYGCHILRPSTVL
FT                   GKDNPLDPSSLDQLIEALGGTTIPYEHKNRCCGFHTLLVAEEESLNVAAEALNEAIESK
FT                   ADFIVTPCPLCHTVLDGYQAKALKQAHINASIPVFHLSEMVGLALGYTKKQLGIKRHIV
FT                   S"
FT   gene            complement(201087..202157)
FT                   /locus_tag="Cpha266_0176"
FT   CDS_pept        complement(201087..202157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0176"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: plt:Plut_1994 succinate dehydrogenase/fumarate
FT                   reductase iron-sulfur protein; TIGRFAM: succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein;
FT                   PFAM: ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64243"
FT                   /db_xref="GOA:A1BCW6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCW6"
FT                   /protein_id="ABL64243.1"
FT                   /translation="MNSRKEPINSMHMTGAAEQHKEEKRDITFRVFRFNPQVDIKPYFD
FT                   DYTIPVERGITVLRALNYIKEHVDPTVSYRAFCQAGICGSCGMRVNGISKLACTTQVWD
FT                   ELDRCKEPGILRVEPLRNMPPIKDLIVDMDPLVDKMKHYMNWVDSSMPESEMGKKEFLV
FT                   SEDEFLKYDKATDCILCASCVSECTILRAHKEYVSPAVLLKSYRMNVDSRDSIHDTRLA
FT                   ELVKDHGVWDCTHCYRCQETCVKSIPIMDAIHGIRENALEVRGTKDTSGAKHAEAFMDD
FT                   IAKKGKLVEATLPFRTNGVLWTLQNLLPMAVKMIMKRRTPPPPPMVKPSKGIKAFREEF
FT                   REMTEHVKDDHQTHNK"
FT   gene            complement(202132..203835)
FT                   /locus_tag="Cpha266_0177"
FT   CDS_pept        complement(202132..203835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0177"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: plt:Plut_1995 succinate dehydrogenase or
FT                   fumarate reductase, flavoprotein subunit; TIGRFAM:
FT                   succinate dehydrogenase or fumarate reductase, flavoprotein
FT                   subunit; PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; FAD
FT                   dependent oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64244"
FT                   /db_xref="GOA:A1BCW7"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCW7"
FT                   /protein_id="ABL64244.1"
FT                   /translation="MKPFDIVIVGGGGAGLYAAMEAMKTNPSLNIAVLSKVYPNRSHTS
FT                   AAQGGANAALANKAKDDTVEMHIFDTIKGSDYLADQDAVDILCSEAPKIIRELDNIGTP
FT                   WSRLDDNTIAQRPFGGAGRPRCCYCADKTGHTILQTLYEQCLKKGVFFFNEYFSLSLSV
FT                   NNSRMRGLLAINMKTGKIEAFPAKTVIFATGGYAKMYWNRSSNAAGNTGDGQAIAYRAG
FT                   IPLKDMEFVQFHPTGLRKSGLLVTEGARGEGGYLVNKDGERFMSRYAPEKMELGPRDLV
FT                   SRSIETEILQGRGFDSPAGKYIHLDLTHLGAELIKSRLPQIREMSMNFEGVDPIEEPIP
FT                   VRPTAHYSMGGIDTDNYGRTVMDGVYAAGECACVSVHGANRLGGNSLLDILVFGRIAGH
FT                   TAAEEAGKFEPGNISPEEIKAKDEELRSFMQSSGHYERYGALREELGQTLALNVGIYRE
FT                   ASKISRGMEDLSLLKDRFKKIRVFDSSDIFNTNLIQVLELQNMLDLAETVATGALAREE
FT                   SRGSHTRNDFPTRNDEKWHKHTLATLENGTVKLGQKPVTMGRYELQERTY"
FT   gene            complement(203961..204407)
FT                   /locus_tag="Cpha266_0178"
FT   CDS_pept        complement(203961..204407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0178"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   cte:CT2044 CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64245"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCW8"
FT                   /protein_id="ABL64245.1"
FT                   /translation="MHQLITLRTLPVSDLMQKDYHTIKGSCTVAEALQLMKRTKESGLI
FT                   VEPRNEDDCYGIVTEKDILEKVIDPGEDVHRDPWNTPIFQIMSKPIISVNPSLRIKYAL
FT                   RLMKRTNVRRLTVMENNKVIGVLNMTDVLHAVEELPIHDDNIAL"
FT   gene            complement(204591..205232)
FT                   /locus_tag="Cpha266_0179"
FT   CDS_pept        complement(204591..205232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0179"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   plt:Plut_1997 hydroxyacylglutathione hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64246"
FT                   /db_xref="GOA:A1BCW9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCW9"
FT                   /protein_id="ABL64246.1"
FT                   /translation="MIIKQFRTGGDRNLGYLAADEVSGDALVVDASYNPGMIYNFACEH
FT                   GLTIRYLFSTHGHSDHTNGNATTSQLTGLKPLLYGDTCPETGISVRAGARFPLGSGSVL
FT                   IIHTPGHTEDSICLHVGDALFTGDTLFTGKVGGTMTAEQALAEYDSLRNKLMRLPDETR
FT                   VFPGHDYGSSPASTIAEEKKSNPFLLQPDFRSFLALKQNWAAYKKEHGIA"
FT   gene            complement(205257..205565)
FT                   /locus_tag="Cpha266_0180"
FT   CDS_pept        complement(205257..205565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64247"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCX0"
FT                   /protein_id="ABL64247.1"
FT                   /translation="MKFLAIMGHEETRPMVRNLFKEYQVNLFSNVAIRGCNCQKPALME
FT                   QSWWPADEMIGTYSSLCFAILDDDKAEAIMLELEKNPIAVDKDFPARAFLMHVEKTA"
FT   gene            complement(205588..208794)
FT                   /locus_tag="Cpha266_0181"
FT   CDS_pept        complement(205588..208794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0181"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   cch:Cag_0123 AcrB/AcrD/AcrF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64248"
FT                   /db_xref="GOA:A1BCX1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCX1"
FT                   /protein_id="ABL64248.1"
FT                   /translation="MNEGIAGKLAKQFINSKITPLLMIASLLVGVMATFMTPREEEPQI
FT                   VVPLVDLYIPYPGATPSEVEERVAKPVERALTEIPGVDFVYSTSMPDVALVTVRYKVGE
FT                   DTEQSMVKLWSVLMKNMDKMPAGAQFPLIKKVAIDDVPVLNLTFWSKTKDPYQLRQTVA
FT                   AVGDELKQIESIGDVEIKGGLKRQVRVVLNKEKLSQFNISALQIARQIQQSNSQMTAGD
FT                   FKQMNNEIIVRSGRFLESADDVRGIVVGIYGASPVYLRDVSEVIDGPEEVNNYTFFGWG
FT                   AAGPKNAATGEYPAVTLTVAKRKGTDATVLANKVMTKVEGLKKTTIPSDITVTETRNYG
FT                   ETASEKVFTLLEHLIMAVVAVTIVVGFFLGWRGALVVFASVPITFALTLLIYYLLDYSL
FT                   NRVTLFALIFVTGIVVDDSIIIAENIHRHFAMKRQPRLQAAITAISEVGNPTILATFTV
FT                   IAAVLPMVFVSGLMGPYMSPMPIGASLAMVFSLLVALIATPWLSYRLLKTEEGHHEEYD
FT                   ITKTGYYKLFNSILSPFIESKLKTWLAFGGVAILLIGAIALVPLKAVQMKMLPFDNKNE
FT                   FQVIVDMPEGTALEQTARVTKEISAYLKTVPEVSSYQYYVGTNAPINFNGLVRHYYLRQ
FT                   ADNMGDIQVNLIHKGERSLQSHDIAKKVRSAVQNIALKYNGNAKIVEIPPGPPVLSTLV
FT                   AEIYGPSQKEQIALAGEVKKIFSQTPGVVDVDWLVEDDQRVYDLEVNKEQAAFRGVSAE
FT                   QIAQTLRMSLHGVEVGLLHTRKSIEPVTIQLRLPQNQRTSIQDLSGIFVQSQGMGSLTT
FT                   RLRAGEMIPLSSLVTIKEKIQDKSIYRKDLRQVVYVTADVAGATESPVYAMLAMDKKIE
FT                   QLKLPGGYSISPLYTSAPTSQAKSSMKWDGEWQITFEVFRDLGTAFAVVLVIIYLLIIG
FT                   WFQSFKTPLIMMIAIPLSLVGIIPGHWIHGAFFTATSMIGMIALAGIMVRNSVLLIDFI
FT                   QIRREEGVDLKQAVIESAAVRTRPIILTSGAVVIGSLVMLFDPIFQGLAISLIWGGVLS
FT                   TILTLVVVPLVYYMAEKKSH"
FT   gene            complement(208787..209203)
FT                   /locus_tag="Cpha266_0182"
FT   CDS_pept        complement(208787..209203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0182"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_2000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64249"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCX2"
FT                   /protein_id="ABL64249.1"
FT                   /translation="MKGQNNSVAFIAVLITLLAGCGKGEQHTNNAKTKPDQALSLPLFQ
FT                   TESTLNARGEEVILVPKSSVFQQGGLTGVFVVGDDQKATIRWIRTGRIDHGSVVVLGGI
FT                   DKGEMVIANYNPELKEGVSVTKSQAVTREATSNE"
FT   gene            complement(209243..210568)
FT                   /locus_tag="Cpha266_0183"
FT   CDS_pept        complement(209243..210568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0183"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   cch:Cag_0122 LipD protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64250"
FT                   /db_xref="GOA:A1BCX3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCX3"
FT                   /protein_id="ABL64250.1"
FT                   /translation="MKVYKTLIGIMLAGSIALPGCVQAAEKTIKLSLGEAVSMARENNR
FT                   TIKAAQSRVAQAEAKIVQTRQSYLPKVTLSETAVITNDPGAALVFKLQQNIITQSDFIP
FT                   DRLNNADVINDFNTSLLVMQPVYNPDASTGRTIAFTAKKAQEQMAARTTETVELQVSKL
FT                   YYGLILARKNIEAVEQSIITMKNHSNEADKAYRVGLLTKSDKLSTDVRLAELLEQKLML
FT                   HDAIKNATDALKVMLNLDANLTIIPTEDLVVDKRLPVVDEKNTPEGRSDLKALQTYREI
FT                   AGYQEKMAQAAKLPRVNAFFQTNLHSSDIFSGGSSWALGMTMQWNIYDGMATTGRIQEA
FT                   KAQQLEAMYNHEEAKSQSLVEIKKAQRDLKTAKARIAVSQESLEEARVSLDYIGTQFKT
FT                   GMAMTFELLMREGAYTYAKLRLNQAKYDYCIARSELAYYSAR"
FT   sig_peptide     complement(210494..210568)
FT                   /locus_tag="Cpha266_0183"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(210575..210850)
FT                   /locus_tag="Cpha266_0184"
FT   CDS_pept        complement(210575..210850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_2002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64251"
FT                   /db_xref="GOA:A1BCX4"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCX4"
FT                   /protein_id="ABL64251.1"
FT                   /translation="MLVCCQEILQLDDKDMDDVILRLKKVNGQIQGLIRMVENSDNCEK
FT                   VIVQFQAAKAALDKTYSLVLDRSLKECMSHNDTENVGRILKLISKH"
FT   gene            complement(210923..211795)
FT                   /locus_tag="Cpha266_0185"
FT   CDS_pept        complement(210923..211795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0185"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: cch:Cag_0591
FT                   proline iminopeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64252"
FT                   /db_xref="GOA:A1BCX5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCX5"
FT                   /protein_id="ABL64252.1"
FT                   /translation="MSFADTTRGKIYYEDTGWGVSDNREVVLFFNGWSISARYWIPVID
FT                   RLSSQYRCLSFDQSGTGRTVCSHSCLSFSVEGFADEASELLVHLGLLGSRKLHIVGHSM
FT                   GGMIATEICNRHPESLVSATIVNCGIFDDELLKSFHHVLVGGMIDVAMLFKGVFLLEPF
FT                   KSLFIDRAIGRPIDQKYRTVFVEDFVASDTRAATAVGKFAIDPEIIGKYTAEAVKIGAP
FT                   LLCVVGMADRTIPPEGMQTLYNRRIEQSDFLTRLARFDHAGHLPMLEVLPEFEQALRNH
FT                   FYAASKLLG"
FT   gene            complement(211792..212448)
FT                   /locus_tag="Cpha266_0186"
FT   CDS_pept        complement(211792..212448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0186"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: mac:MA2698 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64253"
FT                   /db_xref="GOA:A1BCX6"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCX6"
FT                   /protein_id="ABL64253.1"
FT                   /translation="MAMHDELPFRIIFAGIYVAGFLMRGLFIQRMKPQEKPIIPEAGNA
FT                   GEISRFRVIFQKVMFFLWIAIVASYTWYPPWVEALHFPFPTWLRYGGAIAAAVSFLFLF
FT                   LTMKTLGRYWSPLPRLMEGHKLVITGPYRFIRHPMYTAMMLLFIAFILITANAAVTVFS
FT                   LIATVLTVKWALNEEKMLIGFFGDEYRAYMTRTGAFLPAPRKMVRHIFFNQHEKL"
FT   gene            212717..213394
FT                   /locus_tag="Cpha266_0187"
FT   CDS_pept        212717..213394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT2051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64254"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCX7"
FT                   /protein_id="ABL64254.1"
FT                   /translation="MKKEHATISGRKKRFCVIMEVVGKSKALVVLESCLQESTVYFSNH
FT                   EKILKCNPYCRYVRYIPDFDVFQWTFEVDDPRNNPIVAIFFVRQTEEHIPTDSAVFRRY
FT                   VGESRAPIDTETPGKKIIWETVESAPELLFNNDHTFIGKTFSEIFLLHQTDNRTTVHFE
FT                   TNISLDFKLSFPLNLMPEPALKFMSDMIMSKIMQQATESMLCQVQSDICCSMPEIATEG
FT                   GKK"
FT   gene            213535..214821
FT                   /locus_tag="Cpha266_0188"
FT   CDS_pept        213535..214821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0188"
FT                   /product="coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein"
FT                   /note="PFAM: coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein; KEGG: ter:Tery_0742 coenzyme F420
FT                   hydrogenase/dehydrogenase beta subunit-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64255"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCX8"
FT                   /protein_id="ABL64255.1"
FT                   /translation="MQHSVVSLKTSSLPMTKPSKIQTPRFDEPLCSKCGLCMGNAWPVK
FT                   ESLESCVFRCGWVENHEKRIFGRVRNPDDSDELRFGISLKRFNATLKKPVNGAQWSGII
FT                   TRISTMALQTNLVDAVLTLHGEPLQPKAVLAKTAQDIHEARGNKPVLSPVLQALHTAYR
FT                   EKTRRLLVVGAACHVHMVRDFTRKSPYFADLDLYIVGIPCTDNLEPSHLQWVFRNISKN
FT                   PETVINFEFMQDYRVHILHKAGKVEKIPFFCLPSAVMKVGVFPNSCLSCFDYINSLSDI
FT                   TVGYLGAPYSKNRKTQWIIVRTERGEKLLDLINDEIETSPEVFFGDSHSAVQAALQPTL
FT                   MPILQPEKLDDRKAMPKWLGIYLSRKKAKSGPGGTEFAKYSIDIHAIRNFYFLKMYRPD
FT                   DIGIVPTHIYDLLSQYDLSSIQRIIEARI"
FT   gene            214842..215615
FT                   /locus_tag="Cpha266_0189"
FT   CDS_pept        214842..215615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0189"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ath:At4g13250 short-chain dehydrogenase/reductase (SDR)
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64256"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCX9"
FT                   /protein_id="ABL64256.1"
FT                   /translation="MKNIVITGSSRGIGLGLAHAFLSKGCRVMISSSNSSNLDKALNEL
FT                   VEQHGSEHISAKTCDVANYQEVQDLWDHAQKSIGQVDIWINNAGIAHPLLPFWKLDMTQ
FT                   IGHTLDVNLAGTINGSHVAIRGMIEQGSGYLYNLEGQGADGGIIHGMGVFGTSKAAVHY
FT                   FSKSLIEETRSLKIKVGTIIPGIIRTELQAKTSQQTDAGRLFLSLLGENVREATEDLAK
FT                   RILANNTHGVCINRMTTPDMIGKIATLPINFLLGR"
FT   gene            complement(215789..216013)
FT                   /locus_tag="Cpha266_0190"
FT   CDS_pept        complement(215789..216013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64257"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCY0"
FT                   /protein_id="ABL64257.1"
FT                   /translation="MPQLPQNIIPEELTKPAAAIVSGAFLLSPLGIPPFIRGIPRVLLA
FT                   GAGGFLAGAVAEKVIENIGQILPPQPEDD"
FT   gene            complement(216052..216417)
FT                   /locus_tag="Cpha266_0191"
FT   CDS_pept        complement(216052..216417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64258"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCY1"
FT                   /protein_id="ABL64258.1"
FT                   /translation="MANESRKGGFFSVFRKEEKSVANKSAITSQQSETKAASSEKPAVS
FT                   VSREMTPKPVANVKPAATAEQQEKPVVFEAIDTTAAFSACWKAFGDLGLSQIKTVDMVL
FT                   TMLSNSIAKITDGQQTK"
FT   gene            complement(216448..217989)
FT                   /locus_tag="Cpha266_0192"
FT   CDS_pept        complement(216448..217989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64259"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCY2"
FT                   /protein_id="ABL64259.1"
FT                   /translation="MIADKVQTLYPRVSEYFGKIRNGNRYLEHILEVDSFWKNFEHSPC
FT                   RKVVLQGSEMPADACVSDEYDLVYAGGSLGLLHASVMASKYARKVLVFDRHMSGKPSRD
FT                   WNISWNELEKLEQVGLFSYEEINASIACRYKTGWAEFYVENGRKKRLYIDNVLDCAVES
FT                   DQLLSIARQKILADECNRIVDKMTFMRCFQFPESVVIEVENNMHERVYFRAKVFVDAMG
FT                   VHSPVAMQLNDGASFTHLCPTVGTVSSGLENVDPDIGEILVSTEPADTSSGRGRQLIWE
FT                   GFPAGGDRYTTYLFFYDSRSSDNDKSLLGLFETYFLKLPSYKKPGKDFVVHRPVYGVIP
FT                   AYYHDGFERTRQVADNNILMLGDAAALGSPLTFCGFGSFVRNLKSLTEGLEKALACNSF
FT                   EKKNLEQISAYEPNVAAMANLMKFMCYNKYTDHPNFVNELMNEVMIVLDGLPPRYREAM
FT                   FKDTLELSDLLLIGLNVAWKYPGVLMATATKLGLEGSLGMMKNMIGWAMSSKASN"
FT   gene            218179..218400
FT                   /locus_tag="Cpha266_0193"
FT   CDS_pept        218179..218400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64260"
FT                   /db_xref="InterPro:IPR012903"
FT                   /db_xref="InterPro:IPR022516"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCY3"
FT                   /protein_id="ABL64260.1"
FT                   /translation="MSQDSAKLFLAQMKQDKELSDKIHNAATKEDRWTIIRQEGFDFTR
FT                   EELDHATVTELNHFERWNWEAKLLADWL"
FT   gene            complement(218428..219309)
FT                   /locus_tag="Cpha266_0194"
FT   CDS_pept        complement(218428..219309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0194"
FT                   /product="Fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase; KEGG:
FT                   cch:Cag_1641 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64261"
FT                   /db_xref="GOA:A1BCY4"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCY4"
FT                   /protein_id="ABL64261.1"
FT                   /translation="MAEYDKDKQAKEYYTDVPVEKHGFFLKGAHSLDWGMKNRLSRIFR
FT                   PDTGRTVMFAIDHGYFQGPTTGLERPDVNIVPLMSHADAIMLTRGMLRTTVPPSLTRAV
FT                   VMRCSGGPSILKELSDEELAVDIEDAIRMNVAAITLQIFIGGEFETRSIHNMTRLIDMG
FT                   LRYGIPTMAVTAVGKDMVRDAKYFRLACRIAAELGAQIVKTYYVPEDFETVVASCPVPI
FT                   VMAGGKKISELEAVTMSYQAIQEGAAGVDMGRNIFQSDAPLAMMKTVGKVVHENMPPAE
FT                   AYEYFQSIRREG"
FT   gene            complement(219381..221498)
FT                   /locus_tag="Cpha266_0195"
FT   CDS_pept        complement(219381..221498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0195"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   plt:Plut_0410 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64262"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCY5"
FT                   /protein_id="ABL64262.1"
FT                   /translation="MQNLWNDAELQRSVNGQRSANDIPVELAELVYASRLLGSESTLVM
FT                   HGGGNTSVKSELHDIIGYRVNVIFIKGSGVNLAGVDAHDFMPVRIEPLQKLQHLYATGG
FT                   RSSEEDIQQFSTQRFKNFLYLNLFYLTEHMVNHSLSPSIETLLHAFLPHRFIFHTHSTA
FT                   LLTLSNQPDGQDLCREVLGESFGMVPYIKPGLGLARSAATAYESAPSIRGLVLQKHGLV
FT                   TFADTPDEAYHCMIESANLLEERITRAGRKVFPSVSLPAGIASLEDTAPVIRGAVVEEI
FT                   MPGSRDYRQFVLEFRTSPDILAYVNSDSLSDVSQRGAMTPDFIIRTKNRPLIVPTPDAS
FT                   DLDAFKTAVHEAVERYDAEYRAYFQRRRQAAGIEVSMLDPLPRVVLVPGLGLFGLGRTA
FT                   REAAVNADIAESTASAILDAESVGRFESITEQEVFDIEYWEMEQAKMTKVRHDVFAGKV
FT                   ALVTGAASGIGLATARAFRQRGAELVILDLNPEALQQAAEELGGGVLPIACDVTDRAAV
FT                   RRAFDKVCRRYGGLDILVSNVGVALQGRIGDVPDEVLRRSFELNFFSHQSIAQEAVRIM
FT                   RLQGTGGVLLFNVSKQAVNPGPDFGPYGLPKAATMFLVRQYALDHGRDGIRANGINADR
FT                   IRTGLLTDEMIKIRSTARGLNEREYMAGNLLQVEVTAEDVAEAFVHQALETKTTGSIVT
FT                   VDGGNIAAALR"
FT   gene            complement(221628..222833)
FT                   /locus_tag="Cpha266_0196"
FT   CDS_pept        complement(221628..222833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpa:RPA2614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64263"
FT                   /db_xref="GOA:A1BCY6"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCY6"
FT                   /protein_id="ABL64263.1"
FT                   /translation="MSTKRIITKEDVHLKARLLSEGAKVTVNKPPKTGFNPFRAMVLNG
FT                   SDLATLVRPEPYTRLEVQVNGDDVEFYDCGKHLASGRMQEWFSWRDGTLSNGRPVNAAV
FT                   IGMNQDIINIHYSYSCDNNNTGRSCRFCFFFADQHVSVGQDLAKMPFQKIEALAKEQAE
FT                   AVKIATDNGWRGTLVVIGGLVAPERRSQVVDLVEIVMAPLREQLSPEVFNELHITANLY
FT                   PPDDFKDMERWKASGINSTEFDLEVTDPDYFKAICPGKCATYPLEYWHAAQDASVEIFG
FT                   PGRGTTSFILMGLEPMNCMLEGVEERLSKGVYPNMLVYQPVPGADMFRMPPPNADWLVE
FT                   ASEKLADLYFKYQDRFDMPLATDHRPGYTRMGRSQYIMLTADVIARRLYEQGYELPAAY
FT                   PV"
FT   gene            complement(222922..223140)
FT                   /locus_tag="Cpha266_0197"
FT   CDS_pept        complement(222922..223140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64264"
FT                   /db_xref="GOA:A1BCY7"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCY7"
FT                   /protein_id="ABL64264.1"
FT                   /translation="MLKGSFTELWNKAMIYTGSGWLVLVCMIWLSGHFRDSGEQIVFVS
FT                   VLAAGYVAVYVLGFYIKHRHSEKTAKL"
FT   gene            complement(223223..223699)
FT                   /locus_tag="Cpha266_0198"
FT   CDS_pept        complement(223223..223699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0198"
FT                   /product="2-vinyl bacteriochlorophyllide hydratase"
FT                   /note="PFAM: 2-vinyl bacteriochlorophyllide hydratase;
FT                   KEGG: plt:Plut_0408 2-vinyl bacteriochlorophyllide
FT                   hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64265"
FT                   /db_xref="GOA:A1BCY8"
FT                   /db_xref="InterPro:IPR009905"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCY8"
FT                   /protein_id="ABL64265.1"
FT                   /translation="MPRYTPEQLAQRNTTVWTDVQLILAPIQFVFFLIGVGVTYLHYIN
FT                   PDIIAFFWVDVAILFKSFLFALLFFTGAYFEKEIFDKWIFSREFLWEDIGSVTAGAFHI
FT                   LYFILAFTGASREVLVWEAFLAYFTYIANAMQYIVRILLEKRNEKILRNSNALS"
FT   gene            complement(224260..224598)
FT                   /locus_tag="Cpha266_0199"
FT   CDS_pept        complement(224260..224598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4964 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64266"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCY9"
FT                   /protein_id="ABL64266.1"
FT                   /translation="MWLSHLYIHPPERNPNKEYRRKAGSKSKPTQSRNIFECIMLTVQR
FT                   TGCQDQANLKEQFGMPFATYTHFARRQRKGFFAKHESSYDESSACTRYWWMKSNRQRKK
FT                   TAQSAIYL"
FT   gene            224962..226368
FT                   /locus_tag="Cpha266_0200"
FT   CDS_pept        224962..226368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0200"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: cch:Cag_0116 elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64267"
FT                   /db_xref="GOA:A1BCZ0"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034498"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCZ0"
FT                   /protein_id="ABL64267.1"
FT                   /translation="MCSVRVIKKLNIMPLRLLFIAPKGKKDSKTNQKPLFHMAIGVLVS
FT                   LTPDEHTIEIADEHFGDTINYDGDYDLVGITSRTIDATRAYEIADEFRRKGKKVILGGL
FT                   HVSFNPEEARSHADSIVSGEAENLWATVLEDASSGQLKPAYDSKDFPLVTKIVPLDYER
FT                   IARASKRGKVDGSKSIPIYITRGCPYECSFCVTPNFTGKLYRYQNPEDLVRQIETAKKV
FT                   FFKAKGKSSKPWFMLCDENLGINKKKLWENLALLKECNINYSVFFSMNFLEDKETVRRL
FT                   VDSGCNMVLVGFESIKQSTLEAYNKGHVNSAEKFASVIEECRSAGLNIQGNFLVNPALD
FT                   TFEDMDDLVEFVGKNHVFMPIFQIITPYPGTKMYLEYKEKGLITDEDWEKYNAINLVIR
FT                   SEHYDPIAFQHKFMTSYYKTYSWGKIANRVRRNPYKFLNLITSLAFKKNLKEQLETFER
FT                   NHNIRTARTP"
FT   gene            complement(226551..227177)
FT                   /locus_tag="Cpha266_0201"
FT   CDS_pept        complement(226551..227177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0201"
FT                   /product="Proto-chlorophyllide reductase 57 kD subunit"
FT                   /note="PFAM: Proto-chlorophyllide reductase 57 kD subunit;
FT                   KEGG: plt:Plut_1486 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64268"
FT                   /db_xref="GOA:A1BCZ1"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCZ1"
FT                   /protein_id="ABL64268.1"
FT                   /translation="MKAVILYDSKTKGGSTEMLIDSIGQQLAESGLYVEKAKCIATADY
FT                   SFIKEFDIVILGAPVYNFIVSPQLLGAFLQGNLKKHLKKKRVALFLTCWTAESMAAVFY
FT                   LPQLKMHLLTNRILVEKIFHPVESSSDNAIESFVDDLLKQYERSIGSRNKSIIWSDEAQ
FT                   DWLEVVPGFLREKIRSMAAEYAIMNGYKEITVEMLDIARHEIGEK"
FT   gene            227469..227696
FT                   /locus_tag="Cpha266_0202"
FT   CDS_pept        227469..227696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0202"
FT                   /product="chlorosome envelope protein B"
FT                   /note="KEGG: cch:Cag_0191 chlorosome envelope protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64269"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCZ2"
FT                   /protein_id="ABL64269.1"
FT                   /translation="MSNGTSNDFSGAITNLMDTLGKLGQQQVEMLNNGIKTGSQMIEPL
FT                   GKTVTDLAGNMLNMVNQVLQSVSSALAPKK"
FT   gene            227835..228842
FT                   /locus_tag="Cpha266_0203"
FT   CDS_pept        227835..228842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0203"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   cte:CT2055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64270"
FT                   /db_xref="GOA:A1BCZ3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCZ3"
FT                   /protein_id="ABL64270.1"
FT                   /translation="MNTEHHIRCFYGQEDRNQLQITPIQGDASTRRYYRVSGPKGSAIA
FT                   CCDPLLRETTTDDYPFLIVYDLLRRNDIPVPEVIAVNAGEGLLLIEDCGTLQLQYLVFP
FT                   ECGSLAADIYRDVIDTLAGIQAITGDSSQLPFRLSFDREKLMFEFDFFIEHALMGYFAP
FT                   VSGGVDVGALRSEFKAIADILVQPERFVLNHRDFHSRNIMIRDGKPVIIDFQDARMGLP
FT                   QYDAVSIIRDSYVALDQTLADELKTRHYQALMDRNGITMSHDEYLYLFDLMAFQRNIKA
FT                   IGTFSYQTAVLKKTQYEHSIAPALRYLPDYISGRNELKKAGRLLQPVIEQRHER"
FT   gene            228839..229774
FT                   /locus_tag="Cpha266_0204"
FT   CDS_pept        228839..229774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0204"
FT                   /product="nucleotidyltransferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: plt:Plut_2007
FT                   mannose-1-phosphate guanylyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64271"
FT                   /db_xref="GOA:A1BCZ4"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCZ4"
FT                   /protein_id="ABL64271.1"
FT                   /translation="MKAFVLAAGFGTRLRPFTHRIPKPLIPVLNLPALLYTFALLKDAG
FT                   ITDIICNIHHHADDVRESVASFGIEGLAISFSEETTILGTGGGLKKCEQLFDDEDFLLI
FT                   NSDIITDIDFSAFIRHHKLSGLPGTLALYETPEAMAIGCIGIENGQVKDFRNMRNTGLK
FT                   SSLIYTGTALLSPKIFRYLNEDFSSIVDTGFTGLIDHGGLGAFRHSGSWMDIGTPEDYL
FT                   DANNGKGMLPERLTRRVRDAIGIEPHRIAADAWIASGARVIRSVIGSRCMVSRNAVVEN
FT                   SVLLPGAVVAEGECLLNSIRDRENTLQTIP"
FT   gene            229800..230963
FT                   /locus_tag="Cpha266_0205"
FT   CDS_pept        229800..230963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0205"
FT                   /product="Uncharacterized conserved protein UCP016719"
FT                   /note="PFAM: Uncharacterised conserved protein UCP016719;
FT                   KEGG: cch:Cag_0194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64272"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCZ5"
FT                   /protein_id="ABL64272.1"
FT                   /translation="MVKTGLDIFLENIDGYRNRTIGMIVNQTSVTSDLRYSWNVLREKG
FT                   LDIRKIFSPEHGLFATEQDQIAVGSQPVPDIELVSLYGSSSDTLIPDCTTLDDLDLILF
FT                   DIQDVGARYYTYVNTLALFMEAATGRDLEIMVLDRPNPLGGAVVEGPLLDMAYRSFVGI
FT                   FPVPVRHGMTPGELALLYRDWKKLDIRLSVLSMRGWSRTMLFHETGLPWVPPSPNMPTV
FT                   ESAAVYPGMCLFEGLNASEGRGTTTPFQLLGAPFINPNHLLEQCKGTGFEGIYLRPTWF
FT                   KPTFHKFQGEAIGGLWIHVCDQNRFRPFATAVALTAALHKLYPVDLRFLDGVYEFNDTI
FT                   PAFDLLAGTDSVRHALLDGNDTPSIISSWQQDETAFLVTKEQYHLYR"
FT   gene            230985..232397
FT                   /locus_tag="Cpha266_0206"
FT   CDS_pept        230985..232397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0206"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: cch:Cag_0195
FT                   sodium:solute symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64273"
FT                   /db_xref="GOA:A1BCZ6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCZ6"
FT                   /protein_id="ABL64273.1"
FT                   /translation="MQALDIAIIVFFLAGSILLGLWQGKSNKNTGDYFLGGHKFPWIVA
FT                   MLSIVATETSVLTFVSVPGLAYRGDWTFLQLPLGYILGRILVSILLLPVYFKNGVTSIY
FT                   EVIGSRFGTGMQKLASIVFLVTRILGDGVRFLATGVVVQVVTGWSLPVSVMIIGVVTLV
FT                   YTITGGLKTVVWLDSIQFGLYLLGGIITIAFILLHLESSPQETFAALADAGKLAVLNTG
FT                   GNILFNPMTFGSAFTGGIFLSLASHGIDYMMVQRVLGCRDLGSARKALIGSGFFVFFQF
FT                   MIFLLAGSLMYLFMQGSVTEKDREFASFIVNYLPSGLKGLLLAGILSAAMSTIASSINS
FT                   LAASTVTDLLGGRVSLNFSKLISAGWAVVLIGIALIFDESDKAIIMVGLEIASFTYGGL
FT                   LGLFLLSKTTQKYHPASLAIGLLASMGIVFVLKLYGIAWTWYILVSVSVNIMITILVNT
FT                   MLRSIMSKGEQS"
FT   gene            232510..232761
FT                   /locus_tag="Cpha266_0207"
FT   CDS_pept        232510..232761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0207"
FT                   /product="bacteriochlorophyll C binding protein"
FT                   /note="PFAM: bacteriochlorophyll C binding protein; KEGG:
FT                   cte:CT2062 chlorosome envelope protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64274"
FT                   /db_xref="GOA:A1BCZ7"
FT                   /db_xref="InterPro:IPR001470"
FT                   /db_xref="InterPro:IPR038387"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCZ7"
FT                   /protein_id="ABL64274.1"
FT                   /translation="MSKISGAFTQWAEAYGRFVEIFTDGHWWVTGDCMENVGKTTKRLL
FT                   RNAYPYIYGGGSSVDIKGSSPDKGGYATPTKEIKRRFE"
FT   gene            complement(232932..233630)
FT                   /locus_tag="Cpha266_0208"
FT   CDS_pept        complement(232932..233630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0208"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; NmrA
FT                   family protein; KEGG: cte:CT2065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64275"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCZ8"
FT                   /protein_id="ABL64275.1"
FT                   /translation="MNNTCDYRGTVLVAGSTGKTGLWVVKRLQHYGIPVRVLVRSARKA
FT                   AVFGNTVEVAVGLVQNSADLTEAVKGCDAVISALGSSQFFGEASPAEVDRNGAIRLADE
FT                   ASRMGVRHFAMVSSIAVTRWYHPLNLFAGVLSMKYAAEEHVRSLFSRENRSYTIVRPGG
FT                   LKDGDPLQFRLHVDQGDRIWNGWINRSDVAELLVESLWLESAKNKTFEVINEAEEVQES
FT                   LEQYYGKLSN"
FT   gene            233837..235177
FT                   /locus_tag="Cpha266_0209"
FT   CDS_pept        233837..235177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0209"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   plt:Plut_2015 pentapeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64276"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCZ9"
FT                   /protein_id="ABL64276.1"
FT                   /translation="MKQIWHLAGIVLLTVSGFLPVSSAIGFDPDAVKLLVKSPKEWNAF
FT                   RQQHSMQPVDLDKAKLEDADLEGANLSNSSLVRAELSGANLNNADLRGSNLQQAFIKKA
FT                   DLKGADLREAYLVKVNLKEAFMEKSMLQKANLQSANLRWTRFHRADLAGSNLQDAVLFE
FT                   TSFVDADLRGANLKGALYVGNANFSGAKISSNTITPSGEKATASWAAIRDAEYIKEADA
FT                   AMPVYASLPVMVFASPSAGLKSASASSGQAVMGSKQQQALMVDDVETWNTMRAANPELK
FT                   IELKEEKLENARLKGVNLQKASMPGADFEDANLDEAMMEGADLSKADFQKADMKKVKLQ
FT                   GANLSGANLDRSFMEGADLRNANLSGANLFGAMLKDANLSGANLSGASLFETDLEGANL
FT                   SGANLKGANLVEPNLKNAIISPDTILPSGKNATQSWAVIKGATFVKP"
FT   sig_peptide     233837..233917
FT                   /locus_tag="Cpha266_0209"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.573 at
FT                   residue 27"
FT   gene            complement(235220..235477)
FT                   /locus_tag="Cpha266_0210"
FT   CDS_pept        complement(235220..235477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64277"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD00"
FT                   /protein_id="ABL64277.1"
FT                   /translation="MTVILTSAVQPCNRHQNRRGQNSYWPLLNVMNVRVTEKVFTPYLR
FT                   TTDKLKNRFPRAILRQWKSPEKAQQQIFILHVLRIKKAAL"
FT   gene            complement(235520..235813)
FT                   /locus_tag="Cpha266_0211"
FT   CDS_pept        complement(235520..235813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_2016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64278"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD01"
FT                   /protein_id="ABL64278.1"
FT                   /translation="MIQFRVGDPIVYHKPKTSFSPGPRAKQVYPLQHGEDYHYVVDKFW
FT                   TVSQVNRDGTLEVTTRTGKKHLLDAGDPNICKAHLIQHILFRKRFPSLADLL"
FT   gene            235828..236106
FT                   /locus_tag="Cpha266_0212"
FT   CDS_pept        235828..236106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64279"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD02"
FT                   /protein_id="ABL64279.1"
FT                   /translation="MLVIGLFNWVFRHLSLFFSANRTLVVFRFVGGPVFFGLWRLKELS
FT                   PFAPRSAPGNYERCFYVLKLLTYFFFDGYLKIKNERMVYGSTKWMMR"
FT   gene            complement(236076..237254)
FT                   /locus_tag="Cpha266_0213"
FT   CDS_pept        complement(236076..237254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0213"
FT                   /product="arsenite efflux ATP-binding protein ArsA"
FT                   /EC_number="3.6.3.16"
FT                   /note="KEGG: cte:CT2070 ArsA ATPase family protein;
FT                   TIGRFAM: arsenite-activated ATPase ArsA; PFAM:
FT                   Anion-transporting ATPase; TC 3.A.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64280"
FT                   /db_xref="GOA:A1BD03"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD03"
FT                   /protein_id="ABL64280.1"
FT                   /translation="MRLILMTGKGGVGKTSMAAATGLRCAELGYKTLVLSTDPAHSLAD
FT                   SFDMALGHNPNRVSNNLWGAELDVLKELEQNWGTVKRYITGVLQARGLEGIQAEELAIL
FT                   PGMDEIFGLVRVFRHHKEGDYDVLIIDSAPTGTALRLLSIPEVAGWYMRRLYKPFEKVA
FT                   LYLRPLVEPIFRPLAGFSLPDKEMMDVPYEFYEQIDALGKILTDHAVTSVRLVTNPEKM
FT                   VIKESLRAHAYLGLYNIAVDLVIANRIIPPEVTDPYFTFWKENQTLYRQEIQDNFAPLP
FT                   VKEVPLYSREICGMQTLEKLKEMLYGNEDPAQVYYKEQTFQIKQTTQGFTLELYIPGIP
FT                   KDQIQLGKNGDELHVRIGNHRRNMVLPQALASLKTTGAEMDGDHLIIHFVEP"
FT   gene            complement(237528..238454)
FT                   /locus_tag="Cpha266_0214"
FT   CDS_pept        complement(237528..238454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0214"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: cte:CT2075 TPR
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64281"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD04"
FT                   /protein_id="ABL64281.1"
FT                   /translation="MHSIHRTFITATVFILVFTLSARGESPEDFIELGIVKGRSGDTSG
FT                   ALDDFNRALILDPKNSGAYYNRGLVNGQLGNFSAAIADYTSAIKLNPHFPGTYNNRGFA
FT                   HAATGNYRAAIIDISKAIALDPLIPELYNNRGTVKMSLKDYIGAIEDFTKAARLNPKLA
FT                   GPFNNRGLAKSLAGNIMGAIEDFTLALVRDQTYDAAWYNRGNARLSSGDFNGAIEDYKK
FT                   ALVLQPDLIEAYNNRAFAKASLGDYRGAVDDMNILIEKGTENAMTYYNRGLAKKMLGDL
FT                   NGAIADFLKASNLGDTLSVSALREMVK"
FT   sig_peptide     complement(238380..238454)
FT                   /locus_tag="Cpha266_0214"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.971 at
FT                   residue 25"
FT   gene            238734..239249
FT                   /locus_tag="Cpha266_0215"
FT   CDS_pept        238734..239249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0215"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; KEGG: cch:Cag_1684 rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64282"
FT                   /db_xref="GOA:A1BD05"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD05"
FT                   /protein_id="ABL64282.1"
FT                   /translation="MRDEKRNFTIPFYALLIGAWYTALQITFPAFSSAQPPEFSIQSIT
FT                   NQPSASSSGMLSDQPKSRTFLRVAEGKASYYSNQFHGRRTANGETFDMNELTAAHPSLP
FT                   FGTWVRVINLRNGKDVVVRINDRGPFVRGRIIDLSAGAAKRIGLFKSGTANVRIEPVKH
FT                   SPEDPMAG"
FT   sig_peptide     238734..238838
FT                   /locus_tag="Cpha266_0215"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.844) with cleavage site probability 0.655 at
FT                   residue 35"
FT   gene            complement(239375..239815)
FT                   /locus_tag="Cpha266_0216"
FT   CDS_pept        complement(239375..239815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64283"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD06"
FT                   /protein_id="ABL64283.1"
FT                   /translation="MTNHQNQQVSFALTEITTENLSITPETFDTDKPVQMNIGLNFGIN
FT                   SEKQSLKTLFKASFHQDDQEFMVIETGCAFTLDPNSWKMLSNDEIRRFILPKTLAAHFS
FT                   VLTAGTARGILHVKTENTPLNKFIIPANNLDGLIQKDIVLNY"
FT   gene            complement(240184..240360)
FT                   /locus_tag="Cpha266_0217"
FT   CDS_pept        complement(240184..240360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0217"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   plt:Plut_1978 rubredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64284"
FT                   /db_xref="GOA:A1BD07"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD07"
FT                   /protein_id="ABL64284.1"
FT                   /translation="MEKWVCVPCGYVYDPEIGDPDSGVEPGTPFENIPDDWCCPVCGVD
FT                   KSLFEPYDERRNR"
FT   gene            complement(240597..241397)
FT                   /locus_tag="Cpha266_0218"
FT   CDS_pept        complement(240597..241397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0218"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: cch:Cag_0342
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64285"
FT                   /db_xref="GOA:A1BD08"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD08"
FT                   /protein_id="ABL64285.1"
FT                   /translation="MQINFSKLSGAGNDFIIIDNRALAIHLTQPQINALCTRRTGVGAD
FT                   GLILVEPSLHCDFTMKYFNADGFPGSMCGNGGRCAVYFAFMQGVTSAEPEHFSFEANSN
FT                   RYDAEVTNSETVRLHMLDARDFRYHMEIEGFACTFVNTGSPHVVIFADDINAINVAEKG
FT                   VAIRRNTDFFPEGTNVNFVEITSPSSIALRTFERGVEEETLACGTGAVAAAIISRKLGK
FT                   ILPNSVKVTVKSGDMLEVSFSENMQNITLTGPAKIVYQGSVTIP"
FT   gene            241814..244009
FT                   /locus_tag="Cpha266_0219"
FT   CDS_pept        241814..244009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0219"
FT                   /product="photosystem P840 reaction center, large subunit"
FT                   /note="KEGG: plt:Plut_1976 photosystem P840 reaction
FT                   center, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64286"
FT                   /db_xref="GOA:A1BD09"
FT                   /db_xref="InterPro:IPR001280"
FT                   /db_xref="InterPro:IPR036408"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD09"
FT                   /protein_id="ABL64286.1"
FT                   /translation="MAEQVNPAGVKPKGSVPPPKGNAPSPKGNGASGGPSVIKEQDAAK
FT                   MRRFLFQRTETRSTKWYQIFDTEKLDDEQVVGGHLALLGVMGFLMAIYYISGIQVFPWG
FT                   APGFHDNWFYLTIKPRMVSMGIDTYSTRSADLEQAATNLLGWALLHVISGSILLFGGWR
FT                   HWTHNLTNPFTGRAGNFRDFRFLGKFGDVVFSGTSAKSYKDALGPHAVYMSLLFLGWGL
FT                   IMWLALGWAPVPDFQTINSETFMSFVWFVVFFALGIYWWNNPPNAATHLNDDMKAAFSV
FT                   HLTAIGYINIALGVIAFVAFQQPSFAPYYKELDNLVFYLYGEPFNRVSYDFVQEGGQIV
FT                   SGSKEFTEFAPYAILPKNGEAFGMSRVVINLITFNHIICGVLYVFAGVYHGGQYLLKIQ
FT                   LNGLYNQIKSIWITKGRDQEVQVKILGTVMALCFATMLSVYAVIVWNTICELNIFGTNI
FT                   MMSFYWLKPLPMFQWMFADPSINDWVMAHVITAGSLFSLIALVRIAFFAHTSPLWDDLG
FT                   LKKNSYSFPCLGPVYGGTCGVSIQDQLWFAMLWGVKGLSAVCWYIDGAWIASMMYGVPV
FT                   ADAKAWDSVAGLQHHYTSGIFYYFWTETVTIFSSSHLSTILMIGHLIWFISFAVWFEDR
FT                   GSRLEGADIQTRTVRWLGKKFLNRDVTFRFPVLTISDSKLAGTFLYFGGTFMLVFLFIA
FT                   NGFYQTNSPLPPTVGDASLSGQQMLTQVVDYLMKLIA"
FT   gene            244107..244808
FT                   /locus_tag="Cpha266_0220"
FT   CDS_pept        244107..244808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0220"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: cch:Cag_0344 photosystem P840 reaction
FT                   center iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64287"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD10"
FT                   /protein_id="ABL64287.1"
FT                   /translation="MAEPVKQPDVPPAPVSKAAPAAPKAAPKAASPAAKQGEVKPKISA
FT                   APKQTSGKIRLEALNVNLGRTGIRQESALPVKKAPPKAAPKPAPGGAKPAPGAKPAPKT
FT                   AGAPAGTPVAKSAPAAGTPLAKAAPRAKSHYFIIENLCVGCGLCLDKCPPKVNAIGYKF
FT                   YGDVQEGGFRCYIDQDACISCSACFSTDECPSGALIEVLPDGQVLDFSFTPPERLDFDL
FT                   RFLHRFHREVR"
FT   gene            244888..245670
FT                   /locus_tag="Cpha266_0221"
FT   CDS_pept        244888..245670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0221"
FT                   /product="Dolichyl-phosphate beta-D-mannosyltransferase"
FT                   /EC_number="2.4.1.83"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   plt:Plut_1974 dolichyl-phosphate
FT                   beta-D-mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64288"
FT                   /db_xref="GOA:A1BD11"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD11"
FT                   /protein_id="ABL64288.1"
FT                   /translation="MQQKLKKKGDICDLPNEKYEAPVALVIIPTYNEADNIEKLLVAIF
FT                   KMYPSSVDVLVIDDNSPDGTADIVREVQAYERKLHLVTRAGKLGLGTAYLKGFAYALDH
FT                   GYRFIIEMDADYSHDPEMIRTLLEKMAEADLVLGSRYLNNTVNVINWPLRRLILSKAAS
FT                   IYTRYVSGLPVSDPTSGFKCFKREVLETLDLKKVHSEGYSFQIEMNYRVWKKGFAIVEV
FT                   PIVFTDRTVGKSKMTRKNIREAIWIVWLLKLKTILRML"
FT   gene            complement(245800..247875)
FT                   /locus_tag="Cpha266_0222"
FT   CDS_pept        complement(245800..247875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0222"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM: elongation
FT                   factor G domain protein; protein synthesis factor,
FT                   GTP-binding; elongation factor Tu, domain 2 protein;
FT                   elongation factor G, domain IV; KEGG: cte:CT0144 elongation
FT                   factor EF-G"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64289"
FT                   /db_xref="GOA:A1BD12"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD12"
FT                   /protein_id="ABL64289.1"
FT                   /translation="MQSIQPDQLRNIVITGHAGAGKTILCESLALAMGVTNRLGSIDDG
FT                   TTLSDYSAEEVQRKHSLNTSVIHGFWNDKKINIIDTPGLLDFQGDVKSAMRVADTVLIT
FT                   VNAANGVEVGTDATWDYTKEYHKPTMFVLSRLDADRTNFNNTLEELRDHFGHLVTPIQF
FT                   PAEEGLGHHILIDVLMMKQLEFSPDRPGNMTISTIPDLYLKRAEEMHQQLVEAVAETDE
FT                   ELMNRYFEVGNLTEEELRTGIKSALLTRTFFPVFCTSPLHLIGTERLLNIIVNLCPSPI
FT                   ERGPEHALCSLDDTERLLQPDPDGPTIAFIFKTMSEPRVGEISYLRVYSGHLETGHELI
FT                   DVQTGQPEKIGQVYTIIGQKKTPVEKLLAGDIGMVVKLKDAHTNDTLADKGSNCRISPI
FT                   LFPVPVLASAIIPVTQGDEEKISAGLHHLHEEDPSFTIMHDVEFNQTILKTFGETHLEI
FT                   IISRLQNKFNVTVEIAPIKIPYRETIRVTSTAQGKYKKQSGGRGQYGDVWVRLEPKERD
FT                   SGFEFSSEVVGGVVPTRYIPAVEKGLRESIEAGVLAGYPVVDMKAIVYDGSFHPVDSSE
FT                   FAFKIAASMAFKAAFDKAKPLLLEPFYELNVFAPEQYTGEIVGEISSKRGKILGMDTDA
FT                   RFQIVKALIPQAALTSFHHALIRLTQSRARYTYKFNHYEEAPPEIVKQVTSEKSVA"
FT   gene            248120..249433
FT                   /locus_tag="Cpha266_0223"
FT   CDS_pept        248120..249433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0223"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="PFAM: enolase; KEGG: cch:Cag_0347 enolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64290"
FT                   /db_xref="GOA:A1BD13"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BD13"
FT                   /protein_id="ABL64290.1"
FT                   /translation="MPIIRKILARQILDSRGNPTVEVDVYTENSFGRAAVPSGASTGVH
FT                   EAVELRDGDSAVYLGKGVLKAVDHVNTVINDRLKGMFVTDQEEIDMAMLALDGTPNKSR
FT                   LGANALLGVSMACAKAGAEYSGLPLYRYIGGTMANTLPVPMMNVLNGGAHADNTVDFQE
FT                   FMIMPVGFSSYSDALRSGAEIFHALKSLLKSKGLSTAVGDEGGFAPNLKSNEEAIELVI
FT                   EAVGKAGYKIGSSTANGGLGDAQVMIALDPASSEFYDAAKQKYVFKKSSKQELSSLEMA
FT                   EYWEKWASDYPIISIEDGMAEDDWDGWKILTDKIGSRVQLVGDDLFVTNTSRLALGIER
FT                   GVGNSILVKVNQIGTLTETLQAIDLARRNGYTAVISHRSGETEDSTIAQIAVATNAGQI
FT                   KTGSLSRSDRMAKYNELLRIEEELGLQAKYPALSAFRV"
FT   gene            249641..249946
FT                   /locus_tag="Cpha266_0224"
FT   CDS_pept        249641..249946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0224"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG:
FT                   plt:Plut_1971 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64291"
FT                   /db_xref="GOA:A1BD14"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD14"
FT                   /protein_id="ABL64291.1"
FT                   /translation="MKMVNEVWAHISADPKKFFFLIALILFSVWFLFDDYGVVKRIRME
FT                   ADHRLLQQKHLEAERLILNNELRIRNAYAPDSIEKAAREKYNFRKEGEILFIIRNK"
FT   gene            249984..252017
FT                   /locus_tag="Cpha266_0225"
FT   CDS_pept        249984..252017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0225"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="KEGG: cch:Cag_0349 IspG protein; TIGRFAM:
FT                   1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase;
FT                   PFAM: IspG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64292"
FT                   /db_xref="GOA:A1BD15"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017178"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD15"
FT                   /protein_id="ABL64292.1"
FT                   /translation="MFQYRRRFTREVPFGKIALGGYMPIRVESMTNTHTLDTVATVKQC
FT                   RRLYEAGCEIIRLTVPTERDAENLRSIRDQLRSDGIDTPLVADIHFSSRAAFKAVEFVE
FT                   NIRINPGNYATKQKFSAETYTDDEYQEEIERVRKEFLPLVYKAREFGASMRIGTNHGSL
FT                   SDRIVSRYGNSPEGMVEAALEFARICEEEGYHDVLFSMKSSNVKVMIQAYRLLAVKADA
FT                   ELRYAYPLHLGVTEAGDGDEGRVKSAMGIGALLEDGLGDTIRVSLTEDPVNEVPVGFAI
FT                   VKKYNDLQLIRGENGHVPIKQLIENQGSSFTNELPPFDPFSYQRRISRSFFVGGFAIGG
FT                   DSMPRVETEAVIPLCRPEELFHEIMQRLLPEESIDAIRSELVGVRVNTVEDLELLDELL
FT                   SRLGEAKRFITVSTKDIELFFRLLDKVEKVRLDITEGEMLDRNIFDRLTNDRLASVEFC
FT                   FLHETSGAGVPAEVLGLLAQKAGLQGLERIFFSILSAHSVFVYRRLVQFFSKRGFDYPL
FT                   VIRFRQMDSVKLDCLISCAVQTGSLFSDGIGDVLALQTGLDVAAEITLAFNILQGARIR
FT                   MSKTEFISCPGCGRTYFDLEKAAASIKLRLSHLKGLKVGIMGCVVNGPGEMADADFGYV
FT                   GSGKGRISLYVGKECVEENLPESAAVDRLVGLIQEKGKWVNP"
FT   gene            252086..252865
FT                   /locus_tag="Cpha266_0226"
FT   CDS_pept        252086..252865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0226"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: plt:Plut_1969 oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64293"
FT                   /db_xref="GOA:A1BD16"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD16"
FT                   /protein_id="ABL64293.1"
FT                   /translation="MLFTLVTGASMGIGEAFARKFAETGTSLLLVARSEDKLLALAEEL
FT                   KASGATDVRILAEDLSREGSPERIYEFCLRENIAIDVLVNCAGLSFAGDFDKLPVGKLE
FT                   EIMAVNMLALCRLTRLFLPGMIKRKGGGIMNIASIGGFQGVPGLALYSATKSFVITLTE
FT                   ALHTELKETGVKAVAVCPGFIQTGFLAKAGHSQDGILLPVYSRDLVVKAAIKGYKKNRL
FT                   RIFPTVIDFLLVFSQRFVPRKTAVKLADVLSSARSRR"
FT   gene            252936..253008
FT                   /locus_tag="Cpha266_R0003"
FT                   /note="tRNA-Thr1"
FT   tRNA            252936..253008
FT                   /locus_tag="Cpha266_R0003"
FT                   /product="tRNA-Thr"
FT   gene            253022..253104
FT                   /locus_tag="Cpha266_R0004"
FT                   /note="tRNA-Tyr1"
FT   tRNA            253022..253104
FT                   /locus_tag="Cpha266_R0004"
FT                   /product="tRNA-Tyr"
FT   gene            253131..253203
FT                   /locus_tag="Cpha266_R0005"
FT                   /note="tRNA-Thr2"
FT   tRNA            253131..253203
FT                   /locus_tag="Cpha266_R0005"
FT                   /product="tRNA-Thr"
FT   gene            253227..253302
FT                   /locus_tag="Cpha266_R0006"
FT                   /note="tRNA-Trp1"
FT   tRNA            253227..253302
FT                   /locus_tag="Cpha266_R0006"
FT                   /product="tRNA-Trp"
FT   gene            253349..253540
FT                   /locus_tag="Cpha266_0227"
FT   CDS_pept        253349..253540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0227"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: plt:Plut_1968 SecE
FT                   subunit of protein translocation complex"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64294"
FT                   /db_xref="GOA:A1BD17"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD17"
FT                   /protein_id="ABL64294.1"
FT                   /translation="MNKYVGKVGQYYRDVVSEMRKVVWPGKDELKDLTIVVLTVSGILA
FT                   LFTFLVDWVINAVMGLLL"
FT   gene            253562..254137
FT                   /locus_tag="Cpha266_0228"
FT   CDS_pept        253562..254137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0228"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="KEGG: plt:Plut_1967 NusG antitermination factor;
FT                   TIGRFAM: transcription termination/antitermination factor
FT                   NusG; PFAM: transcription antitermination protein NusG;
FT                   SMART: NGN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64295"
FT                   /db_xref="GOA:A1BD18"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD18"
FT                   /protein_id="ABL64295.1"
FT                   /translation="MNTRKKAVEEQGVPGPRWYALRIYSGHERKVKEGIEAEVARCGLA
FT                   DKILQIYVPYERFVEVKNGKKRSLTKNAFPGYVLIEAVLDKQTRNVILDMPSVMGFLGV
FT                   DDVPTPLRPEEVEKILVTENTVEHRAVIEAPFRIGDSVKVIDGPFSSLTGVVHEVCTER
FT                   MKVKVMISFFGRSTPTELDFSQVKSVSQ"
FT   gene            254181..254606
FT                   /locus_tag="Cpha266_0229"
FT   CDS_pept        254181..254606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0229"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="PFAM: ribosomal protein L11; KEGG: plt:Plut_1966
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64296"
FT                   /db_xref="GOA:A1BD19"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BD19"
FT                   /protein_id="ABL64296.1"
FT                   /translation="MAKKIIGFIKLQIPAGAANPAPPVGPALGQKGVNIMEFCKQFNAK
FT                   TQAEAGMITPVVITVYSDKSFTFITKTPPAAVLLLKEAQLKKGSGEPNRNKVGTVSREQ
FT                   VRRIAELKMPDLNAVDVAGAEQMVMGTARSMGIVVEN"
FT   gene            254677..255366
FT                   /locus_tag="Cpha266_0230"
FT   CDS_pept        254677..255366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0230"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="PFAM: ribosomal protein L1; KEGG: plt:Plut_1965 50S
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64297"
FT                   /db_xref="GOA:A1BD20"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BD20"
FT                   /protein_id="ABL64297.1"
FT                   /translation="MAGKKYRDAVAKTDRFQEYDLVDAVEKIREITQVKFDATIDIAMK
FT                   LGVDPRHADQVVRGTVMLPHGTGKTVSVLVVCKEAKAEEAVAAGADFVGFEEYVEKIQN
FT                   GWTGVDVIIATPDVMGQLGKVAKILGPRGLMPNPKSGTVTMDVAKAVKEVKAGKIEFRV
FT                   DKAGNVHAPVGKVSFQSEQLVENITSFLKEVVRLKPSAAKGQYVQGIALSSTMSPSVKV
FT                   KREKFVA"
FT   gene            255384..255902
FT                   /locus_tag="Cpha266_0231"
FT   CDS_pept        255384..255902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0231"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="PFAM: ribosomal protein L10; KEGG: plt:Plut_1964 50S
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64298"
FT                   /db_xref="GOA:A1BD21"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BD21"
FT                   /protein_id="ABL64298.1"
FT                   /translation="MKRDKKEQIVQDVAEKIDRSQGIYLTEFQGLSVAKMAELRNEFRK
FT                   AGVEYRVVKNTLIKKALRDLSSADRLASGLKSTTAVAFGYDDPLAPAKIIRKFSKTNEA
FT                   LKFKMASIDGVVYDADSLPALSEMLSKTENIGRAAGLINGVVSSVPMVVNAVARNLVSV
FT                   LDQIAKQKQ"
FT   gene            255969..256346
FT                   /locus_tag="Cpha266_0232"
FT   CDS_pept        255969..256346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0232"
FT                   /product="LSU ribosomal protein L12P / LSU ribosomal
FT                   protein L12P"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12-like; KEGG: plt:Plut_1963 ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64299"
FT                   /db_xref="GOA:A1BD22"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BD22"
FT                   /protein_id="ABL64299.1"
FT                   /translation="MSIETLVEEIGKLTLTEASELVKALEEKFGVSAAPAMMAGVMAAA
FT                   PAGDAPAQEEKTEFDVVLTAAGESKINVIKVVRALTGLGLKEAKDLVDGAPKTVKEGIS
FT                   KDEAEKVAKELKDVGASVELK"
FT   gene            256527..260465
FT                   /locus_tag="Cpha266_0233"
FT   CDS_pept        256527..260465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0233"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: plt:Plut_1962 DNA-directed RNA polymerase beta
FT                   subunit; TIGRFAM: DNA-directed RNA polymerase, beta
FT                   subunit; PFAM: RNA polymerase Rpb2, domain 6; RNA
FT                   polymerase Rpb2, domain 7; RNA polymerase beta subunit; RNA
FT                   polymerase Rpb2, domain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64300"
FT                   /db_xref="GOA:A1BD23"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BD23"
FT                   /protein_id="ABL64300.1"
FT                   /translation="MQFDKSEVHVKVADATPTPCIDFSKIQSVIDPPDLLKVQLDSFHN
FT                   FIQDSVPLAKRRDQGLERVLRSAFPITDTRGLYLLEYISYSFDKPKYTVEDCIERGLTY
FT                   DVSLKVKLKLSYKDEPDEADWKETIQQEVYLGRIPYMTERGTFIVNGAERVVVAQLHRS
FT                   PGVVFSEAIHPNGKKMYSAKIVPTRGSWIEFQTDINNQIFVYIDQKKNFLVTALLRAIG
FT                   FAKDEDILGLFDLVEEVKITSAKKEQLIGQYLASDIVDMQTGEVVSARTAITEDIVDQI
FT                   IAAGYKSVRVMKSFSGNDKGPDKSIIINTILNDNSATEEEALEIVYEELRANEAPDIDA
FT                   ARSFLERTFFNQKKYDLGDVGRYRIRKKLSKEFEELHGYLDGQPELKKLSDTIYEKILH
FT                   TIQSFSDEPIGGDILVLTHYDIIAVIYYLIKLVNGQAEVDDVDHLANRRVRSVGEQLAA
FT                   QFVIGLARMGKNVREKLNSRDSDKIAPSDLINARTVSSVVSSFFATSQLSQFMDQTNPL
FT                   AEMTNKRRVSALGPGGLTRERAGFEVRDVHYTHYGRLCPIETPEGPNIGLISSLSVYAE
FT                   INDKGFIQTPYRVVTNGVVTDTVLMLSAEDEENKITVPVSIPLDENMKIAIESVQARTK
FT                   GDYPLVPAEDVNYMDVSPVQIVSAAAALIPFLEHDDGNRALMGANMQRQAVPLLTAEAP
FT                   IVGTGMESKVARDSRSVILAEGDGIVDDVTAEYIKVRYDIDADTDVRLSLLDPDEGLKT
FT                   YKLIKFKRSNQDTCISQKPLIHIGQRVSKGDVLADSSSTENGELALGKNVLVAFMPWRG
FT                   YNFEDAIILSERLVYDDVFTSIHIHEFEANVRDTKRGEEQFTRDIYNVSEDALRNLDEN
FT                   GIVRIGAEVKERDILVGKITPKGESDPTPEEKLLRAIFGDKSSDVKDASMHVPAGMKGI
FT                   VIKTKLFSRKKKVGLDIKEKIEILEKKYDYKEYDLRKKFLKRLKQLLEGKTSTGIYSDK
FT                   GKLLVAEDAVYDDSVLERFTAIPFLESIDFVKGVTQSEKVNENVMLLVKEFRLKLKDLN
FT                   DERDNEKYKLNVGDELPPGIEELAKVYIAQKRKIQVGDKMAGRHGNKGVVGKILPIEDM
FT                   PFMENGKPVDIVLNPLGVPSRMNIGQLYETSLGWAGKELGVKFKTPIFNGATYQEVQQE
FT                   LEKAGLPSHGKVSLYDGRTGEQFDDEVTIGYIYMLKLSHLVDDKIHARSTGPYSLITQQ
FT                   PLGGKAQFGGQRFGEMEVWALEAYGAANILREMLTVKSDDVIGRNKTYEAIVKGQNLPE
FT                   PGTPESFNVLVRELQGLGLEIRIDDRVP"
FT   gene            260535..265013
FT                   /locus_tag="Cpha266_0234"
FT   CDS_pept        260535..265013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0234"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: cch:Cag_0358 DNA-directed RNA polymerase beta'
FT                   subunit; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase, alpha subunit; RNA
FT                   polymerase Rpb1, domain 3; RNA polymerase Rpb1, domain 1;
FT                   RNA polymerase Rpb1, domain 5; RNA polymerase Rpb1, domain
FT                   4; SMART: RNA polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64301"
FT                   /db_xref="GOA:A1BD24"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BD24"
FT                   /protein_id="ABL64301.1"
FT                   /translation="MIFSQGASPLKGDFSKIKFSIASPESILAHSRGEVLKPETINYRT
FT                   FKPERDGLMCEKIFGPTKDWECYCGKYKRVRYKGIICDRCGVEVTTKSVRRERMGHISL
FT                   AVPVVHTWFFRSVPSKIGALLDLSTKELERIIYYEVYVVINPGEPGAKQGIKKLDRLTE
FT                   EQYFQIITEYEDNQDLDDHDSDKFVAKMGGEAIRLLLKSIDLNETAIHLRKVLKESSSE
FT                   QKRADALKRLKVVEAFRKSYEPQKKTRKKAVGLFPEDELPEPYVFEGNKPEYMVMEVVP
FT                   VIPPELRPLVPLEGGRFATSDLNDLYRRVIIRNNRLKKLIDIRAPEVILRNEKRMLQEA
FT                   VDALFDNSRKANAVKTGESNRPLKSLSDALKGKQGRFRQNLLGKRVDYSGRSVIVVGPE
FT                   LKLHECGLPKSMAIELFQPFVIRRLVERGIAKSVKSAKKLIDKKDQVVWDVLEKVIDGR
FT                   PVLLNRAPTLHRLGIQAFQPVLIEGKAIQIHPLVCTAFNADFDGDQMAVHVPLSQEAQL
FT                   EAALLMLSSHNLILPQSGKPVTVPSQDMVLGMYYLTKSRPGDPGEGRIFYSDEDVLIAY
FT                   NEDRIGLHAQIFVHFNGAVDQKFDPLRVLDTIVDPKSEKYTWLKSQLEKKTILLTTVGR
FT                   VIFNQNVPDSIGFINRVIDKKVAKELIGRLSSDVGNVETAKFLDNIKEVGFHYAMKGGL
FT                   SVGLSDAIVPDTKVRHIKNAQKDSTKVVKEYNRGTLTDNERYNQIVDVWQKTSNIVAEE
FT                   SYQKLKKDREGFNPLYMMLDSGARGSREQVRQLTGMRGLIARPQKSMSGQPGEIIENPI
FT                   ISNLKEGLTVLEYFISTHGARKGLSDTSLKTADAGYLTRRLHDVAQDVIVTIEDCGTTR
FT                   GLHVYRNIEEETSGQIKFREKIRGRVAARDIYDTLNNNVIVKAGEIITEELGDLIQETA
FT                   GVEEAEIRSVLTCESKIGICSKCYGTNLSVHQIVEIGEAVGVIAAQSIGEPGTQLTLRT
FT                   FHQGGTAQGGISETETKAFYEGQLEFEDLKTVEHSAITEDGVEEIRIIVVQKNGKINIV
FT                   DPDSGKILKRYVVPHGAHLHCNAKALVKKDQVLFSSEPNSTQIIAELHGRVKFADIEKG
FT                   VTYKEEVDPQTGFAQHTIINWRSKLRANETREPRVLIIDESGEVRKNYPVPIKSNLYVE
FT                   DGQKIVPGDIIAKVPRNLDRAGGDITAGLPKVTELFEARIPSDPAIVSEIDGYVSFGSQ
FT                   RRSSKEIKVKNDFGEEKVYYVQVGKHVLANEGDEVKAGDAMTDGAVSPQDILRIQGPNA
FT                   VQQYLVNEIQKVYQINAGVEINDKHLEVIVRQMLQKVRVEEPGDTELLPGDLIDRSAFV
FT                   EANNNVAEKVRVTEKGDAPSRIQEGQLYKTRDITKLNRELRKNSKNLVAFEPALQATSH
FT                   PVLLGITSAALQTESVISAASFQETTKVLTDAAVAGKIDYLAGLKENVIVGKLIPAGTG
FT                   LKRYRNLTLTGESVETISHDASDDASTQNGI"
FT   gene            complement(265212..266558)
FT                   /locus_tag="Cpha266_0235"
FT   CDS_pept        complement(265212..266558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0235"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: phosphoribosylglycinamide synthetase; ATP-dependent
FT                   carboxylate-amine ligase domain protein, ATP-grasp;
FT                   Carbamoyl-phosphate synthase L chain, ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; KEGG: cch:Cag_0359
FT                   acetyl-CoA carboxylase, biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64302"
FT                   /db_xref="GOA:A1BD25"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD25"
FT                   /protein_id="ABL64302.1"
FT                   /translation="MFKKILVANRGEIALRIMQTCREMGISTVAVYSTADAESIHVKYA
FT                   DEAVCIGPALSRESYLNIPRIIAAAEVTNADAIHPGYGFLAENADFAEVCSSVNIKFIG
FT                   PTAKMINQMGDKNTAKATMIAAGVPVVPGSQGLVSNLAEAVKTAQNTGYPVIIKPTAGG
FT                   GGKGMRVVHEENQLEKALNTARSEAEQAFGNSGVYIEKFLENPRHVEIQILSDQHGNTI
FT                   HLGERDCTVQRRHQKLIEETPSPAVDDALRKTMGDAAVAAAAAINYEGAGTIEFLLDKH
FT                   GKFFFMEMNTRIQVEHPVTEERYDVDIVREQIIIADGQSIAGRTFTPKGHSIECRINAE
FT                   DPDHLFRPSPGQLQVFHTPGGHGVRVDSHAYASYVVPSNYDSMIAKLIVTAHTRDEAIA
FT                   RMSRALDEFIVLGVKTTIPFHKQVMHSAVFQSGVFDTSFLESFRYEKSI"
FT   gene            complement(266578..267072)
FT                   /locus_tag="Cpha266_0236"
FT   CDS_pept        complement(266578..267072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0236"
FT                   /product="biotin carboxyl carrier protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: plt:Plut_1959 acetyl-CoA
FT                   biotin carboxyl carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64303"
FT                   /db_xref="GOA:A1BD26"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD26"
FT                   /protein_id="ABL64303.1"
FT                   /translation="MNLNEIKQLIDIVNSSDLQEAIIEEGDFKITLRRHPIAGLSYLQP
FT                   AEQQNAPYSVTPPSLSREVASQTPESVAAPAANPKAEPMAGLIDVCSPIVGTFYRSSSP
FT                   DAPAFVNINDTVNKGDVLCIIEAMKLMNEIEAEMSGTIVEILVENGHPVEYDQPLFRIK
FT                   P"
FT   gene            complement(267125..267691)
FT                   /locus_tag="Cpha266_0237"
FT   CDS_pept        complement(267125..267691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0237"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /note="TIGRFAM: translation elongation factor P; PFAM:
FT                   Elongation factor P/YeiP protein; Elongation factor, KOW
FT                   domain protein; KEGG: cch:Cag_0361 elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64304"
FT                   /db_xref="GOA:A1BD27"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BD27"
FT                   /protein_id="ABL64304.1"
FT                   /translation="MTSISNVSKGSIIRFKGEPHIIESLIHRTPGNLRAFYQANMKNLK
FT                   TGRNVEFRFSASESVDVIVTERKPYQYLYKDGTDFVMMDSGTFDQINVPEITLGTSSRF
FT                   LKDGITVVIVFSDDGSILDVEMPTFVEVEVTETSPTTKDDRATSGTKPAIVETGAEVGV
FT                   PMFIQTGSIIRVDTRTGEYIERVKK"
FT   gene            267907..268182
FT                   /locus_tag="Cpha266_0238"
FT   CDS_pept        267907..268182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0238"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: cte:CT0160 DNA-binding protein HU-beta"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64305"
FT                   /db_xref="GOA:A1BD28"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD28"
FT                   /protein_id="ABL64305.1"
FT                   /translation="MSKAELVEKIASQAGLTKVDAERAVNAFMNVVTESLKEGEDVTLV
FT                   GFGTFTTGERAERQGRNPQNGETITIAAKKVVKFKPGKALKAGVEG"
FT   gene            268272..269273
FT                   /locus_tag="Cpha266_0239"
FT   CDS_pept        268272..269273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0239"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, alpha subunit; PFAM: acetyl-CoA carboxylase,
FT                   alpha subunit; KEGG: cch:Cag_0363 acetyl-CoA carboxylase,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64306"
FT                   /db_xref="GOA:A1BD29"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BD29"
FT                   /protein_id="ABL64306.1"
FT                   /translation="MANRVVLDFEKPLFELEAKLEEMRVYLRNSSRDQDSSDQDVLNRE
FT                   IEALEVKVETLRRSIYKNLTRWQKVQLARHAERPFTLDYIYMMTRDFVEMAGDRYFSDD
FT                   KAIVGGFAILEDIPSGFSQPVMIIGHQKGRDTKSNLYRNFGMAQPEGYRKALRLMKLAE
FT                   KFNKPVITLIDTPGAFPGIEAEERGQAEAIARNLFEMARLTVPVICVIVGEGASGGAIG
FT                   LGVGNRILMAENSWYSVISPESCSSILWRSWNYKEQAAEALQPTAEDLLAQGIIDRIIP
FT                   EPMGGAHTDPEAMAGTLKEMLIEELRILMSKESDVLVRERVEKFSGMGVWDE"
FT   gene            complement(269383..270411)
FT                   /locus_tag="Cpha266_0240"
FT   CDS_pept        complement(269383..270411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0240"
FT                   /product="thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: cch:Cag_0365 ferrodoxin oxidoreductase
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64307"
FT                   /db_xref="GOA:A1BD30"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD30"
FT                   /protein_id="ABL64307.1"
FT                   /translation="MTDTRAQLTAKDFTSNQEPKWCPGCGDFAVLQQLKNAMADLGLKT
FT                   EEVVVVSGIGCSSRLPYYIATYGVHGIHGRALAMASGLKTARPELSVWVGTGDGDALSI
FT                   GGNHYIHTVRRNLDLNVILFNNEIYGLTKGQYSPTSKVGLRTVTSPNGVVDHPINTAAL
FT                   TLGAGGTFFARVMDRDGKIMRDIFKRAAEHKGTSLIEIYQNCPIFNDGAFDPFTDKDRK
FT                   ADTTLYLEQGKPLVFGKQNDKGIRLDGFTPVIVDLNNPSVSQNDLWIHDEKDFIKANML
FT                   ARFFDDPDASEDFLPRPFGIFYVEDRYTYESALSAQIEKAQENGEGTIEELLAGSNTWT
FT                   IA"
FT   gene            complement(270415..272298)
FT                   /locus_tag="Cpha266_0241"
FT   CDS_pept        complement(270415..272298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0241"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   pyruvate flavodoxin/ferredoxin oxidoreductase domain
FT                   protein; KEGG: cte:CT0163 2-oxoglutarate ferredoxin
FT                   oxidoreductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64308"
FT                   /db_xref="GOA:A1BD31"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD31"
FT                   /protein_id="ABL64308.1"
FT                   /translation="MSETTILNREDMVTAKTSVSVLFAGDSGDGMQLTGTQFANTVAVY
FT                   GSDLNTFPNFPSEIRPPAGTVAGVSGFQLQFGTSSVYTPGAKFDVMIVMNAAALKANLN
FT                   NLHHGGIIITDTDGFDAKNLKLSGYGEENNPLRDGTLNDYTVFEIPVVSLTRKALAETG
FT                   LSTKNIDRCKNMFVLGVLYWLYSLPLETTIETLKTKFAKKLDLAEANIKAVTAGYNFGD
FT                   ETEMFSQHGRFSVAPADKKPGVYRRVTGNEASAIGLAVAAKKAGLELFLGSYPITPATE
FT                   ILQTLAGLKKWGVKTFQAEDEIAGVLSSIGAAYGGALAATNTSGPGLALKSEGLGLAVI
FT                   LEIPLVIINVMRGGPSTGLPTKPEQSDLLMAMYGRHGDAPMPVIAAKSPVDCFYAAYEA
FT                   AKIAVEYMTPVLCLTDGYLALSSEPMLVPSPDDLASITPVFSPARNADDPPYLPYKRDD
FT                   RAVRPWAKPGTPGLEHRIGGLEKQNETGNVSHDPENHELMTKLRAEKVARVADIIPDLT
FT                   IDNGPESGDILVLGWGSTYGAIKKAVEQVLEGGCSVAHAHLRYINPFPKNLGEVMGHYK
FT                   KVLIPENNCGQLLSMIRDKFLIEPVGFSKVQGLPFNEMEIEAKITDILKEL"
FT   gene            complement(272505..272774)
FT                   /locus_tag="Cpha266_0242"
FT   CDS_pept        complement(272505..272774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1953 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64309"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD32"
FT                   /protein_id="ABL64309.1"
FT                   /translation="MSWGVEDEKRRKGVLELMELSSRIVKENPNHVNEVAKSTTGCWME
FT                   QMYGMQRCDFCDLASDCPVREETEWQEYLRVNNIVIVKDNDNIT"
FT   gene            273033..275699
FT                   /locus_tag="Cpha266_0243"
FT   CDS_pept        273033..275699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0243"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="KEGG: cch:Cag_0369 alanyl-tRNA synthetase; TIGRFAM:
FT                   alanyl-tRNA synthetase; PFAM: alanyl-tRNA synthetase, class
FT                   IIc; phosphoesterase, DHHA1; Threonyl/alanyl tRNA
FT                   synthetase, SAD"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64310"
FT                   /db_xref="GOA:A1BD33"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BD33"
FT                   /protein_id="ABL64310.1"
FT                   /translation="MNSREIRQSFLDFFDRKGHTIVRSAPVIPLDDPTLLFTNAGMNQF
FT                   KDVFLDKGTRPYVRAADTQKCIRASGKHNDLEDVGRDTYHHTFFEMLGNWSFGDYYKKE
FT                   AISWAWELLTSVWHLPKERLYATVYYDDEESYLLWQEETDIPHDHIIKFDEKDNFWEMG
FT                   ETGPCGPCSEIHIDLTEDGSGKPLVNAGDYRVIELWNLVFIQYNRQADGRLEPLPQKHV
FT                   DTGMGFERVCAVMQGKASNYDTDVFRPLFDRITEITGVSYNASLDDPSDIAMRVLADHA
FT                   RTLTFALTDGAMPSNEGRGYVLRRILRRALRYSKTLGCSEPLLYRLVETLAASMGDVFP
FT                   ELRKQQQAVSRIIRAEEESFLATLDRGIEIFNELIAAVRSRGTTVVSGDDAFRLYDTFG
FT                   FPLDLTRLMAAEAGFEVDEEGFDRCMKEQKTRARQDRRDKQHLKGDEGEWTWFSAERTS
FT                   VFTGYHSLEELASITGVSIFSDRLLVVLDRTPFYAESGGQCGDRGWIETAAYRLRVSDT
FT                   RKDGDMIVHLVTEVRDSVSDGAISPADLSFDEGKLACRASVDRSDRQGTERNHTATHLL
FT                   HAALRRTLGQHVQQKGSFVSSERLRFDFSHFARLTSEELAIVESEVNEQIRSAEPVVKH
FT                   QDIPYDEAIARGALAFFGDKYADRVRVVEIAGLSVELCGGTHVDSIGQIGLFKIVSESS
FT                   VASGVRRIEALTGKAAEVLLWKEYRELQDIRQMLKLKADEEVIGRIAELADSKKELEKQ
FT                   LQVYRTEALSGILQRSLDAAESVGSIRFMTLRLEHVDQDSLRQAVLALREKDPASTGLL
FT                   CTEEDGKVSLTAFAGERAVGEFGLDAGKLVREAAAFVRGGGGGKPEFATAGGKDPEGIQ
FT                   KAFDSFAASVREKVSAK"
FT   gene            275723..277081
FT                   /locus_tag="Cpha266_0244"
FT   CDS_pept        275723..277081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0244"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: plt:Plut_1951
FT                   NADH oxidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64311"
FT                   /db_xref="GOA:A1BD34"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD34"
FT                   /protein_id="ABL64311.1"
FT                   /translation="MKKNVDVLVIGGSAAGIVAASTGKAFYPLKNFLIVRREREAVVPC
FT                   GIPYIYGTLESINQNIIPNAHIEQAGVELFIDEVVAVDRGAKVATTADGTQITFDKLVF
FT                   ATGSMPKVPAWLKGTGLGNVFTIPKDRDYLENLRMTLEQCTNIVIIGGGFIGVEIADEL
FT                   RKKGKRITLIEVMPHVLSAAFDDDLSVKVEKILTDNGVMLRTGEKVRELSGEGSVSGVV
FT                   LENGEILAADAVILATGYAPNVDLARNAGIKINELGAIRVDEYMRTEDKDIFAVGDCAE
FT                   KFSFITRIVKGLMLAATACSEARIAGMNLYGLSRLRTFSGTISIFSTAIGGTTFAAAGV
FT                   TEHLALDRGFDVISASAEGIDKHPKSLPGTSSQFVKLIVNRDSGLVLGGAVVGGVSAGE
FT                   LINVIGVIIENKMTIHEVLTLQVGTHPLLTGPPTGYPLIKAAEAVVKKLRSSR"
FT   sig_peptide     275723..275785
FT                   /locus_tag="Cpha266_0244"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.870) with cleavage site probability 0.605 at
FT                   residue 21"
FT   gene            277187..277681
FT                   /locus_tag="Cpha266_0245"
FT   CDS_pept        277187..277681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0245"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: plt:Plut_1949 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64312"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD35"
FT                   /protein_id="ABL64312.1"
FT                   /translation="MLVFDCFFGRCEKPSCEGCALKLVRSLRLALKSRAMQKDEEFAVE
FT                   TACSPEKPAMVALQAKTTSHKQDATKKRKRLLAPREEIPWYPTIKPELCNGCGDCKVLC
FT                   KPGVFELGAPDPSGIHRPKLVVAHPYKCLVLCTRCVPICTSGAIILPPKEDFERFVEYL
FT                   D"
FT   gene            277733..278035
FT                   /locus_tag="Cpha266_0246"
FT   CDS_pept        277733..278035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0246"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: cte:CT0168 ferredoxin, 4Fe-4S, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64313"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD36"
FT                   /protein_id="ABL64313.1"
FT                   /translation="MSGLPSPSKKKKRLLAPREEIAWFPVIDTAACNGCGDCEGFCKPG
FT                   VFALGEPEGVKRARMTVANPWNCIVLCTRCEPVCPSGAITLPRPEDFERFVEYVD"
FT   gene            complement(278091..279047)
FT                   /locus_tag="Cpha266_0247"
FT   CDS_pept        complement(278091..279047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0247"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein; KEGG: pgi:PG0859
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64314"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD37"
FT                   /protein_id="ABL64314.1"
FT                   /translation="MDRRCLYCYEPLASGEGDFHRKCSRKMFGTPLPPELPYDENQLEE
FT                   LALEVIRSQTAITGVQPKLSLHLEPAGKAHAPQRFTIVGLWGGYILKPPSQRFRQLPEI
FT                   EDLTMRMAEAARIDTVPHSLIRMRSGALAYLTRRIDRTGNGKLHMEDMCQITGRLTENK
FT                   YHGSYEQIAKAIHRYSANPGLDVINFFEVVLFCFLSGNADMHLKNFSLIDIEAKGGYSL
FT                   APAYDLVSTGLVMPSDKEDLALTLDGKKTRITLNDFRAAFGVLTIDEVVQERMFRKFRN
FT                   VLPLWDLLIEKSFLDYENQAAYKELIRKKCHQIRLDA"
FT   gene            complement(279052..279375)
FT                   /locus_tag="Cpha266_0248"
FT   CDS_pept        complement(279052..279375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pgi:PG0858 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64315"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD38"
FT                   /protein_id="ABL64315.1"
FT                   /translation="MQKAEIRYLDRTAGWFIQDEEGFHFLYDQAYLDSKDARPVSLTLP
FT                   LRAAAYSSRTMFPFFDGLIPEGWLLAVAERNWKLDPRDRMGLLLNCCRDCIGAVSVHPV
FT                   IME"
FT   gene            complement(279379..279585)
FT                   /locus_tag="Cpha266_0249"
FT   CDS_pept        complement(279379..279585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0249"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   pgi:PG0857 transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64316"
FT                   /db_xref="GOA:A1BD39"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017507"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD39"
FT                   /protein_id="ABL64316.1"
FT                   /translation="MKDIAEFVRDRRKALGMTQPELAEKAGTGLRFIRDLEQGKKTLRM
FT                   DKVNQVLALFGFVLAPVSPEREA"
FT   gene            complement(279920..281137)
FT                   /locus_tag="Cpha266_0250"
FT   CDS_pept        complement(279920..281137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0250"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /note="KEGG: cte:CT0173 phosphoserine phosphatase; TIGRFAM:
FT                   phosphoserine phosphatase SerB; HAD-superfamily hydrolase,
FT                   subfamily IB (PSPase-like); PFAM: amino acid-binding ACT
FT                   domain protein; Haloacid dehalogenase domain protein
FT                   hydrolase; Haloacid dehalogenase domain protein hydrolase,
FT                   type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64317"
FT                   /db_xref="GOA:A1BD40"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD40"
FT                   /protein_id="ABL64317.1"
FT                   /translation="MSELLLINLTGLDKPGLTSKITAILADARVPVLDIGQAVIHNHLS
FT                   LGMLVEVPKESASSPVLKDLLFCAHTLGIQISFTPVADEEYDRWVGEQGKPRYLLSLLS
FT                   RKISAEQLKRVSSIVAEHDLNIDTISRLSGRIPLDNGDNHTRACVEFSLRGTLSDENLF
FT                   REQLLAITDSLGIDIAFQEDNIFRRNRRMVVFDMDSTLITSEVIDELALEAGVGEEVSA
FT                   ITEQAMRGELDFNESLQRRVAQLKGLDEHVMESIAARLQLTEGAERLFGNLKRLGYKTA
FT                   ILSGGFTYFGHYLQKKLSIDYVYANTLEIENGCLTGRVLGRVVDGARKAELLELLAEKE
FT                   NISLEQTVAVGDGANDLPMLGKAGLGIAFRAKPIVRERAKQAISTLGLDAILYLMGFRD
FT                   RDELSE"
FT   gene            281769..282989
FT                   /pseudo
FT                   /locus_tag="Cpha266_0251"
FT   gene            complement(283296..283586)
FT                   /locus_tag="Cpha266_0252"
FT   CDS_pept        complement(283296..283586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0714 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64318"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD41"
FT                   /protein_id="ABL64318.1"
FT                   /translation="MIFSFHPEAKEEFDKAIEYYENIAPGLGYDFALEVHSAIKRSIEH
FT                   PNAWAVLYEDVRRSLVRRFPYGVLYSKEPAEIFILAVMNLHRNPGYWKKRK"
FT   gene            complement(283583..283807)
FT                   /locus_tag="Cpha266_0253"
FT   CDS_pept        complement(283583..283807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0253"
FT                   /product="putative addiction module component, TIGR02574
FT                   family"
FT                   /note="TIGRFAM: putative addiction module component,
FT                   TIGR02574 family; KEGG: swo:Swol_1551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64319"
FT                   /db_xref="InterPro:IPR013406"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD42"
FT                   /protein_id="ABL64319.1"
FT                   /translation="MNTKQLIDKAVSLPVEERALVVDSLLRSLNQPESEIDKKWSQEAK
FT                   RRLAELRSGQVQAIPGDEVFAEVWKKFES"
FT   gene            complement(283850..285070)
FT                   /locus_tag="Cpha266_0254"
FT   CDS_pept        complement(283850..285070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0254"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: cch:Cag_1580 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64320"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD43"
FT                   /protein_id="ABL64320.1"
FT                   /translation="MNDLTLFQMALGLESPWYVSSSSFDVDQKRLDIRIDFKPGSTFCC
FT                   PQCGREGVKAYDTSEATWRHLNFFQHEAYLTVRVPRISCPECGILKLQSFPWSRRESGF
FT                   TLLFEAMIMIMAKSMPVKAIAAIVGEHDTRIWRIINHYVEKAREQEDHSAVTMVGVDET
FT                   SSKRGHNYVSLFVDLAVSKVLFATEGKDAATVKRFSEDLAAHKGDPALITEFCSDMSPA
FT                   FIKGVADNFTNAQLTFDKFHIMQVINNAVDEVRRQEQKERPELQRSRYIWLKNQNNLKA
FT                   SQRKRLDELSLPRLNLKTTRAYRMRLTFQEFFEQPQVLVEAFLKKWYFWATHSQLQPMK
FT                   EAAYTIKRHWSGILRWFTSRINNGVLEGINSLIQAAKARARGYRTTKNLINMIYLISGK
FT                   LNFGLPT"
FT   gene            285748..286614
FT                   /locus_tag="Cpha266_0255"
FT   CDS_pept        285748..286614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0255"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="PFAM: protein of unknown function DUF1568; KEGG:
FT                   pca:Pcar_1084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64321"
FT                   /db_xref="GOA:A1BD44"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD44"
FT                   /protein_id="ABL64321.1"
FT                   /translation="MGSVVLKTETNIYAWALMTNHAHILLKSGQPGLSAFMRKFLIGYS
FT                   ISYNRRHDRHGHLFQNRYKSIVCEEDACFLKLVSYIHLNPLWAGLVRSFEELEHYPWSG
FT                   HAAVMGRKAYDWQDSDYVLGYFGKRVGSARTAYLECMQQEGKLSRQPELTGGGLIRSAG
FT                   GWSEVLSMKRRGERQFSDDRILGSGDFAQEVIAEADASVREKVSLAKRRSEVIEMIERC
FT                   CARHGVSRQSLESGCRRKEFSEIRKELAMMLVFETGLSYAETAPLLGVSASAVCQIIKT
FT                   GTDSCRM"
FT   gene            complement(286831..286971)
FT                   /pseudo
FT                   /locus_tag="Cpha266_0256"
FT   gene            287225..288241
FT                   /locus_tag="Cpha266_0257"
FT   CDS_pept        287225..288241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0257"
FT                   /product="integron integrase"
FT                   /note="TIGRFAM: integron integrase; PFAM: phage integrase
FT                   family protein; KEGG: dar:Daro_3427 integron integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64322"
FT                   /db_xref="GOA:A1BD45"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011946"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD45"
FT                   /protein_id="ABL64322.1"
FT                   /translation="MVADSQTVLQSTVNSQSLQHGPKLLELFREAMRVRHYSRRTEETY
FT                   CSWVKRYVHFHNMRHPKEMREPEINAFLTHLAVEEKVSASTQNQALSALLFLYRHVIGK
FT                   EIGDLGHLIRARKPSHLPVVLTRDEVKALLVQLAGVKWLMASLMYGAGLRLMECLRLRV
FT                   QDIDFSSNEILVRDGKGAKDRITMLPESLKKPLADHLKQIKSLHDKDLAEGWGRVLLPG
FT                   ALDRKYPNAPAEWRWQWVFPQEHRWKNAKTGEEGRHHMDESLIQKAVKAAVFHAQLTKR
FT                   ATCHTFRHSFATHLLEGGYDIRTVQELLGHNDVRTTMIYTHVLNRGPSGVRSPVDCL"
FT   gene            288424..288852
FT                   /locus_tag="Cpha266_0258"
FT   CDS_pept        288424..288852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0258"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0806 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64323"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD46"
FT                   /protein_id="ABL64323.1"
FT                   /translation="MNNELRTKLIATALEWQDRYGVAPQITTPLSEYDAAMLVGMPEHE
FT                   YSAYMQDITAVNKGSDFIYRNVRYQVKGNRPSGKPGSKVTMVPKATNYEWDKLIWVLYD
FT                   KFYVIQEAWLWDVAEYKQKFHNIKRLSPSHYREGVQLA"
FT   gene            289090..289329
FT                   /locus_tag="Cpha266_0259"
FT   CDS_pept        289090..289329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64324"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD47"
FT                   /protein_id="ABL64324.1"
FT                   /translation="MVKLDYADYKFTVKEGSPSVSGADDAPVSLCCEPRTSELSIVGSG
FT                   HLSIHLKKGISCDDAQEIAKNLEQWIEKISYVKG"
FT   gene            289482..289934
FT                   /locus_tag="Cpha266_0260"
FT   CDS_pept        289482..289934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64325"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD48"
FT                   /protein_id="ABL64325.1"
FT                   /translation="MKSSLIRFAIILFVFLSGCGTKEEPTAQEIAEAQLKETPAYKDYS
FT                   ADANTAFLIEVKERLKAPSGADFPWDDLPKEVTTKGVKLSDMSPYLRKVIKEARKLKKE
FT                   NAVRVYQKDSYVDADNSFGAKIRQRYLGTFIIYTEFGYTKSFVEFY"
FT   sig_peptide     289482..289550
FT                   /locus_tag="Cpha266_0260"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.786) with cleavage site probability 0.671 at
FT                   residue 23"
FT   gene            289980..290132
FT                   /pseudo
FT                   /locus_tag="Cpha266_0261"
FT   gene            complement(290524..291930)
FT                   /locus_tag="Cpha266_0262"
FT   CDS_pept        complement(290524..291930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0262"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   mes:Meso_4308 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64326"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCF7"
FT                   /protein_id="ABL64326.1"
FT                   /translation="MQLPYTNIHTDQPNQQALFPDCFEVSVAPVKGKKVVLDFQGGNAT
FT                   SDAGVLLLKEVESMTRIVPKLADCIADSRRTSSVMHSIPDLIAQRVYQIACGYEDGNDS
FT                   NSMRKDPALKMALNRLPESGDDLASQPTFSRLENMVTRPELYRMAVGFLDHFLDSYTEA
FT                   PRVIVLDFDDTEDVVHGKQQLALFNGYHQETCYQPLHVFEGLTGKLIASILRPGRRPTG
FT                   KEIVSYVKRIVRHIRSRWPETIIVYRGDSHYGVPEVYSFLAREQNCYSVTGLGGNDVLL
FT                   RSVKDIIEEVKKHGAGYRRYHTFQYQARSWKETRRVVAKVEMTEKGLNVRFISTDMQEA
FT                   KAKTLYEQIYSARGNDELYIKAHKTFMKSDRTSCHRFLANQFRVFLHSAAYVLVHAFQT
FT                   NLLRGTALATATFETIRLKLLKIGAKVIEMKTRIKVHLPTSYPYKPILNKCFAVLEHLR
FT                   SVPWPSTAIP"
FT   gene            292108..292848
FT                   /locus_tag="Cpha266_0263"
FT   CDS_pept        292108..292848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0263"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_3899 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64327"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD50"
FT                   /protein_id="ABL64327.1"
FT                   /translation="MIIQDYSEHIENFENYLKSKLASIDEISGDNNVLFKKILYVSFLD
FT                   SLSSCVYPGRGNKERFVSMLERFSKWEDRDRVSLPHLGKFVQIISDPLLEQARKYVTPK
FT                   LKTWQERSCYVISISEDPIIDEILDKSWKTNKETGIHVSLTDFKHISLLYQLRNALVHQ
FT                   FQSRGDEMGNLRQLDHPYYQRVQIFNGTLEDMKPVRFELVYPTQFLKSLSEKTLENVVD
FT                   YLKDGNINPFPHYYAGDYWITELN"
FT   gene            292938..293210
FT                   /locus_tag="Cpha266_0264"
FT   CDS_pept        292938..293210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_2499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64328"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD51"
FT                   /protein_id="ABL64328.1"
FT                   /translation="MPTISMFYGILIRMFFRDAEKHHVPHIHADYQGNVAVYSIPEGTL
FT                   LAGLLPPNKHKLVVAWIEIHHEDLLADWNLAVNGKKPFPIKGLDQ"
FT   gene            293207..293464
FT                   /locus_tag="Cpha266_0265"
FT   CDS_pept        293207..293464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64329"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="InterPro:IPR036782"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD52"
FT                   /protein_id="ABL64329.1"
FT                   /translation="MRIAELHPQPDWVLSIVSEDGRVGRFDVTPYLEYEAFEELRDHGE
FT                   FIKVINGGYFVEWECGADLSADTIEAQWKVVGKAEQQNTV"
FT   gene            293727..294203
FT                   /locus_tag="Cpha266_0266"
FT   CDS_pept        293727..294203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64330"
FT                   /db_xref="GOA:A1BD53"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD53"
FT                   /protein_id="ABL64330.1"
FT                   /translation="MSDVYAELFSIKFLVMSVIVGTALSIAANILSHSIIQNRSKFRWK
FT                   AGLPLYVGTMVYLWFVLELLSSSSTDRPFGIAFSINAIYLVVSCFRASLQVTSFSAVTK
FT                   TAVYLQVAIFVLTLPFTDAFWGPQSADVEASIAFNGIIIAALMFMTKGYREGGV"
FT   gene            294586..295170
FT                   /locus_tag="Cpha266_0267"
FT   CDS_pept        294586..295170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64331"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD54"
FT                   /protein_id="ABL64331.1"
FT                   /translation="MHGAVYIFENSIAKRVKVGMTINNVADRLCDVNDKWLERKVACQI
FT                   CGGRLVNIGGYVPQHVISGNECPGGNALPLEKDLALAVSYLENMKNRLSKLSGSEKGSV
FT                   TRKIKTLEKRIGLYRHYDGPVGMWQFSIAFYTECAEQVELLSHKILTERLDKVAPFGEV
FT                   FCCSVSEATEAVEAALSQLGLLHSARKNTCL"
FT   gene            295418..296188
FT                   /locus_tag="Cpha266_0268"
FT   CDS_pept        295418..296188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64332"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD55"
FT                   /protein_id="ABL64332.1"
FT                   /translation="MRIITRVAILLLIVGIQGCATYGKISGIPSEGQKSVFKDGRKTLI
FT                   SIKQNTVALAPNTETVTSGQKADFVIAVHNGTSQDILFSTDDVTATANTNGQLTTLKVF
FT                   SYDELVAEEKNRRAWAAVAVGLQGAAESMNAANAGYSNAFGTYSGSTYSNYGTKTFSSG
FT                   SYSSTTYNYAAAQAARNVAQANTEARFARLEADGRENLKNLSSTTLKKETIFPAAWHGG
FT                   LIKVELPEVAEQLQDIKFVVNVVGEQHEFNLNNS"
FT   gene            complement(296448..297854)
FT                   /locus_tag="Cpha266_0269"
FT   CDS_pept        complement(296448..297854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0269"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   mes:Meso_4308 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64333"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCF7"
FT                   /protein_id="ABL64333.1"
FT                   /translation="MQLPYTNIHTDQPNQQALFPDCFEVSVAPVKGKKVVLDFQGGNAT
FT                   SDAGVLLLKEVESMTRIVPKLADCIADSRRTSSVMHSIPDLIAQRVYQIACGYEDGNDS
FT                   NSMRKDPALKMALNRLPESGDDLASQPTFSRLENMVTRPELYRMAVGFLDHFLDSYTEA
FT                   PRVIVLDFDDTEDVVHGKQQLALFNGYHQETCYQPLHVFEGLTGKLIASILRPGRRPTG
FT                   KEIVSYVKRIVRHIRSRWPETIIVYRGDSHYGVPEVYSFLAREQNCYSVTGLGGNDVLL
FT                   RSVKDIIEEVKKHGAGYRRYHTFQYQARSWKETRRVVAKVEMTEKGLNVRFISTDMQEA
FT                   KAKTLYEQIYSARGNDELYIKAHKTFMKSDRTSCHRFLANQFRVFLHSAAYVLVHAFQT
FT                   NLLRGTALATATFETIRLKLLKIGAKVIEMKTRIKVHLPTSYPYKPILNKCFAVLEHLR
FT                   SVPWPSTAIP"
FT   gene            298718..298981
FT                   /locus_tag="Cpha266_0270"
FT   CDS_pept        298718..298981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64334"
FT                   /db_xref="GOA:A1BD57"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD57"
FT                   /protein_id="ABL64334.1"
FT                   /translation="MEPFIAVISHDNRARLLNNNIALQNIKIVLFQEPSKTGAGKITER
FT                   QASGAGRISVVCSVVIGWLVLYYFDGSTLFCYTFSKRLLRCV"
FT   gene            299402..300049
FT                   /locus_tag="Cpha266_0271"
FT   CDS_pept        299402..300049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64335"
FT                   /db_xref="GOA:A1BD58"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD58"
FT                   /protein_id="ABL64335.1"
FT                   /translation="MDEKLKLITSSLAVVAAFIGLIVSVISLVRSSENKQSIVVVTQQV
FT                   ANVEKQVKDVLIKSKEVVIAFNDVGAIKHIIKDIPSTPYPPYHDRSRIRPSSDIPVYSF
FT                   PTATISFAQGVHFNKYRITFAWQYHADSNYDPATVEFKVKYPADAHTPSRIETVSKSYQ
FT                   EPLKIWQTATVEINVPKGIPPESLQIFVPQSGDFDFMIKDMHVEALFGEYDL"
FT   sig_peptide     299402..299497
FT                   /locus_tag="Cpha266_0271"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.796) with cleavage site probability 0.411 at
FT                   residue 32"
FT   gene            300217..301065
FT                   /locus_tag="Cpha266_0272"
FT   CDS_pept        300217..301065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bth:BT0082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64336"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD59"
FT                   /protein_id="ABL64336.1"
FT                   /translation="MLRNPVWCYTSGWCSAMFAEGDLAVISIKKLTSMKVKSSKKSRSD
FT                   LANSLSAHLKSFGEKYEDIVICPTCLGEFSVKADQEKFSAGHILPEVAGGQEWTFICRS
FT                   CNSRFGEKQDKWFGEYLHILNIPTGTFLDAKTKNKYISINGEVVRGDISVRDDGSVEVF
FT                   VPIDRNPPGKVKSIPKGPKLELSFKPVLIDHENEIEIGYITAAYLIWFHEIGYNWVFQS
FT                   SLDVVRKQILECDRSLNGAKVIDLDFDKSPVEGVGAVLQSDTLYPCCVVVDKLVVIGKQ
FT                   E"
FT   gene            301160..302731
FT                   /locus_tag="Cpha266_0273"
FT   CDS_pept        301160..302731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0273"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: bfs:BF1534
FT                   putative transposase for insertion sequence element
FT                   IS21-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64337"
FT                   /db_xref="GOA:A1BCG7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCG7"
FT                   /protein_id="ABL64337.1"
FT                   /translation="MRTQLKKLTMYNKVKEFAREGLSIRQISRKTGMDRVTVRKFLRMT
FT                   DEEFSAFLALQKRRLRKLQPYEQFVKDRVTDYPDCSATQVEDWLKEHHPVFPEVTTRTI
FT                   YSFVQWIRKAYDLPKPKGTPRAYHPVEQLPYGEQAQVDFGEYWMASADACKVKVHFMIM
FT                   LLSRSRRKFVSFSQQPITTRFVLEAHEQAFSFFEGIPHTLVYDQDSTIVTDENRGAILY
FT                   TEAFRKYLLHRSLKIHLCRKSDPESKGKIEAGVKYVKYNFLPGRRFVNLEVLNQEALLW
FT                   LERTANAKEHATTRLIPDAEWQVEKQHLRPFEPLPYPISGTVGKEYHVRKDNTISYRGN
FT                   FYSLPVGTYAGPGTLVVLEVRQNTLCLYAQEGRLLANHPIESGKGTVVINNNHRRDTSS
FT                   KLRELQDSLMLLFTNQEHAERFLESIHNRYPRYSRDQFLHVRNAISGCQQKLIDDALAH
FT                   CVDHHLFSSGEFHDILHHYRKQEEKQSHQAVFNTFRPKTLRSDMDRMLSFVPDSSGITT
FT                   YENIFS"
FT   gene            302737..303573
FT                   /locus_tag="Cpha266_0274"
FT   CDS_pept        302737..303573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0274"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: bfs:BF1535 insertion sequence
FT                   IS21-like putative ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64338"
FT                   /db_xref="GOA:A1BCG8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCG8"
FT                   /protein_id="ABL64338.1"
FT                   /translation="MERTITTIQEHARELNLTGLAGTVDLLLEEARKSEPSYSDFALTL
FT                   LESELSCRRKAHLERRRKIANLPLLHDLDHYDSGVQNGISQVQLQQLRQLLWLDQNFNL
FT                   ILIGPSGTGKSYLAGGLCHEALKLGYHALFRTMDDLIQTIRFKEITAAAAREYKRLLSA
FT                   HLLVIDDIMMFPLEKSVAVGLFQLVNQLHEQTSFIITTNKSPKEWAEMLGDEVLATALL
FT                   DRLLYKCEVIKLTGKSYRLEHRTTIFEQQQSPEGGGNRRKKQLPLQKGVGNHCKMT"
FT   gene            304390..305262
FT                   /locus_tag="Cpha266_0275"
FT   CDS_pept        304390..305262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0275"
FT                   /product="SEFIR domain protein"
FT                   /note="PFAM: SEFIR domain protein; KEGG: shm:Shewmr7_1857
FT                   SEFIR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64339"
FT                   /db_xref="GOA:A1BD62"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR013568"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD62"
FT                   /protein_id="ABL64339.1"
FT                   /translation="MQDKRLTYTKSDAADRLYEGYNRLLADSDPEVILPLVQHMASEVF
FT                   PDFTAMQAFYSFACMEEKRFLKKAEVIELIPKYWSKVPEDMRPDIKYFLENIALAPRVF
FT                   ISYSHDSQQHKAWVLKLATHLSQAGIDIVFDQWDIEPGSDVALFMEQGIEKSDRVVLVI
FT                   TEKYVEKTKRNDSGTGYERMIITGQLAQELDTHKFIPITRQTLGKIKLPVFLGNRLYVD
FT                   FSDDELFEDSCHRLLRTLHGEPEVARPSVGPNPFLKQRHEAAQQSTHSSSDSQNNSTIS
FT                   ASDDEILTE"
FT   gene            305551..306744
FT                   /locus_tag="Cpha266_0276"
FT   CDS_pept        305551..306744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0276"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcv:XCVd0072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64340"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD63"
FT                   /protein_id="ABL64340.1"
FT                   /translation="MSEGLTESEKFVNSISERAFLHLWTHPNPIGKKGKELCDCLIVCG
FT                   NHIVIISVKDIKYKDTGDEAGWKRWTKAAIDKSASQIWGAERWLDSSVEFTRHDGRKVE
FT                   LPPKENRIVHRISVSLGAQRKIPTKSGDLGNGIVHVCDEFSLGAIFGLLDTITDFVSFL
FT                   TEVEALINRANIVFNGGGIEDLLAIYLLNNHSFPYDEADLIIIEDTVFRGFIDSDDYKA
FT                   IQESYKDSYFWDKLIEHFVGDLLTDGMFEYGTNQVTDNQLALVQMALQPRGHRANLVDA
FT                   FSEFLQKPELKIAARVILAYKNTAFVFHLGPSSDREARVQELGLRCLVVRGRLPDVKIV
FT                   VGISRDKLGPSEVGYSHDIAYVEIPEWNDDFEEQVTKIQKELGYFENTSCTKRPENA"
FT   gene            306836..307525
FT                   /locus_tag="Cpha266_0277"
FT   CDS_pept        306836..307525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64341"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD64"
FT                   /protein_id="ABL64341.1"
FT                   /translation="MKDIITEFDRPIVFRTVNAEVYESTINSGSIWLRSSDYYVYLEDK
FT                   ARCDKSEGANGTKTLLPLCFHPEGGTKQIYYGDGIIGQKISPHYIFSMHGSSVSECVRK
FT                   DFGEFTFGIKCISRLSAEILYEASKYLNVTGYRFGQVSYQYTALCRSLHSHGAAVGLGG
FT                   NLPEFLQSINTDVLRKDPVLPFIEQDEWRIVIFTNSLIKNDYNEPLKLIVNPNNFYEYK
FT                   SSAKLNA"
FT   gene            307601..308236
FT                   /locus_tag="Cpha266_0278"
FT   CDS_pept        307601..308236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64342"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD65"
FT                   /protein_id="ABL64342.1"
FT                   /translation="MENQLPRIRDEAAYQQAMREWVVPECLHVPVVAVDEEAIKDHVGD
FT                   IVEILSPGRALVVAIYPPRERDFRLPIWAYPSANVFFEPIQVWVNPSYTRYRQAYVRAK
FT                   GADSVSGKVLAHVYNRRMAMLRGYGFVRLVPVSRRANSSSSFTEQWGIKLAAEDFGARR
FT                   LKRGLRMQYADLGDLLVMLDISLGGGVQDTCRLGQNLIEIPGRRPPQE"
FT   gene            308731..308931
FT                   /pseudo
FT                   /locus_tag="Cpha266_0279"
FT   gene            309191..309961
FT                   /locus_tag="Cpha266_0280"
FT   CDS_pept        309191..309961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64343"
FT                   /db_xref="GOA:A1BD66"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD66"
FT                   /protein_id="ABL64343.1"
FT                   /translation="MEGRTMTWLKIIGAVVLLWTLTNFFLRYYEYSVFIYLFRFLGNYR
FT                   QIAHIFIRTDYWGDHREGNRREEYAALRRHEIAERFLIKGGSKAVTGILAELKKTNNEY
FT                   IRTHLAELIIKIGDTKALPDIEELFNRGAFHSSYGPGGSPIEQFLQSNSPSYRQKRNKE
FT                   EEESSAKLVQATDMVKDLSDDQMMDILKRLCRAYSVNDESEIKNIEPIAIAIGRKLNQR
FT                   GGLKAMRELYDKIGNIKGTRSLDMHWNGIGDWQG"
FT   gene            310485..311354
FT                   /locus_tag="Cpha266_0281"
FT   CDS_pept        310485..311354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0281"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   nar:Saro_2395 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64344"
FT                   /db_xref="GOA:A1BD67"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD67"
FT                   /protein_id="ABL64344.1"
FT                   /translation="MTTISNSEPGIARSILSSPPARVLVLGFILLVMMGLNTDVMTSYA
FT                   GEPAKSVLHIMALAIAGISVYLGYAYFIEERDVYELAVPGMGRELGIGLLIGAGLYALS
FT                   ELILMALGIYRIDGLNPLSYMVPAIAMAQSSGIYEELLFRGVLFRSVETWLGSWAALVV
FT                   SSLVFGLTHLMNPHATIEGALFIAVEAGILLAAAYMLTHRLWLSMGFHVAWNYTQSAIF
FT                   SGIVSGNEASQGLVRSTIKGPDFLTGGSFGVESSVLALLLCTTTGIVMLVMASKRGNIV
FT                   PPVWKRAA"
FT   gene            312094..312396
FT                   /locus_tag="Cpha266_0282"
FT   CDS_pept        312094..312396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0282"
FT                   /product="ferredoxin, 2Fe-2S"
FT                   /note="KEGG: cte:CT1655 ferredoxin, 2Fe-2S"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64345"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD68"
FT                   /protein_id="ABL64345.1"
FT                   /translation="MQKQREMPYVAHVFVCTNDRGGEKKSCADNNSQLTKARLKQAVDE
FT                   KGWRGKVRISTSGCMGLCSNGSHVMIYPQKVWFSGVLPDDVDEIVSAIERILADD"
FT   gene            complement(312684..313556)
FT                   /locus_tag="Cpha266_0283"
FT   CDS_pept        complement(312684..313556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0283"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bps:BPSL0088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64346"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD69"
FT                   /protein_id="ABL64346.1"
FT                   /translation="MNNISINISGRIDPERVTLLRDIKEVADGLAIHFFVVGAFARDLN
FT                   FEHIHHIPAPRVTEDIDIGVEVADWETFRYLTDSLIDRDILKPTKSAHRFTGNSPAIVV
FT                   DIIPYGGISNELKKISWPPDHRIIMSMLGFEEAFQSAMAVCLETEPLLEILVPSVPALT
FT                   VMKIISWNDAYPNRNRDARDILFILENYHVIVSEYLYEPPAVLLEEEAFDLCLASVRLL
FT                   GRKIAQLCSKITKETIVIILDRESEENGEVKMLSQMGSAGSFQTKQFENSLKLLKKLLQ
FT                   GIREETTKV"
FT   gene            complement(313519..314508)
FT                   /locus_tag="Cpha266_0284"
FT   CDS_pept        complement(313519..314508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bps:BPSL0089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64347"
FT                   /db_xref="InterPro:IPR019238"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD70"
FT                   /protein_id="ABL64347.1"
FT                   /translation="MEALAVIAPLDYVVEPATYLRDQEYDYLVKGIVFGKKFVWCVNIK
FT                   TRLTRTGEMQLLIGKDKALHPLLLVTGYVPPEAADRLRSIGIEFIDKAGNMFINQPPLL
FT                   IFVKGNKPEKEKNTMPGTRLFKGVGLKIVYLLLCRPDLVNSSYRDLSEMTGVALGTVNT
FT                   TITELLMKDFILDMGKRGKKILNRKKLFERWVEAYPDYLKPKLFLGRFHGDEFWWKNTN
FT                   LDPASAQWGGEIAASKLTGYLKPGSAALYTDKKFLTDLVITNRLKKDPQGNVEIFERFW
FT                   PMDYGFGDLDTTHPIIIYADLLAIGDQRTTETAKMIYEQYLDQYFRQD"
FT   gene            315008..315379
FT                   /locus_tag="Cpha266_0285"
FT   CDS_pept        315008..315379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64348"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD71"
FT                   /protein_id="ABL64348.1"
FT                   /translation="MIRKITITGFLLLAVAFNANAQDIDRINQLEKEVREINIRLSKLE
FT                   SLLSNPGKPHEHVTPGEGWKSIMNWRKLTTDMDYSDVQKTLGEPQRVDGGQVAHWYYQN
FT                   GGNVTFMGGKVYQWSEPRH"
FT   sig_peptide     315008..315073
FT                   /locus_tag="Cpha266_0285"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            315451..315627
FT                   /locus_tag="Cpha266_0286"
FT   CDS_pept        315451..315627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64349"
FT                   /db_xref="InterPro:IPR007460"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD72"
FT                   /protein_id="ABL64349.1"
FT                   /translation="MMVTATANNPEETRYVTTATIGEKFYTVVWTWRANARRIISFRRA
FT                   RDVEERAYRQIHG"
FT   gene            315590..315913
FT                   /locus_tag="Cpha266_0287"
FT   CDS_pept        315590..315913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT0461 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64350"
FT                   /db_xref="InterPro:IPR025528"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD73"
FT                   /protein_id="ABL64350.1"
FT                   /translation="MSRKERIVRYTDKELESMQVHGQDKSDWKSAAAISGKEIEAAVAG
FT                   DEDETGMHIDWSSISAEPPRPKAVLNMRVDYDVLEFFRSQGKGYQKKINAVLRSYVEQK
FT                   QRH"
FT   gene            315976..316242
FT                   /locus_tag="Cpha266_0288"
FT   CDS_pept        315976..316242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64351"
FT                   /db_xref="GOA:A1BD74"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD74"
FT                   /protein_id="ABL64351.1"
FT                   /translation="MLVVFHAATAFFLKSIPDVIWSGLLASFLTLVGVLLSNRGYTQRL
FT                   RMQLDHDAAEKTKERTATLRRETYLRAAEELVRVNAYLASPSI"
FT   gene            316311..316595
FT                   /locus_tag="Cpha266_0289"
FT   CDS_pept        316311..316595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64352"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD75"
FT                   /protein_id="ABL64352.1"
FT                   /translation="MKRINWNTEKSLVLKASRGICFEDVIFFVERGEILDDYLHPNQEV
FT                   YPGQRIMVIGMTNYAYLVPYVENEEELFLKTIIPSRKATQQYFGEKHES"
FT   gene            316573..316872
FT                   /locus_tag="Cpha266_0290"
FT   CDS_pept        316573..316872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lbl:LBL_0502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64353"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD76"
FT                   /protein_id="ABL64353.1"
FT                   /translation="MEKNMKAKLTKEEKEILDSFEKGEWVPVADLSKRRKELAEYAGNS
FT                   LKKDKRLNIRISERDLTELQRKAIKEGLPYQTYVASIIHKFINGTLVDGAAKDG"
FT   gene            317163..317612
FT                   /locus_tag="Cpha266_0291"
FT   CDS_pept        317163..317612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0291"
FT                   /product="nucleotidyltransferase substrate binding protein,
FT                   HI0074 family"
FT                   /note="TIGRFAM: nucleotidyltransferase substrate binding
FT                   protein, HI0074 family; KEGG: lpf:lpl2847 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64354"
FT                   /db_xref="GOA:A1BD77"
FT                   /db_xref="InterPro:IPR010235"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD77"
FT                   /protein_id="ABL64354.1"
FT                   /translation="MATIRKFALSNQDISWIQRYRYYVQAFGQLDRAVELARQRPLTEL
FT                   EQQGLIQSFEYTHELAWNTLKDFLENKGVQPLYGSKDTTREAFKRGLIEDGEIWMQMIN
FT                   SRNLTSHTYNQEIADEIAEAIRIHYHAAYRTLVDTLEPLTSERPE"
FT   gene            317609..317935
FT                   /locus_tag="Cpha266_0292"
FT   CDS_pept        317609..317935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0292"
FT                   /product="DNA polymerase, beta domain protein region"
FT                   /note="PFAM: DNA polymerase, beta domain protein region;
FT                   KEGG: net:Neut_0173 DNA polymerase, beta domain protein
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64355"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD78"
FT                   /protein_id="ABL64355.1"
FT                   /translation="MKYGLDDTTIARIHGVIARYGQVDKAILYGSRAKGNYRAGSDIDL
FT                   TLVGGHDLNLTVLYRIMDDIDDLLLPYTFDISLLHSISDRDVLDHIKMVGKVFYEKTQT
FT                   SQFF"
FT   gene            317966..318145
FT                   /pseudo
FT                   /locus_tag="Cpha266_0293"
FT   gene            complement(318232..319209)
FT                   /locus_tag="Cpha266_0294"
FT   CDS_pept        complement(318232..319209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0294"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:alr0722 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64356"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD79"
FT                   /protein_id="ABL64356.1"
FT                   /translation="MKRKIHLSHLLVALLLSLWLPMYGCSTPHSATEDISQQPTAGISG
FT                   MAQIDGNSWLVVHDALSFENGPRMSIITLSVDAAPVLHPVTIDSWPDAGGQASDLESLC
FT                   PVPSHPNEYLMAESGTWKEKGGRLFHLRLNALTRQAAILGVMKLPVLADNNPQQVGDQY
FT                   EALACVRGADGRLLLLLGERGGSQRFPEGVIRWGVLDIERHELQFTEKGLEGVKVNAPG
FT                   KWKNELTNRDISDMYISPEGEIWVSAAEDNGDNGPFTSVIYSPGRISGNFSLPVIANRH
FT                   SGVWRTIGSLKIEALSGPAESVAGSRMSIGSDDENYGGIWRPVE"
FT   sig_peptide     complement(319117..319209)
FT                   /locus_tag="Cpha266_0294"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.975 at
FT                   residue 31"
FT   gene            complement(319399..319950)
FT                   /locus_tag="Cpha266_0295"
FT   CDS_pept        complement(319399..319950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT1658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64357"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD80"
FT                   /protein_id="ABL64357.1"
FT                   /translation="MRPAHIIRILPLCAFLLISGCSGNSSKQSESSSGNASVQQQASKI
FT                   IEPGDLITAKDAETMLGEPVKPAEKTDNQVVGQKLCLYNPINTGSSEFLQVGLTQDAFM
FT                   PPQGISSASIYKSLKDNFEGMRTDVKGVGDEAFIATGGIYILTDGYYIQIGAGNSSNET
FT                   VRNKLIEAGKIAVAKLNTLK"
FT   sig_peptide     complement(319867..319950)
FT                   /locus_tag="Cpha266_0295"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.968) with cleavage site probability 0.728 at
FT                   residue 28"
FT   gene            320763..323612
FT                   /locus_tag="Cpha266_0296"
FT   CDS_pept        320763..323612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0296"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: cation transporting ATPase
FT                   domain protein domain protein; Haloacid dehalogenase domain
FT                   protein hydrolase; cation transporting ATPase domain
FT                   protein; E1-E2 ATPase-associated domain protein; KEGG:
FT                   gvi:glr4215 cation-transporting ATPase PacL homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64358"
FT                   /db_xref="GOA:A1BD81"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD81"
FT                   /protein_id="ABL64358.1"
FT                   /translation="MPTEIPSRPDTRVLDGKLWHTLPLETALAQLGLSHGGLTTAEANS
FT                   RRETFGPNELEEKGGRTVWHILWEQVSSVMIVILLIAGVLALLFKGGGGPPIDAIAIFS
FT                   IVILFVVQGVMQEYRAQKAIAALKQMSSPTVKVVRDGQVQEMSARDLVPGDLVKLETGS
FT                   VVPADCRIVESVNLRIQEAALTGESEPIEKFSGVLEGEDLSLGDRKNMGYMGTFASYGR
FT                   GEALVVETGMRTELGKIASMIQNVKHEETPLQKKLDKLGKTLALIALVVAVVVALTGVY
FT                   IEGKTWAEVLIIAIAISVAIVPEGLPAVQTFSLAIGAQRMVKRKALIRKLPAVEALGSV
FT                   TVICSDKTGTLTQNKMTVTELETLDHRVELDTQARQYDIEHGQPELAALVACGGLCCDA
FT                   VLNPDGETGVGDPTEVALAVAAHRYNLSRIALESVLPRVAEIPFDSGRKLMTTIHKLPE
FT                   GGALPSTISAMAAGLNGSPYVVFTKGAADNMLAICDRVFSVGQVRPLTDDDRARIHAAN
FT                   SKMASDGIRVLGVGYHGLPDLSEYEQPGKVERELVFLGLVGMIDPARPEAKDAVAKCKT
FT                   AGIRTIMITGDHPDTARYIAADLGITSHDGRVITGVELEKMSDTDLKKALKDANTNCFA
FT                   RVSPEHKLRIVGALQELGNIVAMTGDGVNDAPALKRADIGVAMGITGTDVSKEAADMVL
FT                   LDDNFATIVAAIEEGRVVYDNLRRFVMFSISGNIAKVIIVAVSPLIGLAAMLKPIQILF
FT                   SNLLTDGLLGLGMGMEAAEKNTMQRPPYSPQESIISRVVGRHIAIIGPVIGLLLLVVGY
FT                   LQWQQLGLPNVLQIKNEAERNALFTDPKVLMWGTLMFTALAMMQVGRAFSSRSFLDPFW
FT                   KQPLRTNKVLVGMILAVVTLQLFVVYTPGVQTFFSAVSLSGTNLGLCIAFAMVVLTIME
FT                   LLKALERRNAAAKQPGGKK"
FT   gene            complement(324655..327423)
FT                   /locus_tag="Cpha266_0297"
FT   CDS_pept        complement(324655..327423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0297"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: cch:Cag_0486 TPR
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64359"
FT                   /db_xref="GOA:A1BD82"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD82"
FT                   /protein_id="ABL64359.1"
FT                   /translation="MSDHSSIDNQPAGGFAAISKYNPHLWSADQLRAIFVARKNELADL
FT                   QHTLSSTPSGTVGQHILLVGARGMGKSTLMRRLALAVEDDPALSAAWLPLRFPEEQYTV
FT                   ATLGQFWANVLDSLADALQHLGQSVSELDAAAERIAAMPPAEQAAACLATIDRCADKRG
FT                   QRLLLLVDNTDLLLRNIGSDAQWALRSTLQSNPRLLWVGGSYQSLEAESSYHDAFLDFF
FT                   RIIHLRPLRLDEMRQALLALAETFGGSVARQQMERQLAAQPERLPTLRQLSGGNPRTTV
FT                   MLYEILANGQKGNVRSDLEALLDNMTPLYKARMDALADLPRKLLAHILEHWAPISIGDL
FT                   AAASQVANTSISPQLKRLELEGLIEKTGLQGTTRSGYQASERFFNIWYLMRLSPRRQRS
FT                   RLAWLVEFMRLWFSSDELRTLAQQRLSDGRTAFRSSHEQEYDRALADALPDQTPERHAL
FT                   RWSLLKQLKENRSQLAELFDLEGADADFKGADDYLRRLAELSARLHQNPHAATEEEKKR
FT                   WVNDVLGSIGFNLAQKESLAEAAADLNRDEYDKLEKLLHEERRNLENRFGAAAVQTVRT
FT                   AVLSQDFFPDMPDSHLAYEQIRACFAEKPEALRFGCELFYNNHNDEWCYKAQKLAQETW
FT                   PQDAGIAYQCAWLLHIELGRYDEAETAYRRTIELDEKNTYPWNGLGNLLKDHLGRYEEA
FT                   EVAYRRAIELDEKYAYPWNGLGNLLSDQLGRPEEAEAAYRQAIALDEKDASPWNGLGDL
FT                   LADQLDRPVEAEAAYRQAIALDEKDPYPLTNLARLLARLERKEDAETFYRDVVRSNTDD
FT                   QQLLLQAHLFLGNRQLAIDALQALASAAQSGDQLAFFQLKEQIWECHELGLGERLADLM
FT                   AESDAAGFLVPFVQALYTLAGATNKLRDLPLESRQMADEIVRLARLRQKRT"
FT   gene            complement(327416..328633)
FT                   /locus_tag="Cpha266_0298"
FT   CDS_pept        complement(327416..328633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64360"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD83"
FT                   /protein_id="ABL64360.1"
FT                   /translation="MKLGNPATGDDFFGRTQELSDLWRYLESDHIRFPGVRRLGKTSIL
FT                   RRLESEAADHGLLARWLDVSNIDSAPGFISLLDQAFPEKSIRSFLSDRAQQAGSWFNRI
FT                   RKIDATLPDAVGGGGFGIEFGGETVPEWEKDAGSLHSRLCNQPLLILLDEFPWMLEKLI
FT                   QRDRQEAEQLLSWLRIWRQSQGSCRFVFTGSIGLQSLLERHGLGETMNDCYPYPLGPYK
FT                   LSEARGLWQYFAPIADKTPWEIADPVIDYALGRVGWLSPYFLSLLLDESMRAARERRQE
FT                   CPADATGEARIEIEDVDDAYENLLAERSRFHHWEKRLKSALEPADLDLCLSLLSHLSRH
FT                   ADGLTLPQLSSRLARREPEPDLRTRRIQDLLVRLTDEGYTSPPDSNKRIQFLSFPLRDW
FT                   WNRNHV"
FT   gene            329006..331756
FT                   /locus_tag="Cpha266_0299"
FT   CDS_pept        329006..331756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0299"
FT                   /product="DNA helicase"
FT                   /note="KEGG: fnu:FN1445 DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64361"
FT                   /db_xref="GOA:A1BD84"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD84"
FT                   /protein_id="ABL64361.1"
FT                   /translation="MNSRQNLVIIKGKDRTDQILRIGEATEQRMIVTFSNGKPYFYARE
FT                   NVAWLSNPGRITIDHCQVLVEGDLLFDIEEVLRFETWVKIFRRNGESRCCLFSDFSVQR
FT                   MSSSDGRSTDVLAYFRELAETTGLMTNDNKSMMAMKYRNLGVVSGRSILSSFLQARPPG
FT                   SGTVPSDLIFPFGCNMSQKMAVQRAIEHPVSLIQGPPGTGKTQTILNLIGNMLLRRKRV
FT                   AVVSSNNSATANVLEKLQKYELDFVAASLGSAENKQVFIEGQSSDVVQMPTFQADQEAS
FT                   VLQEISLLNTSLDNAFAEKNGLAVIIQQIDALKLEMAHFEKYCDETNGGDLRVIDRAMN
FT                   AELSARKLLHAWLASEKELKRYAKAGVASPSNRRVGFLKKIGFLLRFGTAGSAFFEVSV
FT                   RERIPLLQKAYYLRKLADMEQRRKTLEGSLAGFHFDERLERLTELSMQLLKHRLAQHYN
FT                   NRERRIFALEDLRNQPEKFLEEYPVILSTTFSIITSLKSGYLFDCVIVDEASQVDLLSG
FT                   VLAMGCAEKLVIVGDSMQLPNVLTAQDEKQAKEVALQYDLPDYARFERHNLLSAVRTAF
FT                   PDIPETLLLEHYRCHPKIIQFCNQKFYGGELLVMTRDQGEADVLKAYMTVEGRHARGTI
FT                   NQRQVDEITQNVLPELASIHPADIGIVSPFRAQADRMLLSVGSNEIGIDTVHKYQGREK
FT                   RAIIITTVSNKSNEFVDNPNLLNVAVSRAKEKLRLVVSMEMADGNSNVADLVRYIRYNN
FT                   CEVIPGRVRSVFDLLYQDYTAARLAVLKKWKRVSIYDSENLVYSEIDAVLQEKAYRGLG
FT                   IVFQFPLSMLVRNRENLTTEESSYAAHPWTKTDFLVYRRVDKSPVLVIEVDGYAFHREG
FT                   TRQAERDALKDAVLEKCGLPILRLSTIGSDERNRIRKKLEDVVAS"
FT   gene            complement(331874..333415)
FT                   /locus_tag="Cpha266_0300"
FT   CDS_pept        complement(331874..333415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0300"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /note="TIGRFAM: GMP synthase, large subunit; GMP synthase,
FT                   small subunit; PFAM: glutamine amidotransferase class-I;
FT                   GMP synthase domain protein; KEGG: plt:Plut_1946 GMP
FT                   synthase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64362"
FT                   /db_xref="GOA:A1BD85"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BD85"
FT                   /protein_id="ABL64362.1"
FT                   /translation="MQSVTVLDFGSQYTQLIARRIRELGIYSEILPYNASPETIREHDP
FT                   KAIILSGGPTSVYGDSALLPDGGVFMLGVPVLGICYGLQAIAKHFGGEVAGSSKQEFGR
FT                   AKMLVSHNEESESPLFRNIPDSDVWMSHGDKVVRLPEGFRVTASSENSEMCALESYGSK
FT                   AALKVYGLQFHPEVQHTLYGKQLLSNFLIDIAGIKPDWSPKSFIGHQIEEIRARAGKDK
FT                   VICGISGGVDSTVAAVLVSQAIGKQLHCVFVDNGLLRKNEAVKVMNFLKPLGLSVTLAD
FT                   ASDLFLKRLDKVASPEKKRKIIGRTFIHVFEQHLNEEKYLVQGTLYPDVIESVSVKGPS
FT                   ETIKSHHNVGGLPKRMKLKLIEPLRELFKDEVRAVGRELGIAEDILMRHPFPGPGLAVR
FT                   VLGSVSRPRLDILREADEIFIEELKTSGLYQHVWQAFSVLLPVQSVGVMGDKRTYENVL
FT                   ALRAVESTDGMTADWAQLPHDFLARVSNRIINEVRGINRVAYDISSKPPATIEWE"
FT   gene            complement(333447..335729)
FT                   /locus_tag="Cpha266_0301"
FT   CDS_pept        complement(333447..335729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0301"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase, family 51; penicillin-binding
FT                   protein, transpeptidase; KEGG: plt:Plut_1945
FT                   penicillin-binding protein 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64363"
FT                   /db_xref="GOA:A1BD86"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD86"
FT                   /protein_id="ABL64363.1"
FT                   /translation="MITLRTTVTVNTTFFKKSFITLAALVFFLLTSVSAFALNPFKGLP
FT                   SLEELENPNPDLASLVYSEDGVLLHKFFVKNRTFIPLKSIPRSARYALIATEDVTFYQH
FT                   WGVDLRRLALVMGENIIKGRQRWHGASTITQQLAKNLYLTQERTVSRKVKELITAVELE
FT                   KTYTKDEILALYLNTVYFGSGAYGIEAAARTYFSKPASQLTLPESATLIATLKNPTGYN
FT                   PVKNPSGAISRRNLILSLMEKEKFITPEQAATAKRSRLLLHYTPVSHHGIAPYFTEYIR
FT                   QTVKPASMLGDINLHRDGLTIQTTLDSRMQKYAEQAAVDHLASLQASFDRSWRWPESLK
FT                   NQMIKESPRFKELLEDGVSAQQALVQLRADRIWLNNLLREKTRIQVALVAIDPANGHIK
FT                   AWVGGNSLSSEDYKYQFDHVWQAKRQPGSTFKPFVYLTAIDKGIPANFRVLDQPLALKS
FT                   GNGIWSPRNSDGSSGGMTTLRSALTRSLNQVSVRLAYEQLTVPEIISYAKRMGISSVMP
FT                   QNYSIALGTGEVSPLELAGAFSTFANNGIWTEPVSILKVSDKHHRSMSESTPNRRFAID
FT                   STSNFVMVSMMRDVINRGTASSIRGRYAMTMDAAGKTGTTQSLRDAWFAGFTPQLVAVV
FT                   WTGFDDERIKFTSMEYGQGARAALPIWAGFMKRCYSDPSLKLTNRYFHIPNTVIAVPIS
FT                   GQASVASAPANNSVYIEYYTPKGFNYYKSNPVQSTPGDQGDSGVPTEGDLEPAPQPAET
FT                   PAQEGAF"
FT   sig_peptide     complement(335616..335729)
FT                   /locus_tag="Cpha266_0301"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.992 at
FT                   residue 38"
FT   gene            complement(335760..336683)
FT                   /locus_tag="Cpha266_0302"
FT   CDS_pept        complement(335760..336683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0302"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: plt:Plut_1944
FT                   proline iminopeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64364"
FT                   /db_xref="GOA:A1BD87"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD87"
FT                   /protein_id="ABL64364.1"
FT                   /translation="MSYLASSRCKLYYEDSAEANPAHLDKPAVLFVNGWAISSRYWKPL
FT                   VQALSGSFRCIIYDQSGTGKTLIKGHNPSFTIQGFADEAGELIEHLGLNKSRNLHIVGH
FT                   SMGGMVATELSLRYKTALVSSAIIACGIFEETAFTSFGLFFLGGLIDVSMNFRNVFQSE
FT                   PFRSMFIKRAATKEIAKEYGDIIIEDFTQSDKDATNAAGKFSIDPEALRAYTRHVIEIA
FT                   SPVLCCVGMADHTIPPEGTITLFETRKARSSAPTTLVQFMNLGHLPMLEDTDNFAEALI
FT                   KHFDSARKFHENNSTEPARCKQYQIS"
FT   gene            336916..337584
FT                   /locus_tag="Cpha266_0303"
FT   CDS_pept        336916..337584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0303"
FT                   /product="DedA protein"
FT                   /note="KEGG: plt:Plut_1943 DedA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64365"
FT                   /db_xref="GOA:A1BD88"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD88"
FT                   /protein_id="ABL64365.1"
FT                   /translation="MDNSFTGILSTIIDFILHIDTHLQALASEYGIWLYGILFLIIFCE
FT                   TGLVVTPFLPGDSLLFAAGSLASMPGSELDQHLLFLIFFVAAVLGDTLNYTIGHKLGPK
FT                   VFGYEKTRFFNPDYLDKTNAFFKKYGGKTIIIARFIPIIRTFAPFVAGIGAMSYKKFIL
FT                   FNIIGALLWVGLFNYSGYFFGQLPFVQKNFKLLILFIIIISVLPPVFEYLKHRFRRSGQ
FT                   "
FT   gene            337928..338001
FT                   /locus_tag="Cpha266_R0007"
FT                   /note="tRNA-Pro1"
FT   tRNA            337928..338001
FT                   /locus_tag="Cpha266_R0007"
FT                   /product="tRNA-Pro"
FT   gene            338068..338544
FT                   /locus_tag="Cpha266_0304"
FT   CDS_pept        338068..338544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0304"
FT                   /product="transcription activator, effector binding
FT                   protein"
FT                   /note="PFAM: transcription activator, effector binding;
FT                   KEGG: cte:CT0179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64366"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD89"
FT                   /protein_id="ABL64366.1"
FT                   /translation="MDFECAFVPELLELTPIPAVTIKCTTTVAAIPALFDSGYRRILEY
FT                   LKRESAGTAGPPFAIYTTLDSDDIDVEFGFPVTRSVAGSGSLTESRTPSGKAVSILFIG
FT                   PYEDVEPAYDALLKWVADNNLTAGSVAYEVYLSDPKDTLPEMQQTRIHLLLEQS"
FT   gene            338629..340107
FT                   /locus_tag="Cpha266_0305"
FT   CDS_pept        338629..340107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0305"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: cte:CT0180 lycopene cyclase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64367"
FT                   /db_xref="GOA:A1BD90"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD90"
FT                   /protein_id="ABL64367.1"
FT                   /translation="MDMENYNVVVIGAGIGGLAAGALLARKGLQVTVLEAQDYPGGCAA
FT                   TFSMQGYRFDAGATIGCGFHPGAPMDMLGRELGISWPVTPEPVAWQYRHRGITLNLTTS
FT                   RSEIINRFPRSEAFWKEQSLLAALLWRLAEGGLSWPVKGPRDLALLARKGVAELPGTAV
FT                   LLKFAAKTAREWLASHDLDTDAEFVRFLDAQLLVSVQTTTMHANALNAAIALDLPVSGA
FT                   SRIAGGIGRVSEQLAGSIAESGGAVLYGQEVTRIDSVRREVIGVETRDGGAFAADFTIA
FT                   NLTPDSLEKLVDMEGEPFSREEIGAKWSAFVLYLGMDAAFFGGVLPTHLQIVAGSGELA
FT                   ECGSIFVSASSPVETDRAPEGLCAVTISTHTAPEPWFEAKKRGQSAYLEMKERYTEKVL
FT                   DLFSEQIPGVREAIKSITASTPVTWERYTGRANGHVGGYPQTSLFNVRGPATRFDNLFL
FT                   VGDSIFPGQSLPGVVTGARRSVELLLQRMAKGTR"
FT   gene            340193..341449
FT                   /locus_tag="Cpha266_0306"
FT   CDS_pept        340193..341449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64368"
FT                   /db_xref="GOA:A1BD91"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023874"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD91"
FT                   /protein_id="ABL64368.1"
FT                   /translation="MNTLEKLQILSGAARYDASCSSSGSKREGSSSGLGNTSSSGICHS
FT                   WSDDGRCISLLKILLSNDCRYDCAYCVNRISNPVQRASFTAREVVDLTMEFYRRNYIEG
FT                   LFLSSAVMQSPDHTMERMVSVAETLRIDEKFGGYIHLKIIPGSSSELVRKAGLYADRIS
FT                   VNIELPSETALQRLAPQKQKAGILEPMAFIGREIKGSLLERQRGRNATPRFAPAGQSTQ
FT                   MIIGASPESDFQILKLSQGLYKKMNLKRVYYSAFIPVNEDSRLPVLASPPLLREHRLYQ
FT                   ADWLLRFYGFTAEEILSDEAPNLDETFDPKTAWALRNPGFFPVEINRADYSVLLRVPGI
FT                   GVTSARRIVAARRFASITPEGMKKIGVVMKRAKYFITCSGRPFENTDRQPALLKSRLLL
FT                   AGGVAPEPPKQLVLPGLFA"
FT   gene            341454..342191
FT                   /locus_tag="Cpha266_0307"
FT   CDS_pept        341454..342191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT0182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64369"
FT                   /db_xref="InterPro:IPR023875"
FT                   /db_xref="InterPro:IPR025404"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD92"
FT                   /protein_id="ABL64369.1"
FT                   /translation="MNSYLYDGTPEGLLSAAFRIIADVSDPEKATLAERRDTLFEEGEF
FT                   IGTDAVAAEKLFKRLRLEAPDAAYIFYYFTLAEKEGLETSLLRYLALALRHGDRVNGNL
FT                   IDPAVRDVVSVSRKAQRELHRMKGLVRFEKLRDGAYLARMEPDHNILQPLAVHFSRRLR
FT                   AEDWFIYDVRRRFAARWHCGNLQFGTIEQFTAPALSEEEMRIQALWQAFFKTIAISDRK
FT                   NPGLQKSNMPMKYWKYLTEKQGE"
FT   gene            complement(342385..343239)
FT                   /locus_tag="Cpha266_0308"
FT   CDS_pept        complement(342385..343239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0308"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   cte:CT0187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64370"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041712"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD93"
FT                   /protein_id="ABL64370.1"
FT                   /translation="MQQRSTTITILADNCAAPGLKTEHGLSFFIEKEDITILFDTACDN
FT                   TLLYNAGALGVDLSQTELLVLSHGHYDHTGGVAEVLFLAPNANIYLHPAAFQERYSIRN
FT                   GTAKPTSMPDHARSAIINLPQQQIHRVSKPTMLCSGIGITGPIPRLTSYENPGGPFFLD
FT                   TTGKQPDPIDDDLSLWIESENGLIIVTGCCHAGLINTIRSIVEHTGEKRIAALIGGFHL
FT                   SAASTERLEKTVKELKEYDIRQIVPCHCTGKNATEYLAQFLGCPVEAGYAGLKLEFQNP
FT                   PQV"
FT   gene            complement(343261..343833)
FT                   /locus_tag="Cpha266_0309"
FT   CDS_pept        complement(343261..343833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0309"
FT                   /product="outer surface protein, putative"
FT                   /note="KEGG: cch:Cag_1755 outer surface protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64371"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD94"
FT                   /protein_id="ABL64371.1"
FT                   /translation="MNRIKGVLGGMFTLFCTVSFAQAATPYASASAGVAILGTSKTETM
FT                   PETSMSYDPGYALTGAIGLEKGKIRFEGEVGYQKNGLKNTADTDVSIMTYMANGYVDFK
FT                   LPLSPVTPYVTAGAGVAGVKADGFGFDDDSSTVLAGQVGAGAGFSVAPFVKIDLKYRYF
FT                   MASDAEFDHEKFSIDSHNVMLGIRVGL"
FT   sig_peptide     complement(343762..343833)
FT                   /locus_tag="Cpha266_0309"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.808 at
FT                   residue 24"
FT   gene            344055..344348
FT                   /locus_tag="Cpha266_0310"
FT   CDS_pept        344055..344348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0310"
FT                   /product="C-type cytochrome, putative"
FT                   /note="KEGG: cte:CT0188 C-type cytochrome, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64372"
FT                   /db_xref="GOA:A1BD95"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD95"
FT                   /protein_id="ABL64372.1"
FT                   /translation="MMLCLSVAVSVPVFADKAPSSLQGKKLFNSSSLGGAANTKTCNAC
FT                   HPGGRGLESAGGNPELSKVINTCIAGPLNGSKLEPNSIEMQSLLLYIKSLKQ"
FT   sig_peptide     344055..344102
FT                   /locus_tag="Cpha266_0310"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.866) with cleavage site probability 0.858 at
FT                   residue 16"
FT   gene            344364..345188
FT                   /locus_tag="Cpha266_0311"
FT   CDS_pept        344364..345188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0311"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   6-phosphogluconate dehydrogenase, NAD-binding; KEGG:
FT                   plt:Plut_1936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64373"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD96"
FT                   /protein_id="ABL64373.1"
FT                   /translation="MQKETISILGCGWLGMPLAKALIAQDYPVKGSTTNEDNLEAMRDA
FT                   GIEPYLVWLDPEVNGEDITDFLQSDILIVNIPPERRDDIVEYHIEQFSSLIDALGQSPV
FT                   RSVLFVSSTSVYPALQREVTEEDSVEPEALSGQALLHVEEMLMQETGFQTTVVRFGGLI
FT                   GYDRNPEKNLARMTELKDPDQPMNLIHRDDCVRIIMEIIRLQQWGEVFNACCPVHPLKR
FT                   DYYRRAAEVSGIPLPSLCSSEAPSPYKLVNSDKLQGALNYTFIYPDPVAQLG"
FT   sig_peptide     344364..344438
FT                   /locus_tag="Cpha266_0311"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.704) with cleavage site probability 0.349 at
FT                   residue 25"
FT   gene            345213..346583
FT                   /locus_tag="Cpha266_0312"
FT   CDS_pept        345213..346583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0312"
FT                   /product="cobyrinate a,c-diamide synthase /
FT                   hydrogenobyrinic acid a,c-diamide synthase
FT                   (glutamine-hydrolysing)"
FT                   /EC_number="6.3.5.-"
FT                   /EC_number="6.3.5.9"
FT                   /note="TIGRFAM: cobyrinic acid a,c-diamide synthase; PFAM:
FT                   Cobyrinic acid a,c-diamide synthase; CobB/CobQ domain
FT                   protein glutamine amidotransferase; KEGG: plt:Plut_1935
FT                   cobyrinic acid a,c-diamide synthase CbiA"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64374"
FT                   /db_xref="GOA:A1BD97"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD97"
FT                   /protein_id="ABL64374.1"
FT                   /translation="MEKLDLCKKKPAFMLAAPSSGSGKTTLTLALLRILARRGYRVQPF
FT                   KCGPDYLDTRLHSLAASYGSMVSDGINLDTFMASESHVKELFSRYSCGSDASVVEGVMG
FT                   LFDGAEKARGSSAEIAKLLGIPVIMVVNAQSMAYSAAPLLYGYRTFDPDVHLVGVIFNQ
FT                   VNTPSHYRYLEEAAFDAGVDPLGYVPRHEPIVISERHLGLNTSSSYDRQGAIEAMADHI
FT                   EKSVAVDRLLELVGRDRESFSGSTSLDFHQRERGEKVIAVARDEAFNFTYLENLDVLSQ
FT                   FGRIEFFSPMEDGRLPACDLLYLAGGYPELYAETLSSNSEMRRAIAAYCLGGGAAYAEC
FT                   GGMMYLGAAMTLGDGLRYPMCGVLDLDTTMQDSRLTLGYRKVRLDTGYTKELRGHEFHY
FT                   SRIERSGELHTIASITNARDEATETLLFRRQNTFASYLHLYWGETRDFPAFLLNRES"
FT   gene            346590..347165
FT                   /locus_tag="Cpha266_0313"
FT   CDS_pept        346590..347165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0313"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64375"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD98"
FT                   /protein_id="ABL64375.1"
FT                   /translation="MNSSGYIITGGPGSGKSTLLEAMRDAGYCCFSEVSRQLIRQQSLL
FT                   ADGVLPWNNLPAFARLAFDAMMRQHDQAIDHDGICFFDRGIPDVFGYLEEGGHPVPACY
FT                   IDAHERCRYEKNVIVLPPWKEIFTNDSERPQSFQQSVRLYRSICSVYERLGYTLHELPK
FT                   SSVNERVRYLLKHFTELQAPARQQFYLH"
FT   gene            347331..347825
FT                   /locus_tag="Cpha266_0314"
FT   CDS_pept        347331..347825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0314"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: plt:Plut_1474
FT                   putative ferric uptake regulator, FUR family"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64376"
FT                   /db_xref="GOA:A1BD99"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1BD99"
FT                   /protein_id="ABL64376.1"
FT                   /translation="MADISLQTKKETSDKTRQAESLFKSFMKEQGLRCTTERIAVLREL
FT                   YRSNTHLDADEIFIRLKKKQVGISRATVYHTLNLLFKFHLVSKIDLGHKHTHYEKSHGV
FT                   TNHLHIICEKCGNVVEVSESGLSELLDRVCRENGFELGSFSLQVFGKCVGNCDENCPKQ
FT                   K"
FT   gene            complement(347869..348480)
FT                   /locus_tag="Cpha266_0315"
FT   CDS_pept        complement(347869..348480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64377"
FT                   /db_xref="InterPro:IPR024523"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDA0"
FT                   /protein_id="ABL64377.1"
FT                   /translation="MQQRFSKNQEQKLSNWRRRLNTQKKSEVLFEHWLFMHTAAVLFAG
FT                   KPGELLILKRGLFGLLPEETLESIDSFCSSLALQFNVLLENEHSIKVIFYNEVAVDRRI
FT                   GCIPKKILHCNLRYPFGLRSESFLKELGRRWLESGTTPHEIGIVLGYPLKDVWGFMGIS
FT                   SDPCSGSCGWRIYGNPLPSLKKRTLYNHARTRAETYLRAA"
FT   gene            348685..349698
FT                   /locus_tag="Cpha266_0316"
FT   CDS_pept        348685..349698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_0619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64378"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDA1"
FT                   /protein_id="ABL64378.1"
FT                   /translation="MNVLLKSTALVGISLVCSSGLFAAEESRQSAALEPALFKGLSFSG
FT                   LLEVEGAYGESDGESSSDLSLATVELGLEAKVTDWLSARILLLYEQNGDDRILVDEASI
FT                   RVQRDNSPFFVQAGRFTQSFGNFATGMISDPITLELGETKHHASLQAGYEGEIVSASFS
FT                   FFKGDVQKEGMDEVNSFVGALSIGGEVNERFRYELGGSYCSNMADTDGLQDDFEPDLYR
FT                   TADYVGGYSVYGLLGFGSVEVRAEYLAAAESFVDGERSGLKPAAYNVEVGCDLPESLHL
FT                   ALRYAGAEDFNVEKQYGATLACDLSEKATLALEYLHNSNDDETSSDAVTVQLAMSF"
FT   sig_peptide     348685..348756
FT                   /locus_tag="Cpha266_0316"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            349728..350033
FT                   /locus_tag="Cpha266_0317"
FT   CDS_pept        349728..350033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0317"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: cte:CT1744
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64379"
FT                   /db_xref="GOA:A1BDA2"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDA2"
FT                   /protein_id="ABL64379.1"
FT                   /translation="MMVPLGFLLQGESAEIVGFRSGREKEHRGFRHGSGAGHGRAHRCA
FT                   EITKEQRLVEMGFCPGEVIEVLQSKAGGLLLLKLRDSRLALDKQIAMDIIVRRVTA"
FT   gene            350030..350257
FT                   /locus_tag="Cpha266_0318"
FT   CDS_pept        350030..350257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0318"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: cte:CT1743 ferrous
FT                   iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64380"
FT                   /db_xref="GOA:A1BDA3"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDA3"
FT                   /protein_id="ABL64380.1"
FT                   /translation="MNLSELKKGQAGRVVKLSAVPQLRRRLLDMGVLVGEMIRVVGVAP
FT                   LGDPVEVTVKNYKLSLRKKEVEGVIVEEVS"
FT   gene            350257..350436
FT                   /locus_tag="Cpha266_0319"
FT   CDS_pept        350257..350436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0319"
FT                   /product="Fe2+ transport system protein B-like protein"
FT                   /note="KEGG: cte:CT1742 ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64381"
FT                   /db_xref="GOA:A1BDA4"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDA4"
FT                   /protein_id="ABL64381.1"
FT                   /translation="MQVTETAGELVKPEKIIGKPSVIAVVGNPNSGKTTLFNALTGMNQ
FT                   RVGNWPGVINPAIK"
FT   gene            350470..351522
FT                   /locus_tag="Cpha266_0320"
FT   CDS_pept        350470..351522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0320"
FT                   /product="transposase and inactivated derivatives"
FT                   /note="KEGG: hch:HCH_03259 transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64382"
FT                   /db_xref="GOA:A1BDA5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDA5"
FT                   /protein_id="ABL64382.1"
FT                   /translation="MMKNDARSYTSDQQKLLRIKAVDMVFREGFTQRATAKALGVSRQH
FT                   VVKWCKAFSSGSYEALELGRRGRRPGEQMLLQPWQCAVIFNTIRDKTPDQLKMPFVLWE
FT                   RIGVRELIKKKFGITLALRTVGEYLKRWGMTPQRPIERAYERSSQAVENWLNNDYPAIQ
FT                   KKAEEEGATILWGDETGVQNTSNVGRSYSPSGKTPVIRQSEKKIKTNMISAITNRGKVR
FT                   FMIYPGKMNQQMFIRFLERVIATIPGKVLFIVDNLKVHHGKKVAEWVTEHIGRIELFYI
FT                   PSYSPDLNPDEYLNRDLKKNVNSRAIPRTEVELKMNLLSFMRKLQKLPDRVMSYFNSSP
FT                   IKYAARAEAV"
FT   gene            351497..353752
FT                   /locus_tag="Cpha266_0321"
FT   CDS_pept        351497..353752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0321"
FT                   /product="ferrous iron transport protein B"
FT                   /note="TIGRFAM: ferrous iron transport protein B; PFAM:
FT                   Ferrous iron transport protein B domain protein; Ferrous
FT                   iron transport B domain protein; nucleoside recognition
FT                   domain protein; KEGG: cte:CT1742 ferrous iron transport
FT                   protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64383"
FT                   /db_xref="GOA:A1BDA6"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDA6"
FT                   /protein_id="ABL64383.1"
FT                   /translation="MLLVPKRCNVFDCRINTVDKKTGFFTHNGRHYELVDLPGIYSLSA
FT                   LSQDEEIAREFILEGQADLIINIVDASNPDRNLYLTSRLLEMKVPVLIALNMMDAAKGR
FT                   GIAFDIARLSSRIGCRIVPLVASRKDGVAELKDAIEEEICLKSFKGCRVTYPACIEKSI
FT                   RELSTDIRRFAEDAHYDPDWFALKLLEGDHLLESLIPVSEKDRVVGYRSEIADTLGDDP
FT                   DILVADAHYRFINELSSESIRRTSEKGESLSDRIDRVVLNRFAGIPIFLAVMYLMFLFT
FT                   INLGGAFIDFFDIAAGALFVDGFGELLHLSGSPEWLTAILATGLGGALQTIATFIPPIG
FT                   FMFIALSLLEDSGYMARAAYVMDRGMRAIGLPGRAFIPLLVGFGCNIPAIMSARTMSDE
FT                   RDRILTIMMVPFMSCGARLPVYVLFAAAFFPSGGQNLVFLLYLIGVAVAVLTGFILKST
FT                   LLKGDISPFIMEMPAYHIPTVKGVFMRVWDRLNSFLVRAGRVLVPVIMVLGLMNSLGTD
FT                   GTFGNEDSENSMLAVTGKAIAPVFVPMGISEDNWPATVGLFTGIFAKEAVVGTLNSLYA
FT                   GMGRTAAAVEGVSEESDLNLMERFGEAFRTIPENISAITGSLLDPLGISVGDVSDRAGV
FT                   AEEQGVEVTIFGTMAALFDGTAGAFAYLLFVLLYFPCVAAIAAVYRETNLAWTLFAGAW
FT                   TTGLAYILAVIAYQAPTYSSHPVSSAVWIAAMVGILAAAVVVMYLLGSRGFRKKTGV"
FT   gene            353759..354046
FT                   /locus_tag="Cpha266_0322"
FT   CDS_pept        353759..354046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT1741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64384"
FT                   /db_xref="InterPro:IPR015102"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDA7"
FT                   /protein_id="ABL64384.1"
FT                   /translation="MIFMGRRHVRLPAQIQNKRFSMTLTDLKGFIQERRRVSLSEIAGY
FT                   FKADMAMIESMLDHWIRKGRVQVKQADAFSASCCGKCGGHKQVWYTWVDG"
FT   gene            354158..354511
FT                   /locus_tag="Cpha266_0323"
FT   CDS_pept        354158..354511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT1739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64385"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDA8"
FT                   /protein_id="ABL64385.1"
FT                   /translation="MNGNEKKRGRCSARCVVNKCSCGAFHLHYRYAVVIIGKQTLFQIM
FT                   EDCYRWEELNVGMSEGWCTKPFVVMLGIVTITVPQVDFEEFSKAIQDAVSLELDLPGIA
FT                   GGLLSFPGSSASK"
FT   gene            354556..355062
FT                   /locus_tag="Cpha266_0324"
FT   CDS_pept        354556..355062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0324"
FT                   /product="flavodoxin"
FT                   /note="TIGRFAM: flavodoxin; PFAM: flavodoxin/nitric oxide
FT                   synthase; KEGG: syn:sll0248 flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64386"
FT                   /db_xref="GOA:A1BDA9"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010086"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDA9"
FT                   /protein_id="ABL64386.1"
FT                   /translation="MKRIGLFWGSQTGNTELAATLIVEAIGSDIVQSYDIRGVDSGTFG
FT                   SYDSLILGTSTWGAGELQDDWDSFLPQFDAIDFIGKKVALFGLGDQLGYGDYFLDGMGI
FT                   LYENLIGRGAKVTGSWSVDGYEHSYSRAIQYGAFVGLALDADNQNHLTPVRIKQWVDQI
FT                   LPILL"
FT   gene            355270..356934
FT                   /locus_tag="Cpha266_0325"
FT   CDS_pept        355270..356934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0325"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   tte:TTE2518 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64387"
FT                   /db_xref="GOA:A1BDB0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDB0"
FT                   /protein_id="ABL64387.1"
FT                   /translation="MFVRVKSTPNSPRQSVQIVASERIGDKVKQRIVRYVGIAMNDEEL
FT                   VKMKELAEFIKAGLEAESAPTLFRPDELARMAIEGRKTADLSSDQPLTVDLKLLREESR
FT                   VVVGIHEIYGKLFDELGFDRVLGNPARRVQAAKTIKHLVLARIANPASKRKSVIDLERD
FT                   FGVKLDLSAVYRTLDYVDEQSIELIQKKAWEAATGLFGEKIDVVFYDCTTLYFESFTDD
FT                   ELRDKGLSKENKHSEVQVLLAMMVSKHGFPLGYRLYNGATWEGHTLKDAIEQIKGMAEV
FT                   DRVVFVADSGLLSKENLALIEQSEKQYIVAARLKNQPETIKEQILDKAGYQQGEQIRFK
FT                   EIPLPENRRLLVSYSEKRARKDAFDRQKALDKLQKKLNKSKNPESFLKNTSYRKYVKIE
FT                   QLSQQTVIIDEEKISYTAQWDGLHGVITNITDITASDAFEHYRGLWQIEETFRLTKHDL
FT                   KVRPIYHWTPRRIEAHVAMCFMALVCIRHLSYRVQLQYQALSPEIIRNELVHVQQSILM
FT                   HKTNGCRYGIPSKPTLHAQKIYQVMGEKLSATPFLIQ"
FT   gene            357017..357337
FT                   /pseudo
FT                   /locus_tag="Cpha266_0326"
FT   gene            357376..357720
FT                   /pseudo
FT                   /locus_tag="Cpha266_0327"
FT   gene            357832..359403
FT                   /locus_tag="Cpha266_0328"
FT   CDS_pept        357832..359403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0328"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: bfs:BF1534
FT                   putative transposase for insertion sequence element
FT                   IS21-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64388"
FT                   /db_xref="GOA:A1BCG7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCG7"
FT                   /protein_id="ABL64388.1"
FT                   /translation="MRTQLKKLTMYNKVKEFAREGLSIRQISRKTGMDRVTVRKFLRMT
FT                   DEEFSAFLALQKRRLRKLQPYEQFVKDRVTDYPDCSATQVEDWLKEHHPVFPEVTTRTI
FT                   YSFVQWIRKAYDLPKPKGTPRAYHPVEQLPYGEQAQVDFGEYWMASADACKVKVHFMIM
FT                   LLSRSRRKFVSFSQQPITTRFVLEAHEQAFSFFEGIPHTLVYDQDSTIVTDENRGAILY
FT                   TEAFRKYLLHRSLKIHLCRKSDPESKGKIEAGVKYVKYNFLPGRRFVNLEVLNQEALLW
FT                   LERTANAKEHATTRLIPDAEWQVEKQHLRPFEPLPYPISGTVGKEYHVRKDNTISYRGN
FT                   FYSLPVGTYAGPGTLVVLEVRQNTLCLYAQEGRLLANHPIESGKGTVVINNNHRRDTSS
FT                   KLRELQDSLMLLFTNQEHAERFLESIHNRYPRYSRDQFLHVRNAISGCQQKLIDDALAH
FT                   CVDHHLFSSGEFHDILHHYRKQEEKQSHQAVFNTFRPKTLRSDMDRMLSFVPDSSGITT
FT                   YENIFS"
FT   gene            359409..360245
FT                   /locus_tag="Cpha266_0329"
FT   CDS_pept        359409..360245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0329"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: bfs:BF1535 insertion sequence
FT                   IS21-like putative ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64389"
FT                   /db_xref="GOA:A1BCG8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCG8"
FT                   /protein_id="ABL64389.1"
FT                   /translation="MERTITTIQEHARELNLTGLAGTVDLLLEEARKSEPSYSDFALTL
FT                   LESELSCRRKAHLERRRKIANLPLLHDLDHYDSGVQNGISQVQLQQLRQLLWLDQNFNL
FT                   ILIGPSGTGKSYLAGGLCHEALKLGYHALFRTMDDLIQTIRFKEITAAAAREYKRLLSA
FT                   HLLVIDDIMMFPLEKSVAVGLFQLVNQLHEQTSFIITTNKSPKEWAEMLGDEVLATALL
FT                   DRLLYKCEVIKLTGKSYRLEHRTTIFEQQQSPEGGGNRRKKQLPLQKGVGNHCKMT"
FT   gene            360264..360512
FT                   /pseudo
FT                   /locus_tag="Cpha266_0330"
FT   gene            360566..361108
FT                   /locus_tag="Cpha266_0331"
FT   CDS_pept        360566..361108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all8069 transposase unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64390"
FT                   /db_xref="InterPro:IPR011518"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDB3"
FT                   /protein_id="ABL64390.1"
FT                   /translation="MKTSILNRNGITPEIAGLITRLVTLIPWPARRQAMGDVVLTILDG
FT                   KPRVAENEFGWNRSAVALGIKEYESGIVCVNDLTERHKPKSEEKYPELLASIRKIMEPH
FT                   SQAEPRLRTTLLYTNMTAQSVYNALLAEGWSEESLPAVRTISNILNRQKYRLRTVQKTK
FT                   VEKKQQKQMPSSTTSGK"
FT   gene            361105..361797
FT                   /locus_tag="Cpha266_0332"
FT   CDS_pept        361105..361797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0332"
FT                   /product="Rhodopirellula transposase family protein"
FT                   /note="PFAM: Rhodopirellula transposase family protein;
FT                   KEGG: ana:all8069 transposase unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64391"
FT                   /db_xref="InterPro:IPR011518"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDB4"
FT                   /protein_id="ABL64391.1"
FT                   /translation="MNAWADEDPETVRLSIDTKATVLVGQYSRGGKSRGTEAVKAWDHD
FT                   MRPREKLVPGGILEPVSGKSFLFFGSSNKTSDFLVDGLELWWEERKSSLSHVKQLVINM
FT                   DNGPECNGRRSQFLYRMTVFADMSGLDIRLIYYPPYHSKYNSIERYWAGLEKSWNGYLL
FT                   ESVTTVINRAKSFTWRGIAATAMLIDTVYQKGIKLCGKEKKQMEKRLMRSKDLQWWDIS
FT                   IRPEMVFL"
FT   gene            complement(361923..362387)
FT                   /locus_tag="Cpha266_0333"
FT   CDS_pept        complement(361923..362387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1933 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64392"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDB5"
FT                   /protein_id="ABL64392.1"
FT                   /translation="MNVHHILLDDNNPEHRELSICRTGTINRINLNDSKYQVYASFCID
FT                   AHNYAALFHYGIIEAMNELHFISESGNGLDSWDEAFLHHSALSALLPIIRRCCESIDPQ
FT                   KKETILLGWQNQPVGVAWLRMIDPVKTAGFLRDFDTFIVESEGFDLEFIL"
FT   gene            362562..365126
FT                   /locus_tag="Cpha266_0334"
FT   CDS_pept        362562..365126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0334"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: UvrB/UvrC protein; AAA ATPase, central domain
FT                   protein; Clp N terminal domain protein; ATPase associated
FT                   with various cellular activities, AAA_5; ATPase AAA-2
FT                   domain protein; SMART: AAA ATPase; KEGG: cte:CT0191
FT                   ATP-dependent Clp protease, ATP-binding subunit ClpC"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64393"
FT                   /db_xref="GOA:A1BDB6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDB6"
FT                   /protein_id="ABL64393.1"
FT                   /translation="MEGNFSNRVQDVIRLSREEALRLGHDYIGTEHLLLGLIREGEGIA
FT                   ARILKNLKIDLYRLKQKIEDSTHPKVPATQMGNVPLTKQAEKVLKITYLEAKICKSNII
FT                   GTEHLLLSILKGEDNIASQILEQFGVSYDMVRDELLSITSGGTESDEPPAEGYASSGGS
FT                   ERSAKKADPKRGERTKTPVLDNFGRDITRLALDDKLDPIIGREKEIERVAQVLSRRKKN
FT                   NPVLIGEPGVGKTAIAEGLALKIVQRKVSRVLYDKRVVALDLAALVAGTKYRGQFEERM
FT                   KALMNELERSRDVILFIDELHTIIGAGGASGSLDASNIFKPALARGELQCIGATTLDEY
FT                   RQYIEKDGALDRRFQKIMVEPATVDETILILNNIKSKYEVHHHVRYSEDAIEKAVKLSE
FT                   RYITDRFLPDKAIDVMDEAGARVHLSNIHVPDEILELEKSIEAIKTEKNQVVKMQNFEE
FT                   AAKLRDKEKHLLESLDHAKQEWEDRAAESVYDVTETDITSVIAMMTGIPVARVAQSESK
FT                   KLLSMEADLMKEVIGQDEAIKKITKAIQRTRAGLKDPSRPIGSFIFLGPTGVGKTELAK
FT                   ALTRYIFDTEDALIRADMSEYMEKFSVSRLVGAPPGYVGYEEGGQLTEKVRRKPYSVVL
FT                   IDEIEKAHPDVFNILLQVLDEGVLTDGLGRKVDFRNTIIIMTSNIGAKDIKSFGAGSGM
FT                   GFTAPDDASGSYKAMKSTIEDALKRVFNPEFLNRIDDIVVFHPLEKQHIFKIIDITAGK
FT                   LFKRLREMGIEVEIDEKAKEFLVDKGYDQKYGARPLKRALQKYVEDPLAEEMLKGRFIE
FT                   GSTIRILFDEDEGELRFIDGEPATKKRKRDEKLDKEVPDPNS"
FT   gene            complement(365166..366539)
FT                   /locus_tag="Cpha266_0335"
FT   CDS_pept        complement(365166..366539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0335"
FT                   /product="pyridoxal-phosphate dependent TrpB-like enzyme"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: plt:Plut_1929 tryptophan synthase subunit
FT                   beta; TIGRFAM: pyridoxal-phosphate dependent TrpB-like
FT                   enzyme; PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64394"
FT                   /db_xref="GOA:A1BDB7"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006316"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDB7"
FT                   /protein_id="ABL64394.1"
FT                   /translation="MGTDLTKIILDEHEMPRQWYNIQADLPVPLPPPVGMDGTPISPDD
FT                   LAQVFPMNLIEQEMSTERWIDIPEEVLSILKLWRPSPLYRAKRLEKALGTPAKIFYKNE
FT                   GVSPAGSHKPNTAVPQAWYNKQFGIKYLTTETGAGQWGSALAMSCKLIGIECKVFMVRI
FT                   SFDQKPFRKIMMKTWGAECIASPSRETAIGRRILEEMPDTPGSLGIAISEAIEQAVERE
FT                   DTRYALGSVLNHVMLHQSIIGLEAQKQFEKIGLYPDVVIGCAGGGSNFAGISFPFICDK
FT                   IHGKDIQIIATEPEACPTLTKGPYIYDSGDVALMTPLLAMHSLGHGFIPPAIHAGGLRY
FT                   HGMAPLVSHVKQLGLIEATALPQTECYEAALLFAHTEGFIPAPETSHAIAQTIREAKKA
FT                   KEEGKERVILMNWSGHGLMDLQGYDAFLSGKLSDYALPDELLQQSLAAVRNHPKPPGA"
FT   gene            complement(366885..366973)
FT                   /locus_tag="Cpha266_R0008"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(366885..366973)
FT                   /locus_tag="Cpha266_R0008"
FT                   /product="tRNA-Leu"
FT   gene            complement(367091..368158)
FT                   /locus_tag="Cpha266_0336"
FT   CDS_pept        complement(367091..368158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0336"
FT                   /product="thiamine-phosphate kinase"
FT                   /note="TIGRFAM: thiamine-monophosphate kinase; PFAM: AIR
FT                   synthase related protein domain protein; KEGG:
FT                   plt:Plut_1928 thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64395"
FT                   /db_xref="GOA:A1BDB8"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDB8"
FT                   /protein_id="ABL64395.1"
FT                   /translation="MPYKAISDLGEFGLIDRISSLVGPTLDASPNLLTGIGDDCAVYQP
FT                   TAGMLEVTTTDLLVEKVHFDLLTTPLKHLGSKSISVNVSDICAMNATPQYALIGIAVPP
FT                   SFSVEMIEELYKGMSHAARIYGVAIAGGDTSVSRSGLFISVTMTGEVSGERLTRRSGAK
FT                   PGEMICVTGTLGGAAAGLRLLMREKNIMLEHIEHHEPYNKSLMVDLEEYADAIKEQLLP
FT                   AARIDIIRFFHSRNINPTAMIDISDGLSSDLRHLCNSSGTGAVIHEGRIPVHSGARRIA
FT                   DELRDDALGWSLTGGEDYQLLFTLPKERFPDIAEHDDISIIGEITEKDAGISLVDIYGM
FT                   SIDLEKLPGYDHFRS"
FT   gene            368262..369212
FT                   /locus_tag="Cpha266_0337"
FT   CDS_pept        368262..369212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0337"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: cch:Cag_1212 cell division transporter
FT                   substrate-binding protein FtsY; TIGRFAM: signal recognition
FT                   particle-docking protein FtsY; PFAM: GTP-binding signal
FT                   recognition particle SRP54, G- domain; GTP-binding signal
FT                   recognition particle SRP54, helical bundle; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64396"
FT                   /db_xref="GOA:A1BDB9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDB9"
FT                   /protein_id="ABL64396.1"
FT                   /translation="MGFFDKFKLSRLKEGLSKTSETFREKLSLITQGKTEIDEEFLEEL
FT                   EHILVGADVGVETTLSIVDAITERAKRESYRSAEELNRMLMEEIQQMLLDSGEHYPIDF
FT                   DAPLSAKPYVILVVGVNGAGKTTSVAKLAYNYEKAGKKVIIAAADTFRAAAYEQLKIWA
FT                   DRAGVPLIGQGQGADPASVVYDAVSSAVSRNSDVVLVDTAGRLHNKSHLMEELAKIMRV
FT                   AKKKIPEAPHEVLLVLDGTTGQNAVSQAREFTRFVNVTGLVLTKLDGTSKGGIVLSISR
FT                   ELNLPVKYIGVGEKIDDLQLFDRARFVEALLGRQE"
FT   gene            complement(369215..369784)
FT                   /locus_tag="Cpha266_0338"
FT   CDS_pept        complement(369215..369784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1211 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64397"
FT                   /db_xref="InterPro:IPR002837"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDC0"
FT                   /protein_id="ABL64397.1"
FT                   /translation="MPPDQFTIFGDNYPRGSYILFLKVSKPIRLSFGKFQGGRLLDVPK
FT                   GEYLYIGSALGSGKADKPLAQRLVRHASRSGNNKPQPIQKTLRLLFEPEASCKKAGTTL
FT                   HKKMHWHIDYLLDCPETEITHIVVVQSPLRLEPLLCNFISSLDTVEPLAKRLGAQDTKN
FT                   STHLLKIADSEQLLLIIKNKIPELIA"
FT   gene            369907..370557
FT                   /locus_tag="Cpha266_0339"
FT   CDS_pept        369907..370557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0339"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="KEGG: cte:CT0202 protein-L-isoaspartate
FT                   (D-aspartate) O-methyltransferase; TIGRFAM:
FT                   protein-L-isoaspartate O-methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64398"
FT                   /db_xref="GOA:A1BDC1"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDC1"
FT                   /protein_id="ABL64398.1"
FT                   /translation="MDSNSRLMTFRRREMVEKLKLSGIADNRVLAAFLSVERHRFFDKE
FT                   SQEYAYADGAYPIGYGQTISQPYTVACMTSLLVERSPSGKVLEIGTGSGYQAAILYALG
FT                   YRVYTIERVVELSEKAEKLFSALGFSIMCRSGDGTLGWPEEAPFDGIMVTAGAPHCPET
FT                   LLHQLALDGSLVVPIGAHGLQKMTVFQRKKDRFEKEVFSDFAFVPLIGREGWG"
FT   gene            370590..372692
FT                   /locus_tag="Cpha266_0340"
FT   CDS_pept        370590..372692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0340"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: plt:Plut_1922 peptidyl-prolyl cis-trans isomerase,
FT                   PpiC-type"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64399"
FT                   /db_xref="GOA:A1BDC2"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDC2"
FT                   /protein_id="ABL64399.1"
FT                   /translation="MAVMTSLRDKTHIILYALLAAFLALIVFEWGMNFSGFSGKKRDIA
FT                   GKVNGKDISAAQYEEVYNEISGNFRRTNPGAEITPVTELEFRQQAWNIVVDQTLLEEQF
FT                   AKFGITVQDQEVVESLDSPEPPMIIRQNFSDSTGSIDRKKLDVARRDPKNKDLWLQLEK
FT                   MVQRELKVNKLIRALQPMVRVTGRELDDIVRRNFGRFSASFVPVPLSFAGTDTSFPVKE
FT                   DEIQKYYNEHKELLKQLPSRSADYVFFPLTPSSKDSSSVRSELESLRSEFSAAVNDTDY
FT                   VKVQSDRPNGVNVLYNRANFSLPAGSIVFSPANLKAGAIVGPVADRGEYRLLKIKEVRT
FT                   AQPIARASHILLRFNPGNKEEVEKVRERMVMIFKNLQAGVPFETLAGKYSEDPGSAVQG
FT                   GDLGWFTRESMLPEFSAAVFSGTPGAVVKPVQTKFGLHIIKVTGFDQTAVIASEIVRTI
FT                   RPSTETVDSARRLAMAFQMQAKDKGLEKSASTEKLVVGKTGDFGKHTLIADIGFSDKIT
FT                   AFAFNGKEGALSDVIETEKGFYVMKLTGVNDTGYRRLDADLKKRITAELVRLKKEPVLE
FT                   KKLSLNAKQSGATLDKIAAAYPGTVVVTADDIRWVDGFIPGYGFDQPLVEAMSAMTEGK
FT                   LSGPVKTNDGYAIVLLSKKNMPAERDVEAAKTAFTPKIIQDKLNRLFTEYFATIKKNAV
FT                   IEDLRP"
FT   gene            complement(372862..374670)
FT                   /locus_tag="Cpha266_0341"
FT   CDS_pept        complement(372862..374670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0341"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing enzyme;
FT                   PEP-utilising enzyme, mobile region; PEP-utilising enzyme
FT                   domain protein; KEGG: plt:Plut_1914
FT                   phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64400"
FT                   /db_xref="GOA:A1BDC3"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDC3"
FT                   /protein_id="ABL64400.1"
FT                   /translation="MPEQKKNTLKGVLPSKKQSRSNRSDGGNIKPHEATFNGIGTSRGI
FT                   AIGECYAYEKEQYEHEITSLDNDNIEAEIERFIEAVHRSEKELKKIERVTTRKLGKGYA
FT                   NIFQAQIMMLQDPMLIDSISLRIRSEMIPAHLVIEEEFGHYHEKFKSSDDVVFQERADD
FT                   FFDIKNRILRNLHVRKMLSWIPEGTIVVSDHFCPGDIILLSRSNVKGFLSDSGGKTSHI
FT                   SLICKSLNIPMVAGLGNFSQNAVSGTQMIIDGSSGTVIIHPEEKTIQLYQEKQKAEKQS
FT                   NADASLTATLPASTKCGVRINFFSNIDFKEELLGLKETGSEGIGLFRSENLFIDGTKVP
FT                   GESEQYHYYREMSETVAPQPFVVRLFDIGGDKLIYSPIREPNPNLGWRGIRILIDVPEI
FT                   LENQLRAVIRANALGNINILIPMITSLDEIMTICAMVDRLHAEVIEQTGVAGEKPELGA
FT                   MIEVPAAVEIIDEITKCVDFISLGTNDLTQYTLAVDRNNVIVQDLFEKFHPAIIRQLHR
FT                   VIATAQKNHCRVALCGDMGSDPLALPFLIGCGLRKFSVVSADIANLKRFVSRYSVAETE
FT                   ALALECIKLDSAQKIKACLETFQAEH"
FT   gene            complement(374682..376214)
FT                   /locus_tag="Cpha266_0342"
FT   CDS_pept        complement(374682..376214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0342"
FT                   /product="replicative DNA helicase"
FT                   /note="KEGG: cch:Cag_1608 DnaB helicase; TIGRFAM:
FT                   replicative DNA helicase; PFAM: DnaB domain protein
FT                   helicase, N-terminal domain protein; DnaB domain protein
FT                   helicase, C-terminal domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64401"
FT                   /db_xref="GOA:A1BDC4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDC4"
FT                   /protein_id="ABL64401.1"
FT                   /translation="MIKPKADILDFSKDIDFNLEGRVPPYSTEIEQEVLACVLLEDDPV
FT                   EQVIQIFGDSAEEVFFERRHRLIFKSMMQLYNKRQAIDLITVSEELLKMNELDNIGGRH
FT                   YLAELSGKVISAANVEYYARLAKEKYLYRRMISISAKVSGAAYSSSMDIFDLVEHASQQ
FT                   FFNISQAGIKKKASPIKDLVKNGIRMLETLRASQSSITGVGSGFSDLDQFTAGFQSSDM
FT                   IIIAARPSAGKTAFALALARNAAVDFNTPVLFFSLEMAEVQLAVRLMCAEAYVESQLVR
FT                   TGRITPEMMSKIINSMDKLNEAKLFIDDTPGISIMELTAKTRRMKQEHNIGMVVVDYLQ
FT                   LVTPVKDGKTNREQEIAQISRSLKALAKELNIPVIALAQLNRSVEQRSGDRRPQLSDLR
FT                   ESGSIEQDADVVMFLSRPEMYNIQTFSDGSSTKNMVEVVIGKQRNGPIGDIRILFLKQY
FT                   GRFQSAATSYLSNTDEQNGGSANERNLPPEAPALQKTQMSANTFINADDAPF"
FT   gene            complement(376201..376872)
FT                   /locus_tag="Cpha266_0343"
FT   CDS_pept        complement(376201..376872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0343"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG: cte:CT0206
FT                   DNA polymerase bacteriophage-type"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64402"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDC5"
FT                   /protein_id="ABL64402.1"
FT                   /translation="MHPFLFSDHDDTLPSVQSEAGAPFRDLIGLSLAVKSCTKCRLSAS
FT                   RKNVVFGEGDPRAALVVIGEAPGADEDSQGRPFVGRSGQLLDKILQAVQFKREEVFICN
FT                   ILKCRPPQNRNPLADEIECCMPWLLLQLELLNPKLILLLGKVAANTILQNSLSMGAMRG
FT                   RIVKWKAYDCMVTYHPAALLRNPGWKKACWEDVQMMRQHYDKLCSAEAHSRTMVTNNDQ
FT                   A"
FT   gene            complement(376893..378125)
FT                   /locus_tag="Cpha266_0344"
FT   CDS_pept        complement(376893..378125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0344"
FT                   /product="Phosphopantothenate-cysteine ligase"
FT                   /EC_number="6.3.2.5"
FT                   /note="TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein; KEGG: cte:CT0207 pantothenate metabolism
FT                   flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64403"
FT                   /db_xref="GOA:A1BDC6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDC6"
FT                   /protein_id="ABL64403.1"
FT                   /translation="MLRGKNIIIAICGGIAAYKIPVLVRLLKKGGANVKVVLTASAARF
FT                   VSELTLATVSQEQVYCSLFPPVERENVDYTRHISLGEWADIFVVAPATANTIAKLAAGL
FT                   CDDMLSACFLTLRPNKPVLLFPAMDGEMFTSSSVQRNLAMLLADGARIINPDSGELASG
FT                   QCGLGRMPEPEAIAALIEEELLKSCNKHSSLQGKSVVITAGPTREKIDDVRFISNYSSG
FT                   KMGFAIARAAAERGAKVTLLAGPVSLITPPLVERVDVESAKEMYDAARQLFETCDVFVS
FT                   AAAVADYRPDSPFQGKLKKNGEELSLTLRKNPDILAEFSKQKSPSQIAVGFALECEDGL
FT                   KNAIKKRIEKKLDLIALNFYDGKSSGFEVETNMLTLIGSDDTATVLPLLSKPDAANRLL
FT                   EAVEKLIQPDS"
FT   gene            complement(378181..382719)
FT                   /locus_tag="Cpha266_0345"
FT   CDS_pept        complement(378181..382719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64404"
FT                   /db_xref="GOA:A1BDC7"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDC7"
FT                   /protein_id="ABL64404.1"
FT                   /translation="MEKSKKVFIGFLALLSAGVLLLSIVAAIVLNSGFLDRFAKDLAVK
FT                   LFNEEFYGHLELQKVKLNFPNKVTILSPRIYEPDEDLPALSADKVTLRFNFLTILKPKI
FT                   DKLSFRKIKVDSLLINVIERENGKRNIDLIFTSRKPDSTDAPIESFFSKVVTLRNSSLN
FT                   YSRTLPNETPLALTVQNISLDLNSLRLKIKKKEFGGTIEALALDIPQHSFRLKQGSGQF
FT                   FVSEKRADIIALKATSDKSNAELSLSLDKFNIFDPDQKKLLLAGKSFLDIQALNIHTRD
FT                   LNMIYPDIALPEGVYSLKGDARSQSNTIEIIKGVLAHNKSHLAVKGKLLNVQNKNAFGY
FT                   QLEIDSSKIDPDFFQAFFSDKNQKELIARIGAISFIGKAHGNLKELSTDVHILTKAGNA
FT                   SIKGEAAGEPGKQIKGKGAFSLEKTLPHLFTGTTTAKSMLNATGNFDGIVNGSELAELH
FT                   IESDLKDSFWQQQALKQGTLSLDYSRELVRAKAILQNGMESIDVSGQISWKGGSADYQA
FT                   EGKVARLNLAKSLASNDFVTDLNGVFALKGSGFDPASLNAALTARFSPSSINNFRLRDK
FT                   SELSAAVEQHAASSTVTLKSDFLDLAVQGNQSFKELLGAIELAGSGISGEIRTQSLWSS
FT                   RPAGPRSDAFLSLKKPFTVSYRILVKDMEPLSPLLPFRDLALQGSAEGQFFYENGRCAL
FT                   TSSLDLGSLAYGKAVALKKLSATAAMECSGNGIPKAAIKGKAASLVFSGQTSNNLVFDA
FT                   TYSTGRLTASIDAGRFENDREFSTAFSLQRTGSAYDLGFTKLAIGKGKNRWQTQGGSHI
FT                   KIEKMAVQFNRFTIANGNQHLVLNGELSNSRPGSFQCNLSHLDLAALGELSEKRLPSGM
FT                   SGTIDASLTISGNPNTKTSTLSINGKSVGFDKIPLGNVQSNIRHAGNKLSFDYKSFITE
FT                   PVNKGNTTPSVNTIAGSGTMPLVLAYYPFELRIPQEQKIQASFRSDNLSARFLKVVLPF
FT                   VEDAAGIMPTTLTVEGTTSRPEIYLLSRLRDTQIKLEATQVTYLLNGDIQVTPRQLELR
FT                   DLRIADLQNGTGSLNGLLKIENLKPKTITLGANLSKLLLFHKKDTRDEKPFGTIIGSTR
FT                   NLLLNGDISSPVVEGDITINSADFTMYRPGANESAKYIGVEKFIEFVPRYPSQQSMVAQ
FT                   TDLDSDPVGFNYSLIDILQLKDLKIRSAEQLKFRVIFDRTRGEELEAAISGMQLMVNKS
FT                   QQRYRLFGSVALSDGKYRFSNTNFDLEDGGKIVWNNVGIHEGIMQNLYGTKYISALSPE
FT                   TGDRDNVKLLLAISGTISEPNVEMGYYLNDQMQPFSSKNLIGGKPSQIDPNAELNVISM
FT                   LLTSQWYAPQGSSGLSKNLAVSSVGLSTGSGLISSQLSRLVQNVAGFESFNVNLGMNSK
FT                   GEISGIDLYMAVNVPGTNGKVRIIGEGSSHDVKNKPLFNYYGTSQKVEYRVSPKVYIEA
FT                   YRSYGQTENEAANTNLQSPTETWGASISYRERFHTWDSFWKRIIPSSNKKK"
FT   sig_peptide     complement(382639..382719)
FT                   /locus_tag="Cpha266_0345"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.410 at
FT                   residue 27"
FT   gene            complement(382706..383263)
FT                   /locus_tag="Cpha266_0346"
FT   CDS_pept        complement(382706..383263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0346"
FT                   /product="rfaE bifunctional protein"
FT                   /note="TIGRFAM: cytidyltransferase-related domain; rfaE
FT                   bifunctional protein; PFAM: cytidylyltransferase; KEGG:
FT                   plt:Plut_1901 RfaE bifunctional protein, domain II"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64405"
FT                   /db_xref="GOA:A1BDC8"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDC8"
FT                   /protein_id="ABL64405.1"
FT                   /translation="MLVLQLHVIFLQLADRYLMNSKLLTRAKAKEQVIAWQSSGKKVVF
FT                   SNGCFDILHAGHVQYLSRARQLGDILLIGLNSDASIQRIKGPLRPVCAEQDRAAVLSAL
FT                   QMVDAITLFDEDTPEALIEALLPDILVKGADWDIERIAGAKAVLQSGGKVLTLPILEGR
FT                   STTGIIEKVIQIYGKHTPRGKE"
FT   gene            383525..384421
FT                   /locus_tag="Cpha266_0347"
FT   CDS_pept        383525..384421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0347"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   cch:Cag_1483 acyltransferase, HtrB/MsbB family"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64406"
FT                   /db_xref="GOA:A1BDC9"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDC9"
FT                   /protein_id="ABL64406.1"
FT                   /translation="MTDPSITNKQSSDRRIYKLFMLFSVLVRKMNRKTALFMADRLGDL
FT                   MFDILKIRKPLVEGNLSITFPEKSANEIRSIARRVYRNQARNFIEVLRLPLIASREDAE
FT                   ELFDINASQLSDILQRSGVVLVSAHFGNWELLGFCAGIMVTPLTIVVKRLRNDDVDRCI
FT                   NTWRTMKGNTVVKKSRALREGLKTLRNKGIVSFLADQSDPEGTFVTDFLGRPSSVFLGP
FT                   AYLALKTRVPLFVCMAYRKEDGRHTVDIEQIPTEDLKDSREDFEELARRYTRAIDKAIR
FT                   VRPEEWFWLHDRWKRTF"
FT   gene            complement(384737..386182)
FT                   /locus_tag="Cpha266_0348"
FT   CDS_pept        complement(384737..386182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64407"
FT                   /db_xref="GOA:A1BDD0"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDD0"
FT                   /protein_id="ABL64407.1"
FT                   /translation="MQINSSDRTQSISSIWHHRLIRFFSSTTTQYIAAGLSLILIFNTY
FT                   YLLIDMKVFGHDEVHYYTDFTFKLKEEGRWANYFLHKLLRHIPLQTHVILFLSSLWGVF
FT                   YYISKNLTKESWYSIIIASVLLIETPNAYQSLWPATVLPTTISLLLLAWMAQKDISYKV
FT                   IYLVGGVLLFGMMQNYYFLLPLLFLGHYKFDKTSINSTIPLVTTHLLFWITGAVSGLVV
FT                   ASLIVYIHTGQAGIIPAEWRLIMPAHDISTLLRNIIYVFQNLTEQLVVFWKNSASNGFL
FT                   YPLLLIIFTFARLKNSFSNLYISIILSAVFLSFFIFSIPLAPIIQTRSLVAFSSSLILL
FT                   FFIESKQLLFPRWLSVFLLLWTGLNLSISGRSYLYEHKTQSEFVLNKIEAAFSHHPANY
FT                   TAVAVFGHVDNKYKEAFLFNNPERLRPIILTLGANHFIDGRVDTQQKSLLTEAVNIDTT
FT                   SANNKIKLFVTKKNVAVILLEKN"
FT   gene            complement(386294..386677)
FT                   /locus_tag="Cpha266_0349"
FT   CDS_pept        complement(386294..386677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0349"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: pma:Pro0382
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64408"
FT                   /db_xref="GOA:A1BDD1"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDD1"
FT                   /protein_id="ABL64408.1"
FT                   /translation="MITISSEIIRYLITGIFNTLVGYGTFFVFYRFVNLSPELSNAIGY
FT                   GIGLISAFILNRLFVFKRTIFSFGAFLRFVLSFIISFILNLAILYYFHRSLHVIPEIAQ
FT                   IAAMIAYTIIFYLLNKYFVWKHK"
FT   gene            complement(386658..387659)
FT                   /locus_tag="Cpha266_0350"
FT   CDS_pept        complement(386658..387659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0350"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   pma:Pro0380 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64409"
FT                   /db_xref="GOA:A1BDD2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDD2"
FT                   /protein_id="ABL64409.1"
FT                   /translation="MQLLSLVIPCYNEEAVIDETIKRLKTFCSERNDLDVELILVDDGS
FT                   RDRTRMLLKSYASDDTRIKVIVFARNFGHQIAVTAGIDAARGDAVVLIDADLQDPPEVI
FT                   HKMIAKWREGYDVIYGTRAVRIGESAFKQFSARFFYRFLNKLSDIPIPLDTGDFRLMSR
FT                   DVVDTLKAMPENDRFVRGMVSWVGFKQTALPYTRQERFAGESKYPLKKMLRFANDGILS
FT                   FSTKPLQISISLGLLSAALAFAGIIYALLVRIFTYNWVEGWAGIMIAVLFLGGIQLISV
FT                   GILGEYIGRIYNEVKKRPLYVVEEYVGFNSEDLKMSRSPVIRHFSYHDNHIK"
FT   gene            complement(387683..390667)
FT                   /locus_tag="Cpha266_0351"
FT   CDS_pept        complement(387683..390667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0351"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; glycosyl
FT                   transferase, group 1; KEGG: xom:XOO_1639
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64410"
FT                   /db_xref="GOA:A1BDD3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDD3"
FT                   /protein_id="ABL64410.1"
FT                   /translation="MINKSLFLKPARIIEPIGWLGHIPFSFWIVEAAKPQVIVELGTHS
FT                   GNSYFSFCQSVKYNSLPTLCYAIYSCLNNEQTELYNADIIDSLLTYNNEHYQAFSNVTG
FT                   NTYYNALSFFEDASIDILHINSEGTYTSVVNLFNAWIPKLSSSGIVLFDNINASENNTE
FT                   VYKLWGYVKNIYPNLTIEHSNGLGVIFTGNMYNDNINEFIKTIETEANRNIIGTLFEKI
FT                   GNTIEMDFQIRRLLNSLKEADTMIDMLNQTISNRETVINKLIQTIEKNDETIKSFSKKH
FT                   DFVKVKPLRKLKKSIRKRAHTLSKLFFKVEDKNHLSVNTHNSNAEWFLKEYKNIACSDN
FT                   KHCFHYKFGIIDHLAENNSFFKESKPTASIIIPVYGNISYTIKCIESLLNLPDSTSFEI
FT                   IIIDDHSPDNSYETLNKISQIKLIRNDCNKGFIHSCNSGASLATGEYLIFLNNDTEVLN
FT                   AWLDSLIAPFIIHDNVGLVGSQIIYPDGRLQEAGGVILSDGSGLNYGRLSDPNKPEYNF
FT                   LREVDYCSGCSIAIKKSLFDSIGGFDTLFIPAYYEDTDIAFTVRKMGYKVLYQPASKVI
FT                   HHEGITSGTDLKKGVKKFQNTNKIKFYNKWETQLKSHNILPDNYSLAKCKYYKDTILFI
FT                   DACTPTPDKDSGSVDAFFHQYIFTKLNFKVTFIPDNLIFLDGYTQVLQQLGIECLYKPH
FT                   ITSIENFLKTRGAEFKYVVLSRVGIAVKHINAIKKYCPNSILIFNLVDIHYIREARQAR
FT                   TLNSIELLHKAKKTKATELSIMKRSDVNIIISESEVKHLSKIDPELKLFNLPLILDMHQ
FT                   RTNNFENRKNIMFIGGFQHSPNVDAVLYFSREIWPLVKTRLVDAHFIIIGSEMPNEIIN
FT                   LHNQNGILSIGYIEDLSPFFNSCKFSIAPLRYGAGQKGKLARSGSYGLPSVATSIAVEG
FT                   MGLKHEKHILIADKPDDFANSIERLYHDSILWEKLSKNIYDYTNSEYSITKGISRISNL
FT                   IHALN"
FT   gene            complement(391265..392671)
FT                   /locus_tag="Cpha266_0352"
FT   CDS_pept        complement(391265..392671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0352"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   mes:Meso_4308 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64411"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1BCF7"
FT                   /protein_id="ABL64411.1"
FT                   /translation="MQLPYTNIHTDQPNQQALFPDCFEVSVAPVKGKKVVLDFQGGNAT
FT                   SDAGVLLLKEVESMTRIVPKLADCIADSRRTSSVMHSIPDLIAQRVYQIACGYEDGNDS
FT                   NSMRKDPALKMALNRLPESGDDLASQPTFSRLENMVTRPELYRMAVGFLDHFLDSYTEA
FT                   PRVIVLDFDDTEDVVHGKQQLALFNGYHQETCYQPLHVFEGLTGKLIASILRPGRRPTG
FT                   KEIVSYVKRIVRHIRSRWPETIIVYRGDSHYGVPEVYSFLAREQNCYSVTGLGGNDVLL
FT                   RSVKDIIEEVKKHGAGYRRYHTFQYQARSWKETRRVVAKVEMTEKGLNVRFISTDMQEA
FT                   KAKTLYEQIYSARGNDELYIKAHKTFMKSDRTSCHRFLANQFRVFLHSAAYVLVHAFQT
FT                   NLLRGTALATATFETIRLKLLKIGAKVIEMKTRIKVHLPTSYPYKPILNKCFAVLEHLR
FT                   SVPWPSTAIP"
FT   gene            392896..394815
FT                   /locus_tag="Cpha266_0353"
FT   CDS_pept        392896..394815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0353"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter, transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: cch:Cag_1482
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64412"
FT                   /db_xref="GOA:A1BDD5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDD5"
FT                   /protein_id="ABL64412.1"
FT                   /translation="MNLLLRMLRYLAPSKGKIALVVVVSIITSFLSVISIYSILPLLNA
FT                   VFETGPVTRTEATHTESDGKSRQEESMQKATPLKPAIGNGFVNFDELKKNALVTFQHAF
FT                   HAETKERSLLNICLFLIAAFAVKNIFVYLNGQLIFRIQTKTAKKLRDDVFRSIIEMHLD
FT                   YFNKNRVGNLMNYVYNDVENVNASISSTLVNFLQNPFSIFVYMVVLFALSWQLTLFAAF
FT                   TSLLIFFLIQLVGKNVKGLALTFQTRMGDMNSVLQEKFNGIKVIKATAFEDVELERFKE
FT                   FTRDFRTLGIKIQQMRNVISPLNETLLVAAIAGVLWFGGLQVFKGVMTANELIVFAFTL
FT                   YSTMGPIKMLGNANTSIQIGLISVERLFEVLDAEAVVVNGTRSITGFSHTIRFEDVCFR
FT                   YLKEPDAPNVLDHVTFEIKKGEMVALVGQSGSGKSTAVDLLLRFYDVDSGRITIDGVDI
FT                   RDYDFKQLRRMIGVVSQEVILFNDSIDANIAYGVRDEIGHGRVEQAARLANAHQFISEK
FT                   PDGYNTLIGDRGIQLSGGQRQRLAIARAMVKNPELLIFDEATSALDNESEKVVQQAIDH
FT                   ALANRTALVVAHRLSTVKNADRIIVMERGQVAESGNHEELLQADGLYRKLYEIQFAGKT
FT                   ERAS"
FT   gene            complement(394874..396850)
FT                   /locus_tag="Cpha266_0354"
FT   CDS_pept        complement(394874..396850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0354"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   bcn:Bcen_0396 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64413"
FT                   /db_xref="GOA:A1BDD6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDD6"
FT                   /protein_id="ABL64413.1"
FT                   /translation="MIRADQKAQNDFGAGECLDTELITRNNDLQALLSEQERRIYDLLQ
FT                   QYHKNESELRSVYNTPIGKIVRYYKTIKQKKKTQKNAEKNDYNIWLNKYDLLTEKRRKN
FT                   IIAEIATKRESPLISVFMRLNKRSLSSLEQSVQSVKAQLYPHWELCIIAEASQHTEAET
FT                   AIRKFVENDARITRHVKKETNTISEASNAALELAGGEFFALLESGDTIHPLALYHVAQE
FT                   VMRYPEAGLLYSDEDSLDNNNKRVNPFFKPDFNYDLFLCQNMVGNLAVFKTSLARQTGG
FT                   FKRELDGAQDYDLALRFYEKLKPEQIRHIPRVLYHKRISRSGTIAATETQISGNQEAAL
FT                   LAVNHHLKRTGIEATVEKAPEYPECNRIRYTIPNTPPSVDIIIPTKDMANLLKICVLSI
FT                   LAKTTYNNYSITIIDNGSKEQNTLDLLKQWKNDSRIRIIRDDETPFNYSKLNNRAVHSS
FT                   SADFICLMNNDIEIITPEWLNEMMGHAIQPGVGAVGARLWYPNATLQHAGVITGMYTGT
FT                   GHAHKKYPKGNPGYFGRACLQQEYSAVTGACLLINRINYLHVAGLNEQELTVAFNDIEL
FT                   CLKLKKKGLRNIWTPYAEMFHHESLTRGRNDTPEKKELAGKELAYMQNTWGIDKNHDPA
FT                   YNPNLSITSDDFSLSWPPRILDR"
FT   gene            complement(396890..398017)
FT                   /locus_tag="Cpha266_0355"
FT   CDS_pept        complement(396890..398017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0355"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   gbe:GbCGDNIH1_0248 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64414"
FT                   /db_xref="GOA:A1BDD7"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDD7"
FT                   /protein_id="ABL64414.1"
FT                   /translation="MKIVYIARSAIPSRDANSIHVMKMCQAFADNGHEVIFLLPDRSSG
FT                   CEPGINDIYAYYGVKRNFQIRKFEYQHLKVKFVSQIRQMQKSLHELDPDLVYGRCFLGC
FT                   TIACLSGYKTIYESHLPLWRSGNIKKLWFSLVTRNRNFKRLVVISEALKTLYSNENIIS
FT                   QDKLFVAHDGADKVIDFQSKAELSGEKERLHVGYSGHLYQGKGVEVIAGVAPLMTEVNF
FT                   HIIGGKENDIAYWKSVIKSDNVFFYGFKNQTELPKYLNSFDICLLPNQKVVLPCGKRDE
FT                   KRNISDFTSPLKMFEYMAHKKAIISSDLPVLREVLNESNALLVQCDDFQQWADAITALQ
FT                   DKNKREAIAQQAYEDFMTSYTWKIRAEQVLSNVIK"
FT   gene            complement(398040..398993)
FT                   /locus_tag="Cpha266_0356"
FT   CDS_pept        complement(398040..398993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64415"
FT                   /db_xref="GOA:A1BDD8"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDD8"
FT                   /protein_id="ABL64415.1"
FT                   /translation="MIINRLLQFFHLFILYRFGSAIGDQLCMTAIIENLFTEHRLKSVV
FT                   FSSYPEFFENNPNVCKNYSFKRMPKFFRNILLSLLRIAEGENIANFCFPKKKDGGLECF
FT                   MRKSKAKISLIEAHSCYFKKKLILLQATPKIYFSDEELAVFSRKFSDLPDRFGIVQPVG
FT                   KTTYTPNKEWGFANFQKVIDSAPHFPWLQTGMINELLLDHVIDFRGKTESLRELAYIVS
FT                   RADFILCLEGLLNHLAASVGTRSFCLFSGFHPVEIANYATTIPVVLDPQPDCSPCWRLE
FT                   KCPQKSKYCTEGILPEQVIKVITTAPSLNNQPAIKL"
FT   gene            complement(399139..400308)
FT                   /locus_tag="Cpha266_0357"
FT   CDS_pept        complement(399139..400308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0357"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   cpe:CPE2219 probable mannosyltransferase B"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64416"
FT                   /db_xref="GOA:A1BDD9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDD9"
FT                   /protein_id="ABL64416.1"
FT                   /translation="MALRNQSKQLHQKSNALNNRKKSTMNITYDVVKTAGYSGNLTYTK
FT                   DLISALALHFPDNRYRLLTQLNKKKDVEAFFGKNNSFEYRNILLNERMLGEKGRPFFQA
FT                   INLSVLREAANHTDMYHATNPTHFPDGIKNGVVTLHDLIALLPESWASVDSRTFYHKKI
FT                   SSILQQAKLVFTVSEFTRSDAQHYFPKYADKYVATPLAANPAFRQISTNRNFLLQYGIA
FT                   DPLKPYLLYVGEIQPRKNIEGLLRAFEALPSALQHELQIIIVGHAKRKENLTLFHDAIN
FT                   DMKSRAPVYHLRNVPLVDLVKLYNAAHAFVYLSFYEGFGLPIIEAMSCGCPVLTSKTTS
FT                   LGEVAADAALTIDPRDHEEITEALKQLLEEGETRKKLIEKGLLRAQEFS"
FT   gene            complement(400322..401470)
FT                   /locus_tag="Cpha266_0358"
FT   CDS_pept        complement(400322..401470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0358"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   mma:MM0650 mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64417"
FT                   /db_xref="GOA:A1BDE0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDE0"
FT                   /protein_id="ABL64417.1"
FT                   /translation="MNIGIDFTHDLGYSGIGTYCRSLTEAMAQREPENIYNILTLHHKI
FT                   PEVQQHFSNLRAIVYSAPFPNPMLLGGKCNKMIRKYHQTIWKKKAANYDLVHFTHQGYF
FT                   VPGIENAAVTIHDLIKLYNKSYTAIETTHPLFLTTKKMINDAATIFVPSEFVRNELRNY
FT                   FAGCEKKVKVTYEGIKPVYRQTPPDPAVLKKYDLLDNGRFFLYVGRYESRKNLDRLILA
FT                   YAQLPDTLKKDTLLVLICPTEKKSTKELQKKIAGAGLEKNVLHLVHVPDNDLVHLYNAA
FT                   LALLFVSFSEGFGLPLVEAMNCGCPAIIANSSSLPEISGSSSLLVDPYDTESIRQAMLA
FT                   ISEDSLLRNDLSKKCIVRAQRFSWQTTAQETLKGYHAMLNKP"
FT   gene            complement(401533..402627)
FT                   /locus_tag="Cpha266_0359"
FT   CDS_pept        complement(401533..402627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0359"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   cte:CT0224 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64418"
FT                   /db_xref="GOA:A1BDE1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDE1"
FT                   /protein_id="ABL64418.1"
FT                   /translation="MNILFVNSIGRDKFGGGEKWMINAAKELAKRGHNVVLGSKKNSRT
FT                   LHYAKANGVKTTIFEIRSDISPLSTLKVAAFLKRHAIDVLICNLNKDVRVAGLAAQIVQ
FT                   TPIVLARHGMLLCDNKWKHKVTLTKLVDGIITNSNTIKESYKNYGWFGDNFVKVIYNGI
FT                   IIPEKIVAHDFSARFPGKKIIYSAGRLSEQKGFTYLIETAAILKQTRNDLVFAISGEGK
FT                   LEIDLKKQVAHAGLADSFIFMGFTDNIYPYLKGCDLFVLASLFEGMPNVVMEAMAMKKA
FT                   VIATDVNGARELMVDGKTGIIVPPKQPAALACAIDKIIDNPDMLEEFGKAGYERVTHEF
FT                   TMTAMGNKLEKHLQEKIVAKQRLK"
FT   gene            complement(402684..403793)
FT                   /locus_tag="Cpha266_0360"
FT   CDS_pept        complement(402684..403793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0360"
FT                   /product="glycosyl transferase, family 9"
FT                   /note="PFAM: glycosyl transferase, family 9; KEGG:
FT                   cte:CT0221 heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64419"
FT                   /db_xref="GOA:A1BDE2"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDE2"
FT                   /protein_id="ABL64419.1"
FT                   /translation="MKIPFMNSSRTLGKKNKLFRKLFTRTLQLIVHKREPLRQFTGPLN
FT                   SIVILAQEKIGDSILLTPLLSNLRHYFPDLEIHLICFSEASVNFFRNDPHITAIHSVKK
FT                   NIVRYYKDVLSREFDLLFNTKDSPSTNFLIQTLLIRARFKAGHAHPYHEGIFNHLITIE
FT                   YHTRMAVKNCSILPLLSIRVEEKKYRPYLPPAPVSSAIKRFSEKINNDVLTGLNISAGG
FT                   PLRCWTEAKWSALIKGFPDMQFVIFSAPGDTHIKLRLEQHDNVTVSPPTANIYEVGLLV
FT                   KHLRLLVTPDTSLVHVASCYNIPVIGLYTSAPQDLSRFGPYLVDFEIITSSTSQVSDIE
FT                   VEAVTSVMQNKLQQQLDMTADRTTGNNRQ"
FT   gene            404366..405319
FT                   /locus_tag="Cpha266_0361"
FT   CDS_pept        404366..405319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0361"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   plt:Plut_1789 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64420"
FT                   /db_xref="GOA:A1BDE3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDE3"
FT                   /protein_id="ABL64420.1"
FT                   /translation="MKAQKSLHAEPSLVRRPSFIMNTLILFGIMMLYQVMGSLLLLKIT
FT                   AIDLSLLFSLDDQARTISLMRIMQVASQLLLLALPVLLLAKRHTGGEHLFSAKTLAFLG
FT                   IRRNGSQALALWAVLGVFCLQPLMQTIAELQQLFLWPALGEAGKQVVENQKAMDRIIAA
FT                   LAVMRSLPEAVAVVAVLAVTPAMCEEVLFRGYIQENYRQSIDPRGAVILTGFVFAVFHL
FT                   SAANFVPLTILGCYIGYVYLNAGTLFVPFAVHLFNNLAALALLSMGSGSGSADAGASFS
FT                   GVVGFWWWWLVVAGSLGLFFLCMVMFRAASFSQRRQ"
FT   gene            405339..406193
FT                   /locus_tag="Cpha266_0362"
FT   CDS_pept        405339..406193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0362"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; KEGG:
FT                   plt:Plut_1788 phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64421"
FT                   /db_xref="GOA:A1BDE4"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDE4"
FT                   /protein_id="ABL64421.1"
FT                   /translation="MHGIAVPITEIMGTLLSINLLQRIVVAVLGIPLLLWINREGGILF
FT                   FLLVLLLSLLATVEFYRLAEHKAHPSPLWLVLPWTVLIQVNFYIGIADTAELLLLMVLF
FT                   LFVLELFDKEGSPLLNLGSLLTGLLYVNLCFGSLLRLRLSLHDGRGEAFVLLLLVCVWS
FT                   ADIFAYFGGSTLGGKLIHRKLFERLSPHKTWEGFLSGFFGSLAASMVFARFVPDVSDSA
FT                   ALITGALIGLGSPAGDLIESMFKRDAGVKDSSGLIPGHGGVLDRFDTVMFVSPFIYLII
FT                   TYL"
FT   gene            407105..407575
FT                   /locus_tag="Cpha266_0363"
FT   CDS_pept        407105..407575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0363"
FT                   /product="PTS system IIA component, Fru family"
FT                   /note="TIGRFAM: PTS system, fructose subfamily, IIA
FT                   subunit; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2; KEGG: cch:Cag_1468
FT                   putative PTS IIA-like nitrogen-regulatory protein PtsN; TC
FT                   4.A.2"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64422"
FT                   /db_xref="GOA:A1BDE5"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDE5"
FT                   /protein_id="ABL64422.1"
FT                   /translation="MKIESLLSESFIALNLDLASKSQVIDAMLDLVATHPSVCDKEKLR
FT                   QDVLKREREMSTGIGKAIALPHAKTSAVKHPVLALATLHKEINFDSIDNEPVRIIFLLA
FT                   TPEEMLAEHLKLLGRITRLAGRMDFREQLLLLKTPAAVLDLFREEEKDFPQI"
FT   gene            407766..409055
FT                   /locus_tag="Cpha266_0364"
FT   CDS_pept        407766..409055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0364"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="KEGG: cte:CT0236 histidyl-tRNA synthetase; TIGRFAM:
FT                   histidyl-tRNA synthetase; PFAM: tRNA synthetase, class II
FT                   (G, H, P and S); Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64423"
FT                   /db_xref="GOA:A1BDE6"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDE6"
FT                   /protein_id="ABL64423.1"
FT                   /translation="MSQYQVVKGARDIFPDEIVRWHYVEDVVHRLASLYGYSEIRTPVF
FT                   EYTELFQRSIGTTTDIVGKEMFSFLPDPQGRSITLRPEMTAGVMRAVLQKNLLSTAPIH
FT                   KLFYLSELFRKERPQAGRQRQFSQFGAELLGVSSPAAVAEVITFMMQVFETLGIRGLKL
FT                   RINTLGDSSDRARYREILRAYLAPFYDRLDLASRERFEKNPLRILDSKNPDMQEIIEGA
FT                   PTLHDSLSHEALEDFEKVRFYLDSRSIAYDIDYRLVRGLDYYCHTAFEVTSPELGAQDA
FT                   IGGGGRYDGLAKELGSSGDVPASGFAAGMERVLITMEKQGLFAALRPSGPKVYVVAQQH
FT                   ALLDHALQVAYRLRREGISTEVDLAGRSMKAQMRDANRMRACFALFIGEDEVVSGSYAL
FT                   KNLVTADQTAQSIETIIEMLNQYSGAEQGS"
FT   gene            409052..409312
FT                   /locus_tag="Cpha266_0365"
FT   CDS_pept        409052..409312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0365"
FT                   /product="glutaredoxin 2"
FT                   /note="PFAM: glutaredoxin 2; KEGG: cte:CT0237 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64424"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDE7"
FT                   /protein_id="ABL64424.1"
FT                   /translation="MTESLHTVTIYGAKGCCLCDDALERVLDVQGSVPFLLEKTDISGS
FT                   PELQQQYGEAIPVVCIDGVEVFRYRVNKTRLLQILRGQGGV"
FT   gene            409463..409666
FT                   /locus_tag="Cpha266_0366"
FT   CDS_pept        409463..409666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64425"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDE8"
FT                   /protein_id="ABL64425.1"
FT                   /translation="MLKFILFVIVVFLVLRMVMRFFTMAVFRKERDANAVRSHMSQNIE
FT                   EADYEVLDSRLAEKEEDGQKGV"
FT   gene            409789..410310
FT                   /locus_tag="Cpha266_0367"
FT   CDS_pept        409789..410310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0367"
FT                   /product="protein of unknown function DUF150"
FT                   /note="PFAM: protein of unknown function DUF150; KEGG:
FT                   plt:Plut_1781 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64426"
FT                   /db_xref="GOA:A1BDE9"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDE9"
FT                   /protein_id="ABL64426.1"
FT                   /translation="MEEKIRRCVLQVLEATAGTKGEGVYLVSLSIKGSGKGTSIEVLVD
FT                   TDTGIRIDQCAFLSRRIRECLEVEEESDGMSGDDFNLDVASPGLGKAIILQRQYARHVG
FT                   RLFRVTFREEDGSMTEISGHLREILFPEEENASLVIEPLGKKKAGKKVSSENRTLRLDR
FT                   VIRAVPEAEL"
FT   gene            410366..411922
FT                   /locus_tag="Cpha266_0368"
FT   CDS_pept        410366..411922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0368"
FT                   /product="NusA antitermination factor"
FT                   /note="TIGRFAM: transcription termination factor NusA;
FT                   PFAM: NusA N-terminal domain protein; KEGG: plt:Plut_1780
FT                   transcription elongation factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64427"
FT                   /db_xref="GOA:A1BDF0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDF0"
FT                   /protein_id="ABL64427.1"
FT                   /translation="MVRKQVKTEGQDRKAQIASAFGEIEQSKIFLDKRTESAAVKMDIA
FT                   DLLKDIIQKQLRKDYDPEVEANIFINPERGDFEVYILKKVVSEVDLESIEISIDEVRKI
FT                   DDSLELGDYYEEGPIKLEDYLSRKSIQIIKQSVQKKVRDLERLVVYEECLEKVGEVVAG
FT                   EVYQVRSNEVIFTYNTSKDHRVELVLPRAEMIKKDNPRRNPRMKLYVKRIEREKVKVRL
FT                   DDGGVVERDKPDGGMKVIVSRIDDRFLYKLFEHEVPEILDGLIVIKGIARVPGERAKVA
FT                   VESTSARIDPVGASVGYRGKRIQSIVKELNNENIDVIYYTDEPQIYIARALQPAKIDPL
FT                   TVHADIKTRKARVMLKPDQIKYAIGKNGNNIHLAEKLTGYEIDVYRDVMDKSMEDPTDI
FT                   DIIEFREEFGDDMIYQLLDGGLDTAKKVLKAGVERIEEVLLGPSAPEEITFFSKGRTRS
FT                   PIKPRERKVTEEEKRYWKKIAENIFKTVKEQFTDADLHDLFDDGDEDSDDQQAAESPAD
FT                   E"
FT   gene            411989..414964
FT                   /locus_tag="Cpha266_0369"
FT   CDS_pept        411989..414964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0369"
FT                   /product="bacterial translation initiation factor 2
FT                   (bIF-2)"
FT                   /note="TIGRFAM: translation initiation factor IF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; GTP-binding protein, HSR1-related; elongation
FT                   factor Tu, domain 2 protein; translation initiation factor
FT                   IF-2 domain protein; Miro domain protein; KEGG:
FT                   plt:Plut_1779 translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64428"
FT                   /db_xref="GOA:A1BDF1"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDF1"
FT                   /protein_id="ABL64428.1"
FT                   /translation="MALEDMEKRYRISDLSRELQVSPQEVLQFIRMNGGKVGSTSSMVN
FT                   EEMRGMIFGNFSVEKKMVDEAMKIRAEKQRRLTRLEEQSRKTYEKEQQLRDSMHVAPLV
FT                   PVAPLHVAQDVIVEVAAPPSAQADHTVQAEPAVQTESAVQTESAVQTESAVQTEPAVQT
FT                   EPAVQTEPEVQTEPAAQTEPEVQTEPAAQTEPAAQTEPAAQTESAVQTEADLSDVGEVS
FT                   IVPENVEVIDVPELPMVPVMPVKEEPSVNDQLVSFDIPQNIGGLTVVGTLDMMNPFDRS
FT                   ESGKMKARKKNFKEQADALKSEFDTPAGEEKLVDDKLVVKKKPVKAAGDGDTAPAADDA
FT                   LAGKKKPGKKKKKPDVDEKVISANIRTTISGMDDSAGSVSRQKFRKMRRMEREKEHEAA
FT                   EAFRESQRAIVRVTEYASPHELAELMGVTAKEIIQKCFALGKFVTINQRLDKESLELIA
FT                   LEFGFEAEFISEIEATAVVAEVDDAEDLLIRPPVVTIMGHVDHGKTSLLDYIRNSNVVA
FT                   GESGGITQHIGAYEVTVEGNRKITFLDTPGHEAFTAMRARGAQVTDIVILVVAADDSVM
FT                   PQTIEAINHAKAAGVPIVVAINKIDKPAANPEKIKTQLSEAGVLVEDWGGEYQCQEISA
FT                   KQGIGIEELMGKLLTEAEIRELKGNFSEDVLASGIIIESELDKGKGVISTVLVQRGYLR
FT                   VGDPFVAGNTMGRVRALMDERSKRIHEAGPSQPVRVLGFEALPQSGDVLTVMASDRDAR
FT                   ELAQKRQVIRREHEFRRSTRVKLDSIARQIREGLMKELSVIIKADTDGSIQALADGLMK
FT                   IHNEEVKVQIIHQGVGQITETDVLLAAASDAIIIGFRVRPNVNAKKLAEKEDLDVRFYS
FT                   VIYHVLEDVEKALEGMLSPELHEESLGSLEIRQVFRVPKVGNVGGCYALEGKVFRDSKV
FT                   RLLRDGVQVYDGQLDTLRRFKDDVKEVDAGYECGLSLKNYDDIKVGDIVEAYKIVEKKR
FT                   KL"
FT   gene            414983..415333
FT                   /locus_tag="Cpha266_0370"
FT   CDS_pept        414983..415333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0370"
FT                   /product="ribosome-binding factor A"
FT                   /note="PFAM: ribosome-binding factor A; KEGG: plt:Plut_1778
FT                   ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64429"
FT                   /db_xref="GOA:A1BDF2"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDF2"
FT                   /protein_id="ABL64429.1"
FT                   /translation="MSIRTEKVASLLQQELGMILEKEFPRGGPILTVVEVKVTADLGIA
FT                   KVYVSVIGSAKEQADTIEYLQQEKKNIRKILSSKIRHHFRRIPELEFYQDRLYEKADRI
FT                   EQLLKEVRKEQE"
FT   gene            415342..416100
FT                   /locus_tag="Cpha266_0371"
FT   CDS_pept        415342..416100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0371"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /note="KEGG: cch:Cag_1460 tRNA pseudouridine synthase B;
FT                   TIGRFAM: tRNA pseudouridine synthase B; PFAM:
FT                   pseudouridylate synthase TruB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64430"
FT                   /db_xref="GOA:A1BDF3"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDF3"
FT                   /protein_id="ABL64430.1"
FT                   /translation="MDQEGLKSVAGTLHTPEVHEDSGCFHLVDKPVDWTSFDVVAKIRN
FT                   TYKLIGQKRKVGHCGTLDPKASGLLILATGRKTKEIASLELLDKVYEGSFKLGVVTDSH
FT                   DRETPEYNQCATGHLEREQIIEAAASFVGTRQQQPPMYSAAWHNGKRLYELARKGDVVH
FT                   DRKAKEIIIRRFEITAVELPLVRFILEVSKGAYIRVIAHELGALLGVGAYLASLKRVAI
FT                   GPYELGSACSVPETIEAILKKRESVLFIEK"
FT   gene            416110..417075
FT                   /locus_tag="Cpha266_0372"
FT   CDS_pept        416110..417075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0372"
FT                   /product="FMN adenylyltransferase"
FT                   /EC_number="2.7.7.2"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibF; PFAM:
FT                   Riboflavin kinase / FAD synthetase; KEGG: plt:Plut_1776
FT                   riboflavin kinase / FAD synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64431"
FT                   /db_xref="GOA:A1BDF4"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDF4"
FT                   /protein_id="ABL64431.1"
FT                   /translation="MLVVEYQNNDVVAYPSGEPVIFSPVPSAVTIGSFDGVHRGHRSII
FT                   ARMNAIARSRQLRSVVVTFEPHPRRVLSASASPSPLVLSTLDEKVALLTSLDVDLLFVI
FT                   RFTDAFAARSSEDFIVGVLVKLLCAKSIIVGYDHGFGRNRTGSSETLLHLGKEFGFDVE
FT                   AITEVKIGNEHFSSTRIRKLLESGNLSDANQFLGYSYIVSGTVVGGDQRGRTIGFPTVN
FT                   IKPSDPQKLLPHSGVYLAMIELDGISYKAMMNIGVRPTVSQGNEKTVEAHIPGFSGELY
FT                   GAFLSFRLLVYIREEKKFATIDELKEQLEKDKKTVELYNE"
FT   gene            417123..417392
FT                   /locus_tag="Cpha266_0373"
FT   CDS_pept        417123..417392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0373"
FT                   /product="SSU ribosomal protein S15P"
FT                   /note="PFAM: ribosomal protein S15; KEGG: cte:CT0245 30S
FT                   ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64432"
FT                   /db_xref="GOA:A1BDF5"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDF5"
FT                   /protein_id="ABL64432.1"
FT                   /translation="MSLTQEDKAGIISQFGGVQQNTGKAEVQVALFSRRITDLTGHLQQ
FT                   HPKDKHSRRGLLMLVGKRKKVLNYLKNVDIERYRTVIAELDLRK"
FT   gene            417471..418373
FT                   /locus_tag="Cpha266_0374"
FT   CDS_pept        417471..418373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0374"
FT                   /product="domain of unknown function DUF1732"
FT                   /note="PFAM: YicC N-terminal domain protein; domain of
FT                   unknown function DUF1732; KEGG: plt:Plut_1774 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64433"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDF6"
FT                   /protein_id="ABL64433.1"
FT                   /translation="MQRYIMLESMTGYGSAEAVDNGVRVFVELRSVNNRFAEVSVKLPR
FT                   QLLAFELEVRELVRSTFQRGKISASIQVQADQEVDFPLRVNPLKVKACRELLDDVRMAA
FT                   GIDAPVSLEHVLRFSEIFETGNTVLDNTEWLWSFVKKLLQDAMHKLKEMRRKEGEELSL
FT                   DFTARIAQIERTLAEISSASQGNLQAARKKLASKAELIAGQDIAYSRDRLEMELVLAAD
FT                   KLDITEEFTRFSSHNKFFLEELNNDESGTGRKLNFLLQEQLREANTIASKSQSAEISQK
FT                   IVHVKEELEKIREQLQNIE"
FT   gene            418378..418962
FT                   /locus_tag="Cpha266_0375"
FT   CDS_pept        418378..418962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0375"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="KEGG: cte:CT0247 guanylate kinase; PFAM: guanylate
FT                   kinase; SMART: guanylate kinase/L-type calcium channel
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64434"
FT                   /db_xref="GOA:A1BDF7"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDF7"
FT                   /protein_id="ABL64434.1"
FT                   /translation="MTISRGPTGKLVVFSAPSGTGKSTIAKIVLERIPSLAFSVSATTR
FT                   PMRAGEEEGVHYYFLDKKKFEEKIRDGGFIEHEYFFNNYYGTLLDKTVDAVNSGHHLLF
FT                   DLDVKGALNLKTLFPLNSLLIFIRPPDMATLRERLLKRESEDADALNVRLERAELELGY
FT                   VDQFDEVIVNDCLDRAADAVTAKVSEFLSNT"
FT   gene            418974..419324
FT                   /locus_tag="Cpha266_0376"
FT   CDS_pept        418974..419324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1772 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64435"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDF8"
FT                   /protein_id="ABL64435.1"
FT                   /translation="MSVNPVDLNKLRSAHANLYETVVAISKRAKKIHEEERAELEEKLL
FT                   PYKEMIRNPGSESESDKVFPEQIAISLEFESREKASQKAVAGYLQHRYDYTLGKIAEPK
FT                   VTPIEDDETDGD"
FT   gene            419302..419799
FT                   /locus_tag="Cpha266_0377"
FT   CDS_pept        419302..419799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0377"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: cte:CT0249 glutathione
FT                   S-transferase, fosfomycin resistance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64436"
FT                   /db_xref="GOA:A1BDF9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDF9"
FT                   /protein_id="ABL64436.1"
FT                   /translation="MMKLTGINQITLRVNDLGRAEEFYADILGFRIDHRVGVNICYLRL
FT                   NSDMLVLVKSETPSVPESRDFRVDHFGFRLASDAEVDEAADYLDAKGVHLITRPAHRQE
FT                   GRAFFVMDPDGNLVEFYSMHNGGIDKECRGCDPISPDALAAGNRSKIREENDQKKPRRS
FT                   RK"
FT   gene            complement(419788..420531)
FT                   /locus_tag="Cpha266_0378"
FT   CDS_pept        complement(419788..420531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0378"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /note="PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase; Nucleotidyl transferase; KEGG: cte:CT0251
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64437"
FT                   /db_xref="GOA:A1BDG0"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDG0"
FT                   /protein_id="ABL64437.1"
FT                   /translation="MSLAVIIMAAGKGTRMQSELPKVLHKANGRPVIEYVLDTALHLKP
FT                   ETIILIVGHQADKVIAATRQYPVICALQEPQNGTGHAVMQAEKALKTFSGDVLILSGDV
FT                   PLVKRSTLLQLIALHHNEQASATVLTARLDNPSGYGRIIRNKTGGEVMKIIEQRDASPE
FT                   ELSVDEINSGIYVFKAPVLFQALREITTENAQQEYYLTDVFDICFRNGNKVCACRTENA
FT                   DEIRGINTPEQLRETEQLLCALSLS"
FT   gene            complement(420548..420943)
FT                   /locus_tag="Cpha266_0379"
FT   CDS_pept        complement(420548..420943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0379"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: plt:Plut_1769 aspartate 1-decarboxylase
FT                   precursor; TIGRFAM: aspartate 1-decarboxylase; PFAM:
FT                   aspartate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64438"
FT                   /db_xref="GOA:A1BDG1"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDG1"
FT                   /protein_id="ABL64438.1"
FT                   /translation="MKLHLLKSKIHNARVTSGDLEYEGSITIDQELLLLAEMIPNEKVL
FT                   VVNNNNGERFETYIINGEPGSRVIQLNGAAARCALPGDEIIIMTFAVMDEKKARTFQPM
FT                   VLIVDHLNNPKRRHRIGQEDEQLSSSI"
FT   gene            complement(420965..421459)
FT                   /locus_tag="Cpha266_0380"
FT   CDS_pept        complement(420965..421459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1768 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64439"
FT                   /db_xref="GOA:A1BDG2"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDG2"
FT                   /protein_id="ABL64439.1"
FT                   /translation="MSGCGAPQSERRKPETGFIGEGHPQQESWDIHLNLTDAGIPKASI
FT                   KAGYAAEFNKNSKKEYHLQKGVTVTFFNSEKEPSTILKAQEAVVHDNLDIEARGNIVIT
FT                   TDNTTTIKTESIKRTAKDKMIRSNDYVTITRPGETLTGYGFESDQALKKYRIFRASGES
FT                   H"
FT   gene            complement(421522..422085)
FT                   /locus_tag="Cpha266_0381"
FT   CDS_pept        complement(421522..422085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0381"
FT                   /product="outer membrane chaperone Skp (OmpH)"
FT                   /note="PFAM: outer membrane chaperone Skp (OmpH); KEGG:
FT                   plt:Plut_1767 outer membrane protein OmpH"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64440"
FT                   /db_xref="GOA:A1BDG3"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDG3"
FT                   /protein_id="ABL64440.1"
FT                   /translation="MTTLIMKPMYNRKGFMSVVRKIVMASLLGLMLGAPATVHAETVGV
FT                   VDFGKILLQMPERKQAETTLQAMATPFQNELERMSQDLQKGLVAYEQQKASMAKPAREV
FT                   KEKELNTKAQAIQKYKLEKFGQEGLVAKKEQELLIPIRQKIVASVQTIAQKEGFTLVLD
FT                   KGAMIYGTPASDLTFKVMNQLNLK"
FT   sig_peptide     complement(421963..422085)
FT                   /locus_tag="Cpha266_0381"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 41"
FT   gene            422399..423127
FT                   /locus_tag="Cpha266_0382"
FT   CDS_pept        422399..423127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0382"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   ava:Ava_1042 methyltransferase FkbM"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64441"
FT                   /db_xref="GOA:A1BDG4"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR026913"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDG4"
FT                   /protein_id="ABL64441.1"
FT                   /translation="MGFFIRAKLYFRQLIGQEPRTNVEIACECRHIHEWCICPVGIDSA
FT                   SSVFSLGVGNDIGFDTGLIKDFNCSVYAFDPTPRWVEWIGSMSLPEKFKFYPYAIGGTD
FT                   GTMKLFPRIHKGRRSSKMLTLLNEGLHDDESIAVTMKRLSTLTAELSVPSIAILKIDIE
FT                   AAEYEVIDDFLADHVPVYQLLVEFHHRFASVPVKKTTDALAKLYKAGYRIFYVSEKARE
FT                   YSFIHEATYDGYRRQAGKSS"
FT   gene            complement(423140..424285)
FT                   /locus_tag="Cpha266_0383"
FT   CDS_pept        complement(423140..424285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0383"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: cch:Cag_1447 smf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64442"
FT                   /db_xref="GOA:A1BDG5"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDG5"
FT                   /protein_id="ABL64442.1"
FT                   /translation="MSATPGCDSRILLLTLSQIPGIGPARINAIVSNLGSDISVLDATE
FT                   GTFQHIPGIGVPLAKEIVSFLGNRQKRLAALEAADEQMLRLERYNAKLLTITDTEYPRL
FT                   LREITDPPPYLFVRGNLPGNHEPGIAIVGTRRASAYGKQAAAKFSGELALQGFPIVSGL
FT                   AYGIDMVAHTASIGSGGKTIAVVATGVDTIYTDPRGKVWPGIVENGAIISEEWIGSNLV
FT                   PAKFPKRNRIISGITLGTLVVESDRNGGSLITASFALEQNREVFAVPGSIFSHTSRGTN
FT                   MLIQLGQAKAALCVDDIISEVAPQSSRENIPRQNPIALDMHLSAEELNVLAIMGKESVH
FT                   IDTIASKTGLDVSTLLVRLFELEMKRAVIQHPGQFFQNRHS"
FT   gene            complement(424300..425298)
FT                   /locus_tag="Cpha266_0384"
FT   CDS_pept        complement(424300..425298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0384"
FT                   /product="farnesyl-diphosphate synthase /
FT                   geranylgeranyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /EC_number="2.5.1.29"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: plt:Plut_1765
FT                   geranyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64443"
FT                   /db_xref="GOA:A1BDG6"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDG6"
FT                   /protein_id="ABL64443.1"
FT                   /translation="MNMSITQELVEKKYRLYHNLINEALASCFSAEAPVTLYAPAKYIL
FT                   DGKGKRIRPFLTLLASEAVCGSSEHALKVALAVEILHNFTLMHDDIMDQAELRHGRPTV
FT                   HKQWNANVAILSGDMMIAYAYELALQSPSSRQIELVHILNDANITICEGQALDIELEEK
FT                   KHATIADYLDMIAKKSGRLISAALEAGGVAGNATDEQLNNLVTFGEKIGRAFQIQDDFL
FT                   DIMADDGKSGKIAGGDVINGKKTYLLLRSIELTSGDDHRLLQSIIENNGISAERVPEIR
FT                   SIYQRCGVLDETRLLIRRDTENALSAVDKLPHAEGREYLKGFANILVKRDF"
FT   gene            complement(425301..426392)
FT                   /locus_tag="Cpha266_0385"
FT   CDS_pept        complement(425301..426392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0385"
FT                   /product="isopentenyl-diphosphate delta-isomerase, type 2"
FT                   /EC_number="5.3.3.2"
FT                   /note="KEGG: cch:Cag_1445 isopentenyl pyrophosphate
FT                   isomerase; TIGRFAM: isopentenyl-diphosphate
FT                   delta-isomerase, type 2; PFAM: FMN-dependent alpha-hydroxy
FT                   acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64444"
FT                   /db_xref="GOA:A1BDG7"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDG7"
FT                   /protein_id="ABL64444.1"
FT                   /translation="MNEKLSTPSNITIERKLNHVEICLHGNVSFEGTTTGLERYAIEHQ
FT                   AVPEINYADINLSATLLGRTIGAPLMISSMTGGYHEAATLNRQFAQAAEHFRIPLGVGS
FT                   MRQALENNEHRESFAVVRKAAPSVPVFANIGAPEVAAGLESSQIETMLDLIQADGLIVH
FT                   LNAAQELFQPEGNTNFHGFLDQLASLTAKTPVPVIAKEVGSGISAEAARLLIDAGVKVI
FT                   DVAGAGGTSWQKVEEVRYIKRFGNENRFSPEALNELLNWGIPTATCLEEIGRLKKNHPQ
FT                   YQPIEIIASGGIQSGIDVAKTILLGASVAASAGRLLKALHEGKLLQTIEMWLNDLKAVM
FT                   FLTGSLSLEQLQKKRMTLKHLPT"
FT   gene            426500..427768
FT                   /locus_tag="Cpha266_0386"
FT   CDS_pept        426500..427768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0386"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   plt:Plut_1763 putative ABC transporter, integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64445"
FT                   /db_xref="GOA:A1BDG8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDG8"
FT                   /protein_id="ABL64445.1"
FT                   /translation="MLKTLFDIALRHLLGRRRQTLTTIFGVAVSTMVLITTISLTRGLL
FT                   DSFIDTIVNVAPHITIKGEKLNPVPVNIINRAGETRVSMVEDNIRKQEKEEVRNYRQIL
FT                   GMFSSSLYEKEVTASSPYVESQVMAVKGNRNQPILLKGVIIDRENEISGIAGKIQQGDL
FT                   SVFRNSSNALLVGRTVARDMHLELNDEVVIIPASGKSRQCKVAGIFFSGVNAVDNSVFV
FT                   SLKLGQIIEGLPANKVSGIALKVRDPLNNTPLAREMERITGYKCPTWQEENASILSLFA
FT                   RIGYIVFSLVAFVGVVSGFGVANILVTTVFEKSRDIAIMKSFGFSALHLVAMFVLEGFL
FT                   VGLAGALLGGVLAIGSINLFASIPVENSQGPLTKTGFSMSLNPIYFFYVIGVTVFISTI
FT                   SAILPSARAAKLEPVKVLRDSSL"
FT   gene            complement(427866..429725)
FT                   /locus_tag="Cpha266_0387"
FT   CDS_pept        complement(427866..429725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0387"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter, transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: cch:Cag_0453
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64446"
FT                   /db_xref="GOA:A1BDG9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDG9"
FT                   /protein_id="ABL64446.1"
FT                   /translation="MNRQKEQTTDTSAQEQTSKRSVSAKSFRTQKDETLEKGKKGSADW
FT                   YIASRLIAYIKPYKALVAASAGITLAGSILGPLRPYLTKIAIDDYIAHGDMKGLATISL
FT                   LLAAVVLLDGIKQFIATWLTQIIGQKAVFSIRMDVFRHLQQLPARFFDRNPIGRLLTRT
FT                   TNDIESLNEMLSSGIITILGDIMQLLFIVGLMLWIDWQLALVVLAILPLMLYATMMFKK
FT                   RVRIAFQDVRTHLARLNTFLQEHIAGMTIVQLFNHQKSEYTKHSDINADHRDANIRTVF
FT                   YFSVYYPFIEVLSSLTAGMVIWYSAVRVLNADLTLGVVVSFVQYIWLFFRPLQHLSDRF
FT                   NVIQTAIASSDRVFRLLEEKGGEGDAGAEPEPFVFRSRITFSNVWFAYDTDNWILKDLS
FT                   MEVRRGEKIAIVGATGSGKTTIINILSRLYPYAKGSIRIDNVELPDIASRSLRKMIGVV
FT                   MQDVFLFSGTIRENLAFGNPDLPDEAIFEAARIVGADRFIDQLPGGYAYRVQENGAGLS
FT                   AGQKQLIAFVRALLYDPQILVLDEATSSVDTETEMLIDAATAKLMQNRTSIIIAHRLST
FT                   VQKADRIIVLHKGVIKESGSHQELLKEKGLYYKLYLLQHPEGR"
FT   gene            complement(429732..431144)
FT                   /locus_tag="Cpha266_0388"
FT   CDS_pept        complement(429732..431144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0388"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase C
FT                   terminal; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III; KEGG: plt:Plut_1760
FT                   phosphoglucomutase/phosphomannomutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64447"
FT                   /db_xref="GOA:A1BDH0"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDH0"
FT                   /protein_id="ABL64447.1"
FT                   /translation="MSLMISVSGIRGIVGESLTPQNLTAFAMAFASWIRNKRDPSTLIS
FT                   SPKRPLIVIGRDTRPTGSCISNLVSNALALSGCDVIDIGIATTPTVELATVTEKADGGL
FT                   IVTASHNPVEWNALKMLNDRGEFLSAPDVEELLAIVEKAHVHAARWDDIGTVTSTSRHD
FT                   DLHIDKIMNLSFINTEAVRKQHFRVMIDCVEGAGFSIVPRLCRMLGMDELTLVACEGSG
FT                   LFPRNPEPVEENLADTISAMKQARCDFGLIVDPDVDRLALICEDGSLFGEEYTLVACAD
FT                   FYLNINNGPVTNNLSSSRALADIARQHGVACFSAKVGEANVIELMKEVGAVIGGEGNGG
FT                   VILPDLHYGRDALVGIALFVQAFTSWRMKNRGGTISSFRREFPEYVMSKQKIKLGSMSP
FT                   RILENLFNEIARRYPLAKTNMTDGLKLDFDDCWVHLRPSNTEPIIRIYAEAHTKKRAEE
FT                   IALELMNELQKD"
FT   gene            431461..431736
FT                   /locus_tag="Cpha266_0389"
FT   CDS_pept        431461..431736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0389"
FT                   /product="SSU ribosomal protein S20P"
FT                   /note="PFAM: ribosomal protein S20; KEGG: cte:CT0261 30S
FT                   ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64448"
FT                   /db_xref="GOA:A1BDH1"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDH1"
FT                   /protein_id="ABL64448.1"
FT                   /translation="MPLHKSAEKRLRQSEKRNVRNRARKKELKVLLKNMQKLIDTSADK
FT                   NVVEEAYRSAVQKLDRLGVKRYLHPNKASRKKAQLTKMLNNYVKVD"
FT   gene            431842..432444
FT                   /locus_tag="Cpha266_0390"
FT   CDS_pept        431842..432444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0390"
FT                   /product="Holliday junction DNA helicase subunit RuvA"
FT                   /note="KEGG: plt:Plut_1758 DNA recombination protein, RuvA;
FT                   TIGRFAM: Holliday junction DNA helicase RuvA; PFAM: RuvA
FT                   domain protein; DNA recombination protein RuvA, domain I;
FT                   SMART: Helix-hairpin-helix DNA-binding, class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64449"
FT                   /db_xref="GOA:A1BDH2"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDH2"
FT                   /protein_id="ABL64449.1"
FT                   /translation="MFAYFKGSLVTALPEEAVIDVSGVAYRMLISATTFRQLPDEGSQV
FT                   LLYAHLSVREDALQLYGFFKEEERQLFRLLLLTSGVGPKLALAVLSGLQVPEVHEAIMA
FT                   NEPERLYGVSGVGKKTAARIILELRDKILKLPLVTPAAGKAAMPSHHVKDDAVHALVTL
FT                   GFSRLLAQKAVSALLEEKPEQSVEEVIKYALATIHNS"
FT   gene            432457..433743
FT                   /locus_tag="Cpha266_0391"
FT   CDS_pept        432457..433743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0391"
FT                   /product="FolC bifunctional protein"
FT                   /note="TIGRFAM: FolC bifunctional protein; PFAM: Mur
FT                   ligase, middle domain protein; KEGG: cch:Cag_0458
FT                   folylpolyglutamate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64450"
FT                   /db_xref="GOA:A1BDH3"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDH3"
FT                   /protein_id="ABL64450.1"
FT                   /translation="MNYQEALDFLYPLHRFGIKPGLERVFGLLAVLGSPHRRLGTIVHV
FT                   SGTNGKGTTAAAIAAIFQAAGKKTALYTSPHLVDFTERMRINGGCIPHELVATYCSLIK
FT                   SRVEESHTTFFEATTAIAFAWFASEHVEVTIVETGMGGRLDATNVVHADYVAITSIGQD
FT                   HTAWLGSTPALIAAEKAAIIKKGSQVFSAVTDSEAAMPVRTAAECCEAPLSVLGIDAHC
FT                   HVDSEEIGRLELSVRTAKHQYERLTVPLTGAFHASNISLAVMVAETAGIDESSIRNGLA
FT                   NLLQTGYRARLEKIAANPDVLLDVSHNANGIEETVNTLARFRNRYRNLFVLIGLASDKN
FT                   ATAIVKHLKRLSCRLVAVSIPSERSIPALELGGIGEAEDIPTMVFSSPLDGLGYLSGIA
FT                   EAEDLVLVTGSFYLAGEVLSNGGWNKEMS"
FT   gene            433743..434036
FT                   /locus_tag="Cpha266_0392"
FT   CDS_pept        433743..434036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64451"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDH4"
FT                   /protein_id="ABL64451.1"
FT                   /translation="MSALLSFFPEKNYIFIITTEVLHDLWVILPGRFFPCIGPDSITDT
FT                   HPQLSSFSVFMIYTEYSAVATSGFPFALVMRASSFRDFLPSDFFDTNVIITF"
FT   gene            434054..435343
FT                   /locus_tag="Cpha266_0393"
FT   CDS_pept        434054..435343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0393"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: plt:Plut_1756 transcription termination factor
FT                   Rho; TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; Rho termination factor domain protein; Rho
FT                   termination factor, RNA-binding; Ribonuclease B, OB region
FT                   N-terminal domain; SMART: AAA ATPase; Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64452"
FT                   /db_xref="GOA:A1BDH5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDH5"
FT                   /protein_id="ABL64452.1"
FT                   /translation="MSNNSLAKGLDINVLQKKKVFELHALAKEIGVTAAGLRKEELIFK
FT                   IIEAQSRNNADSESGNVMINTGVLQVIPEGYGFLRSANYNYLSSPDDIYVSPSQIKRFN
FT                   MRTGDTVSGQVRAPKEGERFFALLKINTIDGNDPEITRERPYFENLTPLFPHDRIKLEI
FT                   KQSEYCGRIMDIFTPIGKGQRGLIVAQPKTGKTMLLQMIANAIIQNHPEIYLIVLLIDE
FT                   RPEEVTDMARSVEAEVVSSTFDEDPERHVQVADMVLEKAKRLVEVGRDVVILLDSITRL
FT                   ARAHNTIIPHSGKILSGGIDANALTKPKRFFGAARNIEEGGSLTIIATALVDTGSRMDD
FT                   VIFEEFKGTGNMELLLDRRLSERRIFPAIDILRSGTRKEELLFSREELSRTWLLRKYLA
FT                   DKNPIECMEFMREKMADTKDNKEFFKYMNA"
FT   gene            436026..436098
FT                   /locus_tag="Cpha266_R0009"
FT                   /note="tRNA-Lys1"
FT   tRNA            436026..436098
FT                   /locus_tag="Cpha266_R0009"
FT                   /product="tRNA-Lys"
FT   gene            436115..436196
FT                   /locus_tag="Cpha266_R0010"
FT                   /note="tRNA-Leu1"
FT   tRNA            436115..436196
FT                   /locus_tag="Cpha266_R0010"
FT                   /product="tRNA-Leu"
FT   gene            436605..437195
FT                   /locus_tag="Cpha266_0394"
FT   CDS_pept        436605..437195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0394"
FT                   /product="outer surface protein, putative"
FT                   /note="KEGG: cte:CT2144 outer surface protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64453"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDH6"
FT                   /protein_id="ABL64453.1"
FT                   /translation="MKKVLMSLFVAGMCAAPAYAAGPYVSASAGLGLLGNSDFKGVVEV
FT                   KDVIEYNSGLVLNGAIGYDADMFRGEFAVGYQSNGVDTLGGVSIDNLDVSILSFMANAY
FT                   VDFEMKDSALTPYLMAGLGLASVDFSDDGGDDFEAESVFAWQIGAGIGVKAADNLTVDL
FT                   GYRYFVPSDVEIDDVDKITLASSNIMLGLRYGF"
FT   sig_peptide     436605..436667
FT                   /locus_tag="Cpha266_0394"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            438083..438742
FT                   /locus_tag="Cpha266_0395"
FT   CDS_pept        438083..438742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0395"
FT                   /product="protein of unknown function DUF151"
FT                   /note="PFAM: UvrB/UvrC protein; protein of unknown function
FT                   DUF151; KEGG: plt:Plut_1753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64454"
FT                   /db_xref="GOA:A1BDH7"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDH7"
FT                   /protein_id="ABL64454.1"
FT                   /translation="MRGFVLFPLFKTTLFDFMGKLQVDILGLSASPHTNGAYALILYEL
FT                   EGKRKLPIIIGGFEAQAIALKLENIKPPRPFTHDLFKSVADAFSLHVKEIFIDELHNET
FT                   FYAKIICELGGELHEIDARPSDAIAIAVRFNAPVFVTEEIMNEAGIREEQKESEEEGEE
FT                   DNTSSFIQEEPQPGGMPAQSAALLELQGRLDDAISRENYEEAARIRDEINRIKNQG"
FT   gene            complement(438858..439589)
FT                   /locus_tag="Cpha266_0396"
FT   CDS_pept        complement(438858..439589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1752 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64455"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDH8"
FT                   /protein_id="ABL64455.1"
FT                   /translation="MKKSLSLLAVLAVVGFASTPVQAADHYVSGMAGISWMQDSSIDLP
FT                   LNLNEVFGVGIDLGYSSGFTAVGAVGCDYGSTRLEAEVGYQTNDIDSITGSFDGDSASL
FT                   ALSGNAKVLSLMANGFYDFDLGGVELYAMAGIGVAQVSINDLTLADTNDLGISADDIDD
FT                   ANEYLSRRLGAPVDLNALGLNVNETTLAYQVGAGLAVPIGDGIMLDARYRYFATTDFTM
FT                   PLDLNTNISSHSALLGLRVNL"
FT   sig_peptide     complement(439518..439589)
FT                   /locus_tag="Cpha266_0396"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(439729..442221)
FT                   /locus_tag="Cpha266_0397"
FT   CDS_pept        complement(439729..442221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0397"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein;
FT                   Polypeptide-transport-associated domain protein, ShlB-type;
FT                   KEGG: cte:CT0266 bacterial surface antigen family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64456"
FT                   /db_xref="GOA:A1BDH9"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDH9"
FT                   /protein_id="ABL64456.1"
FT                   /translation="MKKMQKLITLVLVALAVNATGQTAEAKSKPVKQSVTATQAKTPAE
FT                   KKDLYTISAISFTGLQSLNEQELIASLPIKIGNNIAVPGAELSATMQYLWNLQVFKNIT
FT                   LEKSNPGTKNVALHFIVEEQPLLEEVVFKGNEKFDLDKLQKTADIQTGKKLSEQELLTA
FT                   ANKIEKLYADKGYLTAGAEYKLEAIGKNKVKAVFTITEGRKVVIEKIRFHGNNAFSQGK
FT                   LRGVFKETTQNSWWRKIFGAPKLDKDKFATDKDLLVDFYRENGYRDAKVVSDSISYTPD
FT                   NKGLFLDITIEEGPKYHIGTITWTGNSKDFATTEILEKTFGIKTGDLYNAKLIQERLNF
FT                   SQDNSDVSSIYLDRGYLSYRANLDEVVVNPDTVNLLISIREGEQYQLNLVNITGNTKTK
FT                   DHVIRRELYTIPGEMFSRKNVIRSIRELNMLNYFDAEKLAPEIQPNEENNTVDLTYSVS
FT                   EKQSDTFNASIGYGGSSGFTGTLGVTFNNFSLQDIFDADAYRPLPHGDGQKLSFQWQFG
FT                   SDNYRTLALSFTEPWAFGGPTTVGFSAFKTHRTYDYTGTDSSIENKTIDQYGTILTIGR
FT                   RLTWPDDYFAVGLKLKYLHNKGGFVSFINETGINVPDEADEYSITGTISRNSIDSPIYP
FT                   RRGSKNTLTAQLAGGPLPGTIDFYKFTGNSTWFFPLSRKLVLNMSAQAGYLSTFNKSDY
FT                   IPYTEYFYMGGSGMSSLPTVPMRGYDDRSFGALLETDSDLYGGTIYTKFTTELRYPITL
FT                   SPSVSVYGLAFFDAGNLWQDSESVDFSDLKKSVGVGLRVYLPIIGMVGLDYGYGMDTVP
FT                   GDMEKGWGFMFTFGTSTE"
FT   sig_peptide     complement(442156..442221)
FT                   /locus_tag="Cpha266_0397"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.722 at
FT                   residue 22"
FT   gene            complement(442245..443093)
FT                   /locus_tag="Cpha266_0398"
FT   CDS_pept        complement(442245..443093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0398"
FT                   /product="Undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /note="KEGG: plt:Plut_1750
FT                   di-trans-poly-cis-decaprenylcistransferase; TIGRFAM:
FT                   undecaprenyl diphosphate synthase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64457"
FT                   /db_xref="GOA:A1BDI0"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDI0"
FT                   /protein_id="ABL64457.1"
FT                   /translation="MARIRTMDLSPTFRSPWFTTVSDTEDKKIQADLKASCELPLHIAI
FT                   IMDGNGRWAKLKGKTRIEGHIAGVDSVRDIVEASRQLGISYLTLFTFSTENWNRPEKEI
FT                   SALMRLLIKVLRKEARALHDNNIRLNVIGNTALLPEKVRTVLDETVVLTGHNNGLVMSI
FT                   ALSYSGKWDIVEACRSLAVEVKAGRVSPEMIDEHLFQSCLSTASIPDPELLIRTSGEFR
FT                   ISNFMLWQSAYSEIYFTKTYWPDFRRAQFYAALRDYQNRERRFGQTSEQIQKKNTANSK
FT                   I"
FT   gene            443441..444871
FT                   /locus_tag="Cpha266_0399"
FT   CDS_pept        443441..444871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0399"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase; KEGG: plt:Plut_1749
FT                   glutamyl-tRNA(Gln) amidotransferase A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64458"
FT                   /db_xref="GOA:A1BDI1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDI1"
FT                   /protein_id="ABL64458.1"
FT                   /translation="MHFSSYQDLRSSLLAGQTTCEEVTKSYLERIDRHCDDNIFLAVFH
FT                   EQALSRARSLDRRFSEGGTPGLLFGMPMAIKDNISIKGARLTCASRILENYESVYDATV
FT                   IERLLNEDAVFIGKTNMDEFAMGSSNENSAFGPVANPFDKTRVPGGSSGGSAAAVAAGL
FT                   ALVALGSDTGGSVRQPAGFCDIVGLKPTYGRISRYGLVAFASSFDQIGVLARNSDDAAL
FT                   VLGVMAGADERDATSSRHAVSNYAEEMAAVSPDGLKIGVPKEFFHESLNPDVARLVKAK
FT                   LEELREKGAELVDITLPASDYAIAAYYILVTAEASSNLARFDGARYGYRSPNCDNLSAM
FT                   YVNSRTEGFGKEVKRRIMLGTYVLSAGYYDTYYKKAQQVRRVFQDRYREALEKVDVIAG
FT                   PTSPFPPFGIGDKMDDPLEMYLADVFTVPASIVGMPAISVPIGYDSLNLPVGMHLICNF
FT                   FEEGKLLGIAGLMQHSIV"
FT   gene            444915..445814
FT                   /locus_tag="Cpha266_0400"
FT   CDS_pept        444915..445814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0400"
FT                   /product="succinyl-CoA synthetase (ADP-forming) alpha
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase; KEGG: plt:Plut_1748 succinyl-CoA
FT                   ligase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64459"
FT                   /db_xref="GOA:A1BDI2"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDI2"
FT                   /protein_id="ABL64459.1"
FT                   /translation="MSVLVNKDTRLVVQGITGGEGTFHTSQILEYGTNVVAGVTPGKGG
FT                   TIYHGNERDHFCRPVPVFNTVKDAVDKAEANATVIFVPAPFAADAIMEAADAGLKVIIC
FT                   ITEGIPVNDMMKAYAFVKEKGAVLVGPNCPGVITPGEAKVGIMPGFIHMKGTIGVVSRS
FT                   GTLTYEAVHQLTAVGLGQSTCIGIGGDPIIGTRFIDAIKLFAKDDETEGLVMIGEIGGS
FT                   AEEEAAEYIKRYFKKPVVGFIAGRTAPPGRRMGHAGAIVSGGKGTAEDKIHAMEAAGIH
FT                   MVDNPGDIGTAMLKALGR"
FT   gene            complement(445899..446879)
FT                   /locus_tag="Cpha266_0401"
FT   CDS_pept        complement(445899..446879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0401"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: cch:Cag_0467 KpsF/GutQ; TIGRFAM: KpsF/GutQ
FT                   family protein; PFAM: CBS domain containing protein; sugar
FT                   isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64460"
FT                   /db_xref="GOA:A1BDI3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDI3"
FT                   /protein_id="ABL64460.1"
FT                   /translation="MISQPETAAIIDSGKNILEQEAQAIHRIADRLDDNFARAIALILS
FT                   CKGKIIVSGMGKSGIIGQKIAATMASTGTTALFLHPADAAHGDLGIVCSGDIVICLSKS
FT                   GTTEELNYIIPALKKTGASIIALTGNSRSYLAKSADIVLDTGIEQEACPYDLAPTTSTT
FT                   AMLAMGDALSMTLMQAKNFTPVDFALTHPKGSLGRRLTMKVSDIMASGDTMPVVNEDAA
FT                   VTDLILEMTSKRYGVSAIINKKGVLTGIFTDGDLRRLVQKGDDFLNLTARSVMTANPKT
FT                   VGAERLATECLEILETYRITQLIVCDIDQRPAGIIHIHDLISLGL"
FT   gene            447003..447350
FT                   /locus_tag="Cpha266_0402"
FT   CDS_pept        447003..447350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0402"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT0272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64461"
FT                   /db_xref="GOA:A1BDI4"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDI4"
FT                   /protein_id="ABL64461.1"
FT                   /translation="MSWVILFSFSLAFFFVLMFLLNRFVSYMKKEQNLEIESFKDSLID
FT                   KDNPVGLRGEELEKLKQQQSEAQRHLREVIAKIPVIQKDGRFQLDEEALRQRKEAENRN
FT                   GTSGSVTKDRA"
FT   gene            447357..448871
FT                   /locus_tag="Cpha266_0403"
FT   CDS_pept        447357..448871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0403"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   plt:Plut_1745 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64462"
FT                   /db_xref="GOA:A1BDI5"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDI5"
FT                   /protein_id="ABL64462.1"
FT                   /translation="MLSKLKLLARDTVIYGASTILSRSLNYLLVPLYANKLSTFDNGVQ
FT                   TLVYANIALANVLFSYGLETAYLKSASDSLREGKDGKGFFSTAFFSLLVTATLFSLIIV
FT                   FFSADISVLLGMTPAEYAFVRYAAIILWIDTILVIPFAELRLKRKAVQFAIARVTGVVA
FT                   VVIAAMILVIPFHAGLQGAFIANIIGSAVSGLMVFPVFMQLRPFFSFHQFRELIQIGLP
FT                   YVPAGIAGLLIHLIDRNILIRISSSDIERIYGEGYVASDILGIYGRVVAFGIILQLFIQ
FT                   VFRFAWQPFFLQHASDPDAKRLFRYVLSISTLFTMVLALASTFFVPDLVRYHYADRFYL
FT                   LPPRYWIGLSVLPWIFLSYVFDMISTNLTAGLLITGNTRSLPMVTFSGALVTSLVCWAL
FT                   VPVNGMEGAAYAIVAGTFVMCLVMAYYSLKFYPNRYDWLKLSLLLAVGGVFAGIGLWFE
FT                   TIAAGMVLIVLVKIALLVLFFLLVVFAFNEEVRLVAEKIAHKLKKR"
FT   gene            complement(448922..449428)
FT                   /locus_tag="Cpha266_0404"
FT   CDS_pept        complement(448922..449428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64463"
FT                   /db_xref="GOA:A1BDI6"
FT                   /db_xref="InterPro:IPR025961"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDI6"
FT                   /protein_id="ABL64463.1"
FT                   /translation="MDFLASKRFVTTSLVILVLLNLTLLGILWMQNFSGKQAPVQVKIT
FT                   RQYNRQIYFTAPLALSEKQAISFQELRREHFRRVRPEMQAISLLKEQLVKEAIRDNPDS
FT                   LKIVKLAESIGKHQTSVERQLAEHFHELSEVCTPSQRDSLQKILTHMGKRQMHIRKDTI
FT                   ENLTR"
FT   gene            complement(449575..450156)
FT                   /locus_tag="Cpha266_0405"
FT   CDS_pept        complement(449575..450156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0405"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cch:Cag_0471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64464"
FT                   /db_xref="InterPro:IPR025961"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDI7"
FT                   /protein_id="ABL64464.1"
FT                   /translation="MNKKTVTMITAMLLGFSSIASATDYSSYSDAKLSEMRGTMRTASQ
FT                   EERQAYQTECQKRTALTSPDQRSNRAGITRHKTKGSSPMILKEQLGLSDTQSRQLQEMR
FT                   QKHAGLATKERSRLAELQRQLMDASMTSNPDKQRIAVLAQQIGKEQSDLAIMRSASIQE
FT                   VASVLTPKQREKMKTFMLQISPRKQGGMKM"
FT   sig_peptide     complement(450088..450156)
FT                   /locus_tag="Cpha266_0405"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.980 at
FT                   residue 23"
FT   gene            complement(450212..450766)
FT                   /locus_tag="Cpha266_0406"
FT   CDS_pept        complement(450212..450766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64465"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDI8"
FT                   /protein_id="ABL64465.1"
FT                   /translation="MKKRALAASLAATIMTFGNSAGAADYRDSYAVEQNRYRNESRQEQ
FT                   SDERFTRDERQRNGYQDRQRQAPVIHDDFRTVKAALELDDRQLDRFVAIRENYREHTGS
FT                   VYREIALLKEIRQNEEMRKQRNFRTIAKLNRKISALQDELNRYRIRSIRNYRDVCNNQQ
FT                   RERFDRFAAHNNPTFALMFRF"
FT   sig_peptide     complement(450695..450766)
FT                   /locus_tag="Cpha266_0406"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.976 at
FT                   residue 24"
FT   gene            complement(450871..451251)
FT                   /locus_tag="Cpha266_0407"
FT   CDS_pept        complement(450871..451251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT0277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64466"
FT                   /db_xref="GOA:A1BDI9"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDI9"
FT                   /protein_id="ABL64466.1"
FT                   /translation="MKHNIDTKEEEVRKIMQLLDEMQPLKVSPLFRVHLMEKVEAVSNN
FT                   RRSETFHSFNPRLAFAALLVVINISSAMLFFSSTEQQAKETASNATETVNDDYTSPALA
FT                   YYTETGTEFSGSELNDNQNSNR"
FT   gene            complement(451326..451934)
FT                   /locus_tag="Cpha266_0408"
FT   CDS_pept        complement(451326..451934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0408"
FT                   /product="RNA polymerase, sigma subunit, ECF family"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   cte:CT0278 RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64467"
FT                   /db_xref="GOA:A1BDJ0"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDJ0"
FT                   /protein_id="ABL64467.1"
FT                   /translation="MEKRGEAAVTIPATHEALLDSRATSKDDQFRKLVLEHQEMVLNTC
FT                   FRFVFNREDAEDLAQDVFVEVYRSLDQFREESKLSTWIYRIAVTKSLDYLRRLKRKKRF
FT                   SSLKRVIGIEDPSEDLPDTAGSNPLQSLAGKENANLLLDALNALPENQKTAFLLSKQDG
FT                   YSNQEIADILQSSVSAVESLIHRAKKNLHDKLYKHFKQT"
FT   gene            complement(452118..452512)
FT                   /pseudo
FT                   /locus_tag="Cpha266_0409"
FT   gene            complement(452555..453937)
FT                   /locus_tag="Cpha266_0410"
FT   CDS_pept        complement(452555..453937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0410"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase C
FT                   terminal; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III; KEGG: plt:Plut_1740
FT                   phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64468"
FT                   /db_xref="GOA:A1BDJ1"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDJ1"
FT                   /protein_id="ABL64468.1"
FT                   /translation="MQVKFGTDGWRAIIAKDYTYENLKLAALASARYFQSQPGRSKGVC
FT                   IGYDTRFMSKEFAEYTAEVLSSAGIRVFLSDSFVSTPAVSLYTKAKQLAGGIVITASHN
FT                   PPNYNGFKVKAAYGGPANPEAIAEIESNLLEIDPKTEIKPDMKLIESVDMKSFYMNYLK
FT                   THVDLQLIRESRIKIAHNAMYGAGQDIITRLFDESMVNCYHCTINPGFGGINPEPMPQY
FT                   IEEFVDFFKEVETDVAIINDGDADRVGMLDEKARFVDSHKLFAIILKYLVEERHQTGEV
FT                   AKTFALTDVINKICRKNNLVLHELPVGFKYVSKLMSTNDILIGGEESGGIGITSFLPER
FT                   DGVYIGLLILEIMTRKEKSLSGLVEELYDEYGYFAFTRNDLHVSEAKKQAIIAKAAAGN
FT                   LETVAGYKVLGFSDLDGYKYHFEGGWLLIRPSGTEPVLRLYCEADTDEKVSKVLAFAAK
FT                   LA"
FT   gene            454044..455186
FT                   /locus_tag="Cpha266_0411"
FT   CDS_pept        454044..455186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0411"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="KEGG: plt:Plut_1739 glycosyl transferase, family 19;
FT                   TIGRFAM: lipid-A-disaccharide synthase; PFAM: glycosyl
FT                   transferase, family 19"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64469"
FT                   /db_xref="GOA:A1BDJ2"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDJ2"
FT                   /protein_id="ABL64469.1"
FT                   /translation="MPKKLFVLAGEVSGDLHAAGVVAELLKARPDVRVFGIGGEKLRAL
FT                   GAELFYDTRRMSIMGFLEVLKHAGFLQRVIREMKELVRQEKPDLAFLVDYPGMNLLMAR
FT                   FFHEEGVPVIYYISPQVWAWKEGRVKAIGRYVDRLLVIFDFEVEFFRRHGIRAEFVGHP
FT                   VIEELSAVSLPPRELFFRRHHILPGQRLVGMLPGSRRQEIALVFPEMLKAARMLAADYD
FT                   VVFLLGRSPQMDEKHFSLVSAFDDIRIVECTAYEVMRFSELELVTSGTATLESLCFGVP
FT                   MIVLYKTAWLNYAVGRLLVRLTSISLANIVTKGLGSKDQVVPELLQHEATASGIYMIAR
FT                   RLLDHPQLLAEMRQELLDAREKLASASPSQIISEILQEYL"
FT   gene            455202..455474
FT                   /locus_tag="Cpha266_0412"
FT   CDS_pept        455202..455474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64470"
FT                   /db_xref="GOA:A1BDJ3"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDJ3"
FT                   /protein_id="ABL64470.1"
FT                   /translation="MEKAADLLLGNPVLLLIAVIAAVMVLFSCLRNMFRLALFAAALFV
FT                   LYIAYLSLTGGDAPAAVREIQETIAASFSHVSTMIKSFFDLLKSR"
FT   gene            complement(455497..457476)
FT                   /locus_tag="Cpha266_0413"
FT   CDS_pept        complement(455497..457476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0413"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: cch:Cag_0580
FT                   glutamate synthase (NADPH) small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64471"
FT                   /db_xref="GOA:A1BDJ4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDJ4"
FT                   /protein_id="ABL64471.1"
FT                   /translation="MNALTLTINGLKTTVQPGTSILDAAASCGITIPTLCFQQSLDVQG
FT                   ACWICIVEIKGKNRFVPACSTKVSAGMVIETETEELHMMRRRTLERLIEQHCGDCLGQC
FT                   ELACPAGCNIPGFISEIAAHHDDEAIAIIKNTIPLPGILGRVCPAPCEDACRRHGVDDP
FT                   VSICALKRYAADRDMEASERYIPAIAEKSGKHVAVIGAGPAGLTAAYYLLALGHEVTIY
FT                   DEHPAAGGMMRYGIPRFRLPESVIDKDVEPLEQMGATFRFNTRFGKDISTASLQSAFDA
FT                   IFLAVGAQQAAAMHIPGEHETGVLSGIEFLRQANEGVAEHPGANVVVVGGGNTAVDAAR
FT                   TALRLGATTVTILYRRTKEEMPANQQEINEAIAEGITLHVLALPVSMRRMNGFTEITAI
FT                   AMRQGEPDESGRKKPVPINGSEFTIAANTVISATGQQVDCSIAMAAGIGTSPEGTFDVN
FT                   QATLQSNIAGIFSAGDCVTGPDLAITAVSEGRRAAHSIHLFLQGKPVVGKPQQFNSSYG
FT                   PRDQAPEAFYSKANPFEKIALPEISLLERSGTFREVVLGLSPEDAAQEALRCLQCRCNA
FT                   IDNCRLRELAALYLPSGSCKLEEKLDFEIISGTDIRIEREKCVDCGICVRTLEQYGTEH
FT                   EPDYQKLSTSCPTGALSEAMLNKK"
FT   gene            complement(457509..458495)
FT                   /locus_tag="Cpha266_0414"
FT   CDS_pept        complement(457509..458495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0414"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.7.4"
FT                   /note="PFAM: LytB protein; KEGG: cte:CT0283 penicillin
FT                   tolerance protein LytB"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64472"
FT                   /db_xref="GOA:A1BDJ5"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDJ5"
FT                   /protein_id="ABL64472.1"
FT                   /translation="MKINLDRTSSGFCIGVQGTIHVAEEKLNNPDKLFSLGDVVHNEAE
FT                   VNRLEHLGLTTIDESGFHELKNAQLLIRAHGEPPSTYRIAEKNNLVITDTTCPVVSRLQ
FT                   RTARLLHELGYQIIIYGKPSHPEVIGINGHCKNSAVIIKHPDLSDPSETGQIDLKRKTA
FT                   LISQTTMDVPGFYELKANIRNLFAADSEEIRNENDHLWMAIRDIDLTASLTGIRDMPRY
FT                   VYKDTICRQVSSRNQMLHDFAIANSCVIFVAGKKSSNGQVLFGICKAANPCTYFIEDID
FT                   EIDDAWLTGSDGRTVESVGICGATSTPMWLLEKVAAHLQRRYNHDPA"
FT   gene            complement(458654..459472)
FT                   /locus_tag="Cpha266_0415"
FT   CDS_pept        complement(458654..459472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0415"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="KEGG: cte:CT0284 glutamate racemase; TIGRFAM:
FT                   glutamate racemase; PFAM: Asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64473"
FT                   /db_xref="GOA:A1BDJ6"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDJ6"
FT                   /protein_id="ABL64473.1"
FT                   /translation="MQHHKATPESPIGIFDSGVGGLTVVRAIQAEMPAERIIYFGDTAR
FT                   VPYGTKSPATIRKYAHEDTAILMSHLPKIIIVACNTVSALALDVVEKTAGSIPVIGVLK
FT                   AGADLAVQVTRNKHVGVIGTQATVSSNAYADAITLLDANIEVVSKACPLFVPLAEEGFT
FT                   EHAATRLIASDYLAAFDGHDIDTLVLGCTHYPILRHVITETLHRDIRIIDSAEAVAGRT
FT                   RKLLADAKLLSTEKHAPPPHLLVSDLPQKFSMLYKLFMESDLPDVELVEV"
FT   gene            complement(459501..460592)
FT                   /locus_tag="Cpha266_0416"
FT   CDS_pept        complement(459501..460592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0416"
FT                   /product="GTP-binding protein YchF"
FT                   /note="TIGRFAM: GTP-binding protein YchF; PFAM: GTP-binding
FT                   protein, HSR1-related; Protein of unknown function DUF933;
FT                   KEGG: cch:Cag_0572 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64474"
FT                   /db_xref="GOA:A1BDJ7"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDJ7"
FT                   /protein_id="ABL64474.1"
FT                   /translation="MSLRCGIVGLPNVGKSTLFNAITAKQAEAANYPFCTIEPNVGTVL
FT                   VPDERMQQIANVVKTPTLVPATLEIVDIAGLVKGASKGEGLGNQFLSHIREVDAIVHVV
FT                   RCFDDSNIIHVEGKIDPADDIATIETELMLADLDSMEKRIERLRKNSRKEKDLLQLVDL
FT                   AEKIIAGLAEGIPARSVIETPEEQETAKQFFLLTSKPILFAANVAEEDLQNGNDYTRTV
FT                   AEIAEKAGSKMLIISAKAEADIAELPEEERPMFLESLGLSMSGLDRLIRTAHELLGLQT
FT                   YFTAGEKEVHAWTIRKGAAAPEAAGAIHSDFEKGFIRAEVMFYKDLLELGSEQKVKEAG
FT                   KLRSEGREYIVRDGDIIVFRFNV"
FT   gene            460716..461429
FT                   /locus_tag="Cpha266_0417"
FT   CDS_pept        460716..461429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0417"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="KEGG: plt:Plut_1733 cytidylate kinase; TIGRFAM:
FT                   cytidylate kinase; PFAM: cytidylate kinase region"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64475"
FT                   /db_xref="GOA:A1BDJ8"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDJ8"
FT                   /protein_id="ABL64475.1"
FT                   /translation="MKQRNQEKRIIIAIDGPAASGKSTTARKVADRLGYTYIDTGAMYR
FT                   SVTLKAIESGLMDTLRSSPERVVDLLAGLSVCFSGDRIMLDGRDVTLAIRENRVSREVS
FT                   FISSLKPVRDTMRQMQQDMGRGRGVVMDGRDIGTVVFPDAELKVFLTADVRQRAMRRYA
FT                   ELAVKSGDPSELPCLEDLEREILDRDRADAEREHAPLKKHPDARELDTSSLTIDVQTDM
FT                   VCSMAEDILKKKQNG"
FT   gene            461536..463311
FT                   /locus_tag="Cpha266_0418"
FT   CDS_pept        461536..463311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0418"
FT                   /product="SSU ribosomal protein S1P"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   plt:Plut_1732 RNA binding S1"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64476"
FT                   /db_xref="GOA:A1BDJ9"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDJ9"
FT                   /protein_id="ABL64476.1"
FT                   /translation="MAETLTLEKKVQERLARKKVKYFAHYEPAELEQMEMLYTSTLCEI
FT                   TEDEIVKGRIVSISNKDVTIDVGFKSEGIVSLLEFRDDDDVAVGDEVEVYLENIEDKMG
FT                   QLILSKKKADVLRIWDKIYDSIENDTIINGKIINRVKGGMTVSLSGVEAFLPGSQIDVK
FT                   PVRDFDALVGQTMDFRVVKINPVTQNIVVSHKVILEEAYAARREEMLANIKVGMVLEGT
FT                   VKNITDFGIFVDLGGLDGLVHITDITWGRINHPSEVVDLDQPIKVVVVGFDENTKRVSL
FT                   GMKQLEAHPWENIEIKYPVGSKARGRIVSITDYGAFVEIEKGIEGLVHISEMSWTQHIK
FT                   HPSQFVSLNQEVECVILNIDKDHTKLSLSMKRVNEDPWIALSEKYIEASLHKGTVSNIT
FT                   DFGVFVELEPGVDGLVHISDLSWTKKIRHPSELVKKNQELDVKVLKFDVNARRIALGHK
FT                   QINPDPWDDFEQKYAVGAETPARISQIIEKGVIVILPGDVDGFVPVSHLLQGGVKDIHS
FT                   SFALGDELPLRVIEFDKENKRIILSALEYFKDKSKEEIEAYLQAHPNEKKEIEDATAEL
FT                   EPQVKSAEKKSGEAK"
FT   gene            complement(463386..464303)
FT                   /locus_tag="Cpha266_0419"
FT   CDS_pept        complement(463386..464303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0419"
FT                   /product="GTP-binding protein Era"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Era; PFAM: GTP-binding protein, HSR1-related; KH,
FT                   type 2 domain protein; KEGG: plt:Plut_1731 GTP-binding
FT                   protein Era"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64477"
FT                   /db_xref="GOA:A1BDK0"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDK0"
FT                   /protein_id="ABL64477.1"
FT                   /translation="MDASSFSCGFAVIIGAPNAGKSTLLNKLLDYKLSIVTPKPQTTRK
FT                   RITGIYHKDQCQIIFLDTPGIMKPQQKLHESMLEITRATLKDADVVLALLPYSRQSGSV
FT                   DLEFTEDLFSSWLNPSGKPVIAVLNKSDLVSAEAKRTCESVIQNSFHPKAVLSISAQLG
FT                   NNIEGLISALKPFLPLKEPLYPEETLSTDPERLFVTEIIREKIFLLYGNEIPYASEVII
FT                   DEFKEQHENDPSRKDLIRCSIIVERDSQKQILIGSKGAALKKLGQAARLDIEELLGRPV
FT                   FLELFIKVRNDWRKKNNLLKSYGY"
FT   gene            464415..465641
FT                   /locus_tag="Cpha266_0420"
FT   CDS_pept        464415..465641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0420"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: plt:Plut_1730 rod
FT                   shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64478"
FT                   /db_xref="GOA:A1BDK1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDK1"
FT                   /protein_id="ABL64478.1"
FT                   /translation="MTDKQSNVDFWLLVPMIGLIVFGLMAIFSATHGAGETTLFYRQFA
FT                   WGVIGAVVMLFVYFNDYRVIRDNAYLLYLISIFLLVVVLLFGTKIAGQTSWVKIGFFSF
FT                   QPSEIAKMATILALARFLSDDETDITFTPHLLIALGIPLFPALLIMLQPDMGTTLTSLS
FT                   FIIPMFIMSGFDLYIVIPYLLPIILMLSGFFNVFYIVGLAVLLFLALWLQKKKFKMHQL
FT                   LVTAAGLGAALFTNRFAAELLKPHQLKRIQTFLDPMSDPRGAGYNVIQAKIAISSGGFF
FT                   GKGYLEGTQTQLRFIPAQWTDFIFCVIAEELGFVGSFVLLLLFLVLILRLLWIISSIKN
FT                   KFVELTLAGFVSLLLIHVIINIGMTIGLIPVIGVPLPFVSYGGSSLLGNMIMVALALNF
FT                   VHNKRSIGY"
FT   sig_peptide     464415..464516
FT                   /locus_tag="Cpha266_0420"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.781) with cleavage site probability 0.765 at
FT                   residue 34"
FT   gene            complement(465769..466218)
FT                   /locus_tag="Cpha266_0421"
FT   CDS_pept        complement(465769..466218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT0291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64479"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDK2"
FT                   /protein_id="ABL64479.1"
FT                   /translation="MAKTEMGSPDKYDLFAEKIDQFKLLVEEKKNLQEQIMLLQEEFNE
FT                   KIKPFENQLSTVVRKLELELARVEGKTSEKPAPLKYSRGRLGISIKELLGNSPDRAFKP
FT                   KEIADALSTKGTTVSLWLNKYGSSDQEIERIPSENGGKRFLYKIK"
FT   gene            466369..467709
FT                   /locus_tag="Cpha266_0422"
FT   CDS_pept        466369..467709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0422"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /note="KEGG: plt:Plut_1728 MiaB-like tRNA modifying enzyme;
FT                   TIGRFAM: RNA modification enzyme, MiaB family; PFAM:
FT                   Radical SAM domain protein; Protein of unknown function
FT                   UPF0004-like; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64480"
FT                   /db_xref="GOA:A1BDK3"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDK3"
FT                   /protein_id="ABL64480.1"
FT                   /translation="MPKITAITLGCKLNYAESSAILDLLSKKGWEISSYEKNEDLIIIN
FT                   TCAVTKQAEQKCRQKIRKIIRDNPGSRIVVTGCYAQLSPEVLCKIDGVNAILGSSDKYA
FT                   LPLYEVIGNIESSLPLISVSEIKKEKTIFPGYSLPATFASERTRAFLKIQDGCDYGCAY
FT                   CTIPFARGRSRSFSPDDIIAQASALVASGYREIVLTGVNIGDYRYRGVRLAALLRMLEK
FT                   VPVARIRISSIEPDILDDALIAVVAASEIIAPHFHLPLQSGSDAVLRAMCRRYDTAGYR
FT                   QRILRAVEAIADCSVSSDVMVGYPGESADDYRNMYRFLEGLPISSLHVFSCSVRPGTQL
FT                   AEQVATKKREVVDPDECRQRSSELIKLGNLKKSRFMEGYVGMECMVLFEESQKGANGTR
FT                   KYSGYTRNYLRVTVTVSESSVHLAGSILPVFIEGIDDDLNLMGRLLF"
FT   gene            467760..468293
FT                   /locus_tag="Cpha266_0423"
FT   CDS_pept        467760..468293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0423"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="KEGG: cch:Cag_0565 adenine
FT                   phosphoribosyltransferase; TIGRFAM: adenine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64481"
FT                   /db_xref="GOA:A1BDK4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDK4"
FT                   /protein_id="ABL64481.1"
FT                   /translation="MTIKSRIRSIPDYPKKGIMFRDITTLIKDPVGFRLVIDNLTQHYL
FT                   QNGVDFDVIVGIEARGFIIGGALSYALGKGFVPVRKPGKLPADVASQKYELEYGSDTIE
FT                   IHIDALEEGSRVLLVDDLLATGGTALAAAALVEKVGGVVAEMAFIVNLPDVGGEQRILD
FT                   KGYSIFSLTDFEGD"
FT   gene            complement(468916..469224)
FT                   /locus_tag="Cpha266_0424"
FT   CDS_pept        complement(468916..469224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0424"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: cte:CT0295 DNA-binding protein HU-alpha, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64482"
FT                   /db_xref="GOA:A1BDK5"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDK5"
FT                   /protein_id="ABL64482.1"
FT                   /translation="MGTTTTKADLVNVIAHRTGLTKNETEAVVDCLFESIIDSLKSGKR
FT                   IEIRGFGSFNIRHKNLRQARNPRTGEKVTVDPKNVPTFKISKEFKHAVSESLKNGQE"
FT   gene            complement(469269..469634)
FT                   /locus_tag="Cpha266_0425"
FT   CDS_pept        complement(469269..469634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0425"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT0296 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64483"
FT                   /db_xref="GOA:A1BDK6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDK6"
FT                   /protein_id="ABL64483.1"
FT                   /translation="MQFMIMFITGIAGGILAGMFGVGGGIIIVPVLVLLVGMTQHSASA
FT                   TSLVALLLPVGILGVMEYYRSGRITTEHLWFGLIIALGLFIGAYFGAKIAISLSSDTLR
FT                   KAFAVFTGIVAFRLWFK"
FT   gene            complement(469677..471635)
FT                   /locus_tag="Cpha266_0426"
FT   CDS_pept        complement(469677..471635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0426"
FT                   /product="FtsH peptidase, Metallo peptidase, MEROPS family
FT                   M41"
FT                   /note="KEGG: plt:Plut_1722 peptidase M41, FtsH; TIGRFAM:
FT                   ATP-dependent metalloprotease FtsH; PFAM: peptidase M41;
FT                   AAA ATPase, central domain protein; peptidase M41, FtsH
FT                   extracellular; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64484"
FT                   /db_xref="GOA:A1BDK7"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDK7"
FT                   /protein_id="ABL64484.1"
FT                   /translation="MPENKKERPVKKDSSNKFKPVRNDDQPQGWLPGKTGGGQGKFPVV
FT                   LVFMLLAFLMLFLFQRFFSSSDSPEVTYNSYRSLLVSDLVRDVTVKTFSDKSAIINGKL
FT                   KSVTKLELTNSMTLESDRFSVRIPAFSVEQADLLAEKGIRVKVEDGTPAFTAFLMLFAP
FT                   WIIFGLLYFFIFRRMSSQNGNAAKNIFSFGKSRAKMVSEFDVKTSFKDVAGVDEAIEEL
FT                   QETVEFLTNPERFEKIGGKIPKGVLLLGPPGTGKTLLAKAIAGEAKVPFFSISGADFVE
FT                   MFVGVGASRVRDLFEQAKKNAPCIVFIDEIDAVGRSRGAGVGGGHDEREQTLNQLLVEM
FT                   DGFTTSENVILIAATNRPDVLDSALLRPGRFDRQITIDKPDIRGREAILKIHTRKTPLG
FT                   SDVDLTVLAKSSPGFSGADLANLVNEAALLASREGKEEITALDFEHARDKVLMGPERRS
FT                   MYISDEQKKMTAYHEAGHVLVASYTKGSDPIHKVTIIPRGRSLGLTAYLPLEDRYTHNR
FT                   EYLLAMITYALGGRVAEELVFNEISTGAANDIEKASDIARRMVRQWGMSEKLGPINYGD
FT                   SQKEVFLGKDYSHIREYSEETALQIDVEVRNIIMSCMDNAKKILIEKKSILQKLAETLI
FT                   EKESLDAGEIRKIIGND"
FT   gene            471873..473381
FT                   /locus_tag="Cpha266_0427"
FT   CDS_pept        471873..473381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0427"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="KEGG: plt:Plut_1721 glutamyl-tRNA synthetase;
FT                   TIGRFAM: glutamyl-tRNA synthetase; PFAM: glutamyl-tRNA
FT                   synthetase, class Ic"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64485"
FT                   /db_xref="GOA:A1BDK8"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDK8"
FT                   /protein_id="ABL64485.1"
FT                   /translation="MVAQRYRTRFAPSPTGYLHVGGLRTALYNYLFVKKMKGDFVLRIE
FT                   DTDRSRRVEGAQQNLLKTLEWAGIVPDESPELGGDFGPYIQSERLEIYKKYCDELLEGK
FT                   YAYYCFATSEELEENRQLQLKQGLQPKYNRKWLPEEMGGSMPSSEIRKKMEQNAPYVIR
FT                   MKVPDYVSVWFEDLIRGPVEFDSSTIDDQVLMKSDGFPTYHFASVIDDHLMEFTHIIRG
FT                   EEWLPSMPKHLLLYEFFGWEPPKFAHLPLLLNPDRSKLSKRQGDVAVEDYIRKGYSAEA
FT                   IVNFVAMLGWNEGEGTEQEVYSLEQLVERFSLERVGKAGAIFNVDKLNWLEKQYIKSRS
FT                   ADRIIAVIKPLLMAELEKRPTAMHESVITSDLYLEQVIELMRERVGFEHEFVTFSPYFF
FT                   FDPETYEEEGVRKRWTAETNTLLREFVTVLASLDAFTAEAIETELKAFVAPKGLKAAAL
FT                   IHPLRILCSGVSFGPSLYHMLEVLGKDAVIRRISRGIETVVCLS"
FT   gene            473467..473542
FT                   /locus_tag="Cpha266_R0011"
FT                   /note="tRNA-Phe1"
FT   tRNA            473467..473542
FT                   /locus_tag="Cpha266_R0011"
FT                   /product="tRNA-Phe"
FT   gene            473682..474812
FT                   /locus_tag="Cpha266_0428"
FT   CDS_pept        473682..474812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0428"
FT                   /product="hydroxyneurosporene synthase"
FT                   /EC_number="4.2.1.-"
FT                   /note="PFAM: hydroxyneurosporene synthase; KEGG:
FT                   plt:Plut_1720 hydroxyneurosporene synthase CrtC"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64486"
FT                   /db_xref="GOA:A1BDK9"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDK9"
FT                   /protein_id="ABL64486.1"
FT                   /translation="MNITTERSQELWHDLQEPGAYEWWYFDAEDKKNGLSIVLIWFGGF
FT                   PFSPYYMQHYEEWKKGKTAGPPFPSNYSGFSFQLYENGKETVNFIREGSNGLFESNREE
FT                   IGVRFEQNRFTYDQEQDEYRISVDFSFPARTRKISATLVFKPLRRVIYSKKDGNNSGHV
FT                   PRHQWLLSVPRAAVEGSIDITEGRSDISRRIHVEADGYHDHNLGTMPMQEYIKKWYWGR
FT                   AFSEEFDLIYYVIFFKNDHYQPVSLLMLHDNRSNQMRIMEDVAFSEHNFSRGVFSPLHG
FT                   RVLELRHGNVLLSIHQHKVLDAGPFYLRFASTISLRADGEHLNGISGISEFLNPSCLRS
FT                   KVMRFFIKSRIWRDGVPSIMYNQYNYIKNHFDWFRK"
FT   gene            474993..475541
FT                   /locus_tag="Cpha266_0429"
FT   CDS_pept        474993..475541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0429"
FT                   /product="Plastoquinol--plastocyanin reductase"
FT                   /EC_number="7.1.1.6"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   plt:Plut_1719 plastoquinol--plastocyanin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64487"
FT                   /db_xref="GOA:A1BDL0"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR014909"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDL0"
FT                   /protein_id="ABL64487.1"
FT                   /translation="MAQQGNFKSPSRMGGLGEGAPLSSSGAVQAGKPREQGLKGVDFER
FT                   RSFLGKVVGGVGAVVAVSTLYPIVKYIVPPPVKEAAIVSELIVGKASEVPENSGKIYQF
FT                   NKDKVLVVNDNGKLTACSAVCTHLGCLVHWEDKDNLIFCPCHGAKYKQTGEIISGPQPL
FT                   PLAPFNVRVEGENLIISKA"
FT   gene            475569..476864
FT                   /locus_tag="Cpha266_0430"
FT   CDS_pept        475569..476864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0430"
FT                   /product="Cytochrome b/b6, N-terminal domain"
FT                   /note="PFAM: Cytochrome b/b6, N-terminal domain; KEGG:
FT                   plt:Plut_1718 cytochrome b-c complex, cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64488"
FT                   /db_xref="GOA:A1BDL1"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDL1"
FT                   /protein_id="ABL64488.1"
FT                   /translation="MAENNQNAATGNTPVKPKPAAPGAAKPAAPGAAKPAAPAAAKPAA
FT                   PVAAKAQPSTSTGGGVYKPPVDRPDPNPYKDSRLSPLGSWFQERFYVMMPVIDYLKKKE
FT                   VPQHRLSFWYYFGGLTLFFFIIQIVTGLLLLQYYKPTAAEAFASFVFIQQEVPFGWLIR
FT                   QVHAWSANLMVMMAFIHMFSTFFMKSYRKPRELMWVSGFVLLVLSLGFGFTGYLLPWNE
FT                   LAFFATQVGTEVPKVAPGGAFLVGILRGGEEVGPETLTRMFSLHVVLLPGLLMLVLSAH
FT                   LLLVQVLGTSAPIGYKESGMIKGYEKFFPTFLAKDAIGWIIGFGLLVYLAVVFPWEIGV
FT                   KAEALTAAPVGIKPEWYFWAQFQLLKDLTFEGGELVAIALLTVGAIVWILVPFIDRQAS
FT                   SEQKSPLFTIFGLLVLAFLLINTYRVYAEYGW"
FT   gene            complement(477245..480748)
FT                   /locus_tag="Cpha266_0431"
FT   CDS_pept        complement(477245..480748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0431"
FT                   /product="alpha amylase, catalytic region"
FT                   /note="PFAM: alpha amylase, catalytic region; SMART: alpha
FT                   amylase, catalytic sub domain; KEGG: plt:Plut_1717 alpha
FT                   amylase, catalytic subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64489"
FT                   /db_xref="GOA:A1BDL2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDL2"
FT                   /protein_id="ABL64489.1"
FT                   /translation="MTSNNYQPAPPGKEHFYLNRQARELFKQRDPEFLVLFDRSGDSLA
FT                   HAREQTAIINSFLKKKKGDQAKLILPAQFHGMKLLHEVFHALIAQSVASRKPDFFKTVD
FT                   DNFHRELSQNRANEYEKRFLDDFPPDALFRGVQSTEEYLSIPEKREQLIEESFLVWLNN
FT                   QNPALGQFEDLITDRNLVKDDAYLQLIRSLKGSIHDMGAVGPGDIDLLELLWLPIRHSP
FT                   DSILEQLRYIRLHWADLLEDSPFWSLLADAIILIQDEDRYIFVEQLSKHQDSRHPDFWM
FT                   EKETHVPDYGDPGEAGAHYSADSSWMPEVVMLAKSTYVWLDQLSKIYHRHIARLQDIPD
FT                   RELDLLSERGFTALWLIGLWQRSEASETIKRIQGNPEAKASAYALEQYNISRDIGGYEG
FT                   YLDLRNRAMQRGIRLASDMVPNHTGIDSELVRNNPDWFLSASSAPYVNYSYNGPNLSSD
FT                   ARYGIFLEDGYWNRSDAAVTFKRVDYLNGDTRYIYHGNDGTTMPWNDTAQLDFLSAEVR
FT                   EGVIQQILHVARMFPIIRFDAAMVLAKRHIQRLWYPLHGQTAGVPSRSSFSMSMEEFNA
FT                   AIPEEFWREVVDRIQAEVPGTLLLAEAFWMLEGYFVRTLGMHRVYNSAFMHMLKKEDNA
FT                   SYRYLIKNTLEFDAEILKRYVNFMNNPDEDTAIAQFGRGDKYFGVCMMMITMPGLPMLG
FT                   HGQVEGFTEKYGMEYAKAYYDEQPDQHLVDRHYREIFPVMKKRPLFAEVENFFLYDVYS
FT                   PEGSVNENIFAYSNRLGEEKALVIFNNCAVQAAGWVSTSVGYRKGDEIRQTSLADGLFL
FT                   SREDNLYVIFRDQCSGMEFIRSNRIIAEQGLFVALEGYRYNLFLDFREVKPSRLTPYDR
FT                   LCAELNGNGTASIEHDVLFMSLEPLHRLLSEFLAPDNLAPLHGTTENELIFPVFKTMIA
FT                   TLLQEVAVKYGNLLEKPVDVPATLADETVSRFRHACQMVEEMANLPESDRFNAALGTTE
FT                   REKSGFSTILLHWLALDSLQEMLRANELLSSNLIDDWLMSNTLQQLYSQKGLNGIPGDN
FT                   IPDLLYCLLSEKPATLPADEESALYALLALLDASHSEHVARILQFENRHEKTWFREHRF
FT                   SVLAAWLSVEAMLKKENLPVEQESGKTEHPVAGWVAAARKLDMQAFLSGYEMGALLRQK
FT                   A"
FT   gene            complement(480951..481340)
FT                   /locus_tag="Cpha266_0432"
FT   CDS_pept        complement(480951..481340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64490"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDL3"
FT                   /protein_id="ABL64490.1"
FT                   /translation="MITNNEPLNSIEARIEELHNTIAEKEEQIKTRTRQLKDDIQTELD
FT                   PATVVRRHPFEIAGSIFVTGILIGRSVKSMVGSSRKHQSNTASASDSVPAKAPTQLSVL
FT                   GIDILRSVKDLGFTYLTHYLDKKIK"
FT   gene            complement(481324..481722)
FT                   /locus_tag="Cpha266_0433"
FT   CDS_pept        complement(481324..481722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64491"
FT                   /db_xref="GOA:A1BDL4"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDL4"
FT                   /protein_id="ABL64491.1"
FT                   /translation="MGSSPVQKSGTAAPKRTHSGIPKMLDDTVTSTYEDVVSIVDAKIE
FT                   LLKLDLTKKISIVVAIVILALMLLLATAYLITTVALLLGELTGHLFIGYLLVSLIFLGC
FT                   FVFFAKFRPDLLQNLIQKTLLSAHDYKQ"
FT   gene            complement(481753..482040)
FT                   /locus_tag="Cpha266_0434"
FT   CDS_pept        complement(481753..482040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1714 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64492"
FT                   /db_xref="GOA:A1BDL5"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDL5"
FT                   /protein_id="ABL64492.1"
FT                   /translation="MEQEVPVTIHQGETVEAEAAETMPKPDAAYIPELIKEIASTVSET
FT                   FSGFRESESYGQLIKAAEEVRTYIKNNPAQALLYSLGAGAALGFLFKKRR"
FT   gene            complement(482133..482882)
FT                   /locus_tag="Cpha266_0435"
FT   CDS_pept        complement(482133..482882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0435"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   plt:Plut_1713 3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64493"
FT                   /db_xref="GOA:A1BDL6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDL6"
FT                   /protein_id="ABL64493.1"
FT                   /translation="MTVSGNKVCFMTGATGGLGSELALSIARQGYSVFFTWNASRLKAE
FT                   KTLEKIRRISPESDMIRCDIAKPKEIQQAFNAFLEKFSRLDLLLASASNFYRTGLPDVS
FT                   ETEWDNLVDTNLKGTFFTMQEAVKIMRNQSFVSRIITMTDVSADLVWRHFAPYTVSKAG
FT                   IQHLVKIFAREFAPQVLVNAIAPGTITSNADLQRDEHSVEEKKLIEKIPLQRLGNPLDI
FT                   SRAVLFLLESDYITGQIISIDGGRVLG"
FT   gene            complement(482952..483377)
FT                   /locus_tag="Cpha266_0436"
FT   CDS_pept        complement(482952..483377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0436"
FT                   /product="TOBE domain protein"
FT                   /note="PFAM: TOBE domain protein; KEGG: cte:CT1765
FT                   molybdenum-pterin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64494"
FT                   /db_xref="GOA:A1BDL7"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDL7"
FT                   /protein_id="ABL64494.1"
FT                   /translation="MNISARNIFKGTIASIIIGAVNAEVNLALEDGTTLCSIITIGAVK
FT                   QLGLQEGMAAYGIIKASSIILGSNMQDARISARNIMSGTIRKIVDGPVSTEVDIEIGAG
FT                   NTLSAVITHESARKLGLKEGGDACAIFKASSVMLGVN"
FT   sig_peptide     complement(483306..483377)
FT                   /locus_tag="Cpha266_0436"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.733) with cleavage site probability 0.695 at
FT                   residue 24"
FT   gene            complement(483873..484418)
FT                   /locus_tag="Cpha266_0437"
FT   CDS_pept        complement(483873..484418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0437"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: bth:BT4599
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64495"
FT                   /db_xref="GOA:A1BDL8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDL8"
FT                   /protein_id="ABL64495.1"
FT                   /translation="MFDYRLKVFDTVARRLSFTKAAEELCITQPAVTKHIKELEKQFRL
FT                   RLFERAGNRIALTQGGLMVLKHTSILRDISKQLEYEISMLHESRRGTLNLGASTTIAQY
FT                   VLPPLLARFHGIYQDVQLHMLNTNTEQIEQALLRKEIEPGIIEGDSKRREINYTPFARD
FT                   EIVLIGRKKKKYLSISFK"
FT   gene            complement(484431..485300)
FT                   /locus_tag="Cpha266_0438"
FT   CDS_pept        complement(484431..485300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0438"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: plt:Plut_1712 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64496"
FT                   /db_xref="GOA:A1BDL9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDL9"
FT                   /protein_id="ABL64496.1"
FT                   /translation="MIILSITKTLSGAEGPFELSLDLSLQPETLHTLFGRSGSGKTTTL
FT                   RILAGLTQPDSGHIEVNGRVWLDSAAKINLPPQKRKVGFVFQDYALFPTMTIKENLLFA
FT                   QKTKNEQKVNELLELTHLSVLHNRYPTKLSGGQQQRVALARAILREPDILLLDEPLSAL
FT                   DQSTRLRLQDEIMSFHKRFRLTTVLVSHDKQEVFKLSDRVTVIDRGRIIRTGSPLEVFL
FT                   DRTTSNKFSFASTILSIRKVDCIYLAVIGAGNELVEVVLSRHDFETLKVGDEVLVASKA
FT                   FNPLVIKL"
FT   gene            complement(485334..485729)
FT                   /locus_tag="Cpha266_0439"
FT   CDS_pept        complement(485334..485729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0439"
FT                   /product="TOBE domain protein"
FT                   /note="PFAM: TOBE domain protein; KEGG: plt:Plut_1711
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64497"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDM0"
FT                   /protein_id="ABL64497.1"
FT                   /translation="MNRLSAVISSIDQYESLFMLELDASGITLEMLLFDLQPFFRTGSS
FT                   VQVLFKETEVALAKGLAEETSFSNIFPAIITAIKKGRILAEISLQSKAGSMGSIITMKA
FT                   AMRLGLQIHDEVTVLVKASQLSLEALP"
FT   gene            486186..488390
FT                   /locus_tag="Cpha266_0440"
FT   CDS_pept        486186..488390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0440"
FT                   /product="TonB-dependent receptor, putative"
FT                   /note="KEGG: cte:CT1542 TonB-dependent receptor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64498"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDM1"
FT                   /protein_id="ABL64498.1"
FT                   /translation="MKKTALLVFLLAFPALASASEISEAYPSAEEVTVTGKKGDILQQV
FT                   TGRESELLNPSQMSVYKAINLMPSLSQQSVDPYGLADIVNYHESFRFRGVEATSGGVPA
FT                   TTVNVEGLPVTGRPGGGATIYDLENFSNINIYTGVMPASAGLGLADVGGKINMEIRRPE
FT                   ESFGVLFKQGFGSNDFRRTFLRVDTGALPGDVKSFISFSDAAADKWKGEGDSQRRNVMA
FT                   GVTKTFGDNVKLEAFVTYSKGDIHAYRPFSYAQIGNLESAYTIDYGTNPDSYDYYGYNR
FT                   NEFEDWMVMANLEVKTGEHSKLDIKPYYWSDKGYYLETITLANNQNRIRRWDIDHDLKG
FT                   VLAEYTTTIGSVDLDFGYLYHTQVRPGPPTSWKNYKVVNGKPVFDQWNILSNSSSHELH
FT                   SPFLEATYRFGSWKLEGGLKYINYTLPSIITYNTAGLGDLSYDEALAGNPSINAKASAL
FT                   DTKSFSRLFPNLTLTRFIGDNISLHAAYGENYVTHVDIYPYFISQSANFIQKGISFQQL
FT                   WDAREMETSQNFELGMRVKGSNWSIAPTIYYALHNNKQAVLYDPVLDATYPMNNADAEG
FT                   YGFELEAEYKPLENLSCYGSFSWNRFSFSQDINSDAPGGGIIKVKGEQVPDAPEFLAKG
FT                   MVSYKAGDFLITPIVRYTSVRYGDVLHNEKIDSTTLFDLDLTWQKKMLGFKEVEISLSL
FT                   LNIFDKQYVSMISTSDYKTLKTSYQAGMPFTVMATLAVHY"
FT   sig_peptide     486186..486245
FT                   /locus_tag="Cpha266_0440"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.918 at
FT                   residue 20"
FT   gene            488490..489215
FT                   /locus_tag="Cpha266_0441"
FT   CDS_pept        488490..489215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0441"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; KEGG: plt:Plut_1541 molybdenum
FT                   ABC transporter, periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64499"
FT                   /db_xref="GOA:A1BDM2"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDM2"
FT                   /protein_id="ABL64499.1"
FT                   /translation="MTRKLFPPLFLLFSLFSVTLRAETIIIASGAGYKRPLMEIAGKYE
FT                   KKTGRHIDAVFGNMQQIITQAQMSGNVSIIFGDKSFFDQSAISFAGYYPVGEGKLVLAW
FT                   RKGLQVKRITDIREKRIARLGIPDEKKAIYGRVASEYLEKSGLSGAVKGKLLVVSTVPQ
FT                   VSAYLVSGEIDAGFINITDAIGIQENIGGYLVAGQSLYTPIHIQAGVVKGFEGRSDIRD
FT                   FLQFLKEKESVAVLHHYGL"
FT   sig_peptide     488490..488558
FT                   /locus_tag="Cpha266_0441"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            489233..489895
FT                   /locus_tag="Cpha266_0442"
FT   CDS_pept        489233..489895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0442"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: plt:Plut_1542 putative
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64500"
FT                   /db_xref="GOA:A1BDM3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDM3"
FT                   /protein_id="ABL64500.1"
FT                   /translation="MLSVRELADPVLLTLETAAITMILHLLAGVVSGYLLTGKQSVFGL
FT                   IADALITLPLVFPPIATGFLLLLILGRTGFIGAPLQQMGVEIIFSRSGVFIASFTAGLP
FT                   LVVKSVQSAIAAMSGSLSEAAWTLGKSRVQTYFFVVLPAIRHALFTGLILSLGRSLGEV
FT                   GITLMLGGNIIGKTETVSLAVYNAVFEGNFEKAALLSTLLGILSLAMFYGLKKMGST"
FT   gene            490096..490854
FT                   /locus_tag="Cpha266_0443"
FT   CDS_pept        490096..490854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0443"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: cte:CT1763
FT                   uroporphyrin-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64501"
FT                   /db_xref="GOA:A1BDM4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDM4"
FT                   /protein_id="ABL64501.1"
FT                   /translation="MTQENIHNPVSIVGTGPGDPDLLTVRASRIIRSADVILYDCATAK
FT                   PALSIASETAIIHEVNRQASAGKPSILELIEMYYHEGRKVVRLKVGDPMLFGGEIDECR
FT                   ALKALNIPFEVVAGITAGSSAASSYALPISLKYQSNSVTYIIADEPGADFALFRDASRL
FT                   LRHGSTIVLYMATKNLENIFRVFVEEGVPETMAVFAVGKSGWPDESSAEGTMRDIVAQI
FT                   ELRQLKEPIIFFLGRHLTKEKHFPVMSACS"
FT   gene            490938..492941
FT                   /locus_tag="Cpha266_0444"
FT   CDS_pept        490938..492941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0444"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug; KEGG: cte:CT1762 TonB-dependent outer
FT                   membrane receptor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64502"
FT                   /db_xref="GOA:A1BDM5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDM5"
FT                   /protein_id="ABL64502.1"
FT                   /translation="MKKIVLLVLLLAATETVFAAELPSDLPVSGIKVFTAGEVTVSGKK
FT                   DHAKETVAATEMEMLDKKNIAQAVNMLPGINVSNVGGRNEGMVYVRGFDMRQVPLYLDG
FT                   IPLYVPYDGYIDPNRFTTFDLSEINVSKGFTSVLYGPNTLGGAINMVSRKPAERFEGSL
FT                   KGGLTFSDEGLASEFASLNLGSNQGTWYVQGSLSILDRDFMQLSDSFLATKSEDGSKRD
FT                   NSDSRDFRGSLKVGYTPNSTDEYSLSIISQQSSKGVPVYTGINPTQTVRYWRYGDWDKS
FT                   SIYFIGKKALGSKSYLKARAYYDNYYNTLQSYDDASYATQKTKKAFSSRYDDKTFGGSI
FT                   EFGTEILSGNTLKIALHDKYDMHNEIGNTGEMPKEFEDNTVSVAAENTWKASDNISVIA
FT                   GVRQDFRHTIKAEDLVGGVITSFPLEDNQATNLQLAVVGRLSESQELTAYLTRTTRFPT
FT                   LKDRYSYRLGNAFPNPELKPEQSLNYGLDYAIRPADQLKFQASVYQSKLSDVIQQVNNI
FT                   AYVKGIWVYQFQNTGEATFTGFECSVDWQPVSWLRAYSGYSYIDRKNDSNPSLRFTDIP
FT                   RHKFTGYLQFLFNKDRWAIVESEYYSRRYSTSDGKYTAGAYGLINLRASTVLYDTLSLQ
FT                   ASVENVFDRNYEVAEGYPEAGRQYVVSLAWAL"
FT   sig_peptide     490938..490997
FT                   /locus_tag="Cpha266_0444"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            493033..494043
FT                   /locus_tag="Cpha266_0445"
FT   CDS_pept        493033..494043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0445"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   cte:CT1761 iron(III) ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64503"
FT                   /db_xref="GOA:A1BDM6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDM6"
FT                   /protein_id="ABL64503.1"
FT                   /translation="MSARLLIVTSLFVLAAAAILSLFVGRYQVSPAALFRYLATGYSSD
FT                   ANLETVLLDIRLPRLIASVAAGGALSLAGSAYQGMFRNPMVSPDILGVSSGAGFGAALA
FT                   ILLSLPPAGIQLFSFSGGVTAVLVALGIARTIGRSHDATLVLVLSGIIISSLFGALLSL
FT                   LKYAADPDDKLPAIIYWLMGSFADSSMKDLGLIIPLLLAGVIPLMLVGWRLNVLSFGDE
FT                   EARSLGINTGLMRVLVIACATLVSACMIAVSGIIGWVGLVVPHLARFVAGPDHRVLLPV
FT                   SFLFGGTIMLCADVLARSLLPVEIPVGIITAITGAPFFLWFLKQSTAAAWDSKRG"
FT   sig_peptide     493033..493122
FT                   /locus_tag="Cpha266_0445"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.976) with cleavage site probability 0.335 at
FT                   residue 30"
FT   gene            494022..494822
FT                   /locus_tag="Cpha266_0446"
FT   CDS_pept        494022..494822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0446"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cte:CT1760 iron(III) ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64504"
FT                   /db_xref="GOA:A1BDM7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDM7"
FT                   /protein_id="ABL64504.1"
FT                   /translation="MGFKKRVTLDITHADFGYQGRAVLRDVTFRMDSGDIVCVLGANGA
FT                   GKTTLFKTLLGFIRPISGALMLNGIELSQYKPRELARLIAYVPQAHHVPFSYTAGDVVL
FT                   FGRAVHLGLFASPGKNDRIIASRSLELMEISHLADKPFTELSGGERQMVIISRALAQEA
FT                   PLLILDEPTSNLDYGNQIRVISKIKELQKAETGVLMATHMPDHAFMLASKAVIMHKGSL
FT                   SFSDVSETIVTPEVLKQLYGVDVRIFDTPFDGHAGRKVCAPVLD"
FT   gene            494843..495475
FT                   /locus_tag="Cpha266_0447"
FT   CDS_pept        494843..495475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0447"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: cte:CT1759
FT                   methlytransferase, UbiE/COQ5 family"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64505"
FT                   /db_xref="GOA:A1BDM8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDM8"
FT                   /protein_id="ABL64505.1"
FT                   /translation="MYSMDAKEFNDKIMNGHFRKIYPVIARQIVDRTGISEGCCVDLGG
FT                   GPGLLGISLAKITRLQVTVYDLMPECVALALQNSVEHGVDDQVTAQQGIAECMPFDENS
FT                   LDLVVSRGSIFFWENQMQGLAEVYRVLKPGGWAYLGGGFGTSELLREIELLMADEADWN
FT                   RKRQERMVKNPPEQFESMLRQLGIEGRVEQDDAGMWVVFCKQKSAKA"
FT   gene            495472..496581
FT                   /locus_tag="Cpha266_0448"
FT   CDS_pept        495472..496581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0448"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: cte:CT1758
FT                   iron(III) ABC transporter, periplasmic iron-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64506"
FT                   /db_xref="GOA:A1BDM9"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDM9"
FT                   /protein_id="ABL64506.1"
FT                   /translation="MSGGFIGSYIAVVRIAAVLILFFTTACSPHEDRRYTRIVTDMAGR
FT                   TMGVPDTIKRVYVNRPGALMLYALAPELLVNRSFRMTDSGRRFMKESWLTLPYVDGSAE
FT                   EIIRLKPDVIISCFTIDAKSMADARRLEEKTGIPVFQVPLDMSRYEKTFMVLGTLLDRK
FT                   EQAERMTGFLHAYLDELLSKAREIPPSRKVRVYYAEGDRGLQTDPSGSFHSEILERVGA
FT                   RNVAEVPITGGKGMSSVSMEQILFWDPDVILVWTGMGPSLTTLLEIESDSLWAKARAVR
FT                   QKRLFQIPLQPFGWFDRPPGTNRILGAIWTAQLLYPDLYRFDITRITREYFRIFYHHEL
FT                   TESELREVLDPHAEPLPEKGARTNKSKGL"
FT   gene            496581..497285
FT                   /locus_tag="Cpha266_0449"
FT   CDS_pept        496581..497285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plt:Plut_1539 receptor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64507"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDN0"
FT                   /protein_id="ABL64507.1"
FT                   /translation="MQSVNRNDSKSDVLALCGAVPMHRKSTGNGVPLLKKGAINLYMNM
FT                   PCPLKVVTKMVITEFAEIYNASHAVPIYSPMLHDGYVKDGKNNIPAYELQNISRAMTRG
FT                   IELTASIKLPYGLTVSDELTFLDSEDKSKGQDLLYVPDVTNTLKLAYGAERSGFNGNIR
FT                   VVSVGTQWVENNVRADGYTLVNAYLAKKVSSDTSLFFGVDNIFNEDPAAYGNIGGAGST
FT                   GTCFYGGLTFTL"
FT   gene            497306..497857
FT                   /locus_tag="Cpha266_0450"
FT   CDS_pept        497306..497857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT1753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64508"
FT                   /db_xref="GOA:A1BDN1"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDN1"
FT                   /protein_id="ABL64508.1"
FT                   /translation="MKNSTKGGKTLSRLLFVLSFFSAVAQAKPSGTLSETVRVSGLVEK
FT                   PFTISTTSVGTMNVAERENTAIICDSGQTRKSLKSFRGVLLRDILDSAKVVLSNPGQRG
FT                   EYYVLVRSTDNYNVLFSYNELTYGTAGESTWLVFEENGKPIDDDGRFVVFCASDRATGP
FT                   RHVKWVNGIEVSKIILPVSN"
FT   sig_peptide     497306..497389
FT                   /locus_tag="Cpha266_0450"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.911 at
FT                   residue 28"
FT   gene            497883..498281
FT                   /locus_tag="Cpha266_0451"
FT   CDS_pept        497883..498281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0451"
FT                   /product="cytochrome c, putative"
FT                   /note="KEGG: plt:Plut_1538 cytochrome c, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64509"
FT                   /db_xref="GOA:A1BDN2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDN2"
FT                   /protein_id="ABL64509.1"
FT                   /translation="MHRFYLSILLFGFCFLKTEILFAATDNATGQQLFDRHCSVCHSME
FT                   PPPKTAPPVLGIALHYREAFGDKTLATEYMVKFMQKPDPPLSKLEPAAIRRFGLMPPMS
FT                   MSLQELKKVAAWLWDSYDPQFKTPGNCR"
FT   sig_peptide     497883..497954
FT                   /locus_tag="Cpha266_0451"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.655) with cleavage site probability 0.648 at
FT                   residue 24"
FT   gene            complement(498301..499356)
FT                   /locus_tag="Cpha266_0452"
FT   CDS_pept        complement(498301..499356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0452"
FT                   /product="molybdate ABC transporter, ATPase subunit"
FT                   /note="KEGG: cte:CT0450 molybdenum ABC transporter,
FT                   ATP-binding protein; TIGRFAM: molybdate ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; TOBE domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64510"
FT                   /db_xref="GOA:A1BDN3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR011868"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDN3"
FT                   /protein_id="ABL64510.1"
FT                   /translation="MNLLIDAEKKQGDFLLRVNTGVSGERIGIFGQSGSGKSTLVHLIS
FT                   GLLQPDRGEIFLNDECLFSTTKGINLSPERRRIAIVFQQAMLFPHLSVKANLLYGYRRC
FT                   RTENRHIKPETLIALLKLQPLMQRGVNNLSGGEKQRVALGRAVLANPRLLLMDEPLSAL
FT                   DDTLRFQIIPYLKSVSEEFAIPYLFISHSILEMQLMADRILVLKKGSIAETTTPDQLAR
FT                   NCMAHNPKGYLNLLHLADPVLHKGLYAYPWGHNTLLISDGEPSGTSLFELSSRDIILFK
FT                   QHPEAISARNLLKCTVSELFRSDGRVGVVLLSNGEKFVAEIVRSAAEDLNITAGSTLFA
FT                   AIKASSFRRLG"
FT   gene            complement(499353..500039)
FT                   /locus_tag="Cpha266_0453"
FT   CDS_pept        complement(499353..500039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0453"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cte:CT0451 molybdenum ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64511"
FT                   /db_xref="GOA:A1BDN4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDN4"
FT                   /protein_id="ABL64511.1"
FT                   /translation="MTLTPEDIAAIWLSLKVALTATALALPLGFALAWLIVFKRFRGKV
FT                   VLEVLINLPLTLPPVVIGFFLLLLLGKNGWIGKLLDGSGIQIIFTWKAAVIASATVGFP
FT                   LLVRSIRLGMESIDQQLIEASRSLGAAWYDTLATIILPLSLRGIMAGSSLMFARSLGEF
FT                   GATIIVAGNIPGITQTIPLAIYDYASSPSSTTMALSLCVVSVLISVVVLIVHELLGKKL
FT                   DRRSAL"
FT   sig_peptide     complement(499938..500039)
FT                   /locus_tag="Cpha266_0453"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.668) with cleavage site probability 0.599 at
FT                   residue 34"
FT   gene            complement(500076..500825)
FT                   /locus_tag="Cpha266_0454"
FT   CDS_pept        complement(500076..500825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0454"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein, family 1; KEGG: cch:Cag_0413
FT                   molybdenum ABC transporter, periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64512"
FT                   /db_xref="GOA:A1BDN5"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDN5"
FT                   /protein_id="ABL64512.1"
FT                   /translation="MMISMRKTLLLFFALLTISVPAMAGELSLSVAASLKEVINELSAS
FT                   YSKKNPGTTFVKNFGPSGTLAGQIENGAPVDLFIAANNQWMDYLKEKKLVDGANSGMLA
FT                   YNSLVFAGTTTKKVTSMNDLLKLEKIAIGSPKSVPAGEYAMTAFKNAGIDKQLAGKLVM
FT                   AKDVRECLMYAELGEVDGGFVYRTDAMLAQKAKLLFAVPQKLYPRVTYPMALTAKAAQN
FT                   KEAKAFFLYLRGAEAKNVLGKYGFVLK"
FT   sig_peptide     complement(500751..500825)
FT                   /locus_tag="Cpha266_0454"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(500853..501698)
FT                   /locus_tag="Cpha266_0455"
FT   CDS_pept        complement(500853..501698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0455"
FT                   /product="modD protein"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: plt:Plut_1707 putative molybdenum utilization
FT                   protein ModD; TIGRFAM: modD protein; PFAM: Quinolinate
FT                   phosphoribosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64513"
FT                   /db_xref="GOA:A1BDN6"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR006242"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDN6"
FT                   /protein_id="ABL64513.1"
FT                   /translation="MLYQLPDTDIERFIEEDMPYGDLTTSLLGIGNAQGSITFTSRHLT
FT                   VLSCTEEACRVLERCGARVTSSMPSGTSVEAGVMFLSAEGSAASLHAGWKVALNLLEYA
FT                   SGIATRTAAIVNSARAVNPAVSVVTTRKSFPGTKKVAIKAIMAGGAMPHRLGLSESILV
FT                   FRHHTAFQGGLESFLETLSSLKQRAPENRVIVEADTAKEALQIAAAGADVVQVDKMPSE
FT                   ELAILVAGIHRQFPGVKVSAAGGINADNAAIYASTGVDILVLSSVYFGKPSDIAALINP
FT                   "
FT   gene            complement(502390..502815)
FT                   /locus_tag="Cpha266_0456"
FT   CDS_pept        complement(502390..502815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0456"
FT                   /product="Secreted repeat of unknown function"
FT                   /note="PFAM: Secreted repeat of unknown function; KEGG:
FT                   sat:SYN_00648 exported lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64514"
FT                   /db_xref="InterPro:IPR005297"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDN7"
FT                   /protein_id="ABL64514.1"
FT                   /translation="MKKLSILFLALIIVAAATVSASAKCKYPGIEISEKQGVGHYLTDD
FT                   NGMALYWFTKDSPGTSTCAGPCLEKWPAFYHEKFVKPKALSMEEFGTIMRADGKPQLTF
FT                   RGYPLYLFAGDKAAGNTNGQGVNNVWFVVNPGNFPPK"
FT   sig_peptide     complement(502744..502815)
FT                   /locus_tag="Cpha266_0456"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.516 at
FT                   residue 24"
FT   gene            503165..506314
FT                   /locus_tag="Cpha266_0457"
FT   CDS_pept        503165..506314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0457"
FT                   /product="putative signal transduction protein with Nacht
FT                   domain"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   cch:Cag_0856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64515"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDN8"
FT                   /protein_id="ABL64515.1"
FT                   /translation="MADISARVVKILIASPSDIKEERDIAELVIHRLKIQSEDSVRLVL
FT                   EPKRWELDAASEMGLSPQEIINRQMVDECDCAICIFWTRIGTPTEIAPGGAVEELELML
FT                   KREKLVMPYFSDVKVSLSGIDRDQWNRLEEWKKTLVTEKRGFIKSYRDIYEFKEMLTHD
FT                   LEKQLRARFCQPASGGDDTVDKSKKKGSRVIDDSVFRYQTTLKRQLETITLAGSPAFES
FT                   LPVKLSEIFVSLRIANRSTGETSLNGHEEEEAHRSLSPEKIMQQAFKQHNLLLVIGDPG
FT                   SGKTTLLKYYALSCLDDERYKELGFNEPVPVIFLSLRDLVQLDNGYAPLPENLRELFRK
FT                   HSFGRHDEEDLSRWLDDNTTLFLLDGLDEISDTEDRKKVCRWIDDTARRFAKACFVVTS
FT                   RITGYRKSDGIELEFSHFRADIMDFTDSQQEEFLHRWFAAVGEQDVGSSQQANASQTAE
FT                   SIILFLRQSANEGLRTLARVPLLLQIMAILWKNCGYLPNSRTELYDAALNYLLDYRDRQ
FT                   RGKNPLLPKKEARLVLGPVSLWMQESVERDEVGKDAMHRRMQSQLDDLRNPPSAEDFCE
FT                   NLVDRAGLLVEIGDDDYRFCHKTFREYLAGVQLVMEHSDEQLNTLVAHFGDDWWQEPLR
FT                   FFMAHVDAKLFDAFMQRLFASPVSKTLTPKQQSLLKLLVEEASGRKIDALKSKLHDPNT
FT                   VSDRKTDDDLKEADNQKRYVLECLKTIGSPEAIAAIREFVHAEPKLTGDREIIRLAARI
FT                   SGDLVDDAPADIGATIPRKDIPSVLQSSHEQNAHYILIKGGSFIYSVTKKAQQVSDLYV
FT                   ATYTVTNALYRRFITFLQTGVVPGFDHLPVSVFSDALHELASRHETKGFTEYLKEKSDP
FT                   AERFRSPYDDDKQFNGDDQPVVGVSWYDATAYCLWLSLMESKGVDAKRYRLPSEIEWEW
FT                   AAGGRRDMPRKLLKVRSYPWGEEEPSPQRANFNLNEGQTTPVGRYPEGATPEGLYDMAG
FT                   NVWEWTNSWYDEVKKESFSLRGGSWGNKSANLSCSARVVVNPDLRNGVIGFRVVRPSHL
FT                   L"
FT   gene            506372..506692
FT                   /locus_tag="Cpha266_0458"
FT   CDS_pept        506372..506692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr3496 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64516"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDN9"
FT                   /protein_id="ABL64516.1"
FT                   /translation="MLIVKRAYDFSKWLLHHTGKFPKSYRFTVAVRLENAVLEFTELVA
FT                   VANRRHHKEPLLKEADEVLVRLRLLVRLSFDMQFINENSYEYASRQIAELGKMLGGWLK
FT                   KL"
FT   gene            507049..508080
FT                   /locus_tag="Cpha266_0459"
FT   CDS_pept        507049..508080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr3497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64517"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDP0"
FT                   /protein_id="ABL64517.1"
FT                   /translation="MKTEKNLFESVTAFENVLSAARNAAKGKRETRSVLLFYAQLEDNL
FT                   WQIIAELKSKTWQPGSFKSFSIYKPKPRLISAAPFRDRVVHHALINVVGPLLEQTFIHD
FT                   TYANRMGKGTHKAIRRYQHFLCRFDYALKCDIKKYFPSVDHEILKTSLRRRVACNDTLW
FT                   LIDTIIDNSNSQDDHLHYFQGDDLFTPVERRKGLPIGNLTSQFFANYYLNFLDHFVKER
FT                   LHCKGYVRYVDDFVLFSDSRAELWRWKEEIERYLEEFRLVLNAQRTELFPTTEGRCFLG
FT                   QKVFQSYRLLPAENVRRAKKRVQASDVANPAAMKKMHSGWIGHARQANTGNLLHAMGLD
FT                   KHR"
FT   gene            508115..511012
FT                   /locus_tag="Cpha266_0460"
FT   CDS_pept        508115..511012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0460"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; NACHT
FT                   nucleoside triphosphatase; KEGG: cch:Cag_0856 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64518"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDP1"
FT                   /protein_id="ABL64518.1"
FT                   /translation="MMYARFFMTFLVALCMAANTAGVAYGEQGERKVGGQVAENAGAPV
FT                   VQNVLRERAVTRESGLPESHEDTAEKNFLDYVPAAALVALLVGVGIPIYRRWEKKHKDR
FT                   LQEKRYRSSLHEELCWIRMPGLPGGIESIQVNLDDDTFVQLRFSESSSEGEPSMSDDLL
FT                   KQRNELSAERLPHEIIQRAFTSNRRLLLVLGDPGAGKTTLLQYYALCALDQKRYRKLGF
FT                   TKPPKVFYLPLRELTNHGSTLPENLSQHAKKWYQQDIDSRIIDKWLQNETVTSLVLLDG
FT                   LDEISDTVKRQEACKWIDRILTGFQHVHIVVTSRRTGYGREDALKPQVVLTSDHKRASV
FT                   QDFSREQQELFLKNWFNAAFLREERPDNVDEKIWKEQQLAKAKNRSDRIIAVLKEEKHK
FT                   ALRQLAAVPMILQLMALLWKNNEFLPGSRMELYHSVLNYMLELRDKQKEIDSQLSAERA
FT                   RKVLAPVALWMQEELKQDEADKQLMQKQMQQWLDTLVDRQYVPPTADDFCDHLVLRAGL
FT                   LAKIGESRYVFRHKSFREYLASIELVKKTLRSTCYIDTLISSFGDPWWNEPMRFFIAQT
FT                   DAVQFDCFMDKLVASVGEEEFSPDKMPLLYTLIEEAPQKKVQALSERLLAEATTASCQR
FT                   VILDCLNAIGQPIALETLQSFVNLKRAKNSSVASRAEEVMLALLPAAGVTSSSGSAADA
FT                   HSENSGSYRNRFEQYAEYIRIPGGSFRYSVTGGIENVSELRVARYPVTNKRYRAFISYL
FT                   QSRKPEDEALNKFYRKVLGEIARDHTWDSGFSDYYHKGSKDLAGLFRSKLDEDRKFGGD
FT                   DHPVVGVTWYAAKGYCLWLSLLESEGRERQLYRLPTDLEWEFAAAGEEGRNYPWGNEEP
FT                   TPQRANFNENIGATTPVENYPEGATPEGLYDMAGNVWEWTNSWYDEVKKESFSLRGGSW
FT                   LNLSANLSCSARIFVNPVSRNYGFGFRVVRPSHLL"
FT   sig_peptide     508115..508195
FT                   /locus_tag="Cpha266_0460"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.681 at
FT                   residue 27"
FT   gene            511666..512001
FT                   /locus_tag="Cpha266_0461"
FT   CDS_pept        511666..512001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0461"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: cte:CT1728
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64519"
FT                   /db_xref="GOA:A1BDP2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDP2"
FT                   /protein_id="ABL64519.1"
FT                   /translation="MQRSLSVVEYSGNEEALAGIAKALGHPVRIRILRLLSKEACCFTG
FT                   ELTELIPMAQSTISQHLKALLESGLIQGEINPPKVRYCINRESWRKAQLLFGDFFGEES
FT                   GVGRGQC"
FT   gene            512217..512453
FT                   /locus_tag="Cpha266_0462"
FT   CDS_pept        512217..512453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0462"
FT                   /product="redox-active disulfide protein 2"
FT                   /note="TIGRFAM: redox-active disulfide protein 2; KEGG:
FT                   cch:Cag_0399 redox-active disulfide protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64520"
FT                   /db_xref="InterPro:IPR005243"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDP3"
FT                   /protein_id="ABL64520.1"
FT                   /translation="MKRVKVLGSGCAKCGQLMDAVKAVIAAEGLDASVEKVEDMQQIMA
FT                   YQVLSTPALVVDEVVLSRGRVPSRDELKDLLTR"
FT   gene            512465..512863
FT                   /locus_tag="Cpha266_0463"
FT   CDS_pept        512465..512863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0463"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: plt:Plut_0533
FT                   rhodanese-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64521"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDP4"
FT                   /protein_id="ABL64521.1"
FT                   /translation="MKQVVDVCPTTALGMIERGALLVDVREPDEVAGASFAIPDVMLVP
FT                   FSEFEERFREIPVERDLIIGCMVGERSLRAASFLMHHGYERVFNMQDGIVRWAEKGYPL
FT                   RGSLTGTSHACCCGGTSHGAANNGGKCC"
FT   gene            512914..513966
FT                   /locus_tag="Cpha266_0464"
FT   CDS_pept        512914..513966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0464"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: cte:CT1726 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64522"
FT                   /db_xref="GOA:A1BDP5"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDP5"
FT                   /protein_id="ABL64522.1"
FT                   /translation="MNRFQNHVPERSALLWFAGVAAAALLWLFLYSNLQVFADLFLLAA
FT                   GLGRSDRFGEAVHFFVFEVPKVLLLLIAVVFLMGVVHTFVSPERTRALLSGRRTGVGNV
FT                   MAASLGVVTPFCSCSAVPLFIGFLQAGVPLGVTFSFLISAPMVNEVALALLFGMFGWQV
FT                   ALLYMAMGLLVAIVSGLVIGRLRMERYLEEWVQKLQESGVSVDVENEVMRWPLRFREGV
FT                   NHVREIVGKVWFFIVLGVGLGAGIHGYVPENFMAALMGSEVWWSVPLAVVIGVPMYSNA
FT                   AGILPVVQALLGKGAALGTVMAFMMSVIALSLPEMIILRKVLRPQLIAVFAGVVAAGIM
FT                   LVGFVFNAVF"
FT   sig_peptide     512914..513030
FT                   /locus_tag="Cpha266_0464"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.912 at
FT                   residue 39"
FT   gene            513997..514425
FT                   /locus_tag="Cpha266_0465"
FT   CDS_pept        513997..514425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0465"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: cte:CT1725 arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64523"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDP6"
FT                   /protein_id="ABL64523.1"
FT                   /translation="MKQSILILCTGNSCRSQMAEGFLRSFDPELEVFSAGTSPASSVHP
FT                   LAVQVMREEWIDISGNRPKLVDEFLQRPFDYVVTVCDGAKESCPAFTGTVKNRVHIGFD
FT                   DPAGATGSREEQLDVFRRVRDEINTRFRQFYNETEKGE"
FT   sig_peptide     513997..514056
FT                   /locus_tag="Cpha266_0465"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.755) with cleavage site probability 0.752 at
FT                   residue 20"
FT   gene            514430..515491
FT                   /locus_tag="Cpha266_0466"
FT   CDS_pept        514430..515491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0466"
FT                   /product="arsenical-resistance protein"
FT                   /note="TIGRFAM: arsenical-resistance protein; PFAM: Bile
FT                   acid:sodium symporter; KEGG: cte:CT1724 arsenite efflux
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64524"
FT                   /db_xref="GOA:A1BDP7"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDP7"
FT                   /protein_id="ABL64524.1"
FT                   /translation="MGMSTKQLSFLDRYLTLWIFLAMGIGVLWGYLFPGIAGFWNHFQR
FT                   GTTNIPIAIGLIVMMYPPLAKVKYEELGDVFRNTRVLGLSLLQNWVVGPLLMFVLAVIF
FT                   LSDMPHYMAGLIMIGLARCIAMVIVWNELAKGDTEYAAGLVAFNSIFQVLFFSLYAWVF
FT                   LTVLPEWLGMTTVAVDITIGEIAGSVFIYLGIPFIAGFLTRFFLLRLKGREWYEGEFIP
FT                   RISPLTLISLLFTIVVMFSLKGEYIVTIPMDVVRIAIPLLIYFVIMFLLSFYMARKAGA
FT                   DYPKTATLSFTAASNNFELAIAVAVSVFGINSGEAFAAVIGPLVEVPALIALVNVSLWF
FT                   RGRFFATQESGFQ"
FT   gene            515696..517575
FT                   /pseudo
FT                   /locus_tag="Cpha266_0467"
FT   gene            517656..518948
FT                   /locus_tag="Cpha266_0468"
FT   CDS_pept        517656..518948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0468"
FT                   /product="sulfide dehydrogenase (flavocytochrome),
FT                   flavoprotein subunit"
FT                   /EC_number="1.8.2.-"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: cch:Cag_1921 twin-arginine
FT                   translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64525"
FT                   /db_xref="GOA:A1BDP8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015323"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037092"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDP8"
FT                   /protein_id="ABL64525.1"
FT                   /translation="MRQQVSRRDFNKLLLSGLAGSALGALAPFQRASAVSKRVIIIGGG
FT                   FGGAAAAKYLRKLDPSIAVTLIEPKAVYYTCPFSNWVIGGLRRIEDIAQTYTVLRNRYQ
FT                   VTIIGDVAVALDPLRSTVRLKSGKVLNYDRLIVSPGIDFKWDAIEGYSQSVAESRMPHV
FT                   FQGGAQTVLLRKQLVSMKDGGTVLVCPPGGQFRCPAAPYERASLMAYYLKQHKPKSKII
FT                   ILDDKEKFSKQELFMQGWDRRYPGMIEWRSAAAGGKVSAVHAAAMTVSTEFGDEKGAVI
FT                   NVIPPQKAGKIAFDGGLTDASGWCPVNPVTFESTIHPGIHVIGDSALAGAMPKSGFAAS
FT                   SQGKVAAAAIVNLFQGRVPSSPTLVSTCYSLIGPAYAISVAGVYRLGVDGIVEIKGAGG
FT                   LTPLDADNDHLKEEADYAAGWYDNISRDNWG"
FT   sig_peptide     517656..517760
FT                   /locus_tag="Cpha266_0468"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.563 at
FT                   residue 35"
FT   gene            519388..519960
FT                   /locus_tag="Cpha266_0469"
FT   CDS_pept        519388..519960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0469"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   cch:Cag_1928 thiol:disulfide interchange protein,
FT                   thioredoxin family"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64526"
FT                   /db_xref="GOA:A1BDP9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDP9"
FT                   /protein_id="ABL64526.1"
FT                   /translation="MIKQFGVMIPSRTVAFALCIALCTVICQPLLAGAAEKRDKAALKV
FT                   TSAPGFAARSVQGAPISSDKLRGKAYIVNFFGSWCPVCRKELPDMVALQEKYEKKGFTF
FT                   IGMAYKDNAQSLPDFIWEHSINYPVVVADQTIVTAFGRQISGGLRAVPALFAVNSEGKL
FT                   LSVVVGAQSKAAFEELILNTLASGKKK"
FT   sig_peptide     519388..519486
FT                   /locus_tag="Cpha266_0469"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.752 at
FT                   residue 33"
FT   gene            complement(520137..520394)
FT                   /locus_tag="Cpha266_0470"
FT   CDS_pept        complement(520137..520394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64527"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDQ0"
FT                   /protein_id="ABL64527.1"
FT                   /translation="MNKKTTKALTLAAAVTSLGASLGVVTRHAEARTTLSQGTADTLRQ
FT                   SDQIKLSNQQKLSTQGKISTQSKTHVQTGTSNQIKWQNSK"
FT   sig_peptide     complement(520305..520394)
FT                   /locus_tag="Cpha266_0470"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.797 at
FT                   residue 30"
FT   gene            complement(520419..521084)
FT                   /locus_tag="Cpha266_0471"
FT   CDS_pept        complement(520419..521084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0471"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   dvu:DVU0143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64528"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDQ1"
FT                   /protein_id="ABL64528.1"
FT                   /translation="MIPVLRTKLDRQTPFGFSCKQCLQCCTAKKIQVNPYEIARLARNL
FT                   DISTTAFIARYTVHNGSFLQTTHNKTCLFLGAEGCLVHADRPLVCRLYPLARHVNHKGD
FT                   EWFSELQPEQGCRGIHKKTGTIENYLEEQGATPYMLAANSYLNLLWEMMTILESTTQDD
FT                   KDGTEEPENTMVENGQLMDMDAALNIYCQERELRVPRSVEKKMQMHLEALYLWTKEKP"
FT   gene            complement(521178..521363)
FT                   /locus_tag="Cpha266_0472"
FT   CDS_pept        complement(521178..521363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64529"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDQ2"
FT                   /protein_id="ABL64529.1"
FT                   /translation="MLNKITKNYRKTEQYGGLHEWPEFLQAGWLHQAEIVQRDKPKDMA
FT                   LKKNFSVEKERPEKKN"
FT   gene            521449..522165
FT                   /locus_tag="Cpha266_0473"
FT   CDS_pept        521449..522165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0473"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cch:Cag_0264 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64530"
FT                   /db_xref="GOA:A1BDQ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDQ3"
FT                   /protein_id="ABL64530.1"
FT                   /translation="MGTTMFRLEHIRRELALSRDVRQTIIPDLSLEIEAGEFVAITGPS
FT                   GSGKSTLLYMMGGLDKPTFGNVWLDGEELTEKDESEMNRIRNEKIGFIYQFHFLLPEFT
FT                   ALENVSMPMMINGRFNKKEIKDRAKMLLDTVGLENKYTNKPSQLSGGQQQRVAIARALA
FT                   NEPKVLLGDEPTGNLDSKSAKNVYELFDRLNQEKNQTIVVVTHDEDFANRAGRRIHLVD
FT                   GMIESDSPLRVMAGRS"
FT   gene            522244..523782
FT                   /locus_tag="Cpha266_0474"
FT   CDS_pept        522244..523782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64531"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDQ4"
FT                   /protein_id="ABL64531.1"
FT                   /translation="MSSLLLQIKESYPMVYEAFSALPDGERHLRGIMELDRYWEHLHQP
FT                   VPEVVKPGSELPEGVEVNGDFDLIYAGGTLSLLHAAVMARQYDRKVLVFDRHTPAQSTR
FT                   DWNISRGELLKLADTGVFSLSELESVILRAYKTGWVEFYKPDGSQKRLYIRNVLDCAVD
FT                   ADLLLSMAREVVLSMPENRVLSQTSFTACYRFADHIVVEVTDSEGKSYHYRGKVLVDMM
FT                   GVRSPVAMQLNEGAPQTHVCPTVGTIASGFMDADFDTGEILASIAPADIASGTGKQFIW
FT                   EGFPAKGSEYITYLFFYDEVDSQNDKSLLGLFETYFRTLPEYKKIGPDFSIHRPVYGII
FT                   PAYFHDGFSRTREIADDRIILFGDAASLGSPLTFCGFGSLVRNLHHLTADLDLALDSNA
FT                   LSKKDLEKISAYEPNVASMANLMKYMCFNAETDEPNFVNDLMNEVMVVLDELPERYRQA
FT                   MFRDEMKIEELVVVMLRVAWRYPKVLKATWDKLGVAGSTGFLKNLVGWVFSSAR"
FT   gene            523801..525831
FT                   /locus_tag="Cpha266_0475"
FT   CDS_pept        523801..525831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0475"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: plt:Plut_1699 DNA ligase (NAD+); TIGRFAM: DNA
FT                   ligase, NAD-dependent; PFAM: helix-hairpin-helix motif;
FT                   BRCT domain protein; zinc-finger, NAD-dependent DNA ligase
FT                   C4-type; NAD-dependent DNA ligase, OB-fold; NAD-dependent
FT                   DNA ligase, adenylation; SMART: Helix-hairpin-helix
FT                   DNA-binding, class 1; NAD-dependent DNA ligase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64532"
FT                   /db_xref="GOA:A1BDQ5"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDQ5"
FT                   /protein_id="ABL64532.1"
FT                   /translation="MSDAVNVRKAIEELRREINRHNTLYYVDARPEISDYEFDRLMERL
FT                   IELEKAFPDFVTPDSPSHRVGGAITREFPSVRHREPMLSLSNTYSLAEVEDFYSRVKKL
FT                   LLVEGVREQDMAAELKFDGVAISLLYRDGLLVQGATRGDGTEGDDITTNLKTLSSVPLR
FT                   IPLTSLPVIEGIERDIEIRGEVFMQKDDFARLNEARPEEDRFANPRNATAGTLKLQDSG
FT                   EVARRRLNFVAYYLRLSSQDSFLLTQYDRLELLGQLGFFTGKHYRLCRDMKEIGDFIGY
FT                   WAVERWNLPYETDGVVLKLNDVALWPRIGATAKSPRWAIAYKYPAQQAKTVLQGVAFQV
FT                   GRLGTVTPVAELEPVRLAGSTVSRSTLHNFDEIERLGLMLHDRVIIEKSGEVIPKVIRV
FT                   VLDERPENAEPVGVPSVCPECGASLEKPENEVSYYCPDQDSCPAQIRGRLLHFASRNAL
FT                   DIQSLGESLVAQLVQKGLVRDAGDLYLLQQPQLEALERMGRKSAHNLLRALQESREKSY
FT                   ERLLYALGIRHVGQATARELARAYETVEALQNASEEELATVPDVGPVVAHSVKDYFSKS
FT                   STQMLLRKLRDAGFPLRFTGPQKLINRNFEGVNVLFTGALERYGRQQASELVQQRGGRV
FT                   VGSVSRSTGVVVAGSEPGSKLDKARKLGVKVISEDEFNAML"
FT   gene            525843..526499
FT                   /locus_tag="Cpha266_0476"
FT   CDS_pept        525843..526499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0476"
FT                   /product="conserved hypothetical protein 730"
FT                   /note="PFAM: conserved hypothetical protein 730; KEGG:
FT                   cte:CT0458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64533"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDQ6"
FT                   /protein_id="ABL64533.1"
FT                   /translation="MDAYYRVAMFGSARIQEGDQDYRDVFHIAKGLAEAGFDIVTGGGP
FT                   GLMQAANAGSKSAQSGSYSIGLNIRLPREQGPNAFLDIKGEFDRFSSRLDTFMALSDAV
FT                   VVAPGGIGTLLELFYAWQLVQVEHICDTPIILYGEIWTSLLLWLETEVMPRHFFNKADM
FT                   HMLFHVMDPVHVVELVKKIHKDKLQDEHPCKNFSKYRRALQSVNGTNSGNFTSLL"
FT   gene            526577..526879
FT                   /locus_tag="Cpha266_0477"
FT   CDS_pept        526577..526879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT1515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64534"
FT                   /db_xref="GOA:A1BDQ7"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDQ7"
FT                   /protein_id="ABL64534.1"
FT                   /translation="MTPATCDFGVTIQDKVLHFLAFYLLSLLVDFAFPKTPFGAVKIMG
FT                   LLGYGLAIEIAQSFMPYRCCSLYDLLADVCGIALYLISIPLWKHVPLLRERWEEE"
FT   gene            complement(527206..527964)
FT                   /locus_tag="Cpha266_0478"
FT   CDS_pept        complement(527206..527964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0478"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferases; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   cte:CT0462 ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64535"
FT                   /db_xref="GOA:A1BDQ8"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDQ8"
FT                   /protein_id="ABL64535.1"
FT                   /translation="MTFTEKKADMLMSHPKETAKSLNQTKSRSSIREMFDEVAPTYDFL
FT                   NHLLSLGIDNYWRAAATGRAKKLLKNVPQPRILDVATGTGDLAASIAKLPGAKVTGLDL
FT                   SPEMLELARKKYPAITFLEGYAEKLPFDTASFDAVSAGFGVRNFENLQQGMSEFHRVLK
FT                   PGGYTFIIEPMIPRNPLMKKLYLIYFKKVLPKIAALFSKSTFAYDYLPHSVEQFPQAEA
FT                   FSEILKKAGFRAVSYFPMTFETSILYVAGK"
FT   gene            complement(527939..528352)
FT                   /locus_tag="Cpha266_0479"
FT   CDS_pept        complement(527939..528352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0479"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="PFAM: phosphoribosyl-AMP cyclohydrolase; KEGG:
FT                   cte:CT0463 phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64536"
FT                   /db_xref="GOA:A1BDQ9"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDQ9"
FT                   /protein_id="ABL64536.1"
FT                   /translation="MSENEDLQKSFLDTVKYDEKGLVPAIVQDHETGKVLMMAWMNHES
FT                   LLMTLEKKKACYWSRSRQKLWLKGESSGNMQDVHDILIDCDGDTILLKVSQKGGACHVG
FT                   YHSCFYRKVKETLDMEICDTLMFNPDDVYGKKS"
FT   gene            528519..529610
FT                   /locus_tag="Cpha266_0480"
FT   CDS_pept        528519..529610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0480"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: cte:CT0464 membrane fusion protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64537"
FT                   /db_xref="GOA:A1BDR0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDR0"
FT                   /protein_id="ABL64537.1"
FT                   /translation="MQTLQKVLPKYTIALALVFFVTVAYLLTRGNTVDVEAGEVTYAEL
FT                   VQAIYATGFVEAEAVANLSSELSGTVNYIGALEGQQVTAGQTIISLDNAQPGISVREAQ
FT                   AAFLEQQAVNQEKTMKYSRARNLFREGALARQDLDEAKRISSQAEELLEQKRLQLKSRE
FT                   DELKKIAITAPFAGVLTLQSVKKGDYVTANMLVARVVDTSKYVVSVEIDELDVPRIRPG
FT                   QAAVVVLDALPTERYDAVVSRIVPQTDTITKTSRVYLTFRKAVTGIQAGMTITANIVYH
FT                   IKPHTLLVRKSSVFDDNHKSYVWEIEKGKLKKQLIVTGASDLTFVEVLSGLQQGDRVAL
FT                   LPEERFREGMDANVLVAKAGKAE"
FT   gene            529662..530669
FT                   /locus_tag="Cpha266_0481"
FT   CDS_pept        529662..530669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0481"
FT                   /product="ferrochelatase"
FT                   /note="PFAM: ferrochelatase; KEGG: plt:Plut_0103 protoheme
FT                   ferro-lyase (ferrochelatase)-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64538"
FT                   /db_xref="GOA:A1BDR1"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDR1"
FT                   /protein_id="ABL64538.1"
FT                   /translation="MGEKKTIAVVLVAHGEAETSGFLENYRVSRHTLEHAARVMPIAKP
FT                   LQTLISLSSSLKKKIRPGNSGKGSPQNGITRKQAEVLQNHLDVLSDETDLAFRVIAAFS
FT                   ASPPFMENIIEETRAFDGQILVNMSPMDNSLTCGLLCGYIADTYTGPELTKVKVISGFW
FT                   RDENLYALYLSHLFEQIAMRPVVEHENRVLLLLFHGTLVADAKGRPPAFRTGHEEVVVF
FT                   SESIRSAVVKDVRNPYSEVLVAYLNHEVGGEWTKPSFEQVCRQLRQSGARRIDLFAGGY
FT                   FADGNETIYRAGELAALAETANVVSFPCVNALPAFGRYLAHKIFNTAEQLVTLM"
FT   gene            530847..531710
FT                   /locus_tag="Cpha266_0482"
FT   CDS_pept        530847..531710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0482"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; RNA binding
FT                   S1 domain protein; KEGG: dra:DR1997m hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64539"
FT                   /db_xref="GOA:A1BDR2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDR2"
FT                   /protein_id="ABL64539.1"
FT                   /translation="MDIKRAAVYIDGANLFFTQRSLGWQIDFSRLITFFLDRYASVEAR
FT                   YYVPVSEPASEEQAAFTRVLAAHGYILTSKPVKKIVNKTTGEIIIKGNLDVELAVDALV
FT                   GEIAYDTFILFSGDSDFLPLLRALKEKGKEVLVYSTEGISAWELLIEPGIDFHDLAGLR
FT                   DRIGHAKPGEGGRRETGGQALQQENAFLRLPVVGEVFTGTVLSVKSYGVFLANTYHAKC
FT                   LLPLSFLGISRHITDLTEVVRMADVFDVVVFKVDTSHEVPEITVKLADKEKSHELSERV
FT                   AGSPLS"
FT   gene            531800..532246
FT                   /locus_tag="Cpha266_0483"
FT   CDS_pept        531800..532246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0483"
FT                   /product="protein of unknown function DUF1499"
FT                   /note="PFAM: protein of unknown function DUF1499; KEGG:
FT                   ana:all1003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64540"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDR3"
FT                   /protein_id="ABL64540.1"
FT                   /translation="MDMLNDLFSGVTAMMRGLWPQLQEKPCLINGKLRFCPGSPNCVSS
FT                   ESGSPGEKVDPLEFTGSSADAWLRLKGLIVESGGVIEDEQPEFLWSTFTVPVFGFVDDV
FT                   EFRLDRAANLIHVRSASRLGFSDLGVNRSRVDQLREAFGKVRKN"
FT   gene            complement(532296..533018)
FT                   /locus_tag="Cpha266_0484"
FT   CDS_pept        complement(532296..533018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0484"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gsu:GSU1281 cobalt ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64541"
FT                   /db_xref="GOA:A1BDR4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDR4"
FT                   /protein_id="ABL64541.1"
FT                   /translation="MISIQNLSFTYPDGTTALLNITIDIPNNSSTGIVGANGAGKSTLV
FT                   NHFNGYFLPQTGSISIEKDVINKKNLDVIRKKVGLVFQNPDDQLFTARLYDDIAFGPEN
FT                   LGMPPTEIARVVEASLRDINLWELRDKPPSHLSQGQKRFAAFAAVLVMNPTILVMDEPT
FT                   SDLDPGNRRKLITLVNSLVKTKITVSHDLDFIWDTCQRVCLMNNGRIVADGPTGKILGC
FT                   RELLEANNLELPLRLQDL"
FT   gene            complement(533031..533801)
FT                   /locus_tag="Cpha266_0485"
FT   CDS_pept        complement(533031..533801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0485"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: gme:Gmet_2440
FT                   cobalt ABC transporter CbiQ, permease subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64542"
FT                   /db_xref="GOA:A1BDR5"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDR5"
FT                   /protein_id="ABL64542.1"
FT                   /translation="MTNRVTRFFPCNANEKQNPEKGALLLGSDRSALLITGIFTLFVVS
FT                   IPKFDLNGVIAFGAFPLFMMIATGISFTTVLKKILLLSPFVLFMAAGNMLLDRTPVITV
FT                   EGITITGGLLSGSVIVAKTIITVTALLCLGLSIPFYRLFKALGELRVPEVLVTQLILLY
FT                   RYSSVLGEEAISMQKGRAMRSFKGRGKGVFSTANLLGSLLLRTTNRAERLYRGMFARGF
FT                   DGRIARYRPTATSNLERLALSVWSLVFIALRLVF"
FT   gene            complement(533801..534814)
FT                   /locus_tag="Cpha266_0486"
FT   CDS_pept        complement(533801..534814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0486"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein; KEGG: gsu:GSU1279 cobalamin biosynthesis protein
FT                   CbiM, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64543"
FT                   /db_xref="GOA:A1BDR6"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR025937"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDR6"
FT                   /protein_id="ABL64543.1"
FT                   /translation="MHMSDALLSPIVGGAFWIISGTLIGYSAKKIIEENDHAKTPLMGV
FT                   MGAFIFAAQMINFSIPGTGSSGHLGGGLLLAALLGPYRAFITLSSVLIIQSLFFGDGGL
FT                   LALGCNMFNLAYFPAFLAYPLIFRKIIGNNPSQQRLAAGSISAAIAGLLMGAFSVVIET
FT                   VLSGISELPFGSFMLFMMPIHLAIGIVEGLVTWAVLSFVAKTDPALLPSNQNAARPRAA
FT                   ILGVLTIAALLTGGVLSWFASSSPDGLEWSISRTSGSEELLNRGEPIHELLGSIQEKTA
FT                   FLPDYSFKTADATSPSGDSPVNPAATVSGLAGSFSVLIMAGLAGLILAKKRTRGNH"
FT   gene            complement(534939..535730)
FT                   /locus_tag="Cpha266_0487"
FT   CDS_pept        complement(534939..535730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT0471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64544"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDR7"
FT                   /protein_id="ABL64544.1"
FT                   /translation="MLKKSIFLVTALLFGEPAFAAHPLITDDAGTQGKGHVQLEINSEF
FT                   SRNRETEKGTGIRETGSEITAALSYGLSETIDLVVGLPFVWYKIEENGITVADESGIGD
FT                   ISLEMKWRMYESKDGNFSLALKPGLSLPSGNENKGLGSGKVSGGVVLIATKEGQLGAIH
FT                   GNIGFTHNEYKLEEESDNTRKDIWHASLAAEINLAENLRGVANIGIETSDEPHAENHPA
FT                   FLLGGLIYSLSDDLDLDLGIKTGLNDAETDTTLLAGIAARF"
FT   sig_peptide     complement(535668..535730)
FT                   /locus_tag="Cpha266_0487"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(535856..536260)
FT                   /locus_tag="Cpha266_0488"
FT   CDS_pept        complement(535856..536260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0488"
FT                   /product="transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: cte:CT0472 CopG family transcriptional
FT                   regulator, nickel-responsive regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64545"
FT                   /db_xref="GOA:A1BDR8"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDR8"
FT                   /protein_id="ABL64545.1"
FT                   /translation="MSEIYRFGVSLDKSLIEAFDRHIQSRHYHNRSEALRDLIREELVR
FT                   KKWTEGGTVAGAVIMTYDHHKRELVNRLLDIQHDFQKTIIASSHVHLDHDHCLEVIAVK
FT                   GNAADVEQLSLKLKSLVGVKHLSLSISSAE"
FT   gene            complement(536306..537754)
FT                   /locus_tag="Cpha266_0489"
FT   CDS_pept        complement(536306..537754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0489"
FT                   /product="sulfide dehydrogenase (flavoprotein) subunit
FT                   SudA"
FT                   /EC_number="1.8.1.-"
FT                   /note="TIGRFAM: glutamate synthase (NADPH), homotetrameric;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: plt:Plut_1693 glutamate synthase
FT                   (NADPH), homotetrameric"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64546"
FT                   /db_xref="GOA:A1BDR9"
FT                   /db_xref="InterPro:IPR006004"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDR9"
FT                   /protein_id="ABL64546.1"
FT                   /translation="MNEKTISNKERLAIPRQKMPAQDPNERVTNFREVNLGYTPELARM
FT                   EALRCIQCKDPVCIAGCPVNIKIDQFIKMVADGDFLGAAKKIKEDNVLPAICGRVCPQE
FT                   DQCEKVCVIGKKHEPVAIGHLERFVADYERQTGHVEIPEVKPPTGKKIAIIGSGPAGLS
FT                   CANDLVRLGHEIVVFEALHELGGVLMYGIPEFRLPKEIVRQELDGLKQMGVSFQTNVVV
FT                   GRSVTIDELIEEEGFNAVFIGVGAGLPWFMGIPGENLAGVLSANEFLTRVNLMKAYDFP
FT                   ESDTPVFQCKNRNIAVFGGGNTAMDAVRTAKRLGAEHAYIIYRRSEAEMPARHEEIHHA
FT                   KEEGVEFLLLMNPIAFIGNDQQQLTGVRCLRMELGEPDDSGRRRPVPIEGSEFLLPLDM
FT                   AVISIGNGSNPLIKQTTPDIEVSKRDTVVVDINTMATSKNMVYAGGDIVTGGATVILAM
FT                   GAGRTAAKAIHEKLMGESHGFDEW"
FT   gene            complement(537873..538718)
FT                   /locus_tag="Cpha266_0490"
FT   CDS_pept        complement(537873..538718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0490"
FT                   /product="sulfide dehydrogenase (flavoprotein) subunit
FT                   SudB"
FT                   /EC_number="1.8.1.-"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   cch:Cag_0538 hydrogenase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64547"
FT                   /db_xref="GOA:A1BDS0"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDS0"
FT                   /protein_id="ABL64547.1"
FT                   /translation="MYTIVSAIFLAENIKKIEIEAPRIAKKRKAGQFVMIRVSETGERV
FT                   PLTIADADPEKGTITLIVQGMGKSTRELNQKKAGDSISDIVGPLGTPSHIENFGTAISI
FT                   GGGVGTAIAYPTAVALKEAGNYVITINGARSKELVVLEHEMQAVSDEAYITTDDGSYGF
FT                   HGFVTQKLQELIDSGRRIDYVLAIGPIPMMKAVAEVTRPYNIKTVVSLNPIMIDGTGMC
FT                   GGCRVTVDNQIKFACVDGPEFDAHLVDFKNLSDRNRVYLPEEKKSEEAFTHKCRIEKQG
FT                   "
FT   gene            538882..539487
FT                   /locus_tag="Cpha266_0491"
FT   CDS_pept        538882..539487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0491"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisH"
FT                   /EC_number="2.4.2.-"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: plt:Plut_1691 imidazole
FT                   glycerol phosphate synthase, glutamine amidotransferase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64548"
FT                   /db_xref="GOA:A1BDS1"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDS1"
FT                   /protein_id="ABL64548.1"
FT                   /translation="MVFIADYGAGNLRSVQKAFDYLGVNSVVSSDPGKLVGCKKVLLPG
FT                   VGAFGQAIDSLNRSGFTDAVREHVDKGGHLLGICLGMQLLLSESEEMGSHSGMNLVPGK
FT                   VRHFRSATDKIPQIGWNSIQMQKESLLFRGMPDGSFFYFVHSYYCEPEDNDAVAAVTWF
FT                   AGNNFCSAIEKNGIFAVQFHPEKSSEAGLQVLKNFAGC"
FT   gene            539510..540280
FT                   /locus_tag="Cpha266_0492"
FT   CDS_pept        539510..540280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0492"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="KEGG: plt:Plut_1690
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase; TIGRFAM:
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase; PFAM: histidine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64549"
FT                   /db_xref="GOA:A1BDS2"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDS2"
FT                   /protein_id="ABL64549.1"
FT                   /translation="MLIIPAIDIKDGRCVRLTRGDFNQQKIYLDNPCDMAIIWRKQNAK
FT                   MLHVVDLDAALTGEMVNFLKIEQIVRELDIPLQVGGGIRSLDAVKRYLDIGVGRVVIGS
FT                   AAVTNPGLIEEVLKIYRPSKIVVGIDAENGIPKIKGWTESCGMKDYELGLEMKQMGIER
FT                   VVYTDISKDGMMQGFGYESTKRFAEMTGMKVTASGGVTSSDDLMKLVGLQQYGVDSVII
FT                   GKALYECNFPCQELWYNFEEDICIDHNFSTARKK"
FT   gene            540334..540942
FT                   /locus_tag="Cpha266_0493"
FT   CDS_pept        540334..540942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0493"
FT                   /product="condensin subunit ScpB"
FT                   /note="TIGRFAM: segregation and condensation protein B;
FT                   PFAM: chromosome segregation and condensation protein ScpB;
FT                   KEGG: plt:Plut_1689 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64550"
FT                   /db_xref="GOA:A1BDS3"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDS3"
FT                   /protein_id="ABL64550.1"
FT                   /translation="MAPEEDIVLKQQVEALVFASEEAVTLSTIRHIIGCSLGLAGLDAI
FT                   VEQLNSEYASSGRSFRIRKIAGGYRFFSESEFDALLKKLMAPKIRKRVSQSMLEVLAVI
FT                   AYQQPVTKAEILQVRGVSPDYSLDRLLERGFIEVRGRADSPGKPLQYGTTKEFLDLFSL
FT                   FSLRDLPKLREIEEIIQENEEQEYLASRGGDKDYNGRND"
FT   gene            540958..541689
FT                   /locus_tag="Cpha266_0494"
FT   CDS_pept        540958..541689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0494"
FT                   /product="ribosomal large subunit pseudouridine synthase B"
FT                   /EC_number="5.4.99.-"
FT                   /note="PFAM: RNA-binding S4 domain protein; pseudouridine
FT                   synthase; KEGG: cch:Cag_0542 pseudouridine synthase, Rsu"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64551"
FT                   /db_xref="GOA:A1BDS4"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDS4"
FT                   /protein_id="ABL64551.1"
FT                   /translation="MKETEDEGGIRINRYLAMCGIASRRAADKLVADGRVTVNGKIADE
FT                   PGLRILPFKDEVIVDGRKFVVPEAKKVYILLNKPRNVITTSHDEKDRETILDLVSVEER
FT                   VYPVGRLDRKTTGVILLTNDGILAHRLMHPSSNVKKEYVAELDKRFPQGLLSQLVGGMK
FT                   LKDTGEKVSPCQAKLLDDGMRIWISIHEGKNHQVRRMLETLGFDVTKLERVAYAGLKAG
FT                   DLRRGAWRHLSKNEVRELYRL"
FT   gene            541738..543801
FT                   /locus_tag="Cpha266_0495"
FT   CDS_pept        541738..543801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0495"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1687 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64552"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDS5"
FT                   /protein_id="ABL64552.1"
FT                   /translation="MARLHLLQSCRRMFLSVLLLFVCGLTLLPAPGYGRDELQRFLEQR
FT                   EFDGDIEQLALQLEDLRSNPLVLNAIDPEELRVLPWLASADIQAVALYRREKGRIRSKS
FT                   QLEEVLGKEKAAATLPFITFSDRDVPREAGSAWKPSGTLYSRVSWDTTLRDGIRDGRYA
FT                   GENYKLYNRLQVGRPHLKISLVHDKDIGEPDFADFISLSVNGYDFGALKSFVIGNYELN
FT                   FGQGLLMGQGRFFSKGSDPANSVRLASKRLTAYASSSEYGFMQGLAASVVLDPFELTAF
FT                   YSDNLVDARITRQKNTEFYFITSLDDAGYHRTNTEIRRKDNVHEKVSGANLVVHVNNGL
FT                   LRGSAGGTLLHYAYDEERILPDGTTTSFANLFGFETEFSLGDLSVFAEAVFSEKPDDFS
FT                   WIAGAEYELIKGLDLQTAIRNYGVNYFSPFAGAFAERGDDASNEEGFYIGLEAKFSKKL
FT                   RAAAYVDWFRFPSLSGDDDYPYASEGYDTRFYLTWKQTPSVVWNLQLQHKEKEEARKQC
FT                   PIVNGVLVPCKDSKRVYSALPVVSDRARLYCDVMPSRKFHLRTLGEVKRVVNDFRAGDE
FT                   RLFGYLLYQQVHYESGPLSFKGRVTLFNTDDFDSAIYVYEDDLPLVFNTAMFSGRGKAL
FT                   MLLASWDVMQSMTLGAKYEVAWYTDRAVFSSGADQRDTSAPGTVTLGCSLRF"
FT   sig_peptide     541738..541842
FT                   /locus_tag="Cpha266_0495"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.944) with cleavage site probability 0.943 at
FT                   residue 35"
FT   gene            complement(543798..544769)
FT                   /locus_tag="Cpha266_0496"
FT   CDS_pept        complement(543798..544769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0496"
FT                   /product="translation factor SUA5"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5 domain protein; SUA5/yciO/yrdC, N-terminal domain;
FT                   KEGG: plt:Plut_1686 SUA5/YciO/YrdC/YwlC"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64553"
FT                   /db_xref="GOA:A1BDS6"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDS6"
FT                   /protein_id="ABL64553.1"
FT                   /translation="MQTLLTDSPEEAARIINQGNIVAFPTETVYGLGAAICFPEAVKKL
FT                   FLAKGRPTDNPLIVHIHNAGEMSKVASEISPEATLLIEHFFPGPLTLVLKKKATVPDAV
FT                   TAGLDTVGVRCPENQIARAFLRHCCAPVAAPSANLSGKPSSTTWEAVFHDLNGKIPCIL
FT                   RGEPSIVGLESTIVDCSEHEPILLREGAVTLEELQRILPAMKARKTGMKDEKPKSPGLK
FT                   YPHYAPKAAIRLCRRGERPPESTLSSAYIGLSNPPEGIRMVSICQSIEEYARSLFSFFR
FT                   ACDREGISVIYCELPEQKGLGRAIHDRLMRASGEHESKNGTT"
FT   gene            complement(544787..545467)
FT                   /locus_tag="Cpha266_0497"
FT   CDS_pept        complement(544787..545467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0497"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; KEGG:
FT                   plt:Plut_1685 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64554"
FT                   /db_xref="GOA:A1BDS7"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDS7"
FT                   /protein_id="ABL64554.1"
FT                   /translation="MINKTSNAAETHDRLGLKYEVARKAIHLSSLSIVVIYCHISRDFA
FT                   LMLLLPLFLGFFLVDILKNFFPPVTAWYHRNFGAMLREHELIGGKPHLNGATCITMSAL
FT                   LLVLFFPKIIAITAFSMVAISDTVAAIVGKIYGRHRFGEKSIEGSAAFLISALIVAAMV
FT                   PNLDIRAGIVMAVTATVIEAFVIRIGWFKVDDNLTIPLLSASTGWVTYLLFLPLQIEAL
FT                   SFCR"
FT   gene            546143..547708
FT                   /locus_tag="Cpha266_0498"
FT   CDS_pept        546143..547708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0498"
FT                   /product="Ppx/GppA phosphatase"
FT                   /EC_number="3.6.1.11"
FT                   /note="PFAM: Ppx/GppA phosphatase; metal-dependent
FT                   phosphohydrolase, HD sub domain; KEGG: plt:Plut_1684
FT                   exopolyphosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64555"
FT                   /db_xref="GOA:A1BDS8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDS8"
FT                   /protein_id="ABL64555.1"
FT                   /translation="MGSDALRVAAIDLGTNSFHMVVVEIDRVKGIIEIDRVKDMICIGR
FT                   GSISSKMLDESAMLSGIAALRNFLVLAGQHGVKSEQVIAFATSAIREAKNRDVFIRRVR
FT                   EETGLKVRVISGKEEAEFIYYGVRNAVKLGNSFDLLFDIGGGSVEFVIANNKEVKLLES
FT                   RKIGVARMHERFIGTDPVSAHEIKLLEQFYAAEMVSSLEKATLLGVRRGIASSGTAQNI
FT                   ARMIRSFEARESDVSLNNSVVTRREFQRLYKAVVPLGSVDRRRMTGLDEKRVDLILPGL
FT                   ILVDMIFRKFNLEEIVISDYALREGMVLNYLQRGFHPLSDNGGQPDIRRESVYELGFRC
FT                   GWNREHSEHVAKLAMQFFDQLRLLHGLGPEYRELLEYAALLHNIGIFISNSSHHKHSQY
FT                   IIMNGELRGFSPSETEIIGHVARYHRKSPPSEKHSPYNQLKPKYRNVVDVLSGILRLAN
FT                   GLERGHRQNIYAVSTAISDRVISVRLESHLEPDIEIWAADQLKSWLEMVLSRSIVIRPR
FT                   SEHA"
FT   gene            547701..549548
FT                   /locus_tag="Cpha266_0499"
FT   CDS_pept        547701..549548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0499"
FT                   /product="para-aminobenzoate synthase, subunit I"
FT                   /note="TIGRFAM: para-aminobenzoate synthase, subunit I;
FT                   PFAM: Anthranilate synthase component I and chorismate
FT                   binding protein; KEGG: plt:Plut_1683 para-aminobenzoate
FT                   synthase, component I"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64556"
FT                   /db_xref="GOA:A1BDS9"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDS9"
FT                   /protein_id="ABL64556.1"
FT                   /translation="MRDRESCRIQRLLLHEGTVWLDESYGARHEGESLLFSEPLEMLAL
FT                   FSASGIREFFTLLEQKLDSGYWLAGWMGYEAGYGFESERFLANCDPERAAPLAWFGVYR
FT                   PPERFASIVSERMFSQVAVDEPFMISDFRFNRTPAEYFQDVERVKREIAKGNVYQVNVT
FT                   GRFRFSFHGSAQALFGALYPQQPSVYSAFINTGRHQVLSFSPELFFRRRACTIEAMPMK
FT                   GTAPRSGVVEEDNRLKRQLSLCEKNRAENLMIVDLLRNDLGRICRSGSVEVSGMFATET
FT                   YPTLHQMVSTIRGELKDENGLFETFRALYPCGSITGAPKISAMQLIRELEPGLRGCYTG
FT                   TIGYINPRRDMVFSVAIRTLELSGNEGVYGSGGGIVWDSDPEEEYQECMLKAKILDDVT
FT                   AESVELFESMLFSGRFLWMQEHLGRLAASARVLGFAFDAAEAAARLAALADILFKAGGR
FT                   FKVRLALEKNGRMAISYESLLSDTGRVPLKLSLADGFIDSSNSLRFHKTSSRKRYERYY
FT                   RKALESGYDEVVFLNERQEVTEGAISNIIILKSRRYVTPSLGSGLLDGIYRRYFLSLHP
FT                   NASEQVLTLKDLFEADQVFICNSVRGLRPVVFDGFVISM"
FT   gene            549630..550088
FT                   /locus_tag="Cpha266_0500"
FT   CDS_pept        549630..550088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT1711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64557"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDT0"
FT                   /protein_id="ABL64557.1"
FT                   /translation="MRDHTPDFKMHELSIENKGLIRQTVQQLLEKLAGDGKLACDSLLE
FT                   FWVEVPGVQHPRGTFQGGFLMPDSFIYITDYFTCGVQALKPLPAYEESDGGVDRVWDDL
FT                   FDELFYQIEIFTSTAVSPKGITLELWAGNRLRPEGEWVYAVDRKIELF"
FT   gene            complement(550085..550735)
FT                   /locus_tag="Cpha266_0501"
FT   CDS_pept        complement(550085..550735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0501"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /note="TIGRFAM: endonuclease III; PFAM: helix-hairpin-helix
FT                   motif; HhH-GPD family protein; KEGG: cte:CT1710
FT                   endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64558"
FT                   /db_xref="GOA:A1BDT1"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDT1"
FT                   /protein_id="ABL64558.1"
FT                   /translation="MQRSPKEKITFIKKALGSVYPEPKSELQYASAFQLLIATILAAQA
FT                   TDKKVNEATKELFLLCPDALSMSRTEPDTIKQLVRTLNYFNNKAANILAVSCRLVEEFN
FT                   GEVPPNREALESLPGVGRKTANVVLANAFGQPVMPVDTHVHRVSNRIGLCATSKPEQTE
FT                   EALTNIIPEPWMIDFHHYLLLHGRYTCKAKKPACADCVLKEICAFKDKNPIAD"
FT   gene            complement(550738..551235)
FT                   /locus_tag="Cpha266_0502"
FT   CDS_pept        complement(550738..551235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0502"
FT                   /product="NusB antitermination factor"
FT                   /note="TIGRFAM: transcription antitermination factor NusB;
FT                   PFAM: NusB/RsmB/TIM44; KEGG: plt:Plut_1679 NusB
FT                   antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64559"
FT                   /db_xref="GOA:A1BDT2"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDT2"
FT                   /protein_id="ABL64559.1"
FT                   /translation="MKTYRRQIREKILQALYTLELRDTDIESAANWLLTKEIQEDPNAM
FT                   KFFNLLLKNIKEHREEIDQYIARHTFNWDMSRIAIIDKNILRMALAELLYCEDIPPKVS
FT                   INEAIEIAKKFSSTDKSSKFVNGILDAIFNELKAEGKIHKNGRGLIDHSAIKLQKESET
FT                   PE"
FT   gene            complement(551255..551947)
FT                   /locus_tag="Cpha266_0503"
FT   CDS_pept        complement(551255..551947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0503"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: cte:CT1708 hydrolase, haloacid
FT                   dehalogenase-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64560"
FT                   /db_xref="GOA:A1BDT3"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDT3"
FT                   /protein_id="ABL64560.1"
FT                   /translation="MLKKLVLFDIDGTLLKVGNINRQVLADALMAVYGTEGNVRHHDFS
FT                   GKMDNRIIYEVLQHVGLSLSAISEKFDAVKATYIDMFRKNTTPDDVRLLEGVPALLHEL
FT                   SSRTDQISGLLTGNFEASGRHKLILPKINHYFSFGAFADDAHHRDELPSIAVERAYLLT
FT                   GKKFSASDIVIIGDTRYDIQCAKVLDARSIAVATGNYSFEELQKHSPDVLFENLAETAL
FT                   VIEKIFNN"
FT   gene            complement(551964..555503)
FT                   /locus_tag="Cpha266_0504"
FT   CDS_pept        complement(551964..555503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0504"
FT                   /product="chromosome segregation protein SMC"
FT                   /note="TIGRFAM: chromosome segregation protein SMC; PFAM:
FT                   SMC domain protein; SMCs flexible hinge domain protein;
FT                   KEGG: cte:CT1707 Smc family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64561"
FT                   /db_xref="GOA:A1BDT4"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDT4"
FT                   /protein_id="ABL64561.1"
FT                   /translation="MYLSKIELFGFKSFAHRVTIKFDKGLTAIVGPNGCGKTNVVDAIR
FT                   WVLGEQKSSLLRSEKMENIIFNGSKNLKPLSLTEVSLTIENTRNVLPTEYTEVTVTRRL
FT                   YRNGDSDYLLNQVPCRLKDILDLFTDTGMGSDAYSVIELKMIEEIISNKSEERLKLFEE
FT                   AAGITRYKQRRKQTFRQLESASRDLSRVDDVIAEVEKKVRNLKLQVKKAEKLREIKNKL
FT                   RELDLILSQNQFAACQTKLEPLRRQLSREEMLDHERAAAIAQKDSAVQDAEVMQLNKEQ
FT                   ELASSQKKLNDLNNRIHELEKQLLQDEEQRKSLSSGIGRIKTTAGDKQKKSLAFELTAK
FT                   ALGHEKPALQKECDKQLAEYKKLSAEHEELNSRLQEHRQELAEKRKKNTELEKTLNRLS
FT                   FTRHSLETKIEHRKTTSDRLGQQKLEIARLLDQSSSDEREISEKINARSELVNESRKSD
FT                   ENIKNQIKILRQSIETQKEKLLGFRSERDQLRNQIMLANAVLDNFEGLPEGIAFLEKQN
FT                   KPKSGIGCLSDLVSLDRKHRKAVNAALGELLGYYICRTLDDAKQSIAALSRSDKGKVHF
FT                   LVLELVQESVPKNRAVPENEALRVIDLLQFPPELDNVLALMLHETYLVRDLNAAETLAM
FT                   QHPQASFVTPEGEKFSGKGVLFGGSSTINEGLRLGKKAERDRLLQEQQALEKTVQEAER
FT                   MLTELNREIEGQQKKQQRSETEKHRSELELLEKSLTRIDAERNSRRQTSERMEAEIREI
FT                   LDGQQQLEQEAAELIPEIHEHESLFNTALEMVQKAQENLAALETRHHQLSLELQKTQNI
FT                   YRDSLLEVEKLDFRIGAAEQNRKLLLDEIKALASESAHLTDKAEKLECHHAKIKRECEE
FT                   LLIRSAGEQEQLKTLELDYREMQSANHDAHSKLRDLRRQHEISQQILASLHAEERETAQ
FT                   SLDHLITAIKVKYNTDLTLFETPPPEEPFDQNQATEKLALLENQREQFGAVNELALEEY
FT                   EVEKERLDFLLEQKADLESAALQLRNTIDEINKTALLKFRQTCTSVRKNFITIFHELFD
FT                   PEDEVDLIVHTIDDPLEARIEIVAKPKGKKPLSIEQLSGGEKALTALSLLFAIYLVKPS
FT                   PFCILDEVDAPLDDANVGRFIKLLKKFENNTQFIIVTHNKNSMASCHALYGVTMEEEGV
FT                   SKLIPVRLQKTGL"
FT   gene            complement(555596..556507)
FT                   /locus_tag="Cpha266_0505"
FT   CDS_pept        complement(555596..556507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0505"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: cte:CT1706 dihydropteroate pyrophosphorylase;
FT                   TIGRFAM: dihydropteroate synthase; PFAM: dihydropteroate
FT                   synthase, DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64562"
FT                   /db_xref="GOA:A1BDT5"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDT5"
FT                   /protein_id="ABL64562.1"
FT                   /translation="MKSVTDKPDQYLINCSGVTLDLRKAPVVMGIVNVTPDSFYDGGMF
FT                   VQKKDKPDYDRALNHALQLIRSGATIIDIGGESSRPGAEPIPTEEEIRRTVPLIGMLRK
FT                   KTDALISIDTWKSEVAEAAIRAGAQLVNDISGFTFDADLPEICRKYQAAVILMHTPTKP
FT                   QSMQWSTGTSSTSNDIITTVTAYLQRSILTARHHGINDIIIDPGFGFGKTVEENYRLLG
FT                   AMNKLQKLQRPLLAGVSRKSFLGHVIAEPRQPTPPPSERLSATLAAETIALLNGASIIR
FT                   AHDVKAAMQTIAVVMASRAASA"
FT   gene            complement(556504..557556)
FT                   /locus_tag="Cpha266_0506"
FT   CDS_pept        complement(556504..557556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0506"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: cte:CT1705 zinc protease,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64563"
FT                   /db_xref="GOA:A1BDT6"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDT6"
FT                   /protein_id="ABL64563.1"
FT                   /translation="MDNDHKHAMNGTNQSRATILAEQNYPLHIALFLLTALCTLWAGSF
FT                   WSGHPVRLDNVNLFFFDLFRGLPYAASLLLFLSVHEFGHFFTALHYRMRATLPYYIPVP
FT                   PLPFLLSLGTMGAVIKIKDRIPNTNALFDTGVSGPLSGFIVSLGLLLFGFYHLPPASWI
FT                   FTVHPEYIASGGIPNPAPEGTLTLGKNLLWIVLEQVIAPKNLPPMTEMYHYPFLFTGWL
FT                   GCFVTALNLIPVGQLDGGHVTYAMFGKQGYKKTAKTFMFIIGILGFPSLLELTFSLILP
FT                   AQTIRIPGELLQWSWPGWMLWFLILSRFIGTDHPPTSHDCSLSASRRAIGWVAIVIFII
FT                   TFVPVPFGVQ"
FT   gene            complement(557735..558184)
FT                   /locus_tag="Cpha266_0507"
FT   CDS_pept        complement(557735..558184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0507"
FT                   /product="cytochrome c, putative"
FT                   /note="KEGG: plt:Plut_1674 cytochrome c, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64564"
FT                   /db_xref="GOA:A1BDT7"
FT                   /db_xref="InterPro:IPR025992"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDT7"
FT                   /protein_id="ABL64564.1"
FT                   /translation="MNLKKLLGGTVLVLAAIQLVPYGRDHLNPPVTGEPAWDSPRTQEL
FT                   FSRACKDCHSNNTVWPWYSNVAPASWLAALDVSVGRKKFNVSEWGRAEKNEGDEAAGEV
FT                   REGKMPPWFYLPAHPEAKLNDQEKKELADGLAATFGEKKKSEEKK"
FT   gene            complement(558304..559254)
FT                   /locus_tag="Cpha266_0508"
FT   CDS_pept        complement(558304..559254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0508"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: cch:Cag_0252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64565"
FT                   /db_xref="GOA:A1BDT8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDT8"
FT                   /protein_id="ABL64565.1"
FT                   /translation="MQKADLLNRIKKATMLQLRTAGFQALQKLERERDFPPAWNSMKEL
FT                   EVVTNNFHQRFLDERFEQSKSLGGFFLLNELLDRALRSSETENMDNENLSGDEKLTLVK
FT                   ALDRQNEMMGLYNRYPAIILPLAEEIARKENRSIRLLELASGSGGLALALAHAAKIKNI
FT                   PLSVTGSDIVPAYQDEANRLADEKQLPVTFRIINAFDMDRSITEPFDLVVISQSLHHFT
FT                   PGQLAMIIAQAGKQASTLFIGIDGYRDPLLMAGVPLTASLQGIPSFTLDGFISARKFYS
FT                   NIELDIIAGIAKGRGSHSVQCSWPMSVMTVDFKPE"
FT   gene            559546..560040
FT                   /locus_tag="Cpha266_0509"
FT   CDS_pept        559546..560040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0509"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: putative transcriptional regulator, Rrf2
FT                   family; PFAM: protein of unknown function UPF0074; KEGG:
FT                   plt:Plut_1672 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64566"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDT9"
FT                   /protein_id="ABL64566.1"
FT                   /translation="MKVLTKNTDYAIRALLFLGARKGSYVSAKTIAAEQEIPYQFLRRL
FT                   MQDMIGHGLVVSKGGASGGFMLLKEPDGIRINDLIEIFQGKIQVSECMFRKKLCSNRAT
FT                   CVLRHEIMRIEQVVHQEFEKVTIGKLMRDLDEARLRLSGVEPDTQKSMPQHGAENQGGN
FT                   I"
FT   gene            560037..560918
FT                   /locus_tag="Cpha266_0510"
FT   CDS_pept        560037..560918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0510"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: cte:CT1701 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64567"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDU0"
FT                   /protein_id="ABL64567.1"
FT                   /translation="MKRQIIAIDEKKCTGCGDCIPGCPEGALQVIDGKARLVSDLFCDG
FT                   LGACTGHCPTGAMTISSREVEPYDERRVMHERIVSGGADVIAAHLKHLLDHGQTAWYAE
FT                   ALAYLEEQGVHDRSEVVVKVDQKPALPASSGHGSGCPGSRMMSFGSDTRPSAAIDSPPN
FT                   SVCDTELRQWPVQLHLVTPTAPYYEGSDLLLAADCTAFAAGDFHQRFIKGKSLAIACPK
FT                   LDSDMDVYVEKLAAMIDKAEINTITAVIMEVPCCGGLMALAAEAQKKVSRKIPVKRVVM
FT                   SVRGEVLSDEWV"
FT   gene            560937..561341
FT                   /locus_tag="Cpha266_0511"
FT   CDS_pept        560937..561341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0511"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: cch:Cag_1491 TPR
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64568"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDU1"
FT                   /protein_id="ABL64568.1"
FT                   /translation="MLKDALGAYRGGIHETTRVIGMRPDSADAWNDRANARNCLGNFSE
FT                   AVSDYTRALELGLRFREALTALGNRGLARIVLGDLDGAHDDFSEIILRKPTNKLLLRSA
FT                   FVQRASVKEKKGDSEGAAADRNMAVMLSVR"
FT   gene            561372..562994
FT                   /locus_tag="Cpha266_0512"
FT   CDS_pept        561372..562994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0512"
FT                   /product="hybrid cluster protein"
FT                   /note="TIGRFAM: hybrid cluster protein; PFAM: Prismane;
FT                   KEGG: cch:Cag_1490 hydroxylamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64569"
FT                   /db_xref="GOA:A1BDU2"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDU2"
FT                   /protein_id="ABL64569.1"
FT                   /translation="MSMYCDQCQESVHGSGCTMRGVCGKDEVTAKLQDVLVYAAEGLAI
FT                   CAEGSSGDALRKYGRRMSEALFVTVTNTNFDEDAIVAEIIKTLLLRDELKASDPRYFVC
FT                   DATEWSGISREDFLIKAESVSTEDLSPNEDLSSLKRLVLYGIKGLAAYTDHAAVLGYHD
FT                   DDIYSFYCKGLASLQKDLSLDELTALVLETGATAVKAMALLDRANTETYGNPEITMVKT
FT                   GVGQKPGILISGHDLRDMEELLKQTEGTGVDVYTHCEMLPAHYYPAFKNYGHFVGNYGG
FT                   SWWKQDREFDSFNGPILMTTNCIVPVRESYRSRMFTTGMAGYPGLKHIAARPEGGAKDF
FT                   SELVSLAKTCQSPKELENGEIVGGFAHNQVLALADKVVAAVKFGAIKRFVVMAGCDGRH
FT                   TSRQYYTDVAEALPMDTIILTAGCAKYRYNKLALGDIGGIPRVLDAGQCNDSYSLAVIA
FT                   LKLQEVFELEDINDLPISFDIAWYEQKAVTVLLALLSLGVKGIRLGPTLPEFLTPNVAK
FT                   VLVETFDIKPISSVRSDVEAMMA"
FT   gene            563148..563564
FT                   /locus_tag="Cpha266_0513"
FT   CDS_pept        563148..563564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0513"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: cte:CT0687 Nudix family
FT                   protein, MutT subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64570"
FT                   /db_xref="GOA:A1BDU3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDU3"
FT                   /protein_id="ABL64570.1"
FT                   /translation="MKARPHIGDVVCAIIERNGRFLIARRPEGKTLALKWEFPGGKVES
FT                   GESPRDALHRELAEELGIVVEILQRLSPVVYSYSDFSLRLIPYRCLIVSGEPVPVEHTA
FT                   LEWISVDDAVFYDFPEADIPILEEYRMLVSGESF"
FT   gene            563847..565085
FT                   /locus_tag="Cpha266_0514"
FT   CDS_pept        563847..565085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0514"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: cch:Cag_0150
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64571"
FT                   /db_xref="GOA:A1BDU4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDU4"
FT                   /protein_id="ABL64571.1"
FT                   /translation="MHKEHASVRDIFSLPVIVAALGYFVDIYDLVLFSIVRVPSLKSLG
FT                   LEGKQLIDYGVYLLNMQMIGMLLGGILWGWLGDRKGRLKIMFGSILLYSLANIANGFVT
FT                   SLPAYALMRFIAGIGLAGELGAGITLVSEVLHTKIRGYGTMLVASIGVSGAILANFVAN
FT                   TYEWHNAFFIGGGLGFLLLFARVKVAESGMFKAMEEKAGVNRGNMLALFTDRNRFFRYL
FT                   NSILIGVPIWFVVGVLITFSPEFAVSFGIPEPVSAGNAVMFCYLGLVFGDLSSGLLSQL
FT                   FQSRRKVILLFMLLSVAAVALYFMQGSSSPAFFYGVCSLLGFASGYWAVFVTVAAEQFG
FT                   TNLRATVATTVPNFVRGMVVPITMLFQFTKGLFGLENGALLVGTLCIVVAFFSLGALEE
FT                   TFHKDLDYYEEFL"
FT   gene            565197..565802
FT                   /locus_tag="Cpha266_0515"
FT   CDS_pept        565197..565802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syg:sync_2668 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64572"
FT                   /db_xref="GOA:A1BDU5"
FT                   /db_xref="InterPro:IPR000726"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDU5"
FT                   /protein_id="ABL64572.1"
FT                   /translation="MAINRSFFFDHVRLYLFDGKLKQSQVQGLDAILDYWGNKMEACDD
FT                   RWLAYALATAHHETDRSMQPIKEYGSTAYFMRMYDCSGGRPLVAKNLGNTHPGDGAKYY
FT                   GRGYVQLTGRRNYTDWSKRLDHDLVGNPDLALDPAIATRILFEGMRQGTFTGRKFADYF
FT                   NPQKEDWLNARRIINWIDKANLIEGYGKRYYGGISYTT"
FT   gene            complement(565905..566627)
FT                   /locus_tag="Cpha266_0516"
FT   CDS_pept        complement(565905..566627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0516"
FT                   /product="protein of unknown function DUF1003"
FT                   /note="PFAM: protein of unknown function DUF1003; KEGG:
FT                   plt:Plut_1664 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64573"
FT                   /db_xref="GOA:A1BDU6"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDU6"
FT                   /protein_id="ABL64573.1"
FT                   /translation="MMKETLEKTGHEKTDPACQLCGNKKTSQLKRAIFVGPSVAQVIIK
FT                   ETGGWDETGWICSDDFLKYQQKYVEKLLAEEKGELTTLDREVLRALHEQEIFSKNPDID
FT                   YDANLGFADRLSDKLASFGGSWTFIIMFGFFIFGWMAINTWILFSKPFDPFPFILLNLV
FT                   LSSLAAIQAPVIMMSQNRQEARDRKRAIHDYQINLKAELEIRQLHQKIDHILSHQWERL
FT                   IEIQKIQMELIDEIRNNN"
FT   gene            complement(566631..569519)
FT                   /locus_tag="Cpha266_0517"
FT   CDS_pept        complement(566631..569519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0517"
FT                   /product="Excinuclease ABC subunit A"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: cte:CT1689 excinuclease ABC,
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64574"
FT                   /db_xref="GOA:A1BDU7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDU7"
FT                   /protein_id="ABL64574.1"
FT                   /translation="MEFNHITIKGARVHNLKNISLDIPRNRFVVITGISGSGKSSLAFD
FT                   TIYAEGQRRFMETLSPYARQYIGNIERPDVDFIEGLSPVISIDQKSTSRSPRSTVGTVT
FT                   EIHDFIRLLYAKAGRRYDPVTGQMLQKQSEESICEAILSLPEGTKVQIISPLVTGRKGH
FT                   YRELFEKLLQKGFLRVRIDGEYREMHKNMQLERYKSHAVALVIDRLLINPESADRLKKA
FT                   VNLAIGMSEHKSSVICDPVESDCKEMVFSTRYAYSDGSVPLDTLAPNNFSFNSPYGACP
FT                   SCSGLGTIMQLSADLMIPNPSLSLKEGAIEPFGKAGKRNLWQVIKAIGKVYGFSVDTPI
FT                   SKIPKKALDILLYGSGSETFDISYSYAGRENSYPQLFEGALPYVEEIRLKTNSMKLREW
FT                   AESFMIHQPCPECNGARLRKESLLVKLNDLNIAEVEALPIPEALDFFITLLPTLTAKEL
FT                   LVATPVVHEITKRLEFLLNIGLSYLSLGRSSQTLSGGEAQRIRLASQLGSQLSGVLYVL
FT                   DEPSIGLHQRDNHKLIESLIRLRNLGNTVLVVEHDKDTMLMADQVIDIGPGAGEYGGEI
FT                   VAQGRAEELGKHSLTAAYLQGKKEVYFPPETKKSPDQAKFLVIRGCRGNNLKNIDIRFP
FT                   LSSLISITGVSGSGKSTLINETLYPALARHFYRSKLLTYPYDSIEGIELIDKVVNVDQS
FT                   PIGRTPRSNPATYTGVFTFIRDFYTRLPEAQIRGYKAGRFSFNVKGGRCEVCQGAGTRK
FT                   IEMNFLPDVYVQCEHCKGERYNRETLQVKYRGKSIADVLDMPVEEASVFFTDFPRIKRI
FT                   LATMESVGLGYLKLGQPSPMLSGGEAQRIKLSAELAKIQTGQTLYILDEPTTGLHFQDI
FT                   QHLLEVLRKLVDKGNTVIIIEHNLDIIKNSDWVIDLGPEGGSGGGQFIGEGTPREIAQL
FT                   EHSHTGRYLAVELEAKHSPELPEQGIQNPISE"
FT   gene            complement(570003..572825)
FT                   /locus_tag="Cpha266_0518"
FT   CDS_pept        complement(570003..572825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0518"
FT                   /product="pyruvate phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="KEGG: cch:Cag_0155 pyruvate phosphate dikinase;
FT                   TIGRFAM: pyruvate, phosphate dikinase; PFAM: PEP-utilizing
FT                   enzyme; pyruvate phosphate dikinase, PEP/pyruvate-binding;
FT                   PEP-utilising enzyme, mobile region"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64575"
FT                   /db_xref="GOA:A1BDU8"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDU8"
FT                   /protein_id="ABL64575.1"
FT                   /translation="MPSAFSPSSHVFYLLKKTKSLLTIMPTSERPKEKSDSKQYLYSFS
FT                   GGIAEGDASMKNLLGGKGANLAEMANIGLPVPPGFTISTEVCTHYYDHQRTYPENLFEK
FT                   GIPEALCKIEDALGKKFGDPENPLLVSVRSGARASMPGMMDTILNLGLNEKTVDGLARK
FT                   SGNPRFAWDCYRRFVQMYGDVVLDLKPTDKKQIDPFEEILEAKKHERQIQLDTEFTVED
FT                   LQDIVSEYKAAILKKTGRTFPEDPHEQLMGAIGAVFNSWNNERAIVYRKLNHIPGYWGT
FT                   ACNVQAMVFGNMGEDCGTGVAFTRDAATGDNIFYGEFLMNAQGEDVVAGTRTPLKIEQL
FT                   KAENPGIYDQLEEIRSILEKHYRDMMDIEFTIENNKLFMLQCRVGKRTGFAAVKIAVEM
FT                   FNEGLIDEKEALMRIEPEQLNQLLRPVFNMKEKQAAIAEGRLLATGLNAGPGAATGKIY
FT                   FNAVDAHDASKRGEPVILVRIETSPEDIKGMAVSEGILTERGGMTSHAALVARQMGKVC
FT                   VAGCGALSIDYQKGEMRVNGKDIVLCEGDYLSIDGSTGEVIAGKVATKNSEIIEVLIDK
FT                   TLLPEEAATWNIYKQLMEWADKYRKLSIRTNADQPDQAETAIMFGAEGIGLCRTEHMFF
FT                   GGERIDAMREMILADDVEGRKKALEKLLPYQREDFYGLFKAMGSRPVTIRLLDPPLHEF
FT                   LPHTDSEIEILAGKMNKSFAQVKERISDLHEFNPMLGLRGCRLGILHPEITVMQVRAII
FT                   EAACKLKQEGAEVVPEIMVPLVCTVKELEITSEIIHKTARSVFAEQGIGVSYLVGTMIE
FT                   VPRAAITSDQIATAADFFSYGTNDLTQMGLGMSRDDSGQFLPAYQQQDIFSRNPFESID
FT                   KDGVGKLMSISAKDGRSVKPDLKLGICGEHGGDPATVEFCHQTGLNYVSCSPFRVPIAR
FT                   LAAARAALKN"
FT   gene            572905..573786
FT                   /locus_tag="Cpha266_0519"
FT   CDS_pept        572905..573786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0519"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /note="PFAM: inner-membrane translocator; KEGG: cte:CT1681
FT                   ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64576"
FT                   /db_xref="GOA:A1BDU9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDU9"
FT                   /protein_id="ABL64576.1"
FT                   /translation="MVIEPTVFVLQVLRISVPYILTSVGATFSERGGVINLALEGMILL
FT                   GAFGAALGQYLTGSAFVGIVSALCCGLLVAALHAFVTVSLKADQIVTGIAINILVMGGT
FT                   RFGLILMFGSAMNSGRIAGVQGTTVFTDPLFLAALVSVLAGQFILFKTPYGLRLRAAGE
FT                   SAETADSLGINVTRMRYSGVLVSGALAALAGAFLVFQQHTFTDNMSAGRGYIALAAMII
FT                   GRWTPAGAALAGFLFASAEAFELWMQTDWLPIQLVQSLPYIVTLLVLAGFAGKSAAPRQ
FT                   VGVPFEKNRRSK"
FT   gene            complement(573778..574434)
FT                   /locus_tag="Cpha266_0520"
FT   CDS_pept        complement(573778..574434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0520"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: plt:Plut_1659
FT                   es1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64577"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDV0"
FT                   /protein_id="ABL64577.1"
FT                   /translation="MKKTGVLLSGCGFLDGSEIQEAVLTLLALDKAGVEAICLAPDIPQ
FT                   HHVINHCTGQVMPSENRNVLVESARISRGSIVNLDRIDTLDLDALILPGGYGVAKNLSN
FT                   YASKGTSCEVHPDVRSAIQSFYHAGKPLGFICIAPVIAARVLGNESIELTIGSDTESAD
FT                   HIELMGAKHVDCPVYNIHISKQGKVVSTPAYMLGQSIGEVAMGIEKLVNAVVALL"
FT   gene            574763..575257
FT                   /locus_tag="Cpha266_0521"
FT   CDS_pept        574763..575257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0521"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plt:Plut_0829 Legionella vir region protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64578"
FT                   /db_xref="InterPro:IPR011460"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDV1"
FT                   /protein_id="ABL64578.1"
FT                   /translation="MKQLLTDIKRLLMVLLLVNALVMGFSGLVSAAFLHVGDDFGGGKV
FT                   AYILQRGDAYYIEGKQSGLIAANANMAGLFNWSAANAACEALVENGFSDWHLPGKEDLN
FT                   RLHGCNCLAGGFPDAEFWSSEQAYQDYAWGQYFGDGYQYYANKSNRYKVRAVRNFQVPV
FT                   S"
FT   sig_peptide     574763..574858
FT                   /locus_tag="Cpha266_0521"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.946 at
FT                   residue 32"
FT   gene            575861..577087
FT                   /locus_tag="Cpha266_0522"
FT   CDS_pept        575861..577087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0522"
FT                   /product="Sigma-70, region 4 type 2"
FT                   /note="PFAM: Sigma-70, region 4 type 2; KEGG: plt:Plut_0585
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64579"
FT                   /db_xref="GOA:A1BDV2"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDV2"
FT                   /protein_id="ABL64579.1"
FT                   /translation="MKQKICPVCGLPVTERSHWHIYHPEEDYTITYEAVGDDILHGQAV
FT                   TDHDVVLDYMDNELFQSVCDELKMRGTKFSVVINLKHIRGVTLAYKKDFANLVYNWGPI
FT                   FTRLVIYNVHPDIYSIIEGFTVICPENVEAVIVDDYRDAIARASVSEDNPETDGCFGQE
FT                   PVYDFRTASKKAFLADLAQLFWIDMLDQPVLLPPAEDDTYIFFGALEEMRKDMLAKKKE
FT                   HQDEVERLKESYELKQKHYLIQMKSLIDQHKEMITQFEKEKLLLQNILKVNAAEMVVAG
FT                   EINTTSIDGLTSLIDSAAMSQPLKEPLLNSCKRIAQTGKIENQHSAGASEAEQIFLSLL
FT                   EQKHPGLSWRDRRIILWIKSDYSNSEIAGLMGISTRGMESIRYRLHKKLALQKHQTIKS
FT                   YLSSLESDA"
FT   gene            577162..577833
FT                   /locus_tag="Cpha266_0523"
FT   CDS_pept        577162..577833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT1679 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64580"
FT                   /db_xref="InterPro:IPR011871"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDV3"
FT                   /protein_id="ABL64580.1"
FT                   /translation="MVCLWILTEQLLKNAVLLVFFLLVALGCADDRKKNGAEVSIGDQV
FT                   WMNRNLEVDRYRTGDPVREAQTVAEWQDAAVHEEGAWCWYDGERDNERVYGKLYNWFAV
FT                   NDSRGLAPAGWHIPSDDEWKRLAVFLGGEGIAAGKLKTLNFRVLPGVDVDNSTGFSAVP
FT                   AGSRNCLDGFFGKEMAAFFWSSTQSGDFEAWNRELGSASNAIQRVSVNKSLGLSVRCIK
FT                   D"
FT   gene            complement(578072..578578)
FT                   /locus_tag="Cpha266_0524"
FT   CDS_pept        complement(578072..578578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0524"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64581"
FT                   /db_xref="GOA:A1BDV4"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDV4"
FT                   /protein_id="ABL64581.1"
FT                   /translation="MNKKNQRTREFMKGKRGEYLVIIQFLLLFIFIFLPVYPSFSETET
FT                   FAATTGIRWAVIVLLWTAALLLGGLGSRHIKKYLTPLPYPVDHNELVTTGIYALVRHPL
FT                   YSSQLFAAFGWAIFSMSLTHLFLTMAAFFFFSYKAAKEEKWLTERHPEYADYAKRVKMF
FT                   IPWVY"
FT   gene            578698..579240
FT                   /locus_tag="Cpha266_0525"
FT   CDS_pept        578698..579240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0525"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: cch:Cag_0168
FT                   hydrolase, isochorismatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64582"
FT                   /db_xref="GOA:A1BDV5"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDV5"
FT                   /protein_id="ABL64582.1"
FT                   /translation="MISPQETLLLVIDVQGKLASSVFHAERVEKNIDKLIRACRILDVP
FT                   VLYTEQYPKGLGSTVEPLRRLLSGQVPVEKLSFSCCGSEEFMRQLRAFKRNDILVTGME
FT                   THVCVYQTSLELLDFGYSVHLVTDAVSSRSEENRQLGIRCIERAGATPTSTEMAVFELL
FT                   RIAEGEQFKEISKIIKE"
FT   gene            complement(579252..580319)
FT                   /locus_tag="Cpha266_0526"
FT   CDS_pept        complement(579252..580319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0526"
FT                   /product="lipid-A-disaccharide kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="KEGG: cch:Cag_0169 tetraacyldisaccharide-1-P
FT                   4'-kinase; TIGRFAM: tetraacyldisaccharide 4'-kinase; PFAM:
FT                   Tetraacyldisaccharide-1-P 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64583"
FT                   /db_xref="GOA:A1BDV6"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDV6"
FT                   /protein_id="ABL64583.1"
FT                   /translation="MSFDLPDIILRPASLLYKNIIRIRNRLYDQQIFHTWHSPLPIVSI
FT                   GNISAGGTGKTPLVDWIVKYYLSLGCKPAIVSRGYGRNTKGVQLVSDGKTVLMKSNACG
FT                   DETAMLAWNNRDAIVIVAEKRKDAVTFIIRRFAEAMPDVIILDDAFQHRQIARNLDIVV
FT                   INEKEPYFRADMIPKGRLREPLINLARADLLVLSKITGGSTTAAISMDLEQTGKPVIKA
FT                   GIAAGNLVCLSGMFNTAKESPVHAGIKALAFAGIGSPQSFIDTLEGQGIQIVSHRFFRD
FT                   HESYTAKKIAALRLEADEKKLTLVTTEKDYFRMLGQPELQEILHTLSCCYLKIRPEFTE
FT                   GEKLLKTMLNAVINR"
FT   gene            complement(580309..580923)
FT                   /locus_tag="Cpha266_0527"
FT   CDS_pept        complement(580309..580923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0527"
FT                   /product="protein of unknown function DUF374"
FT                   /note="PFAM: protein of unknown function DUF374; KEGG:
FT                   cte:CT1675 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64584"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDV7"
FT                   /protein_id="ABL64584.1"
FT                   /translation="MRPIVTRFILPITLKLLYKSLRITVSAFEETTCTEKKQLLFAFWH
FT                   GKMITGWVLARKLFTQSIIHAVVSLSEDGQLLSGTLSNIGFSLIRGSSSKGADEVKSAI
FT                   LKALQSGDIVAITPDGPRGPVHQFKYGIVRIASEQQIPILFAEISYNDAWKLKSWDDFE
FT                   IPKPFSRVAVTLKTVTVPEFNNETMLRNFASQLSRSFTHVV"
FT   gene            581100..582383
FT                   /locus_tag="Cpha266_0528"
FT   CDS_pept        581100..582383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0528"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: plt:Plut_1653 phosphoribosylglycinamide
FT                   synthetase; TIGRFAM: phosphoribosylamine--glycine ligase;
FT                   PFAM: phosphoribosylglycinamide synthetase; protein of
FT                   unknown function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64585"
FT                   /db_xref="GOA:A1BDV8"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDV8"
FT                   /protein_id="ABL64585.1"
FT                   /translation="MNVLIIGSGAREHAMAWAAARNDAVQQVYVAPGNGGTALMGGKVQ
FT                   NVALKATALDELLEFAVLKAVDLTIAGSEQPLELGIVDLFRSAQKKIIGPSQAAAQLET
FT                   SKVFAKDFMSRYGIPTAGYHVFREFQTASLYLASLDESRYPQVIKASGLCAGKGVIVAS
FT                   DGMEAFRATRAMFEDRVFGDAADEVVIEDFLEGEEASVFVLTDGEKYRMFYSAQDHKRI
FT                   GEGDTGKNTGGMGAYAPAPLVTSGVMKKIEEQIVVPALEGMAADGTPYTGFLYVGVMID
FT                   KGEPSVVEFNARMGDPETQVVLPLLKDDFIDALQASLQGTLDLVPFEMLEQCATTVVIA
FT                   SKGYPDLYETGREITIDSELFDMRDVLLFHAGTEIEKGTLRTSGGRVFSVTALGKTLMD
FT                   SIELAYRAVDHISFEGACFRRDIGAKAL"
FT   gene            582406..582837
FT                   /locus_tag="Cpha266_0529"
FT   CDS_pept        582406..582837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT1673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64586"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDV9"
FT                   /protein_id="ABL64586.1"
FT                   /translation="MKLLRRHFEIIQEQAFREQPYECCGLLAGVSHVDHRGNIENVVYE
FT                   IAPCRNCLYYGKEHGFEIGRGEFHDIEQEARALGYEIVGSYHSHINSPAVPSCNDIDFS
FT                   SPGHSMLIISLIDGVPKEVTAWLRRDSGGFHQEPIRITP"
FT   gene            582925..584403
FT                   /locus_tag="Cpha266_0530"
FT   CDS_pept        582925..584403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0530"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain,
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain,
FT                   oligomerisation; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; KEGG: plt:Plut_1651 carbamoyl-phosphate
FT                   synthase, medium subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64587"
FT                   /db_xref="GOA:A1BDW0"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDW0"
FT                   /protein_id="ABL64587.1"
FT                   /translation="MPKREDIKSILVIGAGPIVIGQACEFDYSGTQACRALKEDGYRVV
FT                   LVNSNPATIMTDIEMADATYIEPITPDYVRKIIEKEKPDALLPTMGGQTALNTAVTLAE
FT                   SGILERNGVELIGAKLRAIRKAENREFFSDAMKKIGLEMAKGFFVRNEKEAKEALEEIG
FT                   LPIVIRPSFTLGGTGGGFAESKADYYDAVRRGLAESPISEVLVEECLVGWKEFELEVIR
FT                   DLADNVIIVCSIENVDPMGVHTGDSITVAPAQTLTDRQYQELRDASVRIIREIGVETGG
FT                   SNIQFAIHPRTGRIVVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDEILNDIT
FT                   RTTPASFEPVIDYCVVKVPRWDFEKFKNVDARLGVQMKSVGEVMAFGRNFREALQKSLR
FT                   GLEIGRAGLGADGKDIMNVIDMTQQQKQFAKEDILDKIRIPKADRMFYLRYAFLAGATI
FT                   DEVYQATGIDPWFLDNIRQIVEFESGLRELAAQD"
FT   gene            584409..585185
FT                   /locus_tag="Cpha266_0531"
FT   CDS_pept        584409..585185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0531"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   cch:Cag_0174 indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64588"
FT                   /db_xref="GOA:A1BDW1"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDW1"
FT                   /protein_id="ABL64588.1"
FT                   /translation="MTYLSRILEEKRQAVLALKQQRPLQHYLEQETELSPCRDFQGCLK
FT                   RSVDRIKLIAEIKKASPSRGLIVSDFKPLEMARRYMDLGASAFSVLTEEVFFQGSPDYL
FT                   KEVRRAFSLPVLRKDFILDECQIFESRLMGADAILLIVAALDPHQLQDYLDLARQTGLH
FT                   VLVEVHDHRELDIALNAGSMIIGINNRDLRDFSVNLHTSIKLRPYIPEGIVSVSESGVK
FT                   TAADAALLDNASFDAVLIGEGLHVSEDLKRVIWTET"
FT   gene            complement(585166..585831)
FT                   /locus_tag="Cpha266_0532"
FT   CDS_pept        complement(585166..585831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0532"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   cte:CT1670 ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64589"
FT                   /db_xref="GOA:A1BDW2"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDW2"
FT                   /protein_id="ABL64589.1"
FT                   /translation="MPGKTTLLAPSILSADFTALASSIAVAENAGADWIHCDIMDGVFV
FT                   PNITFGPFIVQAISRCTTMTIDTHLMIIDPDRFIADFIKAGSNQVTVHQEACPHLHRTI
FT                   QLIKSLGAKAGVSINPGTTLATLESILPDLDLVLLMSVNPGFGGQSFIPSSIDKIAALD
FT                   RMRCDRNPEMIIAVDGGITEDNAGVVVDAGADALIAGTAFFKAADPAEAARKLKSQSR"
FT   sig_peptide     complement(585748..585831)
FT                   /locus_tag="Cpha266_0532"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.844 at
FT                   residue 28"
FT   gene            complement(585881..588112)
FT                   /locus_tag="Cpha266_0533"
FT   CDS_pept        complement(585881..588112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0533"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: plt:Plut_1648
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64590"
FT                   /db_xref="GOA:A1BDW3"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDW3"
FT                   /protein_id="ABL64590.1"
FT                   /translation="MLFFKIVFRVILQCLALSLFCGIALPAAAKSKMADTTEALPASMY
FT                   VNKIRFSGNKAVSSDELLQIITTSPHSSFLGLGLFGGPKKPFIAEEFKKDLSLIKKLYT
FT                   YKGYFFTEIASSISPRNNGKKIDIAINIRENEPSRIDSLAYDGLESITDDLRTAYLQKS
FT                   VIKTNTIFSVERLIKERDRTMDFFREEGYAFFHEDSIRIKVDTVGTQAGVLFKLRLPEK
FT                   LTYGGVQAVVQNPFRSDTTGSKTTFLQDSVTVVIYGRQNINPALLSKLTTMRPGRLTKD
FT                   SREKETLQNLGATNVFSSISIKPDSVRSGKLYTSINLEPAPKHQIEPKLLIDNRYGSLF
FT                   FGGALTYENRNLFGGAEQFKAATEFGTQAGYSKTFLSDLSEDQYEKVVPFEFSLKSSLI
FT                   MPVITKPGNSYSAYVEYSAAKLPILLSTQIGLIRGTYSAKTGNASRINFDFFDFEWVKK
FT                   DSLKGFRQLFKNDLASNIGIDPTDDAAVNAGIDSLLDARVNQSIRLRYNTTNRASAAPG
FT                   KNIWNLDILLEEAGGIAWLIDKYIDTKQYDGFSDKDPQIFGTTYSQYVKLETKLGMTRN
FT                   LSDNHQLAGRIHLGYMIPYGKAGATPEERRFYAGGANSMRGWMYNTLGPGRSNSEAAAN
FT                   FGANIKLELGLEYRLKFFEFLGQASGVTFFTDIGNIWDNTGPYAFNLTSLTRDFAWDFG
FT                   AGLRIGSPIGPLRFDFAYKLHDPGDEHPWKISDFDPLDFTFHFGIGETF"
FT   sig_peptide     complement(588023..588112)
FT                   /locus_tag="Cpha266_0533"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.979 at
FT                   residue 30"
FT   gene            complement(588131..588358)
FT                   /locus_tag="Cpha266_0534"
FT   CDS_pept        complement(588131..588358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64591"
FT                   /db_xref="InterPro:IPR021527"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDW4"
FT                   /protein_id="ABL64591.1"
FT                   /translation="MYWNLDLARYIADAPWPLTKDELINYANRTGAPQQVIENLHDLPD
FT                   SDELYESIDEVWPDYPTDEDFCYGDEELLT"
FT   gene            complement(588391..589134)
FT                   /locus_tag="Cpha266_0535"
FT   CDS_pept        complement(588391..589134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0535"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: plt:Plut_1646 membrane
FT                   proteins related to metalloendopeptidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64592"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDW5"
FT                   /protein_id="ABL64592.1"
FT                   /translation="MFSKNRFFLLSEHGRNLKKAGKSAFFAGLVFICSSFPSSPLISSA
FT                   IAEEKPSASAEGLLASTEEMIEHLILQIDRQSDNSPEIKENYQESGKNFFSSIPNIKPV
FT                   PGAITSHFGQRFHPVYNTMLFHAGVDFSAAIGTRVQATGSGVIAFSGYDKGYGEKVVIN
FT                   HGYGFETVYAHLSKSLVRQGQRVNRGEIIALTGNSGVSTGPHLHYEVRKHNVKVNPTAY
FT                   FFNGGNPSKFITNETISAEANGSNS"
FT   sig_peptide     complement(588991..589134)
FT                   /locus_tag="Cpha266_0535"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.896 at
FT                   residue 48"
FT   gene            complement(589218..592058)
FT                   /locus_tag="Cpha266_0536"
FT   CDS_pept        complement(589218..592058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0536"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: cte:CT1667 DNA polymerase I; TIGRFAM: DNA
FT                   polymerase I; PFAM: DNA-directed DNA polymerase; 5'-3'
FT                   exonuclease; 3'-5' exonuclease; SMART: Helix-hairpin-helix
FT                   domain protein, class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64593"
FT                   /db_xref="GOA:A1BDW6"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDW6"
FT                   /protein_id="ABL64593.1"
FT                   /translation="MSIDNQFDFFQAGCGQPSEATKKNIPEKKPALFLIDGMAMVYRAY
FT                   YALQSARMKTRDGLPSGAVFGFTSALLKIFETYKPDYLAVAFDSREKTFRHDLYDLYKA
FT                   NRPSPPEDLISQLDAIYQLVTLLGIPIIKTAGFEADDLIGSLARKFEKSCAIYIVTPDK
FT                   DLAQLVNDEVYILKPGKIQNELELLGIKEITIQFGVRPEQFTDFLALAGDASDNIPGAK
FT                   GIGPKTAASLIGKYGSIASILLNLNEISPKNRQSLEEFQPRLKLIRQLVTIRTDLDLHV
FT                   SLQNLATTTPDVEKILPFLKQYELKSIAARLPAIFPEMNLQPESLPADNENNEKNDSPE
FT                   LTAPGSAKDGADYRIVTRKEELQALVEQLNHAAALAVDTETTSLDTFQAELVGISLSIK
FT                   PKQAWFVYFGKGGVDRRVALDMLKPVLENPSLRKTGQNLKYDLLVLKKYGIDINPVAFD
FT                   TMLASYVLDPEAKHNLDDLALRHLSIKTTTYDELVADGKKKMSILDVPPGELSDYACQD
FT                   ADLALRLQEVFKEKLLQEKDLLWLCENIEFPLVPVLATMEYHGISIDTDHLKKTETTVS
FT                   KQIGQLSEKIFEASGRVFNLDSPKQLAHILFDILGLPSGKATKTGFSTNVQVLEDLAPI
FT                   HPVAQDLLEYRSLQKLRNTYIEALPKMINPLTGKLHTSFNQHVTATGRLSSSHPNLQNI
FT                   PIRTLIGKEIRRAFIPSNPENLLLSADYSQIELRVAAEISGDEKLMEAFRNREDIHSAT
FT                   ARTIFNTTEITPEMRRKAKEVNFGVLYGIMPFGLSRRLNISRNEAKNIIDTYTEKYPGI
FT                   FNALQQIISDGKERGYVSTLLGRRRYIPDLNSRNKNMQKAAERAAMNTPIQGTAADIIK
FT                   CAMNLCSTQLRLHKMKSVMLLQVHDELLFETPENEKHRLKTLVEEVMIDAAKRCGLHNV
FT                   PVEVDTGIGKNWLEAH"
FT   gene            complement(592055..592894)
FT                   /locus_tag="Cpha266_0537"
FT   CDS_pept        complement(592055..592894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0537"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: cte:CT1666 prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64594"
FT                   /db_xref="GOA:A1BDW7"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDW7"
FT                   /protein_id="ABL64594.1"
FT                   /translation="MTNCLIAYQGEPGAYSEIAALRIGQPKPCESFEEVFAAVEKHEAD
FT                   YAVIPIENSLGGSIHQNYDLLLQHPVVIVAETFVKVEHCLLGLQGSSVQHAEKVLSHPQ
FT                   ALAQCRNFFSSHKHLKAEVAYDTAGSAKIIAAEKKPKQLAIASKRAGELYGLEILQENL
FT                   ADEEWNITRFFCIAHADNPDTSFLKNLSDTTQQKTSIVFTLPNVQGSLFKSLATLALRD
FT                   IDMTKIESRPFRKKAFEYLFYVDFTGQQNERNIYNALRHLREFATMVKVLGSYGVIA"
FT   gene            593014..593766
FT                   /locus_tag="Cpha266_0538"
FT   CDS_pept        593014..593766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0538"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; KEGG:
FT                   cch:Cag_0165 protein of unknown function DUF28"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64595"
FT                   /db_xref="GOA:A1BDW8"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDW8"
FT                   /protein_id="ABL64595.1"
FT                   /translation="MSGHSKWATIKRKKAATDQKRGNLFTKLVKEITIAAKMGGADPGG
FT                   NPRLRLAIDTARSNSMPMENILRAVKKGTGELEGVTYDEITYEGYGPAGIALIIETATD
FT                   NRNRTVADIRHIMSRNNGSLGESGSVSWMFHRKGSLDVSKSAVSEDMLLEILLDAGLED
FT                   LESDDAIYYTVITDLKDLETVKKALDAAAIPFENARIDMIPENYIELEAEDASKVIRII
FT                   DALENNDDVQAVYSNMEISEKAMNSLNE"
FT   gene            593770..594333
FT                   /locus_tag="Cpha266_0539"
FT   CDS_pept        593770..594333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0539"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /note="TIGRFAM: crossover junction endodeoxyribonuclease
FT                   RuvC; PFAM: Crossover junction endodeoxyribonuclease RuvC;
FT                   KEGG: cch:Cag_0164 crossover junction endodeoxyribonuclease
FT                   RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64596"
FT                   /db_xref="GOA:A1BDW9"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDW9"
FT                   /protein_id="ABL64596.1"
FT                   /translation="MVVLGVDPGSLKTGYGVVRQDSSGFSVLTCGVIRLHSGKSHAERI
FT                   GQIYRELEEIINSTKPRRVALETVFLSKNAQSALKLGQVRGAVIALSMNTDLELHEYAP
FT                   REVKSAVTGRGSASKEQVAFMVTRMLQVTGHITSYDVTDALGLALCDLLRIGNRAAQEP
FT                   AQGISRGNKNWTGFVRAFPEMVVR"
FT   gene            594433..594987
FT                   /locus_tag="Cpha266_0540"
FT   CDS_pept        594433..594987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0540"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   plt:Plut_1641 CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64597"
FT                   /db_xref="GOA:A1BDX0"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDX0"
FT                   /protein_id="ABL64597.1"
FT                   /translation="MNGKIFNLPNSLSFLRILLIPWFLYYFHTGNLTVSVTLMIIAILS
FT                   DWFDGQTARWTNEVSEMGKILDPLADKLCLASVALYFLWVGQLPLWFVLFVVSRDALIF
FT                   LGAAYVKFRHRVVTTSLWPGKWAVGFLSMMFIAMVVPHPFFERYALKESFMYLSVVMLF
FT                   YSFVEYCLRFYRIQKGLDYKA"
FT   gene            complement(595389..596792)
FT                   /locus_tag="Cpha266_0541"
FT   CDS_pept        complement(595389..596792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0541"
FT                   /product="3-hydroxyacyl-[acyl-carrier-protein] dehydratase
FT                   / UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="4.2.1.-"
FT                   /EC_number="3.5.1.-"
FT                   /note="TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ; PFAM: UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase; Beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase, FabA/FabZ; KEGG: plt:Plut_1640
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64598"
FT                   /db_xref="GOA:A1BDX1"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDX1"
FT                   /protein_id="ABL64598.1"
FT                   /translation="MLIHQRTLQKEVSLRGTGLHTGKECRITFKPAPVNYGYRFIRSDI
FT                   ENSPEIPALIDNVVDVLRGTTIGINGVNVHTTEHVLAALYGLQIDNCSIEMSGPEPPVM
FT                   DGSSLPFAEALLSAGIAKQDEPKNYLVIDETVEFHDTVNTVDIVALPLDSFRVTVMVDY
FT                   KNPALGSQHSGLFDLEKEFLKDFAPSRTFCFLSEVETLANQGIIKGGDIDNAVVIVDKS
FT                   MNNEELQSLAGKLDLEHDHLAIGENGILNNRALRFQNEPARHKLLDLLGDIALLGMPLR
FT                   AQVLAARPGHASNVEFVKQLKKYADRNKLARQYQHEKKAGVIFDINAIQNILPHRYPFL
FT                   LIDKIVEFKLDEKIVSIKNVTMNEPFFQGHFPGNPVMPGVLIIEAMAQTGGIMMLNGTE
FT                   NIQEMLVYFMGIDKARFRKPVLPGDTLVIEAVMTNKRRSVCQFDAKAYVRGELVCEASL
FT                   MATVMPKTK"
FT   gene            complement(596919..598754)
FT                   /locus_tag="Cpha266_0542"
FT   CDS_pept        complement(596919..598754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0542"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="KEGG: sru:SRU_2074 tetratricopeptide repeat domain
FT                   protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64599"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDX2"
FT                   /protein_id="ABL64599.1"
FT                   /translation="MQAKFLTLCCILLFSICPADGEAASPIKAVTAPPPAPVHAQKPEE
FT                   TLRSGKNLFRIKEYSKAQTIFETLLKENGNPQSKIRHSTLLWLSKSLFMQKQPEKAAQL
FT                   LEELLKNPSINGIDPATIVEAHYDLAACRYKLGTPLSAALDFLNVALSATPAGMQAMQE
FT                   QALINTKLIACTSLDGNAIASLERIARTPDLQTFLLNARMQNYLQKNNTNTFLSTIPLV
FT                   DQLLRSPSISRDSQQLMESLKKQAAQLSLATFKERKIGILLPVEIPVYRAAERSSASNQ
FT                   MFKGIHQRLLRYQMERPDILISYSVAKPSEGAENDLFGSTKQLLETSSPLVLIGPMFSN
FT                   DAIEAARAAKNSKVPLITPTATDNLVTDNNPWAFQLNPTHEERGRIAARELLKTGKPQR
FT                   AAAIAEKTDNLEEMAKGFLDELKQAGSKSVIYASFSGKPEDQNNLAESLGTPPGTLLDA
FT                   LYLPMDSPETIETTLLFLEKNRIGYKRLLGSGVWSDRKVVERFRKKISKGITFFNDYSF
FT                   SGSAIETVETAKSHQKLWNTALSSNFWYGYDTMDFLLHTIDKSPDLKHSELAKAIRNAP
FT                   VYNAHYTKYRFEGNNVNHYLNVILIQPDTARQPIN"
FT   sig_peptide     complement(598689..598754)
FT                   /locus_tag="Cpha266_0542"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.614 at
FT                   residue 22"
FT   gene            complement(598767..599558)
FT                   /locus_tag="Cpha266_0543"
FT   CDS_pept        complement(598767..599558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0543"
FT                   /product="Inositol-phosphate phosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /note="PFAM: inositol monophosphatase; KEGG: cch:Cag_0161
FT                   extragenic suppressor protein SuhB"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64600"
FT                   /db_xref="GOA:A1BDX3"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDX3"
FT                   /protein_id="ABL64600.1"
FT                   /translation="MSKELQTAIHAAKTAGNITLRKFGELSQSEIRSKESKDFVTEVDQ
FT                   ACEAAISAVILEAFPHDSLLCEEGTTAKGGSGRTWIVDPLDGTLNFIHSFPVFSISIAL
FT                   CNKDGELLCGVVYQPLLDELFSAEKNKGAFLNGKPIHVSLRSDPESYLIATGMPFKEYH
FT                   YIESYFGMLAEVIRDSAGVRRAGSAAIDLAYTACGRFDAFWEYKLFPWDFAAGVLLVRE
FT                   AGGTVTDFEGNGNIFNKQSIIAGNHATHPLLLEKALKHFKP"
FT   gene            599791..600270
FT                   /locus_tag="Cpha266_0544"
FT   CDS_pept        599791..600270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0544"
FT                   /product="TspO and MBR like proteins"
FT                   /note="PFAM: TspO/MBR family protein; KEGG: plt:Plut_1638
FT                   CrtK protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64601"
FT                   /db_xref="GOA:A1BDX4"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDX4"
FT                   /protein_id="ABL64601.1"
FT                   /translation="MNNTAVKLLACISLCFLFAFAGSTFTPVPGSEWYYSILNKPSWNP
FT                   PDWLFPPVWSLLFLMMSLSLFLVVKKGLDSWTTKRAVVIFVLQLVLNLAWSASFFGLHD
FT                   PLLALVVIFFLWSALVVTIMMFKQLSKAAAYLLVPYLLWVSFASYLNFVIWQLNR"
FT   sig_peptide     599791..599856
FT                   /locus_tag="Cpha266_0544"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.874 at
FT                   residue 22"
FT   gene            600846..601301
FT                   /locus_tag="Cpha266_0545"
FT   CDS_pept        600846..601301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64602"
FT                   /db_xref="InterPro:IPR026002"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDX5"
FT                   /protein_id="ABL64602.1"
FT                   /translation="MKTENKEFLAATHKKFATLKELVEQVGMNEAWEKMLVGFPEQQKK
FT                   RMTPFLAAPTLFEGFTRSIPFFESVGMEMEVVDISNDDCDAVLEIQKYCPYLEICNEYG
FT                   FETPCHVICEMDVEATHRAFPEMRAEILSRQAFDSCVCIFKYERPMK"
FT   gene            601546..608001
FT                   /locus_tag="Cpha266_0546"
FT   CDS_pept        601546..608001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0546"
FT                   /product="amino acid adenylation domain"
FT                   /note="TIGRFAM: amino acid adenylation domain; PFAM:
FT                   GCN5-related N-acetyltransferase; AMP-dependent synthetase
FT                   and ligase; Thioesterase; condensation domain protein;
FT                   phosphopantetheine-binding; KEGG: ava:Ava_1613
FT                   non-ribosomal peptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64603"
FT                   /db_xref="GOA:A1BDX6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDX6"
FT                   /protein_id="ABL64603.1"
FT                   /translation="MKEGITTVENRYGVETPLHYYDISHCLHELFKKQASLNADNPAVI
FT                   DGTGSLTYRVLDEEADNIAQAIVQRGINRGSFIGLCTTRSSQVISGMLGILKAECAYVH
FT                   LDPEYPSDRLGYIIDDAGISLILTQQRFTQTFSFCLPSLLLFMDCDQPESYTASIPFSP
FT                   VEASVSGDPAYVIYTSGTTGKPKGVCCHHKGVVNLLDEFQQRRYLGSEDRCSWWTNLNF
FT                   DVSVYEIFSSLLAGSALLIVPESVRIDGHAFMDWLHVNDITSAYLPPMMVADFLEWVER
FT                   NPGKSRMRRLLTGVEPIPENLLLNIQRCVPQLTIINGYGPTETTICATLYTVNSASHHH
FT                   ETTPVGKAVQNMHLHLLDEAGDPVAAGETGEVYIGGVGVSRGYLNQPELNECLFISDPC
FT                   YKEEGYRMYRTGDLAVFLPDGELAFVGRKDFQVKYMGYRIELGEIEMVLKSHAAIRDAV
FT                   VMLREDDPGLKKIVAYCVLEISGNVSPKELQLFAGRLLPAYMIPAVFVFLKKIPMTPNG
FT                   KSDRNALPPPGKESFLAGKDDGYTAPESVMERDVAAVLSGILGISAIGVDDNLFSLGAH
FT                   SLMATRLCSQIRMRWNVNIPLAFVFENPTVKQIADEIVRKERIGDVPCRITASDAHRTV
FT                   FPVSLIQKGLWLFQQFQEEGTLFNIPVVVYFSGAIQEQLIKKSFDFLIDRHECLRTVFE
FT                   LEGEELVQRVLPAMQVELMVKDLSGCNQDTKFAELDRIRKEEGLHRFELDKGPLIKLHL
FT                   VILGESATHLFITFHHLIIDGWGASVLFRELAASYDAFSRGNMPALPDKKISFGDFCLW
FT                   QLERIKSARLSMQIQYWIEQLKGCSFIQNIPHDYSRPSMPSFSGARCAFSFSPEITKAL
FT                   NEYCLRNNCTMFMYLMTVFQIFIQRYSGRSEIVTGTTIANRNLSDTENIVGLLANSLAI
FT                   RTDFSGDPKFTELLMQVRKVSLEAFDNQDVPFEIVVENVVQKRERSYHPVFQNLFIFQN
FT                   TPPPFLHAGDMDFVYEEIGNETAKLDLLLNVEFRKESLFCWIEYNTCLFNADTIERVAR
FT                   DYIWIASHALHETGDPVSSWHFPSIPARNYYATKDNPLALSCCHYLFELQAERTPDNIA
FT                   VCCDDVQMTFRELNKKANHLAHRLIQRGVGPDIPVGLCLTRSVYLAVGILGILKAGGSY
FT                   VPLDSQYPEERIRYMAHDSGIRLAVTDEASAHVLSFDREMLLVLLDKSDAVESEHSCDN
FT                   PVFRAGAENTAYIMYTSGTSGRPKGVMVPHRGVSNLAVSAVNNYALKSSDRVLQFFSVS
FT                   FDGSVEEIFMTLAVGATLVIRTFNAAISVTDFLFHLEKNEITVLDLPTAFWKELVHGVS
FT                   RTGIKIPNSLRLVIIGGEQASVTDFQKWQKVCGGRVRLINTYGPTECSAVSVFSEPEKI
FT                   NCSYDFNRGLPIGRPMDNTTLYVVDEHCCLVPFGMPGELLIGGAGVAKGYLNLSLLTED
FT                   RFIDDVFQESEPKGRLYRTGDIVRSLSDGNLQFLGRKDNQVKIRGFRIEPGEIESVLNQ
FT                   HELIKQSVVIDLTNDQGETALVGYFVTEKNALSSSELRHYLAQKMPEYMVPSYFVPIKK
FT                   VPLLPNGKIDRSALPVPDTVVEKKATYVGPRDETEKTLVEIWQEVLGVHPIGVTDDFFE
FT                   LGGHSLLAVRLCSQIQEKVNKKVTLSGLFQSLTIEKLARTITDEVWVPESSPAVCIQCV
FT                   DFGKSLPPLFFIHILGTGLKFCRPMVKYLSPELPVYGLSVHLNEKDHFEEFSVEELATR
FT                   YVREVRRIYPQGPFLFAGISFGGLIAFEMARKMSEDGEDIRMVALIDSILPEAFHKMTG
FT                   KEGAHAHREKFRSEGVSYLIRKVLERARHEGFVMREKSSHCYSKILLQYYMVRDRVDRM
FT                   PVSLYEFAARLQNDDALQKYHPKIYTGKVTLFKSRERFYGVSFIQDPLSGWGAFSSGGV
FT                   EVIDCPGDHLGMLADPHVETLGMKLMQSIETCLHMARPIATSQTGEVVIRSVKRGESRL
FT                   FRDISLRSIRESPDAFVATLDQVQHEPLTYWEQLLDFIVDSPLDTIFLACIDQRCIGFA
FT                   AARIYSNDPYLTELRWMWVDRDFRGKGLGGSLLEKVIEWAQSRGSQKINLWVSESQNSA
FT                   IQLYTSKGFVDTGDRGFLRPGSALHARKMIRDNADYLRHGG"
FT   gene            608005..608736
FT                   /locus_tag="Cpha266_0547"
FT   CDS_pept        608005..608736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0547"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase; KEGG:
FT                   cte:CT2196 EntD/Gsp/HetI/Sfp family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64604"
FT                   /db_xref="GOA:A1BDX7"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDX7"
FT                   /protein_id="ABL64604.1"
FT                   /translation="MNMTHQRVYVWQINIEVFEENADAFFSLLSSDEQSRAAHLSFARD
FT                   KRSFIVRRALLRMILGSYCSVHPHQLRFRQQQSGKPFIAFPGHTGIHFSHAHSVNMGLY
FT                   AFSPDQAVGIDVEKIRSLPDLLVVARRFFSYREYVILKGLSTRNRESVFFRMWSMKEAL
FT                   IKANGWSLEKGLAECCTAKVFNNDYGRVADSSVCVVDSGSDFAAALAVQGCGEYEIFFE
FT                   KPDAGSFISELMRDASFDCGH"
FT   gene            complement(608742..609735)
FT                   /pseudo
FT                   /locus_tag="Cpha266_0548"
FT   gene            complement(609777..610328)
FT                   /locus_tag="Cpha266_0549"
FT   CDS_pept        complement(609777..610328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT1658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64605"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDX8"
FT                   /protein_id="ABL64605.1"
FT                   /translation="MFITIHARLLLVPVIALFILQGCGNPSQNGKEEKLAVQQAQQITI
FT                   IEPSHLVTQQDAEKILGEPVKKAVRTEKPIVGLKLCMYNPVNEQSTSFLQITLTQNGFM
FT                   LPEGTSTASIYNRLKKNFESTRTDIRDLGDDAFIATGGLYILKENCYIMIAAGNINSEA
FT                   TRTILMDAGKTALDNLSRLK"
FT   gene            complement(610511..612514)
FT                   /locus_tag="Cpha266_0550"
FT   CDS_pept        complement(610511..612514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0550"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /note="TIGRFAM: acetate--CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: cch:Cag_1685 acetate--CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64606"
FT                   /db_xref="GOA:A1BDX9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDX9"
FT                   /protein_id="ABL64606.1"
FT                   /translation="MATDEKTSSNQPTASPALIEESISSVMTEKRKFPPPVEFSNSAHV
FT                   SSMEEYEKLYAAAAEDPETYWAGLAEQFHWFKKWDSVLEWKTPYAKWFNGGKTNICYNA
FT                   VDVHMNSWRKNKAAILWEGEEGDQRVLTYGELHRQVSKFANVLKIAGIKPGDRVAIYMG
FT                   MVPELVIAVLACARVGAVHNVIFAGFSAHAITERVNDSRAKMVICCDGTRRRGSTINLK
FT                   KIVDEAIVNTPSVRNVIVLKVTSETVSMHDGMDHWWHDLMGLAMDVSEPVEVDSEHPLF
FT                   VLYTSGSTGKPKGILHTTAGYMVHAASSFKYVFDIKDEDIYWCTADVGWITGHSYMVYG
FT                   PLLNGATLLMYEGAPNYPQWDRFWDIINRYKVTILYTAPTAIRAFIRAGNEWVTKHDLS
FT                   SLRLLGTVGEPINPEAWMWYHRVVGQEKCPIVDTWWQTETGGIMVSPFPGATPTKPGTA
FT                   TRPLPGIMVDVVRKDGVSCNANEGGYLVIKKPWPSMLRTIYGDNERYEKTYWSEFNDMY
FT                   FTGDGARKDEDGYIWIMGRVDDVVNVSGHRLGTSEVESALVSHEAVAEAAVVSRPDDIK
FT                   GNSLVAFVTLKDEYEGDMKLRESLRNHVAKEIGPIAKPDEIRWAKGLPKTRSGKIMRRL
FT                   LRELATSNEVKGDVTTLEDFGVLENLRDQEDE"
FT   gene            complement(612695..615145)
FT                   /locus_tag="Cpha266_0551"
FT   CDS_pept        complement(612695..615145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0551"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="TIGRFAM: leucyl-tRNA synthetase; KEGG: plt:Plut_1636
FT                   leucyl-tRNA synthetase, class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64607"
FT                   /db_xref="GOA:A1BDY0"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDY0"
FT                   /protein_id="ABL64607.1"
FT                   /translation="MRYDFSTIEKKWQSFWLKNNSFSSGESTDKPKYYVLDMFPYPSGS
FT                   GLHVGHLEGYTATDIVARYKRSCGYNVLHPMGWDAFGLPAEQFAIKTGTHPKNTTEKNI
FT                   SSFRETLQAMGFSYDWSREINTTSPDYFRWTQWIFIKLYELGLAYVSEVDINWCEELKT
FT                   VLANEEVEEKVKEGYTVIRKPLRQWVLKITAYAERLLDDLDELDWPENVKQMQRNWIGR
FT                   SEGMEIDFELRCHNRKLRVYTTRPDTLFGATFLVISPEHPLALKLATAQQLVAVTQYIK
FT                   EAKLKSELERTGLQKDKTGIFTGSFAINPATGDPLPVWISDFVLTSYGTGAIMSVPAHD
FT                   SRDWEFAKKFGLPIIEVIKSPDGVDDAAFEGKESVSINSSNPEISIDGLHFSEAFQIMA
FT                   HWLETKGLGERKVTYKLRDWIFSRQRYWGEPIPVKHYEDGSIRTESNLPLQLPEVEAYQ
FT                   PSETGESPLATMHDWLYGADEFGSFRRETNTMPQWAGSCWYYLRFIDPENNAQLIDPAK
FT                   EKYWMNVDLYIGGAEHAVLHLLYARFWHKVLYDLGVVSSREPFKKLFNQGMILGEDNEK
FT                   MSKSRGNVIPADQVLKDYGADAVRLYEMFLGPLEQVKPWNTNGIEGISRFLGKVWRLVY
FT                   PDSENPDQRDQAAVLDENPLPEILQRRMHKTIKKVTEDTDHLKFNTAISEMMVFVNELQ
FT                   KNGCRQKSAVENLLLMLAPYAPHITAELWQAIGHTSPISAEPFPVFDPAIAEDPVVTIA
FT                   VQVNGKLRGRFTAPAKSPEESLVDMAKHVDTVIKFLEGQTIVKEIVIQDKLVNFAVKQS
FT                   IPNH"
FT   gene            complement(615226..617424)
FT                   /locus_tag="Cpha266_0552"
FT   CDS_pept        complement(615226..617424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0552"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="KEGG: plt:Plut_1635 polyribonucleotide
FT                   nucleotidyltransferase; PFAM: 3' exoribonuclease; RNA
FT                   binding S1 domain protein; KH, type 1, domain protein;
FT                   SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64608"
FT                   /db_xref="GOA:A1BDY1"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDY1"
FT                   /protein_id="ABL64608.1"
FT                   /translation="MIINKAIDLGKGKILSIETGKMAKQADGAALVRLGDTMVLATVVS
FT                   SKTPPPANQDYFPLQVEYREKYSAAGKFPGGFFKREGRPSEKEILTARLIDRALRPLFP
FT                   DGYLFETQIIVTVFSSDQINDADVLGGVAASAAIMVSDIPFHNSMSEVRVGRINGEFIV
FT                   NPNINELQGSDIDICIGGTANTICMLEGEMKEISEAEMLDAIKFGHEAIRKICALQDEM
FT                   AAEIARPQRSFAPVKAPAKLKEVIAGLSETRLKELAYTPLCKEDRAEKTASVYKETLQS
FT                   TLELFKALLTPEEIAAEPEKALCLNAHIIEEEIHAVEKKVMRHMILDDGKRLDGRTLDE
FT                   IRPISIELGIIPRAHGSALFTRGETQALVTITLGTKKDAQSVDTLTDSADKRFMLHYNF
FT                   PPFSVGETGRVGGTGRREIGHGNLAERSIKMVSPSETDFPYTIRIVSDILESNGSSSMA
FT                   SVCGGTLALMDGGVPIRKPVSGIAMGLIKEGDAYSVLSDILGNEDHLGDMDFKVAGTED
FT                   GITACQMDIKIDGLDYHILETALEQARKGRLHILDKMEVAIPISRGELAQYAPRLTSIQ
FT                   IPVDAIGLIIGKGGETIRSITEETGAEINIEDDGTVTIACSSPEGTNAAVETIKTLISK
FT                   PEIGNTYLGKVRDIRDELGAFVEFLPKTDGLVHISEISKERVTKVSDHLKVGDRVKVKL
FT                   VDIRKDPRTGKNRFALSIKAVESEPEKSDENKAGTEGN"
FT   gene            complement(617598..618449)
FT                   /locus_tag="Cpha266_0553"
FT   CDS_pept        complement(617598..618449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0553"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: cte:CT1647 pantoate-beta-alanine ligase;
FT                   TIGRFAM: pantoate--beta-alanine ligase;
FT                   cytidyltransferase-related domain; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64609"
FT                   /db_xref="GOA:A1BDY2"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDY2"
FT                   /protein_id="ABL64609.1"
FT                   /translation="MQIITDPIQMQAIAEKLRLNRQLIGVVMTMGALHEGHLSLIKEAR
FT                   KIAGTIILTIFVNPRQFAPHEDFHRYPRPFEQDAAHAKAAEVDYVFAPPVDAMYTGNFQ
FT                   TTVHPGPLGEQFEGKQRPGHFSGVATIVTKLLQITRPHIAVFGEKDAQQLAVIKQLVKD
FT                   LNIDVRIIEAPIIRDENGLAVSSRNIYLSAKERDAATVLYKGLCHAERRIAEPCLDLDA
FT                   IVPEVENIIKSALSCHPEYICFVDDETFLPASKAEKGKTYRLLLAVQAGTVRLIDNRKF
FT                   MV"
FT   gene            complement(618433..619167)
FT                   /locus_tag="Cpha266_0554"
FT   CDS_pept        complement(618433..619167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0554"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: cte:CT1646
FT                   tetrapyrrole methylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64610"
FT                   /db_xref="GOA:A1BDY3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDY3"
FT                   /protein_id="ABL64610.1"
FT                   /translation="MQHETGNTGCLYVVATPLGNLEDITLRAVKTLQNAGAIACEDTRR
FT                   ASILLKHFDIIGKKLISYHNYNEARAVLQITRLLEEGVDVCLTTDAGTPIISDPGYSLI
FT                   HALREKGFPVIPIPGPSALTAALSVCPLPVNNFFFAGFLPHKKGRKSRLAFLSSLNTPV
FT                   VFYESPHRIIKLLDEFKEAFPDSELFIAREMTKIHEEYRTGTLDALRERLEHETIRGEF
FT                   VVVVNPACKKNKKTEQDNADHY"
FT   gene            619263..620246
FT                   /locus_tag="Cpha266_0555"
FT   CDS_pept        619263..620246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0555"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: plt:Plut_1632 oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein-like; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter, C-terminal domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64611"
FT                   /db_xref="GOA:A1BDY4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDY4"
FT                   /protein_id="ABL64611.1"
FT                   /translation="MKDQNQLVTARDVTVFFSLKKNGFFAKPYKVTAVNGVSFDIKRGE
FT                   TLGLVGESGCGKTTLGRAMIRLGHGVTGGHIEFNGRDISSMGKREFRALRKDIQMIFQD
FT                   PFGSLNPRLTIGQMLAEVLKVHRLARGESARKRILELLDIVGLQKEYFNRYPHEFSGGQ
FT                   RQRIGIARALAVSPSFIICDEPVSALDVSIQSQIINLLKDLQKEFGLTYFFIAHDLSVV
FT                   EYISDRVAVMYLGKIVEIADSRSLYEAPRHPYTEALLSAIPIPVPGGKKHRILLKGDQP
FT                   GPLNIPSGCGFHPRCPKAMPECSIREPVLKSPQGEPDRLVSCLLYP"
FT   gene            620290..622095
FT                   /locus_tag="Cpha266_0556"
FT   CDS_pept        620290..622095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0556"
FT                   /product="signal peptide peptidase A, Serine peptidase,
FT                   MEROPS family S49"
FT                   /note="TIGRFAM: signal peptide peptidase SppA, 36K type;
FT                   PFAM: peptidase S14, ClpP; peptidase S49; KEGG:
FT                   plt:Plut_1631 protease IV"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64612"
FT                   /db_xref="GOA:A1BDY5"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004634"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDY5"
FT                   /protein_id="ABL64612.1"
FT                   /translation="MKDVNKKSGCWRIGCFSFVVVPILIAVSAFFYFRSSYVLPDKFVL
FT                   SVPIQGNLDEVHSLSSSLPLLSSAEPLSFQDLLFLFDHAAGDKRIGSILLEIGGVHANP
FT                   AKLTELRYSIEKMKASGKKVVAFLRSAEDSDYLLATACDSIVVEEGGFLMLDGLKAETL
FT                   FYTKSLNKIGITFQASQWKTYKSGIEPFVRTGASSEYLEQIGELLDDVYDDYLGYASKR
FT                   RGISRDSLQAVIDNMALLSAKKAVQLGLADGIASSWALNRSLAGKITGREPERGDDVMV
FT                   SAERYRDSVEPNYNADGRDAIALITLSGPIYRSGGASGMGVAEGFDEKLLQRSLEVALD
FT                   NRDVKALVLRIDSPGGDALASADMLEMLYFAAKKKPIVVSMSGVAASGGYMAALAGNKI
FT                   FAEPLTITGSIGVYALKPEISGLVEKTGLQREVVTRGRYADATSLFKPLDKDAYDKFVA
FT                   ASGDVYHDFVSKVATSRKMRWAAADSVAGGRVWSGKRALQAGLIDSLGGLHDAIREAQI
FT                   LGKIDKTKKPRILFYPERKSWMESLAEGDFSGFSRSVTIALKQRLIHELVPEGQSSSIT
FT                   AFYDMLMVSGQLHLIAALPGEVVIR"
FT   gene            complement(622165..623577)
FT                   /locus_tag="Cpha266_0557"
FT   CDS_pept        complement(622165..623577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64613"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDY6"
FT                   /protein_id="ABL64613.1"
FT                   /translation="MYIQVFHATCIRRNKPLKAHTSMNRKRTLPYALMLAGLLLAPPAV
FT                   TAAETLEERVIRLEKELAELKTLVGRKPAAPAQVAAIPVTPATPEAKPAAKSPLTVSLG
FT                   SGVKAQLYGFARFDASYDTGKINPGNIALWVRPEGLNNNDAEWNLTAGATRLGLNLTGP
FT                   DTDSIKLSGNIEFDFLSNVGAENNASPRLRHGYLKAFWPASDFSILAGQTWDVISSQIP
FT                   FTDDPAIMWAAGNIGSRHPQLRLTKGFSVGEKGRIELVAAASRTIGESNTLAETWNTDP
FT                   GKDADMPAIQGRIAFSAPLLVDTQPATIALSGHYGQEEWDSDKTGNHATLDSWSCNVEI
FT                   AMPLSEKITLGGEYFTGSNLDDYWGGIGQGVNKDVSGDLKEIRSQGGWAALRYTMNPST
FT                   TFSLGAGIDDPNDNDLAADGRSLNQSFFANVINRITPNFILGVQLSQWRTDYRNAPESD
FT                   AFRAQSSMTYKF"
FT   sig_peptide     complement(623434..623577)
FT                   /locus_tag="Cpha266_0557"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.961 at
FT                   residue 48"
FT   gene            complement(623904..625460)
FT                   /locus_tag="Cpha266_0558"
FT   CDS_pept        complement(623904..625460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0558"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: cte:CT1641 magnesium-chelatase, subunit D/I
FT                   family; TIGRFAM: Mg chelatase, subunit ChlI; PFAM:
FT                   magnesium chelatase, ChlI subunit; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64614"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDY7"
FT                   /protein_id="ABL64614.1"
FT                   /translation="MLSTLYAASLYGIDAVKVDVEINVTGGIPSFTVVGLPDNAIRESR
FT                   ERILTAVRNSGFDLPPKKITVNLAPADLKKEGTAFDLPIAIGLLGSLKLIKNRFPDTLI
FT                   MGELALDGSIRRINGALPVAIMAVKEKIKRLIVPLANAAEAAVAISASKADTLVFGVET
FT                   LNETADLLNGKTKPSPVEVNVAELFQKEPEYPVDFADIKGQQAAKKALEIAAAGGHNLL
FT                   MIGPPGSGKTMLAKALPSILPPLGFEESLETTKIYSVASLLEKDHPLMVTRPFRNPHHT
FT                   TSNVALIGGGTTAKPGEVSLAHNGILFLDELPEFTRNALEVLRQPLEDREVTVARISVT
FT                   TKYPAGFMLVAAMNPSPAGALKDRDGNLTASPQQIQRYLSKISGPLLDRIDIHIDVPKV
FT                   ENTELFSASAAESSRAIRERVIRAREIQHQRFAAVTSPRIYTNAQMQSKLIRTFCKLDP
FT                   ESSQKLMDAMNRLNLSARAHDRILKVSRTIADLEGSETIEMRHLIQGIQYRNLDRDFWS
FT                   F"
FT   gene            complement(625602..628370)
FT                   /locus_tag="Cpha266_0559"
FT   CDS_pept        complement(625602..628370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0559"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="PFAM: phosphoenolpyruvate carboxylase; KEGG:
FT                   cte:CT1640 phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64615"
FT                   /db_xref="GOA:A1BDY8"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDY8"
FT                   /protein_id="ABL64615.1"
FT                   /translation="MITTTSSVINFEKAERDFTFLLQCFQEMLHDLGEKELAEHLPWKR
FT                   ASMRLDDYPDIERAIQAYSIFFQLLNMAEENSGAQYRRTIETEKGLSELKGLWGKNLHR
FT                   LKKNGITEEEILSELSRVTVDVALTAHPTEAKRKTVLEQHRQLYILLVKRENQMWTPLE
FT                   QEDIRKEIKVVMERLWRTGELLYDKPAVSAERRNIVHYLYNIFPEVLPMLDKRLLHAWQ
FT                   ECGFAPEKLADPQTLPLLRFGSWVGGDRDGHPLVTAKVTRETLLEMRRKALALIAFHLT
FT                   RLASKLSLSEKHQLPPDALEERIRTLANHLGEDGEVALIRNRHEPWRQFINLMIASLPK
FT                   NPRNEHDTGNQNDIFSYGSSRELLDDLELLRQSLLNVGARHIADSDVAPVYRIVQTFGF
FT                   HLASLDIRQNSEFHDLALSQLMSAAGLNGSAFLTWNEEERTAFLDRELQSPRPFTHPDM
FT                   KAGPEAEAVLDCYRVLLDHCKEYGSEGIGSLIVSMTRNASDLLVVYLFMREVGLMTPFK
FT                   EHDACMLPVVPLFETIEDLEKSPDIMRTFLSHPLTRRTLGMQQEMNGWEKPAQQVMIGY
FT                   SDSNKDGGIFASIWNLYRAQESLLEAGKKSETEILFFHGRGGSISRGAGPTHRFLRAQP
FT                   HGSFQAGIRFTEQGETIAQKYANRISALYNLELFMAGVTGELLKHRNKEKTSHELEPLM
FT                   DMLSRTSNLAYRRLIEAEGFIDFFREATPIDIIEATRIGSRPSRRSGKKSLADLRAIPW
FT                   VFSWNQARFSLSGWFGIGSALEQLQHEHPEACDNIRRQDASWAPLRYIISNADASLATV
FT                   DTEIMREYAALVENSELRSRIFGIIENEYHKTRTMIESLYGAHLEEQRLNVSRFISLRQ
FT                   EGLRELHRQQIRLLKKWRKLHQTGQNKKADNLLAELFLTVNAISGGLRTTG"
FT   gene            628707..629348
FT                   /locus_tag="Cpha266_0560"
FT   CDS_pept        628707..629348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0560"
FT                   /product="photosystem P840 reaction center cytochrome
FT                   c-551"
FT                   /note="KEGG: plt:Plut_1628 photosystem P840 reaction center
FT                   cytochrome c-551"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64616"
FT                   /db_xref="GOA:A1BDY9"
FT                   /db_xref="InterPro:IPR019604"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDY9"
FT                   /protein_id="ABL64616.1"
FT                   /translation="MDNKSNGKLIALAIGGAVLMGALFFGVSFLTGYKVPAENISNILT
FT                   PLKSFTGWFSLIFFASLIIMTLGKMSSRISDKWFLSFPLGALGIVALMFAILWIRPSGF
FT                   LLPTTGRTTTLDGKYIRSVGELKAFLDKPAEGSKVPKAPAGFDFDGAKALADGRCNKCH
FT                   TLDSVQDALRTKFKKTGKVDVVVNRMQAYPGSGITVDEANTIMIYLVEKY"
FT   sig_peptide     628707..628799
FT                   /locus_tag="Cpha266_0560"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.916) with cleavage site probability 0.435 at
FT                   residue 31"
FT   gene            complement(629489..629839)
FT                   /locus_tag="Cpha266_0561"
FT   CDS_pept        complement(629489..629839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0561"
FT                   /product="GTP cyclohydrolase I"
FT                   /note="PFAM: GTP cyclohydrolase I; KEGG: plt:Plut_1627
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64617"
FT                   /db_xref="GOA:A1BDZ0"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDZ0"
FT                   /protein_id="ABL64617.1"
FT                   /translation="MKKEILEVFDNTFPGRDYTIEIVNPEFTSVCPITALPDFGTIIIR
FT                   YIPDKSCVELKSLKYYFLEFRNAGIFYENITNTILDDLTSVLQPREMTVITQWKARGGI
FT                   TETVSVTWPQKQ"
FT   gene            630005..630724
FT                   /locus_tag="Cpha266_0562"
FT   CDS_pept        630005..630724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0562"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: cch:Cag_1760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64618"
FT                   /db_xref="GOA:A1BDZ1"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDZ1"
FT                   /protein_id="ABL64618.1"
FT                   /translation="MDRMLISADKQSREMAELYDALSGEYDLRESPFTFADQTFSFLSV
FT                   LDSYALLDRITQEEFVKDEQMPYWAEIWPAAIALSSFIAEDLMLEGRRVIEIGAGVGMV
FT                   SVTAARFGAGVLATDYSTEALRFVRYNALLNRVSLETARLDWRSVMCSEQFDFLFAADV
FT                   LYERVNLLPVVTAIDKLLKPDGVAYVADPRRRLAEQFLELAAENSFIITPELHEFRIGR
FT                   PPVAVTIYRITRCQQLS"
FT   gene            630721..631581
FT                   /locus_tag="Cpha266_0563"
FT   CDS_pept        630721..631581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1761 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64619"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDZ2"
FT                   /protein_id="ABL64619.1"
FT                   /translation="MNNGTMRFTRRWSFHAGEGALVWQLVFPQTGEVVGQKLLRESRRS
FT                   LFFSLDSATGRVLFDDLPLIGDDGSLNTPDGWYTGIETTAHHLVYCYCYQRESPEHLGL
FT                   WAIDPGSGQVVWARRDVVFVANLEETFLVYTPSSFGGFPERHYLLLDPLAGSTVRTIGF
FT                   DSMTANALRREMTPEEDRQGLLLPQFVSEGMVEETLALRRAGIDAPQHCECIVLGPLLV
FT                   AARYEPSSVSGRWNTVLGVWFDAVRVYEEVMEKDGEKPCLNNFLIRDLSLYYIKEKEEL
FT                   ISVSL"
FT   gene            631578..632564
FT                   /locus_tag="Cpha266_0564"
FT   CDS_pept        631578..632564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0564"
FT                   /product="tyrosine recombinase XerC subunit"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein; KEGG:
FT                   cch:Cag_1762 site-specific recombinase, phage/XerD family"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64620"
FT                   /db_xref="GOA:A1BDZ3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDZ3"
FT                   /protein_id="ABL64620.1"
FT                   /translation="MKKHDAYGTTDSGEDGCYREAERFLGYLKTSKNVSRHTITAYRND
FT                   LDQFFSFMQRHLELQHMSLFDPEQVTVASVRLFMGDLLQRGLQPKSIARKLASVKSFYR
FT                   YLQETGVIKSSVLSLVSTPRYPRHVPGFLTEQQTEKIFEQEDSGLFGSDDTFEFHRDIS
FT                   VLEMLYGCGLRISELIDLCPDDINFLQGYVKITGKGQKQRIVPLGTQAAEAVRKYFEVR
FT                   RNFFRINKLMDEKELNHVFVTKRGKKLYPMLVQRITKKYLMSVTEQKEKNPHLLRHTFA
FT                   THLLNNGADLKSVSEMLGHSSLATTEIYTHVTFGRLKEVYRKAHPKA"
FT   gene            632641..632964
FT                   /locus_tag="Cpha266_0565"
FT   CDS_pept        632641..632964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64621"
FT                   /db_xref="GOA:A1BDZ4"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDZ4"
FT                   /protein_id="ABL64621.1"
FT                   /translation="MKTAVNDTISNVQVTLRHSSNHNSIEEYARSAVQVLGRVYPGIIS
FT                   CHIILDHQKNDFEKNKLAEITVHVPQNVLVAREAGTAYEQTIDSCVESLGRQLKKYKEK
FT                   FVP"
FT   gene            633049..634017
FT                   /locus_tag="Cpha266_0566"
FT   CDS_pept        633049..634017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0566"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /note="PFAM: HPr serine kinase domain protein; KEGG:
FT                   plt:Plut_1622 HPr kinase/phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64622"
FT                   /db_xref="GOA:A1BDZ5"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDZ5"
FT                   /protein_id="ABL64622.1"
FT                   /translation="MTLEQKGLKKQSITVAYFFDTIGKEHDIKLRRLNSVDEQKRRIFE
FT                   RDLHRPGLALAGFTNLFTYKRVQILGNTEMRFLNQHEEDARKNAFGNFVRFKIPCIILT
FT                   STNKLQPELLAMATEAGIPVFSTRHSSTKTMYLITEFLDNQFSLYQQYHGSMVDVYGVG
FT                   VLLKGRSGLGKSEVALDLVERGHGLVADDVVVIHRKGESMILTAKRNKNIEHFMEIRGL
FT                   GVVDVKANFGIRAIRDAKEVQVVVELLEWNKEMEYERLGLDTKTTKILGVEVPLVQLPI
FT                   FPGKNITVIIEVVALNFLLKHYYDYVPAEALTKRIRTAIDQ"
FT   gene            634030..635856
FT                   /locus_tag="Cpha266_0567"
FT   CDS_pept        634030..635856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0567"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: plt:Plut_1621 peptide ABC transporter, periplasmic
FT                   peptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64623"
FT                   /db_xref="GOA:A1BDZ6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDZ6"
FT                   /protein_id="ABL64623.1"
FT                   /translation="MTMFTKREVTVPACSNSRPFRFSLSALILFMTVLASTSCSEKKQG
FT                   DDIGSKGRAAKDSTLVIAMLGDADYLNPVLGTTVTSNNIFSLIYPGLLQSEFDTTTGLL
FT                   NFIALEKRLRQTGTGTGKKTPRAALAKTWRMAPDHKSITYILRNNAFWNDGKPIVSGDF
FT                   KFSYKLYGNPVIASARQQYLSELIGAETGQVDFRRAIETPDDTTLIFRFHKPVSEQLAL
FT                   FHTSLTPLPSHYWRSVKPEDFRSSPLNQLPLGAGPYKLQVWRQQQEIVLASNKRSNLPK
FT                   PGNIPYISYRVVPDYTVRLTQLQTNAVDVVENIKPEDFQGVLKSNAAIEIKTVGLRVFD
FT                   YVGWSNIDQAEYHKTGKIKPHPLFGSAQVRLALTTAIDRESIIDGYLKSYGVLCNTDIS
FT                   PSLKWAYNRAILAHQFDPAKASALLKAEGWLPGPDGILRKNGRKFSFVLYTNSGNARRN
FT                   YASVIIQQNLKAIGIDCKLDVQESNVFFENLQSRKLDAWMAGWSIGLEIDPLDVWGSDL
FT                   KKSRFNFTGYQNPRIDGLCELAKQKMDPLEAKAYWMEYQQILHRDQPVTFLYWIRETQG
FT                   FNKRIQGEELNISGTFYNIDDWTLNPSATVAL"
FT   sig_peptide     634030..634152
FT                   /locus_tag="Cpha266_0567"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.910) with cleavage site probability 0.366 at
FT                   residue 41"
FT   gene            635866..636831
FT                   /locus_tag="Cpha266_0568"
FT   CDS_pept        635866..636831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0568"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cte:CT1631 peptide ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64624"
FT                   /db_xref="GOA:A1BDZ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDZ7"
FT                   /protein_id="ABL64624.1"
FT                   /translation="MLTYIIKRLLIAVPLIFGVLTLTFFIIRLAPGDPAAYFIQPGISP
FT                   HVAEQIREQYGLNDPLPVQYIKWISSVLHGDFGRSFSRAQQPVFDVIAEALPVTVTIAL
FT                   LTLIANFIFGIIIGIISAVRQNSVLDRVLTVIALFFYSMPEFWFALMMIIMFSLKLPLF
FT                   PASGLNEIGAESFGTVGFILDRLWHLVLPVTVLSINGAAGIARYVRGSMLEVIRQDYIR
FT                   TARAKGLKERVVIFKHALRNALLPVITLMGSSLPFIFSGALFIEVIFAFPGMGRVTVEA
FT                   IFSRDYPLIIANTFISGSLIVLGNLVADVFYAVADPRIKL"
FT   gene            636859..637899
FT                   /locus_tag="Cpha266_0569"
FT   CDS_pept        636859..637899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0569"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="KEGG: plt:Plut_1619 Holliday junction DNA helicase
FT                   RuvB; TIGRFAM: Holliday junction DNA helicase RuvB; PFAM:
FT                   AAA ATPase, central domain protein; Holliday junction DNA
FT                   helicase RuvB, C-terminal domain; Holliday junction DNA
FT                   helicase RuvB, N-terminal domain; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64625"
FT                   /db_xref="GOA:A1BDZ8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BDZ8"
FT                   /protein_id="ABL64625.1"
FT                   /translation="MKIELLNTPADALEIRYEEQIRPLKMDDFTGQQRLTDNLRVFISA
FT                   AKIRGDALDHVLLSGPPGLGKTTLANIIASEMGGNIKVTSGPMLDKAGNLAGLLTSLRK
FT                   GDVLFIDEIHRLPAAVEEYLYSAMEDFRIDIMLDSGPSARAVQLRIEPFTLVGATTRSG
FT                   LLTSPLRARFGISSRFDYYPPELLERIILRASGILGIGVTTEAAGEIAGRSRGTPRIAN
FT                   RLLRRARDFAQVADSFVINHDIAMTTLASLEIDEEGLDDMDKKIMDTIVNKFNGGPVGV
FT                   ASLAVSVGEEQDTIEEVYEPYLIQAGYLARTPRGRVATRLALKRFSSGSGINSSEGPLF
FT                   DAAPAR"
FT   gene            637880..639655
FT                   /locus_tag="Cpha266_0570"
FT   CDS_pept        637880..639655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0570"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_3; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   plt:Plut_1618 TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64626"
FT                   /db_xref="GOA:A1BDZ9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1BDZ9"
FT                   /protein_id="ABL64626.1"
FT                   /translation="MQRLHDKIFFRKERFAKSVRPVFAYSGMVVAICILLLFFSSCSST
FT                   TIVSKSPSRAGFEKGITAEQLKGEFITASFRAAKGDYWGAIDHYRRVIKQEPDNAAVNY
FT                   FMAKAFSVLDVSDSAMVYSEKAVSLSPDNLYYLKLLAGISHRLKDYKRAAEILTRVAAL
FT                   EPGHPENLALLALAYLSSEQPEKALDVFQEMLRLDPENERTQAQVLLLEIKLRHYQEAI
FT                   GTLKELIGAGDEKEKLRLTLGELYLQTGQRDLAVAAFRSLVKDDPLFVPAWLALFEVSV
FT                   QAGDQPGFIRDLHGFYTTKGVNVQNKIDLAQLFFVRSVHDSVYAEPYKAMMSALEKNYP
FT                   GESRVYELKASASMQQKKYLQAIADFKQALALDAANFDAWEGLVSAYIVQNDPGAARKA
FT                   LMLAKRKVKGNRTRLLMLEGYLFYHIGETKKAVVVLEKALSTKDAKKEKMFYMQASVTL
FT                   ALCFDRLGIPAKSIRIYETILLLDPDNALAMNNLAYILSQQGSQLDKAKTLALGAVAKD
FT                   PESMVYLDTLGWVYYKLGEYDKAEKALEKAFEYAVEKNQVDPEIMHHLIMVYEKLGYTE
FT                   KIRVLREKTGEKKSP"
FT   sig_peptide     637880..638014
FT                   /locus_tag="Cpha266_0570"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.945) with cleavage site probability 0.316 at
FT                   residue 45"
FT   gene            complement(639741..643301)
FT                   /locus_tag="Cpha266_0571"
FT   CDS_pept        complement(639741..643301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0571"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   pyruvate flavodoxin/ferredoxin oxidoreductase domain
FT                   protein; KEGG: cch:Cag_1730 pyruvate:ferredoxin
FT                   (flavodoxin) oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64627"
FT                   /db_xref="GOA:A1BE00"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE00"
FT                   /protein_id="ABL64627.1"
FT                   /translation="MSRTFKTMEGNEALAHISYRTSEVISIYPITPASPMGEYSDSWAS
FT                   EGKTNIWGTIPKVDEMQSEAGAAAAVHGALQTGALTTTFTASQGLLLMIPNMYKIAGEL
FT                   SPCVIHVSARSLAAQALSIFGDHGDVMSVRGTGFALLASSSVQEVMDMALIAAASTLES
FT                   RIPFLHFFDGFRTSHEISKIEVIPDETIKAMISDDLVIAHRNRRMSPDAPIIRGTSQNP
FT                   DVYFQGRETVNSYYNACAGITERAMIKFGELTGRHYELYQYYGSPDAEKVIVLMGSGVE
FT                   TARETVAYLNKQGEKVGVINARLFRPFSIEHFIKAFPATVKSISVLDRVKEPGSSGEPL
FT                   YLDTVNAIHEGFQKGMLGSMPNITGGRYGLSSKEFTPTMIKAVFDNMSSSAPKNHFTIG
FT                   IKDDVTSISLDYDKDFSIEPDDMFRALFYGLGSDGTVGANKNTIKIIGENTPNFAQGYF
FT                   VYDSKKAGSITTSHLRFGPREIRSAYLISEAQFIGCHHWIFLEMIDLLKNLKSGGTLLI
FT                   NSHYSAEDVWDKLPKIAQEHLIRKQARLYTIDAYKVAQASGMGQRINTIMQSCFFAISG
FT                   VLPREEAIENIKNSIRYTYGKKGDEVVNQNIQAVEHSIANLHQVTIGSIADSKKELRSP
FT                   IVGEAPDFVCNVLAKIIAGEGDDLPVSMIPADGTYPTGTSKFEKRNLADNIPGWEPDLC
FT                   IQCGKCCMVCPHAAIRAKVYDPKYLKNAPNTFKNTDAKAANWEGMKYTIQIAPEDCTGC
FT                   EMCAHVCPARDKSGSGRKALNMHVQSPLREAEIDNWNYYLNIPELDRNLINPRLVKEQQ
FT                   LQEPLFEFSGACSGCGETPYVKLMTQLFGDRLVIGNATGCSSIYGGNLPTTPYTTNASG
FT                   LGPTWSNSLFEDTAEFALGFRISIDKQREYARELVQKLAAQTGETLASEILEATELTEP
FT                   DIFEQRKRVAILKDKLRQIDTPDAKNLLSVADMLVKKSVWGVGGDGWAYDIGYGGVDHV
FT                   TASDKNINLLVLDTEVYSNTGGQASKATPKAAVAKFAAAGRTVTKKDLGLISMSYTNAY
FT                   VASVAFGARDEQTLKAFLEAEAFDGPSIIIAYSHCIAHGINMSTALDNQKAAVDSGHWL
FT                   LYRYNPDRLKEGKNPLILDSKKPKIPVSQFLDMENRFRMLKKSHPALADHYYAAIQKEV
FT                   DARWAHYDYLAARSFDEIKS"
FT   gene            643595..644353
FT                   /locus_tag="Cpha266_0572"
FT   CDS_pept        643595..644353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0572"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase, substrate binding; KEGG: plt:Plut_1616
FT                   RNA methyltransferase TrmH, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64628"
FT                   /db_xref="GOA:A1BE01"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE01"
FT                   /protein_id="ABL64628.1"
FT                   /translation="MEKEKDMEQQEKVVYGRNAVLELLLKKPDSIEKIYFQFNTSHPKL
FT                   KEILVSARRQKLVTGKARLERLSLMAGTTKHQGVCALVSAVSYYTIEEVLDKPRNTFPL
FT                   LLILQGLEDPHNIGAIIRTAEAVAADAVLLIEGKGSPVNATVHKASAGALSHMRVCKVK
FT                   SLVRCLEFLHERKFLIIAADMDAEINYTDIDLTKALAIVLGAEGSGLAPEAVKFCDHTV
FT                   RIPMAGCVESLNVSVTAGVLLYEAMRQRLA"
FT   gene            644478..644861
FT                   /locus_tag="Cpha266_0573"
FT   CDS_pept        644478..644861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0573"
FT                   /product="glycine cleavage system H protein"
FT                   /note="TIGRFAM: glycine cleavage system H protein; PFAM:
FT                   glycine cleavage H-protein; KEGG: plt:Plut_1615 glycine
FT                   cleavage H-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64629"
FT                   /db_xref="GOA:A1BE02"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BE02"
FT                   /protein_id="ABL64629.1"
FT                   /translation="MNIPEDLRYTKDHEWVKLLDDGSTALAGITDFAQSELGDIVFVEL
FT                   KAPGTKLKAHEVFGTVEAVKTVADLFAPIAGELVGINEALDAAEVVNTDPYGEGWLVKI
FT                   KVDDAKAVEELLDAASYRQLIGA"
FT   gene            644897..646231
FT                   /locus_tag="Cpha266_0574"
FT   CDS_pept        644897..646231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0574"
FT                   /product="glycine dehydrogenase (decarboxylating) alpha
FT                   subunit"
FT                   /EC_number="1.4.4.2"
FT                   /note="PFAM: glycine cleavage system P-protein; KEGG:
FT                   plt:Plut_1614 glycine dehydrogenase (decarboxylating)"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64630"
FT                   /db_xref="GOA:A1BE03"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BE03"
FT                   /protein_id="ABL64630.1"
FT                   /translation="MPFIVNTDQDTREMLSVLGAASFDELIPDIPEEIRLKKALDLFPA
FT                   MSEQEVKRLLEGLASSNTSTSDYVSYLGGGAYDHFIPSAIKTIVSRSEFYTAYTPYQAE
FT                   VSQGTLQAIYEYQSLMCRLYDMDVANASMYDGATALAEAVLMAISVTGRQEVIVAGKLH
FT                   PHYCEVLKTYLEAGGHSAVVQNTLENGVGTLDGLGALLTDRCAAVIVQQPNFYGSLEDV
FT                   EAIGELAHSKGALFVVSADPVSLGLLAAPGSYGADIAVGEGQPLGNAQSFGGPYLGIFT
FT                   VKQDLVRKIPGRLVGMTKDRNGDDGFILTLQTREQHIRREKATSNICTNQALNALHAAI
FT                   YLSLLGKQGIIDVAEQSALKSHYLAEQIADIPGFSLKYSAPFFREFVVETPMAAREVIS
FT                   NLLEKKIFAGCDLSVYDEAGLLVAVTEKRTKAELDAFVEYLGALK"
FT   gene            complement(646224..647114)
FT                   /locus_tag="Cpha266_0575"
FT   CDS_pept        complement(646224..647114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0575"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase; KEGG: cte:CT1624
FT                   dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64631"
FT                   /db_xref="GOA:A1BE04"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BE04"
FT                   /protein_id="ABL64631.1"
FT                   /translation="MSTRYIAGSAVALVTPFRKNNTIDTDALKKLVQFHIEAGTDIIIP
FT                   CGTTGESPTLTSDEQFRIIRIVSEEADGKIMVAAGAGTNATAHAVELAKNAEKAGASAI
FT                   LSVAPYYNKPSQEGFYQHFRHIAEAVSVPIIVYNVPGRTGSNLSASTILRLARDFANIA
FT                   AVKEASDNMNQIMELLEERPENFSVMTGEDMLILPFMAMGGDGVISVAANQIPSTVKQL
FT                   VIAAKQGNLDEARALNRKYRRLFKMNFIESNPVPVKYCLSLMGMIEENYRLPLVPLSDE
FT                   NKAVLKKEMEFLGLI"
FT   gene            complement(647180..648886)
FT                   /locus_tag="Cpha266_0576"
FT   CDS_pept        complement(647180..648886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0576"
FT                   /product="DNA replication and repair protein RecN"
FT                   /note="TIGRFAM: DNA repair protein RecN; PFAM: SMC domain
FT                   protein; KEGG: cch:Cag_1749 DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64632"
FT                   /db_xref="GOA:A1BE05"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE05"
FT                   /protein_id="ABL64632.1"
FT                   /translation="MVTTLYVRDFALIAELTVSFAPGLTIITGETGAGKSILIGALSLV
FT                   LGERASVDLVRSGANKAIIEAVLKNLPLQKISPILIGAAIDISDEMILRREISASGQSR
FT                   CYINDTPCTVTLLKQIGELLIDLHGQHEHQLLLRTDTHEAMLDSYAQTGSEVSAYKETL
FT                   KRVATLKKQLTLLQKKAVETKENKDLLTYQLNEINALELKAGEPEAIDKEIILLENAET
FT                   LFSLCSGLCTELYDKDQSAYSAITTSVHILEKLALIDPQFESHLEENRTAASIIEELYH
FT                   FSRRYTTQVEFNQEKLDELRQRQMQLHRAQKKYGKTLDELIVFREELLARLAMEETIDD
FT                   EISLILEEIALEKTTLSIRAQTLSSKRQASAQKLERIIRKELGELGIPNAFFKISIIHE
FT                   EHPDGEITLAGKNFIACSGGYDRIEFLVSANPGEKPKPLVKVASGGEISRIMLALKSAL
FT                   AASTDLPVLVFDEIDTGISGSVAAAVARSLKRLSKLHQIIAITHLPQIAAMADLHLSAS
FT                   KSVQQERTVTEVTALHGDARLHALASLVSGKQLSPSSLKLAGELLEGAKSV"
FT   gene            complement(649264..649461)
FT                   /locus_tag="Cpha266_0577"
FT   CDS_pept        complement(649264..649461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0577"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: cch:Cag_1748 twin-arginine translocation
FT                   protein TatA/E"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64633"
FT                   /db_xref="GOA:A1BE06"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BE06"
FT                   /protein_id="ABL64633.1"
FT                   /translation="MFGLGGQELVLILLIILLLFGAKKLPELARGLGRGMKEFKKAQTE
FT                   IEEEFNKVVEEPPAKEKTTT"
FT   gene            complement(649572..650210)
FT                   /locus_tag="Cpha266_0578"
FT   CDS_pept        complement(649572..650210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0578"
FT                   /product="phosphatidylserine decarboxylase related protein"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: cch:Cag_1747 phosphatidylserine decarboxylase;
FT                   TIGRFAM: phosphatidylserine decarboxylase related protein;
FT                   PFAM: phosphatidylserine decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64634"
FT                   /db_xref="GOA:A1BE07"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BE07"
FT                   /protein_id="ABL64634.1"
FT                   /translation="MPTSYGYTTLLKTTLVCCLLTALVSIFLPALLPLTATGSAAVIIF
FT                   TLYFFRDPERRIPLDQQVIVAPADGKILLIQPLDHAFTGNDSTLVSIFMSPFNVHVNRI
FT                   PLDGTIVHLRYVPGKFLMAFDNRSMESNEKMEIGIDNGSLRVLFIQVAGFLARRIVCPL
FT                   HRNESVLSGKRFGMIKFGSRVDMILPAAVKIMVQSGQKTCAGETIIGRY"
FT   sig_peptide     complement(650088..650210)
FT                   /locus_tag="Cpha266_0578"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.383 at
FT                   residue 41"
FT   gene            650316..651293
FT                   /locus_tag="Cpha266_0579"
FT   CDS_pept        650316..651293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0579"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: cch:Cag_1746 MesJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64635"
FT                   /db_xref="GOA:A1BE08"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE08"
FT                   /protein_id="ABL64635.1"
FT                   /translation="MNVLEKKFLEQIRIRQLVSKEDHVLLAVSGGSDSMALLHLFCAIR
FT                   RAVPCRISAVHCNFRLRAEESDEDERFVQEACLALGVTCYTVGFDTLKMAGEWKTSIEE
FT                   TARILRYRYFDTLLSEHGMKVVATGHHVNDNAETMLFNLFRGTSLLGLRGIRAKRGKII
FT                   RPLLLVHKVEILGYIDEKHIAFRIDATNFGIDPDRNFIRNRIIPLIEERFSHKLLPSLQ
FT                   RLSEQAGELEEFLELYFENLLADKPGLSASNGMLEVKDLVLLSLFEQKEVFKRALREHD
FT                   VKCDSKTLDQLVRLLKTQPGRMVRLSAQIVVLWKGGTLHILRQS"
FT   gene            complement(651356..652393)
FT                   /locus_tag="Cpha266_0580"
FT   CDS_pept        complement(651356..652393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64636"
FT                   /db_xref="GOA:A1BE09"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE09"
FT                   /protein_id="ABL64636.1"
FT                   /translation="MQSSAEEPQVRPEKRSLKKGAGLLISISILSMLCFLAVVVWINWE
FT                   KPRVQTEPLSPEVRGLIERFPGKSDALIYLGLKDIRQSGFWKEIIPDSLKKAPVLITER
FT                   KLDDLIRVSGINLSEDLDTLIISFRRKSYNRQDYLGIASGPFAEKLPESLLLKESSSSE
FT                   PLNGHTCYELDNSVWICPIGHRRVALASNRELLEQFLSPKGSFFQRDSLASALIDKAEF
FT                   KSHLWFALPSAAWTSGALQSLTSANKDMKAVGNLNRIQHLALSVKFTDGINAGTEWIYK
FT                   TRRAAYFASTFIWGAVKLSGITGTRTSEQKKELLEKLKIEQNLESVIIHMNLPPEIFRK
FT                   TPANK"
FT   gene            complement(652406..652846)
FT                   /locus_tag="Cpha266_0581"
FT   CDS_pept        complement(652406..652846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0581"
FT                   /product="RNase HI"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease H; KEGG: cte:CT1612 ribonuclease
FT                   H"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64637"
FT                   /db_xref="GOA:A1BE10"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BE10"
FT                   /protein_id="ABL64637.1"
FT                   /translation="MQKKIIVYTDGACSGNPGKGGWGALLMYGASTREISGYSPATTNN
FT                   RMELSAAIEALETLKEPCIVHLYSDSSYLVNAINEGWLKRWTANNWKTAAKKSVENIDL
FT                   WQKILTLIKLHDVTFHKVKGHSDNPYNNRCDELARQAIKNNR"
FT   gene            complement(652925..653143)
FT                   /locus_tag="Cpha266_0582"
FT   CDS_pept        complement(652925..653143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0582"
FT                   /product="LSU ribosomal protein L28P"
FT                   /note="PFAM: ribosomal protein L28; KEGG: cch:Cag_1743
FT                   ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64638"
FT                   /db_xref="GOA:A1BE11"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BE11"
FT                   /protein_id="ABL64638.1"
FT                   /translation="MSKVCVLTGKRPKYGNTVSHANNHVRTRFEPNLHTKKIWIEEEKR
FT                   FVKVKLSAKAMKIIAKTGTAQLAKLLK"
FT   gene            complement(653217..654179)
FT                   /locus_tag="Cpha266_0583"
FT   CDS_pept        complement(653217..654179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0583"
FT                   /product="chlorophyll synthase"
FT                   /EC_number="2.5.1.62"
FT                   /note="TIGRFAM: bacteriochlorophyll/chlorophyll synthetase;
FT                   PFAM: UbiA prenyltransferase; KEGG: cte:CT1610
FT                   bacteriochlorophyll a synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64639"
FT                   /db_xref="GOA:A1BE12"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006372"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE12"
FT                   /protein_id="ABL64639.1"
FT                   /translation="MQQSISEKLHSSGISAARQKAIQQALENVNKPGFRIEPSAIIPLM
FT                   KPVTWFPPMWAFACGVVSTGENIAENWSILLRGVILAGPLMCAMSQTMNDYFDREVDAI
FT                   NEPDRPIPAGKISKSASWLITFGLIISGFLVALSIHPYVVAIAFVGVLMSHAYSGPPIR
FT                   AKRNGWFGNLIVGLAYEGVAWLTGSFAITQGVPSSETIALAIIFSLGAHGIMTLNDFKS
FT                   IVGDNIRQVASIPVQLGEKKAAILASIIMDFAQLLAISILIVKGSLITTVIAILLLAAQ
FT                   IPMQKILIANPGEKAIWYNAFGTLLYVLSMMVCAVGIRP"
FT   gene            complement(654284..655339)
FT                   /locus_tag="Cpha266_0584"
FT   CDS_pept        complement(654284..655339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0584"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="KEGG: cte:CT1609 anthranilate
FT                   phosphoribosyltransferase; TIGRFAM: anthranilate
FT                   phosphoribosyltransferase; PFAM: glycosyl transferase,
FT                   family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64640"
FT                   /db_xref="GOA:A1BE13"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BE13"
FT                   /protein_id="ABL64640.1"
FT                   /translation="MPQKKLLNMLMAGKDLAREEMTLCMNNIMDGAFSDIVLAALLALL
FT                   QKKGVTADEAAGAYASIMARATLCKLDEDAVDTCGTGGDNTGTFNISTAAAIIACGAGV
FT                   SIAKHGNRSMTSQCGSADVLEALGFAIDLPPSATEELFRQTGFAFLFAPMYHPSMKAVA
FT                   HVRRELGIRTIFNMLGPLLNPAGVKRQLVGVFEPELMDLYGTVLLATGCRHSLIVHGET
FT                   ETGAAFDEPSISGPTHILELHEGVMARHIVHPEDFGFIRCPIEDLAGGNREENAIIIRN
FT                   ILDGSATRAKTEAALYAAAMTCYVSGKASCIDEGVCMASDSLESGQASCKFTAILQLNR
FT                   ELSGKHKALIN"
FT   gene            655461..656555
FT                   /locus_tag="Cpha266_0585"
FT   CDS_pept        655461..656555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0585"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: cch:Cag_1740
FT                   aminopeptidase P"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64641"
FT                   /db_xref="GOA:A1BE14"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE14"
FT                   /protein_id="ABL64641.1"
FT                   /translation="MQPDYFRPYRQAAIESILLKISLQALDSCIVTDLSVIRWLTGFSG
FT                   SSARLLITQARTFLFTDFRYREQALCEVDLAEIIIPPDGFIDALASGNYPMGMVAGLQS
FT                   DDITWHEASRLIDALSGKVKIVPVGSFFDEFRMIKNGIEIMKMQQAAAISEQVLDKIIS
FT                   MISPAVTELDLAAEITYQHKKLGADKDSFDPIVAGGPRSAMPHARPANLHFVPGEFIVL
FT                   DIGCVYEGFASDQTRTVALGTVSREAKKVYHIVQTAQALGIRSAAIGMKACELDGLIRR
FT                   YIDDHGYGEAFGHGLGHGVGLDVHEEPRISPKGRHELQENMVFTIEPGIYLPGKFGVRI
FT                   EDTVLMTPDGAKPMQRFTKELIEL"
FT   gene            656575..656949
FT                   /locus_tag="Cpha266_0586"
FT   CDS_pept        656575..656949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0586"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; KEGG:
FT                   cte:CT1607 periplasmic divalent cation tolerance protein
FT                   CutA"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64642"
FT                   /db_xref="GOA:A1BE15"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE15"
FT                   /protein_id="ABL64642.1"
FT                   /translation="MSSYCIVITTAPDRKLAEKLAEGILGNRLAACVQMTDIRSFYLWE
FT                   GALRKEIEVILYIKTTEARYPDLEAWITKVHSYAVPEIVKLPITAGLPGYLNWLDSTTG
FT                   IESGETGKQDSEKRGTTGFM"
FT   gene            complement(656942..658108)
FT                   /locus_tag="Cpha266_0587"
FT   CDS_pept        complement(656942..658108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0587"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: plt:Plut_1602 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64643"
FT                   /db_xref="GOA:A1BE16"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE16"
FT                   /protein_id="ABL64643.1"
FT                   /translation="MSWNTIIGHKQQIKVLQKALETGRLAHAYLFTGPEACGKESVAFE
FT                   LARILNCRTADPVSGSCETCKECISLNAFMHPNVEYIFPVESALLDPGDTAKKENKRFT
FT                   EAKERYDLLLEEKKQNPFFSPAMERSMGILTEQVIALQHKASFMPSQGTRKIFILSQAE
FT                   KLHPSAANKLLKLLEEPPAHILFILVSSRPEAVLPTIRSRCQVIRFSRVSSRELRLWLH
FT                   ENRPEITDPLLSFIVSFSRGNLRLAWEFINNIGSDTAETATIILRNQAIDYLRKALVPG
FT                   KLHEAITASEEQVKNLSRTELTLFIGALLLFFQDVNHRRINPSFQGLNNPDIVDSIDRF
FT                   AKNFPDPDFFRISTIAEEAIRAIERNANPTLVMAAFTAELKGLLQRVT"
FT   gene            complement(658124..659035)
FT                   /locus_tag="Cpha266_0588"
FT   CDS_pept        complement(658124..659035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0588"
FT                   /product="branched chain amino acid aminotransferase
FT                   apoenzyme"
FT                   /EC_number="2.6.1.42"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase, class IV; KEGG: plt:Plut_1601
FT                   branched-chain amino acid aminotransferase I"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64644"
FT                   /db_xref="GOA:A1BE17"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE17"
FT                   /protein_id="ABL64644.1"
FT                   /translation="MNKSAKIWMNGELIDWNDAKIHIMSHVVHYGSSIFEGIRCYDTEK
FT                   GSAILFLDEHIKRLRDSSKIYRIEIPYSEKELKEAIISTIKTNEHKSCYVRPLVYRGQG
FT                   ALGVNPYRASIEVAIATWEWGTYLGDDVLENGVDVRVSSWSRLAPNTLPSWAKAGGNYL
FT                   NSQLIKMEALMDDYAEGLALDINGYVSEGSGENIFVVRDGIIYTPMSAQSILPGFTRFA
FT                   VMHIAKKLGYEVRESLIPREALYVADEVFLTGTAAEITPVRSIDKYPVGNEKRGPVTEV
FT                   LQHNYLKIVQTGEDPYNWLTFI"
FT   gene            complement(659232..660437)
FT                   /locus_tag="Cpha266_0589"
FT   CDS_pept        complement(659232..660437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0589"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="PFAM: phosphofructokinase; KEGG: cch:Cag_1780
FT                   phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64645"
FT                   /db_xref="GOA:A1BE18"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE18"
FT                   /protein_id="ABL64645.1"
FT                   /translation="MKKIGILTSGGDCGGLNAVLKGAALMAQSKNLEMYIIPNGYAGLY
FT                   NLIDQNRLVRLDSERLDRFDASFAGSEAGHSRVKIKAISNPEKYARIKAGMKKFELDAL
FT                   IISGGDDSGSVMIDLNHNGIQCIHAPKTMDLDLQTYSVGGDSTINRIAQFVHDLKTTGK
FT                   THNRVLVTEVFGRYAGHTAFRSGIAAEADCILIPEIPVDWNAVYEHLAERFTRRIRESD
FT                   VHSGTYTIVVAEGMKNADGTDIVDESAGLDAFGHKKLAGAGKYTCQQIQKNMKADPAMP
FT                   IFMKETGMFVEGIYEIPEVREIHPGHLVRSGNSSAYDINFGFEAGAAAVLLLLDGKTGV
FT                   TISKVKGRKVEYIESSKAIMQRYVDLEHVAMYEALGICFGRKPVAYDPILREVDGVYER
FT                   IY"
FT   gene            660615..661889
FT                   /locus_tag="Cpha266_0590"
FT   CDS_pept        660615..661889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0590"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   cch:Cag_1781 lipoprotein releasing system"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64646"
FT                   /db_xref="GOA:A1BE19"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE19"
FT                   /protein_id="ABL64646.1"
FT                   /translation="MTLFDQIRIAYVHLKERKRQTMLTALGVAVGSAMLVTTISVARGS
FT                   SSNVITKVIDTAPHVLVSADRIEPLVPENLIGYSSSRVAMVTRNVTSNDKEVIKNYTEV
FT                   VENIRKIKGLESISPFVLSKVLARNKSRFTSCIARGVSPPLEADIAGLKKNLIEKNALE
FT                   ELAYTPDGILVGYLLAEKLDAGYHDRIVLVTKNSESYPVTIVGSFSSGFNAKDEREAYV
FT                   NLALAQRMEGIAANSVSGIGLRTSDVNRASGVAAQVADITGYKSESWDETNRNVIDFYN
FT                   RNAVITLVLVGFVFVVAGLGVSSVMTTVVLQKVKDIAILRSMGLQRESITRIFMFEGLF
FT                   IGILGVLIGSPAGHAICHFVSMIRFEASTAGVLKSDRINLVETPEAHLIVIVFGVLIAV
FT                   ISSFSPARKATSYLPVSILRGEVGA"
FT   sig_peptide     660615..660743
FT                   /locus_tag="Cpha266_0590"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.811) with cleavage site probability 0.390 at
FT                   residue 43"
FT   gene            complement(661886..662362)
FT                   /locus_tag="Cpha266_0591"
FT   CDS_pept        complement(661886..662362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0591"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="KEGG: plt:Plut_1598 MECDP-synthase; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; PFAM:
FT                   MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64647"
FT                   /db_xref="GOA:A1BE20"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BE20"
FT                   /protein_id="ABL64647.1"
FT                   /translation="MRTGIGIDVHPFAEGRKLVIGGVEIPSAKGLDGHSDADVLLHAVS
FT                   DALLGAAALGDIGLHFPNTSQEFKDIDSMILLKHVKKLLDKEGFRIVNIDAMLLLEAPK
FT                   IASYINEMRKNIARCLGLELNAVSVKATTNEKLGYIGREEGAAAHAVCLIQVKP"
FT   gene            662649..663755
FT                   /locus_tag="Cpha266_0592"
FT   CDS_pept        662649..663755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0592"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1597 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64648"
FT                   /db_xref="GOA:A1BE21"
FT                   /db_xref="InterPro:IPR025519"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE21"
FT                   /protein_id="ABL64648.1"
FT                   /translation="MTFSQLQRFFWICSGTPEHFIEKYPTEHSKYLGIGATIFFTALFA
FT                   ALSGGYALYFVFAGNPFAGLWGLLFGLMWGLAIFNLDRYIVSSINKTSKGLKQFYQASP
FT                   RLVFAILIALVIARPLELKIFDKEIHDRLKQRYLNDQNEQIKKVQSAFNEKYALELSQI
FT                   KKYQDEYDLLSADVNRLREELKEEVFGSRTSTTSGVPGYGSYAKNKELVVVAKQTRLEY
FT                   LAGQLADLHATMNRQKTAEGINNQMMLSETLLDKKAATAGFADRNWALGALAHASDDVS
FT                   SSSANAILFITLLFIVFECAPLIVKLLSDLGPSDVETKETEKRIIAQLTNTAYFSRNRA
FT                   IREYRIMGSKIGGRRAKKYLSNKRGWGR"
FT   gene            complement(663774..664718)
FT                   /locus_tag="Cpha266_0593"
FT   CDS_pept        complement(663774..664718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0593"
FT                   /product="dihydroorotate oxidase B, catalytic subunit"
FT                   /EC_number="1.3.98.1"
FT                   /note="TIGRFAM: dihydroorotate dehydrogenase family
FT                   protein; PFAM: dihydroorotate dehydrogenase; KEGG:
FT                   cch:Cag_1783 dihydroorotate dehydrogenase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64649"
FT                   /db_xref="GOA:A1BE22"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023359"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033888"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE22"
FT                   /protein_id="ABL64649.1"
FT                   /translation="MTDHIPVEKTSITGISLGRGLELRSPVLLASGTVSYGEELNTLCD
FT                   LGKIGGLVTKAISLEPRTGNPPQRIAETPSGMVNAIGLANVGVKKFITEKAPFLRKLNT
FT                   AIIVNIAGRSIDEYAEVIARLDDVEGIGGYEINLSCPNVKGECMIMGVSRSATHEIVSV
FT                   LRKITNRHLMIKLTPNVTSISSIALAAEEAGADSVSLINTLVGMAVNYKTRKPLLRNVT
FT                   GGLSGPAIKPIALAKVWEVFNAVNIPVVGMGGITGFEDAMEFLLVGATAIQIGTMNFVY
FT                   PDIGEKTAVALEKHFSMPDAPNIKEYIGSLITE"
FT   gene            complement(664816..666927)
FT                   /locus_tag="Cpha266_0594"
FT   CDS_pept        complement(664816..666927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0594"
FT                   /product="alpha-glucan phosphorylases"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: plt:Plut_1595 alpha-glucan phosphorylase;
FT                   TIGRFAM: alpha-glucan phosphorylases; PFAM: glycosyl
FT                   transferase, family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64650"
FT                   /db_xref="GOA:A1BE23"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="InterPro:IPR024517"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE23"
FT                   /protein_id="ABL64650.1"
FT                   /translation="MRKQITPCKELTRNLWWSWDTEAKEVFRELSPIIWERVNHNPVEL
FT                   LRHISNDELRARCQCDLGEKIERVNQRFADYISDKNTWAAEHAPELVKQPIAYFSAEFG
FT                   IHESVRIYSGGLGVLAGDHIKSASDLGLNFVGISLFYKEGYFRQYLNHDGWQMEEYPLQ
FT                   YSENLPIEKVTGPDGKDLIISINIAQSEVFAQAWALKVGRATLYLLDTNIPDNESHYRD
FT                   ICCRVYGGDQNMRINQEILLGIGGVKLLDALNLSPAVYHMNEGHSAFLTLELLSKEIAL
FT                   GTSLEEAREKVKSRCVFTTHTPVPAGHNRFSRDMMHYTFDKYLSQNGIDFEELMLLGSE
FT                   DRSNTFGLFTMTVLALNLSRSANGVSKLHGEVSRAMWQSLYADKPVSEVPIGHITNGIH
FT                   TQSWVYGITDRFWRKHTDNIDNMTISREAAEAVLAQVSDEELWCLRYRLKRNLVDFISR
FT                   YLANQLFHQHTFPVFSENDQSRTEKHTLSPDILTIGFARRFATYKRAPLIFRDLDRLNR
FT                   IINHPNMPVQIVFAGKAHPHDDAGKDYIRQIIEHSRRPQFTGKVIFLENYNLGIAKRMV
FT                   SGVDIWLNNPVRPMEASGTSGEKIVMNGGLNFSVLDGWWPEAYNGENGWSIGNGESFEN
FT                   HEEQDSFDAEKMYSVLENQIIPTYYERNEFNIPVQWLKKIRNAIATIAPIYNTHRMVKE
FT                   YTTRYYLNR"
FT   gene            667078..667944
FT                   /locus_tag="Cpha266_0595"
FT   CDS_pept        667078..667944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0595"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: plt:Plut_1594
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64651"
FT                   /db_xref="GOA:A1BE24"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE24"
FT                   /protein_id="ABL64651.1"
FT                   /translation="MIESSIKIAHISDLHLAGRNDRRLLQYLDGMLEHFKKVKVDHLII
FT                   SGDLTDTAEPKDWQILKDRLIAHDLYEWQKVTVIAGNHDLINLEEEMRFYNVLNPLPGI
FT                   RNRSFSGKVSRFCTMFSELIVSEDASVAGFPFVKILKVDGFSFALVAVNSVWPWHPADN
FT                   PLGARGCISPSELRVLRIPDVVDVLRESFVVGLCHHAYKVYSTESVIDQAFDWTMELTN
FT                   RNEYLEVLKLLGARIALHGHFHRFQSYRVDDISFFNGGSFKYSPERYSELIVRCDGSFS
FT                   QQFLNLA"
FT   gene            complement(668001..668495)
FT                   /locus_tag="Cpha266_0596"
FT   CDS_pept        complement(668001..668495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0596"
FT                   /product="Ferritin, Dps family protein"
FT                   /note="PFAM: Ferritin, Dps family protein; KEGG: sth:STH544
FT                   ferritin"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64652"
FT                   /db_xref="GOA:A1BE25"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE25"
FT                   /protein_id="ABL64652.1"
FT                   /translation="MLSTSLQQAFNEQINHEMASAYLYLSMAAYAESRSLPGFANWMKL
FT                   QTKEEMGHAMKLYKFVNERGGRVILTAMDTPKADFSSPTELFEEVLKHERQITALINKL
FT                   YEATLEAKDYAAQVLLHWFIQEQVEEEASASEILETLKMAGEKGHALIMMDRQLARRGQ
FT                   G"
FT   gene            complement(668754..669224)
FT                   /locus_tag="Cpha266_0597"
FT   CDS_pept        complement(668754..669224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64653"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE26"
FT                   /protein_id="ABL64653.1"
FT                   /translation="MTKSLHDHLEESIKLEVNLAKLYTVFNDLFPEDEEFWFQLAMEER
FT                   GHAALLQQEKKQPHPIDFFPENLLAKDLQSLIDANKRVLNYITVYSENMPSRKTAFETA
FT                   LSLENSAGEAHFQHFLDSPNNSLSATIFKQLNLEDRDHAERIEEYMLNNGLS"
FT   gene            669704..670183
FT                   /locus_tag="Cpha266_0598"
FT   CDS_pept        669704..670183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0598"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sru:SRU_1567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64654"
FT                   /db_xref="InterPro:IPR024755"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE27"
FT                   /protein_id="ABL64654.1"
FT                   /translation="MLKKIMSGGQTGVDRAALDAAIAAGLAHGGWCPKGRLSEDGMVPS
FT                   YYLLDETPRSGYLQRTAWNVRDSDGTLIIARRGLSGGSRYTRECALYAARPVMIVQPED
FT                   RDVSSAIYGWIVRHGLATLNVAGPRASSDPDIYAEARSIVEAFIGCDRRNTPEGF"
FT   gene            complement(670143..671999)
FT                   /locus_tag="Cpha266_0599"
FT   CDS_pept        complement(670143..671999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0599"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain,
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain,
FT                   oligomerisation; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; MGS domain protein; KEGG: plt:Plut_1592
FT                   carbamoyl-phosphate synthase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64655"
FT                   /db_xref="GOA:A1BE28"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE28"
FT                   /protein_id="ABL64655.1"
FT                   /translation="MTTQAVELSQEVLDLARKLPEEMLLKAKKHGFSDYQIAHIFKTTE
FT                   TVVRNLRKHLGVISVFKTVDTCAAEFDAKTPYHYSTYEEENESVSSDRKKVIILGGGPN
FT                   RIGQGIEFDYCCVQAVFALKEAGYETIMVNCNPETVSTDYDIADKLYFEPLTFEDTIRI
FT                   IEHEKPLGVIVSFGGQTPLKLSTKLEEAGVTILGTSSTGIDLAEDRKKFGALLEKLAIP
FT                   HPDYGTAICFEEAQMITRRIGYPVLVRPSYVLGGRAMKIIYSDDSLKEYVDQALFISEK
FT                   YPLLIDRFLETAVEFDIDAIADSSDCVISGIMQHVEAAGIHSGDSTSILPYHNISPEVI
FT                   ATMKTYTQILAANLHVVGLMNVQYAVQNDHVYVLEVNPRASRTVPFVGKATAVPVVKIA
FT                   TRVMLGEKLSDLRQQYDLKDCDELGMKHLAIKEPVFPFSKFVKSGVYLGPEMRSTGEAM
FT                   SLADQFPEAFAKAYQAANMELPLSGSVFISVNNQDKNQRIITIARELFRMDFDLVATAG
FT                   THQFLIDNGIECKKVFKVGEEGRPNIFDIIKHGKIDFVINTPRGEKALHDEEAIGAASV
FT                   LSNVPFVTTIEAAEASVQAIDCIRRQEFGVKSLQEYSSYRNR"
FT   gene            672350..673639
FT                   /locus_tag="Cpha266_0600"
FT   CDS_pept        672350..673639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0600"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /EC_number="4.1.2.-"
FT                   /note="PFAM: 3,4-dihydroxy-2-butanone 4-phosphate synthase;
FT                   GTP cyclohydrolase II; KEGG: cch:Cag_1788
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64656"
FT                   /db_xref="GOA:A1BE29"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE29"
FT                   /protein_id="ABL64656.1"
FT                   /translation="MDKKIFDTIEAAVEDIRQGKLVIVIDDEDREDEGDFIAAADVVTT
FT                   EMVNFITKEARGLLCVALTMGRARELQLDPMVQRNTSQHETNFTVSVDAIAVGVTTGIS
FT                   VSDRTMTIKMLGDPLSMADDFSRPGHIFPLRAMDGGVLRRVGHTEAAVDLARLAGCSPV
FT                   GLLCEILNDDGSMARLPELIRLKEKFGLKLITIKDLVAYQMQRNKLVFRAVETKLPTIY
FT                   GDFRLIAYESFIDHQNHMAFVKGDVSTDEPVLVRVHSQCATGDTFASLRCDCGNQLASA
FT                   LTMIENEGRGVLVYLMQEGRGIGLINKLKAYNLQDEGFDTVEANEKLGFKADLRDYGIG
FT                   AQILKDLGVKKMKLLTNNPKKIVGLEGYGLEITERVSIEIAPNSINKSYLDTKRDKMGH
FT                   MIGRSCGNESLFFEQITENHLNKSQQPPNQ"
FT   gene            673670..674992
FT                   /locus_tag="Cpha266_0601"
FT   CDS_pept        673670..674992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0601"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase; KEGG:
FT                   cch:Cag_1789 serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64657"
FT                   /db_xref="GOA:A1BE30"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1BE30"
FT                   /protein_id="ABL64657.1"
FT                   /translation="MDTDILQMQDKEVFEAVVNETVRQTETLELIASENFTSRAVMQAC
FT                   GSVMTNKYAEGYPGKRYYGGCEFVDVAENLARDRAKKLFNCSYVNVQPHSGSSANMAVL
FT                   FSVLKPGDRIMGLDLSHGGHLTHGSPVNFSGQLYEAHSYGVRRETGCIDMNMVEELANK
FT                   VRPKLIICGASAYSQGFDFKAFREIADRIGALLMADIAHPAGLIVAGLLSDPVPHCHFV
FT                   TTTTHKTLRGPRGGMIMMGSDFENPLGITIKTKTGSRVKMMTEVMDAEVMPGIQGGPLM
FT                   HIIAGKAVAFAEALRPEFRDYALQVKKNAAVMADKFSSLGYTIVSGGTKNHLMLLDLRN
FT                   KNVNGKVAENLLHQAGITVNKNMVPFDDKSPFVTSGIRIGTPAMTTRGMKESDSERIVE
FT                   LIDRVVSAAETPAVDDVCRLVRQEIRELCLQHPMDGYEMTP"
FT   gene            complement(675077..676987)
FT                   /locus_tag="Cpha266_0602"
FT   CDS_pept        complement(675077..676987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0602"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="KEGG: plt:Plut_1589 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: zinc finger, CHC2-family protein; TOPRIM
FT                   domain protein; DNA primase catalytic core, N-terminal
FT                   domain; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64658"
FT                   /db_xref="GOA:A1BE31"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE31"
FT                   /protein_id="ABL64658.1"
FT                   /translation="MDQEVMIPQNIIDDIRRSTDIVDLIADYVKLHPSGRNYKALSPFT
FT                   QEKTPSFVVSPDKQIFKCFSTGKGGNVYTFVMEMEKISFPEAVELLAKRTGIDISRFTK
FT                   QQKIQNEENESQTGTLRWAARTFHNTLESPKGVQGLSYLTEARGLSRAIIQQFGIGYAP
FT                   DQWDNLINEAKQASIPLANLTELGLTTHHKERGSWYDTFRNRVIFPIFSIGGQVAGFGG
FT                   RTLDSDPRTPKYLNSPENPLFEKSKLLYGLHAAKDEIRRSESALLVEGYMDVLALHQAG
FT                   ITTAVASCGTSLTRYQAKILQRYTNRVLFVYDADPAGKKSMMAGIDTLVTEGITPFVLE
FT                   LPSGDDPDSFVQRAGKEEFLRYSEKNKQSFIDFQIRFFTQSGNFAQTDVKAKAIRAITH
FT                   TIALIPDRIRQELYLQELSEKLGISFSSLKELLVIESTMRREKNIPGENSMRARPTPVP
FT                   EKKMSVLERTFLKALLESSFYGNAVLEFAASHENMLTLPNPLAQNIFTHLIRRYHSLSG
FT                   SPNDHLDIISEISMFSEPEARNLASGLLLDQPVSKKWHEQTDLNAENARQCLASFLDAF
FT                   KSLVLEPLIRQKEILTEQIRNENDAALETELLREKITLDRKIRKTSDDLRAMIRSIIDN
FT                   R"
FT   gene            677325..678071
FT                   /locus_tag="Cpha266_0603"
FT   CDS_pept        677325..678071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0603"
FT                   /product="outer membrane transport energization protein
FT                   ExbB"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   cte:CT1586 MotA/TolQ/ExbB proton channel family protein; TC
FT                   2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64659"
FT                   /db_xref="GOA:A1BE32"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE32"
FT                   /protein_id="ABL64659.1"
FT                   /translation="MKQSFFTSLLILATYVVSLGFYAWMGTTPSDSMFHAIWKGGPIVS
FT                   VLMALILMVIAYIVERIIALNKAAGKGNIPQFVQSLKQDIDNGYVDQAIAKCDEHQSCL
FT                   SAVLRSVLDRYKKMGSLNITDRDKRISEMEKAVEEATIMEMPLLEKNLVAISTIASIST
FT                   MIGLLGTTLGMIRAFAAMATSGAPDAVQLSLGISEALFNTALGIVGGIMGIVTYNVFIS
FT                   KVDHFSYMIDEAAFYIIQTLGNSKSE"
FT   gene            678078..678611
FT                   /locus_tag="Cpha266_0604"
FT   CDS_pept        678078..678611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0604"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="KEGG: plt:Plut_1587 hypothetical protein; TC
FT                   2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64660"
FT                   /db_xref="GOA:A1BE33"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE33"
FT                   /protein_id="ABL64660.1"
FT                   /translation="MSRIKAKRVGFRIDMTPMVDVAFLLLTFFMLTTKFRPPEIAEVDL
FT                   PSSHSQLKLPESDVLTVTVSGDNTFFMGVSSRQAKEKIFNTAVKPKLQAAKISEAEIRD
FT                   SLKSFRLAESFPVGKDELDKFVLMARFANPKLRPVIRADDDAGFDAVNHAIKVYKKANM
FT                   LTFNLVTVLEREVR"
FT   gene            678613..679137
FT                   /locus_tag="Cpha266_0605"
FT   CDS_pept        678613..679137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0605"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   plt:Plut_1586 hypothetical protein; TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64661"
FT                   /db_xref="GOA:A1BE34"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE34"
FT                   /protein_id="ABL64661.1"
FT                   /translation="MGMVDSPNERRAKKGRKRIRKRIGFHLDMTPMVDVAFLLLTFFML
FT                   TTTFAKSNTMEISMPPEMEEVKIAEANVMTLRISGEGMAYCSLGNEAPRRLSLYESGDA
FT                   SRFALSAELRQILKQQTTANKKLVIVLKISEKAKYKYLVDVIDELNLMKIDRFSLDDFT
FT                   DQDELEIKRAV"
FT   gene            679216..679968
FT                   /locus_tag="Cpha266_0606"
FT   CDS_pept        679216..679968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cpha266_0606"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TIGRFAM: TonB family protein; PFAM: Gram-negative
FT                   tonB protein; KEGG: plt:Plut_1585 TonB-like; TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Cpha266_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABL64662"
FT                   /db_xref="GOA:A1BE35"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A1BE35"
FT                   /protein_id="ABL64662.1"
FT                   /translation="MGSWSIREDFLDTDCLRNVHYGNLVLRRQAHLFLSHGVLTAMVLL
FT                   SFVWLLSANWQSITAVFGFFQKDDKPLTESYEFVTCVTQLPPPPPIAAPPPAVAKAAPA
FT                   PANVGKIKKVKADEVPLQQTFATQKEISHAIQSQPADGADCGSASGSDEGATFVAREKD
FT                   PVLLSMKKSYPEMARTAGIEGRVFISVLVGEDGRAVQAKILKRIPADCNVFDAAAMKAV
FT                   MEAKYAPGIQNGNPIKVWFTVPIRFQLD"
FT   gene