(data stored in ACNUC7421 zone)

EMBL: CP000494

ID   CP000494; SV 1; circular; genomic DNA; STD; PRO; 8264687 BP.
XX
AC   CP000494; AALJ01000000-AALJ01000056;
XX
PR   Project:PRJNA16137;
XX
DT   12-MAY-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Bradyrhizobium sp. BTAi1, complete genome.
XX
KW   .
XX
OS   Bradyrhizobium sp. BTAi1
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Bradyrhizobiaceae; Bradyrhizobium.
XX
RN   [1]
RP   1-8264687
RX   DOI; 10.1126/science.1139548.
RX   PUBMED; 17540897.
RA   Giraud E., Moulin L., Vallenet D., Barbe V., Cytryn E., Avarre J.C.,
RA   Jaubert M., Simon D., Cartieaux F., Prin Y., Bena G., Hannibal L.,
RA   Fardoux J., Kojadinovic M., Vuillet L., Lajus A., Cruveiller S., Rouy Z.,
RA   Mangenot S., Segurens B., Dossat C., Franck W.L., Chang W.S., Saunders E.,
RA   Bruce D., Richardson P., Normand P., Dreyfus B., Pignol D., Stacey G.,
RA   Emerich D., Vermeglio A., Medigue C., Sadowsky M.;
RT   "Legumes symbioses: absence of Nod genes in photosynthetic bradyrhizobia";
RL   Science, e1252229 316(5829):1307-1312(2007).
XX
RN   [2]
RP   1-8264687
RG   US DOE Joint Genome Institute
RA   Giraud E., Moulin L., Vallenet D., Barbe V., Cytrin E., Avarre J.-C.,
RA   Jaubert M., Simon D., Cartieaux F., Prin Y., Bena G., Hannibal L.,
RA   Fardoux J., Kojadinovic M., Vuillet L., Lajus A., Cruveiller S., Rouy Z.,
RA   Mangenot S., Segurens B., Dossat C., Franck W.L., Chang W.-S., Saunders E.,
RA   Bruce D., Richardson P., Normand P., Dreyfus B., Pignol D., Stacey G.,
RA   Emerich D., Vermeglio A., Medigue C., Sadowsky M.;
RT   "Rhizobial Nod Factors are not Universally Required for Legume Nodulation";
RL   Unpublished.
XX
RN   [3]
RP   1-8264687
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Saunders E., Brettin T., Bruce D., Han C., Tapia R., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Richardson P.;
RT   ;
RL   Submitted (05-DEC-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; f39646fd9ecb37bf5661a9e5e52c0010.
DR   BioSample; SAMN02598359.
DR   EnsemblGenomes-Gn; BBta_miscRNA7.
DR   EnsemblGenomes-Gn; BBta_miscRNA8.
DR   EnsemblGenomes-Gn; BBta_rRNA16S1.
DR   EnsemblGenomes-Gn; BBta_rRNA16S2.
DR   EnsemblGenomes-Gn; BBta_rRNA23S1.
DR   EnsemblGenomes-Gn; BBta_rRNA23S2.
DR   EnsemblGenomes-Gn; BBta_rRNA5S1.
DR   EnsemblGenomes-Gn; BBta_rRNA5S2.
DR   EnsemblGenomes-Gn; BBta_tRNA1.
DR   EnsemblGenomes-Gn; BBta_tRNA10.
DR   EnsemblGenomes-Gn; BBta_tRNA11.
DR   EnsemblGenomes-Gn; BBta_tRNA12.
DR   EnsemblGenomes-Gn; BBta_tRNA13.
DR   EnsemblGenomes-Gn; BBta_tRNA14.
DR   EnsemblGenomes-Gn; BBta_tRNA15.
DR   EnsemblGenomes-Gn; BBta_tRNA16.
DR   EnsemblGenomes-Gn; BBta_tRNA17.
DR   EnsemblGenomes-Gn; BBta_tRNA18.
DR   EnsemblGenomes-Gn; BBta_tRNA19.
DR   EnsemblGenomes-Gn; BBta_tRNA2.
DR   EnsemblGenomes-Gn; BBta_tRNA20.
DR   EnsemblGenomes-Gn; BBta_tRNA21.
DR   EnsemblGenomes-Gn; BBta_tRNA22.
DR   EnsemblGenomes-Gn; BBta_tRNA23.
DR   EnsemblGenomes-Gn; BBta_tRNA24.
DR   EnsemblGenomes-Gn; BBta_tRNA25.
DR   EnsemblGenomes-Gn; BBta_tRNA26.
DR   EnsemblGenomes-Gn; BBta_tRNA27.
DR   EnsemblGenomes-Gn; BBta_tRNA28.
DR   EnsemblGenomes-Gn; BBta_tRNA29.
DR   EnsemblGenomes-Gn; BBta_tRNA3.
DR   EnsemblGenomes-Gn; BBta_tRNA30.
DR   EnsemblGenomes-Gn; BBta_tRNA31.
DR   EnsemblGenomes-Gn; BBta_tRNA32.
DR   EnsemblGenomes-Gn; BBta_tRNA33.
DR   EnsemblGenomes-Gn; BBta_tRNA34.
DR   EnsemblGenomes-Gn; BBta_tRNA35.
DR   EnsemblGenomes-Gn; BBta_tRNA36.
DR   EnsemblGenomes-Gn; BBta_tRNA37.
DR   EnsemblGenomes-Gn; BBta_tRNA38.
DR   EnsemblGenomes-Gn; BBta_tRNA39.
DR   EnsemblGenomes-Gn; BBta_tRNA4.
DR   EnsemblGenomes-Gn; BBta_tRNA40.
DR   EnsemblGenomes-Gn; BBta_tRNA41.
DR   EnsemblGenomes-Gn; BBta_tRNA42.
DR   EnsemblGenomes-Gn; BBta_tRNA43.
DR   EnsemblGenomes-Gn; BBta_tRNA44.
DR   EnsemblGenomes-Gn; BBta_tRNA45.
DR   EnsemblGenomes-Gn; BBta_tRNA46.
DR   EnsemblGenomes-Gn; BBta_tRNA47.
DR   EnsemblGenomes-Gn; BBta_tRNA48.
DR   EnsemblGenomes-Gn; BBta_tRNA49.
DR   EnsemblGenomes-Gn; BBta_tRNA5.
DR   EnsemblGenomes-Gn; BBta_tRNA50.
DR   EnsemblGenomes-Gn; BBta_tRNA51.
DR   EnsemblGenomes-Gn; BBta_tRNA52.
DR   EnsemblGenomes-Gn; BBta_tRNA6.
DR   EnsemblGenomes-Gn; BBta_tRNA7.
DR   EnsemblGenomes-Gn; BBta_tRNA8.
DR   EnsemblGenomes-Gn; BBta_tRNA9.
DR   EnsemblGenomes-Gn; EBG00001114225.
DR   EnsemblGenomes-Gn; EBG00001114226.
DR   EnsemblGenomes-Gn; EBG00001114227.
DR   EnsemblGenomes-Gn; EBG00001114228.
DR   EnsemblGenomes-Gn; EBG00001114229.
DR   EnsemblGenomes-Gn; EBG00001114230.
DR   EnsemblGenomes-Gn; EBG00001114231.
DR   EnsemblGenomes-Gn; EBG00001114232.
DR   EnsemblGenomes-Gn; EBG00001114233.
DR   EnsemblGenomes-Gn; EBG00001114234.
DR   EnsemblGenomes-Gn; EBG00001114235.
DR   EnsemblGenomes-Gn; EBG00001114236.
DR   EnsemblGenomes-Gn; EBG00001114237.
DR   EnsemblGenomes-Gn; EBG00001114238.
DR   EnsemblGenomes-Gn; EBG00001114239.
DR   EnsemblGenomes-Gn; EBG00001114240.
DR   EnsemblGenomes-Gn; EBG00001114241.
DR   EnsemblGenomes-Gn; EBG00001114242.
DR   EnsemblGenomes-Gn; EBG00001114243.
DR   EnsemblGenomes-Gn; EBG00001114244.
DR   EnsemblGenomes-Gn; EBG00001114245.
DR   EnsemblGenomes-Gn; EBG00001114246.
DR   EnsemblGenomes-Gn; EBG00001114247.
DR   EnsemblGenomes-Gn; EBG00001114248.
DR   EnsemblGenomes-Gn; EBG00001114249.
DR   EnsemblGenomes-Gn; EBG00001114250.
DR   EnsemblGenomes-Gn; EBG00001114251.
DR   EnsemblGenomes-Gn; EBG00001114252.
DR   EnsemblGenomes-Gn; EBG00001114253.
DR   EnsemblGenomes-Gn; EBG00001114254.
DR   EnsemblGenomes-Gn; EBG00001114255.
DR   EnsemblGenomes-Gn; EBG00001114256.
DR   EnsemblGenomes-Gn; EBG00001114257.
DR   EnsemblGenomes-Gn; EBG00001114258.
DR   EnsemblGenomes-Gn; EBG00001114259.
DR   EnsemblGenomes-Gn; EBG00001114260.
DR   EnsemblGenomes-Gn; EBG00001114261.
DR   EnsemblGenomes-Gn; EBG00001114262.
DR   EnsemblGenomes-Gn; EBG00001114263.
DR   EnsemblGenomes-Gn; EBG00001114264.
DR   EnsemblGenomes-Gn; EBG00001114265.
DR   EnsemblGenomes-Gn; EBG00001114266.
DR   EnsemblGenomes-Gn; EBG00001114267.
DR   EnsemblGenomes-Gn; EBG00001114268.
DR   EnsemblGenomes-Gn; EBG00001114269.
DR   EnsemblGenomes-Gn; EBG00001114270.
DR   EnsemblGenomes-Gn; EBG00001114271.
DR   EnsemblGenomes-Gn; EBG00001114272.
DR   EnsemblGenomes-Gn; EBG00001114273.
DR   EnsemblGenomes-Gn; EBG00001114274.
DR   EnsemblGenomes-Gn; EBG00001114275.
DR   EnsemblGenomes-Gn; EBG00001114276.
DR   EnsemblGenomes-Gn; EBG00001114277.
DR   EnsemblGenomes-Gn; EBG00001114278.
DR   EnsemblGenomes-Gn; EBG00001114279.
DR   EnsemblGenomes-Gn; EBG00001114280.
DR   EnsemblGenomes-Gn; EBG00001114281.
DR   EnsemblGenomes-Gn; EBG00001114282.
DR   EnsemblGenomes-Gn; EBG00001114283.
DR   EnsemblGenomes-Gn; EBG00001114284.
DR   EnsemblGenomes-Gn; EBG00001114285.
DR   EnsemblGenomes-Gn; EBG00001114286.
DR   EnsemblGenomes-Gn; EBG00001114287.
DR   EnsemblGenomes-Gn; EBG00001114288.
DR   EnsemblGenomes-Gn; EBG00001114289.
DR   EnsemblGenomes-Gn; EBG00001114290.
DR   EnsemblGenomes-Gn; EBG00001114291.
DR   EnsemblGenomes-Gn; EBG00001114292.
DR   EnsemblGenomes-Gn; EBG00001114293.
DR   EnsemblGenomes-Gn; EBG00001114294.
DR   EnsemblGenomes-Tr; BBta_miscRNA7-1.
DR   EnsemblGenomes-Tr; BBta_miscRNA8-1.
DR   EnsemblGenomes-Tr; BBta_rRNA16S1-1.
DR   EnsemblGenomes-Tr; BBta_rRNA16S2-1.
DR   EnsemblGenomes-Tr; BBta_rRNA23S1-1.
DR   EnsemblGenomes-Tr; BBta_rRNA23S2-1.
DR   EnsemblGenomes-Tr; BBta_rRNA5S1-1.
DR   EnsemblGenomes-Tr; BBta_rRNA5S2-1.
DR   EnsemblGenomes-Tr; BBta_tRNA1-1.
DR   EnsemblGenomes-Tr; BBta_tRNA10-1.
DR   EnsemblGenomes-Tr; BBta_tRNA11-1.
DR   EnsemblGenomes-Tr; BBta_tRNA12-1.
DR   EnsemblGenomes-Tr; BBta_tRNA13-1.
DR   EnsemblGenomes-Tr; BBta_tRNA14-1.
DR   EnsemblGenomes-Tr; BBta_tRNA15-1.
DR   EnsemblGenomes-Tr; BBta_tRNA16-1.
DR   EnsemblGenomes-Tr; BBta_tRNA17-1.
DR   EnsemblGenomes-Tr; BBta_tRNA18-1.
DR   EnsemblGenomes-Tr; BBta_tRNA19-1.
DR   EnsemblGenomes-Tr; BBta_tRNA2-1.
DR   EnsemblGenomes-Tr; BBta_tRNA20-1.
DR   EnsemblGenomes-Tr; BBta_tRNA21-1.
DR   EnsemblGenomes-Tr; BBta_tRNA22-1.
DR   EnsemblGenomes-Tr; BBta_tRNA23-1.
DR   EnsemblGenomes-Tr; BBta_tRNA24-1.
DR   EnsemblGenomes-Tr; BBta_tRNA25-1.
DR   EnsemblGenomes-Tr; BBta_tRNA26-1.
DR   EnsemblGenomes-Tr; BBta_tRNA27-1.
DR   EnsemblGenomes-Tr; BBta_tRNA28-1.
DR   EnsemblGenomes-Tr; BBta_tRNA29-1.
DR   EnsemblGenomes-Tr; BBta_tRNA3-1.
DR   EnsemblGenomes-Tr; BBta_tRNA30-1.
DR   EnsemblGenomes-Tr; BBta_tRNA31-1.
DR   EnsemblGenomes-Tr; BBta_tRNA32-1.
DR   EnsemblGenomes-Tr; BBta_tRNA33-1.
DR   EnsemblGenomes-Tr; BBta_tRNA34-1.
DR   EnsemblGenomes-Tr; BBta_tRNA35-1.
DR   EnsemblGenomes-Tr; BBta_tRNA36-1.
DR   EnsemblGenomes-Tr; BBta_tRNA37-1.
DR   EnsemblGenomes-Tr; BBta_tRNA38-1.
DR   EnsemblGenomes-Tr; BBta_tRNA39-1.
DR   EnsemblGenomes-Tr; BBta_tRNA4-1.
DR   EnsemblGenomes-Tr; BBta_tRNA40-1.
DR   EnsemblGenomes-Tr; BBta_tRNA41-1.
DR   EnsemblGenomes-Tr; BBta_tRNA42-1.
DR   EnsemblGenomes-Tr; BBta_tRNA43-1.
DR   EnsemblGenomes-Tr; BBta_tRNA44-1.
DR   EnsemblGenomes-Tr; BBta_tRNA45-1.
DR   EnsemblGenomes-Tr; BBta_tRNA46-1.
DR   EnsemblGenomes-Tr; BBta_tRNA47-1.
DR   EnsemblGenomes-Tr; BBta_tRNA48-1.
DR   EnsemblGenomes-Tr; BBta_tRNA49-1.
DR   EnsemblGenomes-Tr; BBta_tRNA5-1.
DR   EnsemblGenomes-Tr; BBta_tRNA50-1.
DR   EnsemblGenomes-Tr; BBta_tRNA51-1.
DR   EnsemblGenomes-Tr; BBta_tRNA52-1.
DR   EnsemblGenomes-Tr; BBta_tRNA6-1.
DR   EnsemblGenomes-Tr; BBta_tRNA7-1.
DR   EnsemblGenomes-Tr; BBta_tRNA8-1.
DR   EnsemblGenomes-Tr; BBta_tRNA9-1.
DR   EnsemblGenomes-Tr; EBT00001705402.
DR   EnsemblGenomes-Tr; EBT00001705403.
DR   EnsemblGenomes-Tr; EBT00001705404.
DR   EnsemblGenomes-Tr; EBT00001705405.
DR   EnsemblGenomes-Tr; EBT00001705406.
DR   EnsemblGenomes-Tr; EBT00001705407.
DR   EnsemblGenomes-Tr; EBT00001705408.
DR   EnsemblGenomes-Tr; EBT00001705410.
DR   EnsemblGenomes-Tr; EBT00001705411.
DR   EnsemblGenomes-Tr; EBT00001705413.
DR   EnsemblGenomes-Tr; EBT00001705414.
DR   EnsemblGenomes-Tr; EBT00001705415.
DR   EnsemblGenomes-Tr; EBT00001705416.
DR   EnsemblGenomes-Tr; EBT00001705417.
DR   EnsemblGenomes-Tr; EBT00001705419.
DR   EnsemblGenomes-Tr; EBT00001705420.
DR   EnsemblGenomes-Tr; EBT00001705421.
DR   EnsemblGenomes-Tr; EBT00001705423.
DR   EnsemblGenomes-Tr; EBT00001705425.
DR   EnsemblGenomes-Tr; EBT00001705426.
DR   EnsemblGenomes-Tr; EBT00001705428.
DR   EnsemblGenomes-Tr; EBT00001705429.
DR   EnsemblGenomes-Tr; EBT00001705430.
DR   EnsemblGenomes-Tr; EBT00001705431.
DR   EnsemblGenomes-Tr; EBT00001705432.
DR   EnsemblGenomes-Tr; EBT00001705433.
DR   EnsemblGenomes-Tr; EBT00001705434.
DR   EnsemblGenomes-Tr; EBT00001705435.
DR   EnsemblGenomes-Tr; EBT00001705436.
DR   EnsemblGenomes-Tr; EBT00001705437.
DR   EnsemblGenomes-Tr; EBT00001705438.
DR   EnsemblGenomes-Tr; EBT00001705439.
DR   EnsemblGenomes-Tr; EBT00001705440.
DR   EnsemblGenomes-Tr; EBT00001705441.
DR   EnsemblGenomes-Tr; EBT00001705442.
DR   EnsemblGenomes-Tr; EBT00001705443.
DR   EnsemblGenomes-Tr; EBT00001705444.
DR   EnsemblGenomes-Tr; EBT00001705445.
DR   EnsemblGenomes-Tr; EBT00001705446.
DR   EnsemblGenomes-Tr; EBT00001705447.
DR   EnsemblGenomes-Tr; EBT00001705448.
DR   EnsemblGenomes-Tr; EBT00001705449.
DR   EnsemblGenomes-Tr; EBT00001705450.
DR   EnsemblGenomes-Tr; EBT00001705451.
DR   EnsemblGenomes-Tr; EBT00001705452.
DR   EnsemblGenomes-Tr; EBT00001705453.
DR   EnsemblGenomes-Tr; EBT00001705454.
DR   EnsemblGenomes-Tr; EBT00001705455.
DR   EnsemblGenomes-Tr; EBT00001705456.
DR   EnsemblGenomes-Tr; EBT00001705457.
DR   EnsemblGenomes-Tr; EBT00001705459.
DR   EnsemblGenomes-Tr; EBT00001705460.
DR   EnsemblGenomes-Tr; EBT00001705461.
DR   EnsemblGenomes-Tr; EBT00001705463.
DR   EnsemblGenomes-Tr; EBT00001705465.
DR   EnsemblGenomes-Tr; EBT00001705466.
DR   EnsemblGenomes-Tr; EBT00001705467.
DR   EnsemblGenomes-Tr; EBT00001705469.
DR   EnsemblGenomes-Tr; EBT00001705471.
DR   EnsemblGenomes-Tr; EBT00001705472.
DR   EnsemblGenomes-Tr; EBT00001705474.
DR   EnsemblGenomes-Tr; EBT00001705475.
DR   EnsemblGenomes-Tr; EBT00001705476.
DR   EnsemblGenomes-Tr; EBT00001705477.
DR   EnsemblGenomes-Tr; EBT00001705478.
DR   EnsemblGenomes-Tr; EBT00001705479.
DR   EnsemblGenomes-Tr; EBT00001705480.
DR   EnsemblGenomes-Tr; EBT00001705482.
DR   EnsemblGenomes-Tr; EBT00001705484.
DR   EnsemblGenomes-Tr; EBT00001705486.
DR   EuropePMC; PMC2394895; 18326675.
DR   EuropePMC; PMC3489047; 22335393.
DR   EuropePMC; PMC4393458; 25710371.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00435; ROSE.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01059; mir-598.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01723; Rhizobiales-2.
DR   RFAM; RF01736; flg-Rhizobiales.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   SILVA-LSU; CP000494.
DR   SILVA-SSU; CP000494.
DR   StrainInfo; 121600; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000390
CC   Source DNA and bacteria available from Michael Sadowsky
CC   (sadowsky@umn.edu)
CC   Bacteria available from ATCC: ATCC BAA-1182
CC   Contacts: Eric Giraud (giraud@mpl.ird.fr)
CC        Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8264687
FT                   /organism="Bradyrhizobium sp. BTAi1"
FT                   /strain="BTAi1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:288000"
FT   gene            571..1998
FT                   /gene="dnaA"
FT                   /locus_tag="BBta_0001"
FT   CDS_pept        571..1998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BBta_0001"
FT                   /product="Chromosomal replication initiator protein"
FT                   /function="DNA replication; Nucleoproteins, basic proteins;
FT                   Regulon (a network of operons encoding related functions);
FT                   Cytoplasm"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32306"
FT                   /db_xref="GOA:A5E812"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E812"
FT                   /protein_id="ABQ32306.1"
FT                   /translation="MTNSEQERWSRVKGRLRSTVGEDVYTSWFARMDLEAVQDESVHLS
FT                   VPTRFLKSWIQAHYAERVLSCWQAEMPEVHRIDLSVRTAMRCATPAKEAPVAVEARRAE
FT                   RGDAKPADTRAPVMTPVAASHDALGGSPLDPRLTFASFVVGRANTLAHAAARQVADGRR
FT                   GDPVMFNPLYIHAGVGLGKTHLLQAVTWAGNAGGERKVLYLTAEKFMYGFVAALKSQTA
FT                   LAFKEALRGIDVLVIDDLQFLQGKSTQAEFCHTLNALIDAGRQVVIAADRPPSDLESLD
FT                   DRVRSRLAGGLVVEMATLGEDLRLGILKSRVAAARAHHASFDVPEPVLDYLARSITHNG
FT                   RDLEGAINRLLAHSKLNNQPVTLDMAEREVRDLVRPQEPKRIKIEDIQRVVARQYNVSR
FT                   SDLLSSRRTANVVRPRQVAMYLAKTLTLRSLPEIGRRFGGRDHTTVLHAVRKIEALVGK
FT                   DTTLNDEVEALKRQLQD"
FT   gene            2294..3412
FT                   /gene="dnaN"
FT                   /locus_tag="BBta_0002"
FT   CDS_pept        2294..3412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BBta_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /function="DNA replication; Cytoplasm"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32307"
FT                   /db_xref="GOA:A5E813"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A5E813"
FT                   /protein_id="ABQ32307.1"
FT                   /translation="MKVTVERAQLLKSLGHVHRVVERRNTIPILGNVLVRAENARLSLR
FT                   ATDLDLEVTETLAAETATAGATTVPAHMFYDIVRKLPDGSQIVLESDGERAVLAIRAGR
FT                   SKFTLQTLPESDFPDLAAGDMTHAFGVPAKDIKSLIDRTQFAISTEETRYYLNGIYLHA
FT                   GGTAKQPSLRAVATDGHRLAQVDLPQPAGAAEMPGVIVPRKTVGEVQRLIEDNDSEIRI
FT                   ELSQGKIRFTLGQVVLTSKLIDGTFPDYGRVIPQNNDKELIVDKADFAAAVDRVSTISS
FT                   ERGRAVKLALSPGRLVLSVTNPDSGSATEELEVEYAADALDIGFNSRYLLDIAAQIEGE
FT                   VAVLRLADPGSPTLIQDRDNRNALYVLMPMRV"
FT   gene            3484..3771
FT                   /locus_tag="BBta_0003"
FT   CDS_pept        3484..3771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0003"
FT                   /product="putative Excinuclease ABC, C subunit"
FT                   /function="DNA repair"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32308"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A5E814"
FT                   /protein_id="ABQ32308.1"
FT                   /translation="MANWVYILASKPGGTLYIGVTNDLIRRVYEHREGLAESSTRRYGI
FT                   KRRVYFEAHETIAAALQREKNIKHWSREWKIDLIVASNPDWRDLYDEIVR"
FT   gene            3835..4971
FT                   /gene="recF"
FT                   /locus_tag="BBta_0004"
FT   CDS_pept        3835..4971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="BBta_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /function="DNA replication; DNA recombination; DNA repair"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32309"
FT                   /db_xref="GOA:A5E815"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E815"
FT                   /protein_id="ABQ32309.1"
FT                   /translation="MTPSRINRLALTHFRSYRAASVSVQADMVALVGANGAGKTNCLEA
FT                   ISFFAPGRGLRRATLEDVADNQGDGSWAISAEIEGALGLATFGTGIEPPRNDAAIVRRC
FT                   RIDREPVGSAAAFGDHIRMVWLTPAMDGLFMGAASERRRFFDRLVLAIDSEHSSRVSAL
FT                   ERSLRSRNRLLEVRNFDDHWCDAIERETAELAVAVAASRGQTAVKLAAMLRQRGQASAF
FT                   PSAEIALAGWMENALLTEPALAVEDRYRALLRDNRARDAAAGRTLDGPHLTDLHVIYAP
FT                   KSMPARDASTGEQKALLIGLILAHATLVAETTGIVPMLLLDEIVAHLDPGRRTALFAEL
FT                   GTLGAQVWLTGADPAAFAELRELGEIFDVEGGRISARR"
FT   gene            5084..5455
FT                   /locus_tag="BBta_0005"
FT   CDS_pept        5084..5455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0005"
FT                   /product="putative transposase"
FT                   /function="transposases"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32310"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A5E816"
FT                   /protein_id="ABQ32310.1"
FT                   /translation="MARFDLSDTEWTIIAPLLPGAEGKKNGRPRPDDRKVLNGIFFVLR
FT                   TGTPWRDLPERYGPYTTAYNRFNRWAKKGIWLQIFEALAAKSPQSLQLIDSSIIRAHQH
FT                   AAGGKKGARITPSAVLVED"
FT   gene            5491..5856
FT                   /locus_tag="BBta_0006"
FT   CDS_pept        5491..5856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0006"
FT                   /product="putative transposase"
FT                   /function="transposases"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32311"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A5E817"
FT                   /protein_id="ABQ32311.1"
FT                   /translation="MPVHIVLSQGQSSDKTVAPPLIEAVEPGRDLVADRGYDARALIDL
FT                   VESRGGRAHIPTCRDRKVQRSVDPALYRQRNLIERFFNKLKHFRRIATRYDKSARNFLS
FT                   AVLLASTRLWMRFESTT"
FT   gene            5840..8083
FT                   /locus_tag="BBta_0007"
FT   CDS_pept        5840..8083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0007"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32312"
FT                   /db_xref="UniProtKB/TrEMBL:A5E818"
FT                   /protein_id="ABQ32312.1"
FT                   /translation="MSPRPSCRWMTRSSRRRAPKPGAPRARTWSWRSVMTELWRQAIAG
FT                   PRLRLFACGLLLLTGCAVPAHADDAIVDVHGLPRLDGAVEDTSRPDRYRVVYRVPMLAA
FT                   AANPATQQLLAADGWVRYVRPLDERSALLNYKKGKQGLTVYLSGSAGHPGQSDVTYSPQ
FT                   RIYADLPFADGAVDLVFDETRPYLSCVVPMALDAAKALYAKDMIAIGWKPLAPEAAARW
FT                   PNADLSETMPGGVRAFYGRDDNDGSRRQSPVMLTLTRRDDGRTNVEVRVAPFALPAELE
FT                   AGEERAGLPMPKPTKWSQSLGGATSPSRQAKGAVIAELPAVLAFYTRELPARGWRIEAA
FT                   APGTANDVTLKVASAEETGTLRLSRNYDLTMVELSVRATEAALAARAKAKKDADDRFMA
FT                   DAAAMAKQVIAADEARRSAQVGAMSDAPLKALAGNPAPIPLPETAEAVEFDGSQGRLEF
FT                   KSTSSVRALTGFYRATLKPAGWKEAPTVIDNPTMARLEFSTKGKAVAFTIMQMGPKVNV
FT                   TADGTGLVAAAGPTAAAQPAPAAAPLEADPSSALPVPKERSATSMGRSKAPGIDTPVRL
FT                   ELEASVPAELKAVVAFYRSELAKLGWQETPQSAQISVDSARLAFASPQGPAVLTLGRAR
FT                   GETSVNLVQKNADAAAKAEILPKPGQSKLMLGNVGDADAVLTINKQTVKIAAGIGSPKT
FT                   PKGPLLDLPPGKYRYEIKIAGRAPVSDTIALGAGDTWGLMVGPTGRALPLPLY"
FT   gene            8418..10856
FT                   /gene="gyrB"
FT                   /gene_synonym="acrB"
FT                   /gene_synonym="Cou"
FT                   /gene_synonym="himB"
FT                   /gene_synonym="hisU"
FT                   /locus_tag="BBta_0008"
FT   CDS_pept        8418..10856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /gene_synonym="acrB"
FT                   /gene_synonym="Cou"
FT                   /gene_synonym="himB"
FT                   /gene_synonym="hisU"
FT                   /locus_tag="BBta_0008"
FT                   /product="DNA gyrase subunit B"
FT                   /function="DNA replication; Transcription related; DNA
FT                   bending, supercoiling, inversion; Cytoplasm"
FT                   /EC_number="5.99.1.3"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32313"
FT                   /db_xref="GOA:A5E819"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5E819"
FT                   /protein_id="ABQ32313.1"
FT                   /translation="MTEPARQTIADNEPATANDYGAESIRVLKGLDAVRKRPGMYIGDT
FT                   DDGSGLHHMVYEVVDNAIDEALAGYASRVEVVLNADNSVTVRDDGRGIPVDIHKGEGVS
FT                   AAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSSKLQLRIWREDKEHLIEFAHG
FT                   DAVAPLKVVGEAQGRRGTEVTFLASTETFKMVEYDYATLEHRLRELAFLNSGVHIVLSD
FT                   MRHAVEKREEMFYSGGVEEFVRYLDRNKKAIVPSPIMVRSEVNGITVEAALWWNDSYHE
FT                   NVLCFTNNIPQRDGGTHLAGFRGALTRQVNGYADAHAKKEKIALTGDDCREGLTAVLSV
FT                   KVPDPKFSSQTKDKLVSSEVRPVVENVINEALSAWFEEHPSEAKTVVGKVIQAAAAREA
FT                   ARKARELTRKNPLNNIASLPGKLADCQEKDPAKSELFIVEGDSAGGSAKQGRNREFQAV
FT                   LPLRGKILNVERVRPDKMLSSEQIGTLITALGTGISDDFSIDKLRYHKIIVMTDADVDG
FT                   AHIRTLLLTFFYRQMRQIIDRGHLYIAQPPLYKVTRGKSEQYLKDERALEDYLIGTGLD
FT                   DCVFKSAEGEERKGRDLLALVEEARIVRNILRNLHSRYDRTVVEQAAIAGVLRADITRD
FT                   IATADAAAEYIAKRLDVLADEVERGWIGHFVEGQGFTFERTVRGVKDVAVIDDALLASA
FT                   DARKLDDYAARLQEAYAKPGFLRRGDAPTVIHGPIDLFEAVTDAGRKGIAMQRYKGLGE
FT                   MNPQQLWETTLDTEARTLLQVKVKEVDEADDIFTKLMGDVVEPRREFIQDNSLSANVDV
FT                   "
FT   gene            10897..11634
FT                   /locus_tag="BBta_0009"
FT   CDS_pept        10897..11634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0009"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32314"
FT                   /db_xref="UniProtKB/TrEMBL:A5E820"
FT                   /protein_id="ABQ32314.1"
FT                   /translation="MAISLKKLSPALFPLLLGHAPASATSPSFDCSRAKSSDEKLICED
FT                   DHLAELDQAVAIAFKQALTAKKADAADVKTSAKERLDDRRACGAEQICILDAQVKAISL
FT                   FGEMGSNVPVPPWIGEYRLNYAKVHPAVMDEKLPQMRGHCTRTQIASITGRFGETLKFP
FT                   LSKDDEVSGTAVKYTNDIYQISYGYEEDVARSHIGDQVLLCLSSIPRNCPPGDNRGREY
FT                   SATNLTSRTSWIMPDSQHMCGGP"
FT   gene            complement(11652..12029)
FT                   /locus_tag="BBta_0010"
FT   CDS_pept        complement(11652..12029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0010"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32315"
FT                   /db_xref="UniProtKB/TrEMBL:A5E821"
FT                   /protein_id="ABQ32315.1"
FT                   /translation="MSWAAGTLIFTVGAVMIEVVTVSERKARETARRQRAADAVMVELK
FT                   AFAQRCGGHFSVFGSVAQQRLSFDSDFDVIVDIPPEQEVAAVELVEDLCRQHGLPTDIR
FT                   LKSHANERLLARVADYAVILP"
FT   gene            12179..13474
FT                   /gene="murA"
FT                   /locus_tag="BBta_0011"
FT   CDS_pept        12179..13474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="BBta_0011"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /function="Peptidoglycan (murein); Peptidoglycan (murein);
FT                   Cell division; Cell cycle physiology"
FT                   /EC_number="2.5.1.7"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32316"
FT                   /db_xref="GOA:A5E822"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:A5E822"
FT                   /protein_id="ABQ32316.1"
FT                   /translation="MAPIQYIVEGGHRLKGAIEPSGNKNAALPIIAAALLTEHPVTLDN
FT                   VPRIRDTETLVELVRSVGASAEWRGRNRLAIHAKEIRAADLDPDLCARIRASILLAGPL
FT                   LARCGEVALPPPGGDVIGRRRLDTHFLAFEQLGATVTATDKIELRASGLKGADVFLDEP
FT                   SVTATENALVAAVAAHGTTYLRNAASEPHVQDLAHFLVALGANIEGIGTNTMVIHGAST
FT                   LGQASYAIQPDHIEVGSLIGLAAVTRSPLRIVRAGTEHLRSIRMGFERLGIVCEVAGDD
FT                   LIVPSDQTMKIKDDFGGHVPKLEDQPWPAFPADLMSIAIVTATQCEGVILMFEKMFESR
FT                   MFFVDKLISMGARIVLCDPHRAIVSGPSRLRGARVVSPDIRAGMAMLLAALCAEGTSKI
FT                   DNADQIERGYERIDERLNALGAKITRVPERGR"
FT   gene            13615..14094
FT                   /locus_tag="BBta_0012"
FT   CDS_pept        13615..14094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0012"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32317"
FT                   /db_xref="InterPro:IPR021295"
FT                   /db_xref="UniProtKB/TrEMBL:A5E823"
FT                   /protein_id="ABQ32317.1"
FT                   /translation="MTISEITPDVDRARWLADADFADAFRITVEAPALDARMAAERMLG
FT                   QAPAWMAALVKLRNLLVRPFGLKTSGADAQNPRPMIGMFPVVDETPQRIVLGFDDMHLD
FT                   FRVVIDAASHGKTSQVTATTLVQTHNALGRIYLTIIMPFHRLVAKTMLRQVAASA"
FT   gene            complement(14251..14688)
FT                   /locus_tag="BBta_0013"
FT   CDS_pept        complement(14251..14688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0013"
FT                   /product="putative Acetyltransferase, GNAT family"
FT                   /function="Transcription related"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32318"
FT                   /db_xref="GOA:A5E824"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5E824"
FT                   /protein_id="ABQ32318.1"
FT                   /translation="MTIVLEPVDDQLPIDFHQLELDARAGGHANMTRLSAEFAEAPSMF
FT                   HRVIAAHVDGVLAGIGAITDEPVPSTQPAWRMRRLYVHRDFRRRRVARTIVADLLRAPA
FT                   GEIEIVTVHAGSDDAARFWEAIGFDAVAGQGWSHQRRLRSA"
FT   gene            15547..16929
FT                   /locus_tag="BBta_0014"
FT   CDS_pept        15547..16929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0014"
FT                   /product="putative multidrug resistance protein norM"
FT                   /function="The Multi Antimicrobial Extrusion (MATE) Family;
FT                   Drug resistance/sensitivity"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 5 : Inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32319"
FT                   /db_xref="GOA:A5E825"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A5E825"
FT                   /protein_id="ABQ32319.1"
FT                   /translation="MTTAIGTDHAPPAAPAPSFALELWDTMRLAAPMALTQLSQIAMMS
FT                   TDLAFIGRLGGDAVAAAALAGTVYFVGSTFGMGLMSAVAPLAAQAYGASDAGLVRRALR
FT                   VGLWAGLFIALPIMLIALNGEAILLALGQAPGVAHLAQNYLAGLAWGIAPMLWFLALRS
FT                   FMGAVNRPEPVLWITLAAIPLNALLVYPLLYGQWGFPQLGLTGVGLATSTVNLGTFLAG
FT                   LWFATCRAPFRDYHVLARLQRIDWRLMRQLLVIGAPISLSFLLEYGLFSAAAILMGLIS
FT                   TAALAAHQIALQITAILFMVPFGISMAATVRVGHATGRNDAIGVRRAGLMAMLLGVSLA
FT                   VLFTVGIILARYDIVQLFLGSGLADAEATAALAATLLLVGTTFFITDALQTIAVGALRG
FT                   IKDTRVPLLLAVLGYWLIGFPASYVLGLRTALGATGIWIGLSLGTAIYAALLVMRFLRL
FT                   SR"
FT   gene            complement(16935..18077)
FT                   /locus_tag="BBta_0015"
FT   CDS_pept        complement(16935..18077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0015"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32320"
FT                   /db_xref="GOA:A5E826"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:A5E826"
FT                   /protein_id="ABQ32320.1"
FT                   /translation="MASFKELFGRVRARKAPMSLAVRGTVAATLAFAIATAFQLKLPLW
FT                   AVLTSLIVTQGSVGRSLKATRDYMFGTIGGAIYGGAITVFIPHSGELQLLGMLILAVTP
FT                   LAFIAAINPSLNAATVTAVIVLLVPTMGHLDPLGSAIDRVFEVAVGALTGLAVSFIVLP
FT                   SRAHVQMRSAAGRLLELIAAALAELLAGLSRGRDNDALHLIQDGIGAALTELNATGAEA
FT                   ERERAARLSSGADTGPLLRTILRLRHDVVMIGRASVVPLPSELQARLSGPVTRVSDAIA
FT                   SYLRGCAGAIRNGSGPPAIWPVHVALKAYAEAVAAVRSDGLTRGLPGDAAERFFALGFS
FT                   LDQMRQNLIDLERVVAEWAGASTGKPHRPQPEQTSDTAGA"
FT   gene            18198..19568
FT                   /locus_tag="BBta_0016"
FT   CDS_pept        18198..19568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0016"
FT                   /product="hypothetical protein"
FT                   /note="MmgE/PrpD family protein domain; Evidence: Similar
FT                   to previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32321"
FT                   /db_xref="GOA:A5E827"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="UniProtKB/TrEMBL:A5E827"
FT                   /protein_id="ABQ32321.1"
FT                   /translation="MAQETATLAAYVADLKYDDIPPEVLDRAKVLTLDFLGSAIRARRE
FT                   AESTPSVVKMLAALKLDSAGEATVFGDSRTWTPAVAALLNGTMGHSLDFDDTHADSSLH
FT                   PSAPVVPAAFAVGEMVGASGREVLTAIVAGYEVCCRLGNALDPTSHYARGFHPTATAGT
FT                   YGAAAAAGKLFGLSEQQLIYAFGVSGSQAAGSLQFLVNGAWNKRYQVGASAMNGVIAAT
FT                   LAKNDFVGAIESVEGKHGLLVGYTDTPHREKAVAGLGTTYETMKIGVKPYPSCRYTHAA
FT                   IDAIIALRREHNLTPDQVKRVEIGLHRNGITLTGDAATKRHPTSIVGGQFSMFFTGALA
FT                   LDQGRFGWDDYTRLGDAAINNLANKFDVVQDDKLEIGRSHPFGARVTITTEDGVHERLH
FT                   DDPSGEPTSFPSAQAMSDKFITLARPVLSSRAQHFADAILGLERFDRVAQATALGRA"
FT   gene            complement(19577..20983)
FT                   /locus_tag="BBta_0017"
FT   CDS_pept        complement(19577..20983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0017"
FT                   /product="putative 6-aminohexanoate-dimer hydrolase"
FT                   /EC_number="3.5.1.46"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32322"
FT                   /db_xref="GOA:A5E828"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A5E828"
FT                   /protein_id="ABQ32322.1"
FT                   /translation="MTRRRLLFAVFATTTLTALAVAVARARDVPQVATGFIASVVCSET
FT                   FVSGVDPDRILSETQAAMPGAGLLNWAMDVHVDRVAKDVTVTLLGLGRSHAVFAEGLGC
FT                   HLDHGEAQGWPTARPAAAQPAALPEIAPPHPVAPATPALAAALDRAFSEPESPPFRRTH
FT                   AVIVLKDGKVIAERYAPGFTLDTPLLGFSATKSMTATLIGILVRQGRLALHAPAPVAAW
FT                   RSEIDPRHAITIDHLLRHTAGLALGNSLQASLLSALEPVNRMKFVEADRAAFAESMPLE
FT                   TNPGAVFNYHDGNTVILSHLIRDAAGGSAADVLRFAHRELFDPLGMTSVTIEFDAAGTP
FT                   EGSSQMLASARDWARLGQLYLDDGVVGGRRILPAGWVDYVSTPTPDAFVGIGAGFWTNR
FT                   GDSFGANYRISHGWPRDAFFAKGTLGQYVIVIPSERLVIARFGRTVNWPPEVDGVARLV
FT                   SDVIAATHGE"
FT   gene            complement(21125..22201)
FT                   /locus_tag="BBta_0018"
FT   CDS_pept        complement(21125..22201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0018"
FT                   /product="transcriptional regulator, AraC family"
FT                   /function="Transcriptional level"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32323"
FT                   /db_xref="GOA:A5E829"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR016981"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A5E829"
FT                   /protein_id="ABQ32323.1"
FT                   /translation="MPLESLDLALRAAAIALLAVLAVSLGRDLGKQWSGRLAIALALGA
FT                   AAHALTFNIGGAAAPSLAVAPLIAVATAAIVVLWLFCRALFDDGFAPRWLHGLIWLAVF
FT                   GFSMISCLVLGPSGHVRLVIVANNLLALGFVGLALAQTVRSWSVDLVERRRRVRAVVVI
FT                   AALGYGGVNALLQIGTVGGGASELANVINAAMLLAVVGAVALMLLRVGAGDVFAVETPR
FT                   AMAVSEAAAAAATKAGETVANRRLVERLTRLMADERIYRQENVTIGALATRLGIPEYRL
FT                   RRLINSELGYRNFSSFLNSHRIAEAQAALADPAQAEVPVITIAMDAGFQSLGPFNRAFK
FT                   AVTGVTPTEYRRMRRSAA"
FT   gene            22342..23259
FT                   /locus_tag="BBta_0019"
FT   CDS_pept        22342..23259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0019"
FT                   /product="putative Pirin family protein"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32324"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A5E830"
FT                   /protein_id="ABQ32324.1"
FT                   /translation="MSWQPSIDPEFGDPASCDALEHVIVPRTRDLGDGFAVRRALPHGR
FT                   RQMVGPFIFFDHFGPVQFVSGKGMDVRPHPHIGLATVTYLFDGAIMHRDSEGNVQEIQP
FT                   GAMNLMTAGRGIAHSERTPDLQRQNGQSMLGLQSWIALPVESEEIAPSFQHYAADALPT
FT                   VSDTGFTARVIAGKAFGAASPVTMVSPWFYVEVTAQAGTVVPLDPDHEERAIYIVDGEI
FT                   EIARERHTGPRLLIFRPGDAISVRIVKPTRMMFLGGDALEGPRHVWWNFVSSSKERIEQ
FT                   AKQDWKTGRFAAVPQEHEFIPLPE"
FT   gene            23302..24216
FT                   /locus_tag="BBta_0020"
FT   CDS_pept        23302..24216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0020"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /function="Purine biosynthesis"
FT                   /EC_number="6.3.2.6"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32325"
FT                   /db_xref="GOA:A5E831"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:A5E831"
FT                   /protein_id="ABQ32325.1"
FT                   /translation="MTTLLASNLPLPKIGRGKVRDIYAVGDDRVLLLTTDRISAFDVVM
FT                   NETIPMKGAVLTQISAYWFNALEGVVHHHMISADTDAIIAEVPELAPHRQEILGRAMLC
FT                   KRTNVFPIECVIRGYLSGSAWKEYAASGTLAGEQLPAGLVESQKLEPAIFSPATKAETG
FT                   HDENITIARMREVVGDETAYTLESMTRAVYTLGETLAREQGIIIADTKFEFGRDKDGHI
FT                   ILIDEVMTPDSSRFWAVDAYKPGQPQPSFDKQPLRDYLDAERKAGRWNGEAPPPPLPQS
FT                   VVDATSQRYLEAFRRVTGRELNI"
FT   gene            complement(24573..24938)
FT                   /locus_tag="BBta_0022"
FT   CDS_pept        complement(24573..24938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0022"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32326"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039437"
FT                   /db_xref="UniProtKB/TrEMBL:A5E832"
FT                   /protein_id="ABQ32326.1"
FT                   /translation="MIAAVERYFDLMFDSNVEQFDRVFAPTARLHGLRESGLRVLTAAE
FT                   YRELLATTPSPQSKAAPRHQEILLIDLASPSQALAKVRVRIDQTLYLDYLCFHLIDGEW
FT                   LVTAKSFHIESRFLANG"
FT   gene            25173..25652
FT                   /locus_tag="BBta_0023"
FT   CDS_pept        25173..25652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0023"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /function="Isoleucine/valine; Leucine; Transcription
FT                   related; Nucleoproteins, basic proteins; Activator;
FT                   Repressor; Operon (regulation of one operon); Cytoplasm"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32327"
FT                   /db_xref="GOA:A5E833"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5E833"
FT                   /protein_id="ABQ32327.1"
FT                   /translation="MPKARLDAIDQRIIGELQADARLSNVDLADRVGLSPSPCLRRVKR
FT                   LEQEGVIQGYRAVLNRDSVGLGFSAFLAVKIEGHANEHAMAFEDTVCAMPEVLACHLVS
FT                   GDSDYLLEVVTADLEHYRHFLVERLLSLSIVREVRSNIAIQTRKAAAPLPLEQPR"
FT   gene            complement(25872..26549)
FT                   /locus_tag="BBta_0024"
FT   CDS_pept        complement(25872..26549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0024"
FT                   /product="hypothetical protein"
FT                   /note="nitroreductase family domain; Evidence: Similar to
FT                   previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32328"
FT                   /db_xref="GOA:A5E834"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A5E834"
FT                   /protein_id="ABQ32328.1"
FT                   /translation="MEFDDVILGRRSIRGYKPDPVPRALIEEILTLAMRAPSSMNTQPW
FT                   NFYVITGEPLNRIRAGNTERMLAGVPQSREFRIGEPFAGQHRERQIGVAKQLFSAMGIA
FT                   RDDKEKRQDWVLRGFRQFDAPVCIIVTYDRVLAGSDDTPFDCGAVTTALVNAAWSRGLG
FT                   AVINSQGIMQSPVVREHAGIADDQVIMKSIALGWPDHDFPANAVVSERKSVKEATVFVG
FT                   FDD"
FT   gene            complement(26671..27330)
FT                   /locus_tag="BBta_0025"
FT   CDS_pept        complement(26671..27330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0025"
FT                   /product="putative haloacid dehalogenase-like hydrolase
FT                   family protein"
FT                   /function="Carbon compound utilization"
FT                   /EC_number="3.1.3.18"
FT                   /note="putative Phosphoglycolate phosphatase; Evidence:
FT                   Function proposed based on presence of conserved amino acid
FT                   motif, structural feature or limited homology;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32329"
FT                   /db_xref="GOA:A5E835"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5E835"
FT                   /protein_id="ABQ32329.1"
FT                   /translation="MSPIHSVLLDLDGTLIDSRPGIAASTLAALRSLGHTPDDTLDVTA
FT                   FIGPPLQDMLRVLLQAHGGDRVDDAVAAYRQHYGDTGLFDCALYPGIRDALQAMHDAGL
FT                   RLATSKREMFARRILEHLGLASYFRAIHGSVPSGALDHKPELLAHILAERNIAAPDSLM
FT                   VGDRRHDVAGAHAVRTRSLGVLWGYGSRDELEAAGADRLVENPADLAGTVLAMLRR"
FT   gene            complement(27393..28097)
FT                   /locus_tag="BBta_0026"
FT   CDS_pept        complement(27393..28097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0026"
FT                   /product="putative uridine kinase"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32330"
FT                   /db_xref="GOA:A5E836"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E836"
FT                   /protein_id="ABQ32330.1"
FT                   /translation="MSMSSNRMAKLLDLARQISRLEIGHPMRVAVDGRTASGKTTLSDE
FT                   LAELIERSGRPVIRTSIDGFHRPKAQRYARGRFSALGYYNDARDLSAVRSLLLEPLAPG
FT                   GDRLYRTASFDLKRDVAIAQPSALAPVDAVLVVDGTFLQRPELRDHWDIVIFVETSRGV
FT                   SDARGLRRDRDRLGEQIAMKVYAERYGPAFDLYEETCDPARTADVVFNNDDVDDPILRI
FT                   RRGGRLSPDQHF"
FT   gene            complement(28209..29072)
FT                   /locus_tag="BBta_0027"
FT   CDS_pept        complement(28209..29072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0027"
FT                   /product="putative Aspartate/ornithine carbamoyltransferase
FT                   family protein"
FT                   /function="Arginine; Pyrimidine biosynthesis; Arginine
FT                   catabolism"
FT                   /EC_number="2.1.3.-"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32331"
FT                   /db_xref="GOA:A5E837"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A5E837"
FT                   /protein_id="ABQ32331.1"
FT                   /translation="MTSDRDILALGDLDGADILGMLTRAQELAACWHAREMPQTLAGRR
FT                   IALVVDDGGWRNTTAFDLGARSMGGLCVHVPIRLNATEAAEDLAAYLDNWFDAVVCRTP
FT                   ELEMLYALSHWAQAPVVNARTRQNHPCETLGDLAFLWHRHGAIDGLKIAVVAPAANILG
FT                   SWIEAAQVLPIEVVQVYPARWHAPGESPRFRVATDLGELQDADVIITDCWPRDDDAGDL
FT                   QDYQITAALLDGLRPDLDFLPCPPVTRGMEVSGDAMLHRACRVVQAKAFLLHAQNAALE
FT                   WVFGAL"
FT   gene            29208..30296
FT                   /locus_tag="BBta_0028"
FT   CDS_pept        29208..30296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0028"
FT                   /product="putative Mandelate racemase/muconate lactonizing
FT                   enzyme family protein"
FT                   /function="Tryptophan utilization"
FT                   /EC_number="5.1.2.2"
FT                   /EC_number="5.5.1.1"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32332"
FT                   /db_xref="GOA:A5E838"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034382"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A5E838"
FT                   /protein_id="ABQ32332.1"
FT                   /translation="MALIASIETGLYRIPLSVTLSDSTHGAMTAFELITCRVRDVDGAE
FT                   GVGYTYTVGRNGGAVADIVRREIPDLIAVHDADDTEAIWHRVWWGLHYGGRGGPVVLAL
FT                   SALDIALWDLKARRATLPLFKLLGGFDAGVPCYAGGIDLDLSNEALLKQTDDNLAKGFR
FT                   AIKMKVGRPDLGADVARVAAMREHLGDGFPLMADANMKWTVEEAIRAARALQPFDLTWL
FT                   EEPIIPDDIAGHARILAAGGVPIAAGENLRSLWDFKTYIASGALSYPEPDVTNCGGVTS
FT                   FMKIARLAEAFNLPVTSHGAHDVTVHLLAACPNRSFLEAHGFGLDRFIEHPLLLENGLA
FT                   LAPARPGHGITFDWEGLAKLAA"
FT   gene            complement(30314..30943)
FT                   /locus_tag="BBta_0029"
FT   CDS_pept        complement(30314..30943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0029"
FT                   /product="Putative Glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32333"
FT                   /db_xref="GOA:A5E839"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034345"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A5E839"
FT                   /protein_id="ABQ32333.1"
FT                   /translation="MMLYDCSTAPSPRRVRIFLAEKGLTLPTVQVDLRGGEQFTPAFRA
FT                   MNPGCTVPVLALDSGAAISDIIAICRYIEELHPEPALMGRDAEERALIECWVRRIEWDG
FT                   IYAIQEAFRNSMPGLEHRALPGPLPLEQIPALAERGRLRARHFLAWLDTRLADHAFVGG
FT                   AAFTIADISAMVTVDFAARAKLDPPEHLRHLRRWHQDVSSRPSAKA"
FT   gene            31212..33416
FT                   /locus_tag="BBta_0030"
FT   CDS_pept        31212..33416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0030"
FT                   /product="Putative sulfate transporter conatining a
FT                   cAMP-binding domain-like protein"
FT                   /function="Putative uncharacterized transport protein;
FT                   sulfate"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 5 : Inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32334"
FT                   /db_xref="GOA:A5E840"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A5E840"
FT                   /protein_id="ABQ32334.1"
FT                   /translation="MSNTVSATIGHSAARRGFEDILGGAAASVLTITYGLSYTLLIFAG
FT                   PLAPSLSHGLGITFTVSALMALVLALGSSLPFAIGAPDSSVAATTAILAGTIADRLAGA
FT                   APAAALLPVVLITFGFASLATGLILGGLGTTQLGRAIRYVPYPVVAGFLGATGALILLG
FT                   AISVVTGQQLELATLGAFASRQVLYELGAAAVMALVLYLTWHRSRWPFSLPLILIVATL
FT                   AAHAGFWLAGISPKAAQTLGWTFLPPQHVALAWPWTIDALSHYPWHALPALAGDIIAVI
FT                   FVTACSTLFNTTGIEVATHSEANIERELTVTGLGNILAASIGGYPGCISVSRTILNFSA
FT                   GGSGRLSGLTSATIALSMLVLAPSLLGYMPKFVLGGLLLYLGADTLYKWAVQSRRRLSL
FT                   IEYASLLAIIIIILKWGFIAGIVLGIVIGCTAFAFSAARINPIKYSFDGTEYRSSLDRS
FT                   REQQEILALHGGEIHGLNLQSYLFFGSANRLYRHVKARLQRRSECRFLVLDFRLVTGMD
FT                   SSAAYSFSQIKRLARDRHVQIAMAHLTPAIERTLRAGEFITKDVVITPELDHALERCEN
FT                   AIIARHQGHAQDEASLRDWFTAILGSDADASELMRRCERLDVPAGTTIVRAGDEAASMH
FT                   FILDGRVGVMVPAERGGTTRVRSLGRYTTIGEMGLVAHTPRSATIQAETDSVLYELSIP
FT                   QFDAITREHPALAQKLLTYFVTIMAERLSFANRTIAVLRR"
FT   gene            33663..34253
FT                   /locus_tag="BBta_0031"
FT   CDS_pept        33663..34253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0031"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32335"
FT                   /db_xref="UniProtKB/TrEMBL:A5E841"
FT                   /protein_id="ABQ32335.1"
FT                   /translation="MERVYHQSNLLGEWKGSWTANNQAVSFKVVNIRGAQATVEYTHHG
FT                   RTERGIGKVNGSTIDFGPVTLGTKNGKNAVLLFSAGGGKATAMLEKQAPPANESNLTGS
FT                   WAGYSADNGKSASFRVLAVKGNEAQVSVTTDGITRQGIGIVYKNVIMFGQSQISTNDGK
FT                   SGTVIYQVGNKSFMVPVNKLPAVSTSSSVDRSA"
FT   gene            complement(34256..35752)
FT                   /gene="gabD"
FT                   /locus_tag="BBta_0032"
FT   CDS_pept        complement(34256..35752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BBta_0032"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /function="Aminobutyrate catabolism; Putrescine catabolism"
FT                   /EC_number="1.2.1.16"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32336"
FT                   /db_xref="GOA:A5E842"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A5E842"
FT                   /protein_id="ABQ32336.1"
FT                   /translation="MTPTAATRTTPSATASLRERLKDGSLLREQCYIDGSWVGVPVFPV
FT                   NNPATGAELAKVAQLGAAETTQAVEAAARAFPAWAKLTAKQRSNLLRKWFELIVANRED
FT                   LALILTSEQGKPLNEALGEVDIGAAYIEFFAEEARRVYGETIPTQKPDARLLALKQPIG
FT                   VCGAITPWNFPNSMITRKVSPALAAGCTVVLKPANETPLSALALAVLAERAGIPKGVLN
FT                   IITGDAPPIGKVLCEHPAVRFVGFTGSTEVGKILYRQSAGTVKKLGLELGGNAPFVVFD
FT                   DADVDAAVEGAIVSKYRNMGQTCVCANRLYAQDGIYDAFVEKLAARVAAMKIGDGTEAG
FT                   VVQGPLINEEAVEKVERHIADAVKGGATIVTGGKRHALGRTFFEPTVLSNVKADALVAH
FT                   EETFGPLAPVIRFQSEADVIAMCNASPFGLASYFYARDLGRVWRVAEALESGMVGVNTG
FT                   LITTEVAPFGGVKESGLGREGSHHGIEEYLEIKYVMMAGV"
FT   gene            complement(35921..36241)
FT                   /locus_tag="BBta_0034"
FT   CDS_pept        complement(35921..36241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0034"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32337"
FT                   /db_xref="UniProtKB/TrEMBL:A5E843"
FT                   /protein_id="ABQ32337.1"
FT                   /translation="MISTWSEWKRYPRPGRGDNIEAPITPGIYEVRIAATGALYAFGAV
FT                   DNVAQALALLPVGQKSWFGRRDPAALPDLEYRTCATSTKADAKAAAERMIGRRETYMSG
FT                   AA"
FT   gene            36589..37782
FT                   /locus_tag="BBta_0035"
FT   CDS_pept        36589..37782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0035"
FT                   /product="putative beta-lactamase"
FT                   /function="Drug resistance/sensitivity"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32338"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A5E844"
FT                   /protein_id="ABQ32338.1"
FT                   /translation="MQNKTDIDRGLRQRAEAGEIPGVVAVAADSNGVIYEGAFGKRDLG
FT                   RDDPMTTDSVFWIASMTKAITCAAGMQLVEQGRLSLDAPIGEVLPDLAAPKVLDGFDAH
FT                   GEPILRPARTAITLRHLMTHTAGFCYDMWNGDMASYVQKAGTPGIITCKNDALTLPLAS
FT                   DPGTRWEYGINIDFVGKAVEAVSGVTLDRYLRDNLFAPLSMDDTGFKLGASQRARLVGM
FT                   HARGEDGALAPIPFEIEQEPEFHMGGGGLYGTAGDYIRFTRMILNNGRGNGNQVLKPET
FT                   VAAMRDNHIGELEMTKMAAAVPGVTNDVDLYPDIVKKWGLSFMITTAPTPEGRSAGSLA
FT                   WAGLANTYYWIDPARDVTGVILMQLLPFADRLCLETFAGFERAVYAGLDAAGGRKAA"
FT   gene            complement(37936..38937)
FT                   /locus_tag="BBta_0036"
FT   CDS_pept        complement(37936..38937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0036"
FT                   /product="putative pfkB family carbohydrate kinase"
FT                   /function="Nucleotide"
FT                   /EC_number="2.7.1.20"
FT                   /note="putative Adenosine kinase; Evidence: Function
FT                   proposed based on presence of conserved amino acid motif,
FT                   structural feature or limited homology; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32339"
FT                   /db_xref="GOA:A5E845"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A5E845"
FT                   /protein_id="ABQ32339.1"
FT                   /translation="MTDAKYDVLGIGNAIFDVLVHADEAFLAKHAMTKGSMALIDEARA
FT                   AAIYRDMGPATEMSGGSGANTIVGLASLGARAAYVGKVRDDQIGRMYSHDIRAAGVTFD
FT                   TAPATDGPATGCCYILVTPDGERTMNTYLGAAQNLTAADIDPAQIAAARIVYLEGYLWD
FT                   PKEAKEAFVKAATVAHDAGREVALTLSDSFCVDRYREEFLDLMRGGTVDIVFANEAELH
FT                   SLYQTSDFDGALKQLREDATLGIVTRSDKGCVVVSNDGVIAVPAHPIETLVDTTGAGDL
FT                   FAAGFLFGLVRKTGYEMAGRLGGLAAAEVIQHIGARPQVSLKELAAQNGLKA"
FT   gene            39008..40564
FT                   /locus_tag="BBta_0037"
FT   CDS_pept        39008..40564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0037"
FT                   /product="putative Virulence factor MviN-like protein"
FT                   /function="Virulence associated"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 5 : Inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32340"
FT                   /db_xref="GOA:A5E846"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A5E846"
FT                   /protein_id="ABQ32340.1"
FT                   /translation="MIRSFVTVLSGTLASRLLGFGRDALIAALLGAGPVADAFLAAFQL
FT                   VNVVRRLLTEGALNAALVPAWLRIYQQAGTMQAAAFAGRVLGTVSAGLFAATVGLALLM
FT                   PLVMAILAPGFSGEETLTLAVDDSRLMLPYLAFAGPSTVLLALSSAQRRFALAAFAPLL
FT                   FNVALIGVTIVLLTQHPDPARAALLLAATIGVAGLLQLAMLARRGRGARIASPVRLAFD
FT                   AEMRGFFANALPGMVASAGPQLLAVAGAIIASSQPSAVSWLYFANRLIELPLGLVGVAM
FT                   GTVLVPELTRALHGGNKQALAEVQSHGLELTIGLALPATLGLMILNDPIIRLLFEHGAF
FT                   TSDDATATAHVLGWLAAALPAQVLTKALQPAFFAREDTQTPLRATLIGCGVAIALAFLL
FT                   GQRFGVDGIAAGLALGAWANAAVLIRRGTASFGFAISQASRRRLPRMVLAAAIMGAALA
FT                   AAVQLTSPETTGHLGLAALLAVLIGGAVMLYVGLLSALRVVSWGETVRALRQRPAGDLH
FT                   L"
FT   gene            40614..41666
FT                   /gene="trpS"
FT                   /locus_tag="BBta_0038"
FT   CDS_pept        40614..41666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="BBta_0038"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /function="Amino acid-activation; Cytoplasm"
FT                   /EC_number="6.1.1.2"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32341"
FT                   /db_xref="GOA:A5E847"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A5E847"
FT                   /protein_id="ABQ32341.1"
FT                   /translation="MAFVERVFSGVQPTGNLHLGNYLGAIVNFVKMQETHNCIYCVVDM
FT                   HAITMPVDVWGGPAELARNTREVTAAFIAAGIDPKKHIVFNQSQVSGHAELAWIFNCVA
FT                   RIGWLNRMTQFKEKAGKDRENASVGLYDYPVLMAADILLYRATHVPVGEDQKQHLELSR
FT                   DIAQKFNNDFGDSIRSHGFGDGLFFPLPEPFITGPATRVMSLRDGTKKMSKSDASDYSR
FT                   INLTDDADTIAQKVRKAKTDPEPLPTEEKGLEARPEADNLVGIYAALSDRSKAEVLRDF
FT                   GGGQFSSFKNALVELCVTKLGPIAAEMKRLTADPGYVDSVLIDGGERAQAIAAETMKAA
FT                   KDIVGFIRKS"
FT   gene            41799..42293
FT                   /locus_tag="BBta_0039"
FT   CDS_pept        41799..42293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0039"
FT                   /product="hypothetical protein"
FT                   /function="Adaptation to stress"
FT                   /note="Universal stress family domain, UspA-like protein;
FT                   Evidence: Similar to previously reported genes of unknown
FT                   function; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32342"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A5E848"
FT                   /protein_id="ABQ32342.1"
FT                   /translation="MAVQRQSYDIGHTPKCLVVVDDSAECDRAIRYAGRWAARAGGGIV
FT                   MLHVIETEDQNQQWLGVADLMRAEAQDEANAALDQAATLLSSIGIQAPDRVIREGDPTT
FT                   QILATVEADRDIALLVLAANAGAEGPGPLVSHVTKTIGAFPVPLVIVPGDLADADIDAL
FT                   S"
FT   gene            42402..42971
FT                   /locus_tag="BBta_0040"
FT   CDS_pept        42402..42971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0040"
FT                   /product="putative nifU protein"
FT                   /function="Sulfur metabolism; Nitrogen metabolism"
FT                   /note="C-terminal fragment; Evidence: Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32343"
FT                   /db_xref="GOA:A5E849"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:A5E849"
FT                   /protein_id="ABQ32343.1"
FT                   /translation="MFIQTEATPNPATLKFIPGRVVLPSGTMEFSSREAAARSPLAERL
FT                   FAIGGVTGVFYGADFITVTKNDGEWQHLKPAILGAIMEHYMSGAPLLADGSAANDDATD
FT                   EDDEFYDEADTETVGMIKDLIESRVRPAVANDGGDITFRGFKDGIVYLNMKGACSGCPS
FT                   STATLQHGIQNLLKHFVPEVVEVRPM"
FT   gene            complement(43038..43355)
FT                   /locus_tag="BBta_0041"
FT   CDS_pept        complement(43038..43355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0041"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32344"
FT                   /db_xref="UniProtKB/TrEMBL:A5E850"
FT                   /protein_id="ABQ32344.1"
FT                   /translation="MIQRAPRDPLTVVDAISRALVMIAFDLDGTLSAPGRLQAGPGPVI
FT                   SCGCDRADQQHHGQINLPASSRKIGMARAGESTPDSVGNANRNVNDDVSSATRPATGTT
FT                   A"
FT   gene            43609..44310
FT                   /locus_tag="BBta_0042"
FT   CDS_pept        43609..44310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0042"
FT                   /product="putative Glycoprotease family protein"
FT                   /function="Proteins/peptides/glycopeptides"
FT                   /EC_number="3.4.24.57"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32345"
FT                   /db_xref="GOA:A5E851"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A5E851"
FT                   /protein_id="ABQ32345.1"
FT                   /translation="MLILAIDTALDHCAAAVLDTDSAVMRAQETLPMKRGHAEALMPLV
FT                   ARVRQQSGIAFQELDRIVVTTGPGSFTGLRVGLSAARGIALAAHKPVVGVTTLSAYAAP
FT                   VVSADGDAPVISAIDARHDHVYYQIVSGNGDELVAPKVAPIDDLLADARFAAPHLVGNA
FT                   ASMLAERWPAGATAPVAVDNQPGPDIAWVAWLGAAADPAHAPARPFYLRAPDVKPPAGA
FT                   APELAHTAASS"
FT   gene            44307..44789
FT                   /locus_tag="BBta_0043"
FT   CDS_pept        44307..44789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0043"
FT                   /product="putative Ribosomal-protein-alanine
FT                   acetyltransferase, RimI-like protein"
FT                   /function="Posttranslational modification; Ribosome"
FT                   /EC_number="2.3.1.128"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32346"
FT                   /db_xref="GOA:A5E852"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5E852"
FT                   /protein_id="ABQ32346.1"
FT                   /translation="MNMLFRWFGRSKPSIQAASPGDAARLAQIHAASFHRGWGEGEFES
FT                   MLAERNTMVHRLRLGRRVIGFIVSRIGADEAEILSIALDPNQRGRGFSRDLLLQHLGHL
FT                   AGRGVRTVFLEVEENNQPARRLYERAGFATVGRRERYYLQPGGEQLNALLMRRDLS"
FT   gene            44833..45285
FT                   /locus_tag="BBta_0044"
FT   CDS_pept        44833..45285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0044"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /function="Transcriptional level"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32347"
FT                   /db_xref="GOA:A5E853"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5E853"
FT                   /protein_id="ABQ32347.1"
FT                   /translation="MTSLKPTPALNSTGIEARCAATGMRMTEQRRVIARVLADSSDHPD
FT                   VEELYRRCVAVDDKISISTVYRTVKLFEDAGIIERHDFREGRARYEQMRDSHHDHLINL
FT                   RDGKVIEFTSEEIEKLQAEIARKLGYKLVDHRLELYCVPLDEETNG"
FT   gene            45295..45993
FT                   /locus_tag="BBta_0045"
FT   CDS_pept        45295..45993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0045"
FT                   /product="putative Haloacid dehalogenase-like hydrolase"
FT                   /function="Carbon compound utilization"
FT                   /EC_number="3.-.-.-"
FT                   /note="putative Phosphatase; Evidence: Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32348"
FT                   /db_xref="GOA:A5E854"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5E854"
FT                   /protein_id="ABQ32348.1"
FT                   /translation="MSFDLVIFDCDGVLVDSEVISCQTHADVLSRCGYPITTDQVFRRF
FT                   LGRSLKQACVEIEAELGHGLPDDFSAKLQAEMYSAFERDLQAINGIADALDALTVPVCV
FT                   ASSGSHQRMRVSLGATGLYDRLAPHIFSSSQVENGKPAPDLFLFAAAQMNAKPSACVVV
FT                   EDSSAGIRGGVAAGMTVLGFHGGSHCRDGHADDLRAAGATLVFDDMRQLPAILGRLSQK
FT                   TSPLAGFSAL"
FT   gene            46049..47449
FT                   /locus_tag="BBta_0046"
FT   CDS_pept        46049..47449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0046"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /function="RNA modification; Cytoplasm"
FT                   /note="tRNA modifying enzyme domain (MiaB-like); Evidence:
FT                   Similar to previously reported genes of unknown function;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32349"
FT                   /db_xref="GOA:A5E855"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E855"
FT                   /protein_id="ABQ32349.1"
FT                   /translation="MTPPRKLHIKSYGCQMNVYDAQRMVDTLGAEGFVETAEAGDADLV
FT                   ILNTCHIREKASEKVYSELGRLRVAKEEAARQGRAMQIAVAGCVAQAEGAEIVTRAPTV
FT                   DVVVGPQSYHHLPELLARAGRGEPAIETEFPAEDKFGFLARPSREAIRARGVSAFVTVQ
FT                   EGCDKFCTFCVVPYTRGSEMSRPVARILDEVTRLTENGVREITLIGQNVNAYHGEAPDG
FT                   STWTLGRLLYGIAEIPGVARIRYSTSHPNDVDDSLIAAHRDLASVMPFVHLPVQSGSDR
FT                   ILGLMNRKHGASDYRKVVDRFRAARPDIAFSSDFIVGFPGETEEDFRATLALIAQIGYA
FT                   AAYSFKYSPRPGTPAADMQEMVSATEMDERLERLQSLIDSQQAAFNKAAIGTVVDVLFE
FT                   RAARKPGQLVGRTAYLQPAHVMAPDNIIGQVLPVRIDSLERYSLLGELVATAAPVAGAA
FT                   TPLVSIGG"
FT   gene            47454..48491
FT                   /locus_tag="BBta_0047"
FT   CDS_pept        47454..48491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0047"
FT                   /product="putative phosphate starvation-inducible protein,
FT                   PhoH-like protein"
FT                   /function="Putative uncharacterized transport protein"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32350"
FT                   /db_xref="GOA:A5E856"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:A5E856"
FT                   /protein_id="ABQ32350.1"
FT                   /translation="MPKSASDSSSLAPSRKFDRDMSMPPETQVVIDFDDNRAASALVGP
FT                   YGQNLALVERRLGVVVDSRGNHITIGGSRDGCDAARRVLESLYTQAVQGQDLSQGDVEG
FT                   AIRAVVAQGSLFEFDAKGAKNAFESINLRKRPVRARTAAQDSYIRALKRHELVFGIGPA
FT                   GTGKTWLAVAHAAQLFERKEVDRIILSRPAVEAGERLGFLPGDLREKVDPYLRPIYDAL
FT                   YDLMDARIVERALQAGEIEIAPLAFMRGRTLTNAAIILDEAQNTTSMQMKMFLTRLGEN
FT                   SRMIITGDPSQVDLPNGQTSGLAEAARLLEGVEGIAQVRFTGEDVIRHELVARIVAAYE
FT                   GPKAR"
FT   gene            48557..49066
FT                   /locus_tag="BBta_0048"
FT   CDS_pept        48557..49066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0048"
FT                   /product="hypothetical protein"
FT                   /note="metal-dependent hydrolase; Evidence: Similar to
FT                   previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32351"
FT                   /db_xref="GOA:A5E857"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E857"
FT                   /protein_id="ABQ32351.1"
FT                   /translation="MPQSPIPTTEVIIAADCWQDQPDAEDVIHRAILAAAERVDAEVGD
FT                   AEIAVMLTDDAGIRTLNSNWRGIDKPTNVLSFPALQPTGPRGDDDAPRMLGDIAIAYET
FT                   MRREADEEQKPFDHHLSHLTVHGFLHLIGYDHESDAEAEEMEALETEILAHLGVPDPYA
FT                   DRERLD"
FT   gene            49069..50229
FT                   /locus_tag="BBta_0049"
FT   CDS_pept        49069..50229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0049"
FT                   /product="putative transporter with CBS domain"
FT                   /function="Membrane"
FT                   /note="putative Magnesium and cobalt efflux protein corC;
FT                   Evidence: Function proposed based on presence of conserved
FT                   amino acid motif, structural feature or limited homology;
FT                   Localization: 5 : Inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32352"
FT                   /db_xref="GOA:A5E858"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A5E858"
FT                   /protein_id="ABQ32352.1"
FT                   /translation="MADSEPIHDNPRQTRNLPAVVPPAELGRSPSENWLLRALRNLFGW
FT                   KGGGSVRDDLQVVLDASTPDDIGFSAVERTLLRNILDLHERRIADVMVHRADIVAVRRD
FT                   IPLGELMSLFESASHSRLVVYNDTLDDPEGMVHIRDLLAFMTAQARVSDEAKARRKKPL
FT                   PAGLDLKTVDLAMPLFEANIIRKLLYVPPSMRAIDLLAQMQASRIHLALVVDEYGGTDG
FT                   LVSIEDIVEQIVGEIDDEHDSDEPPAIMRQADNAFIADARASLDDVRRVIGEEFVTGEA
FT                   GEGVETLGGYLVNHVGRLPVRGELISGPGNFEVEVLDADPRRVKRLRIAPRKERPVPRP
FT                   PRESRRRGEASGESNEVIEPPRAAEGGKPPGADDDNPPATDGASPQ"
FT   gene            50226..51836
FT                   /gene="cutE"
FT                   /gene_synonym="lnt"
FT                   /locus_tag="BBta_0050"
FT   CDS_pept        50226..51836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutE"
FT                   /gene_synonym="lnt"
FT                   /locus_tag="BBta_0050"
FT                   /product="Apolipoprotein N-acyltransferase"
FT                   /function="Lipoprotein; Membrane; Inner membrane"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 5 : Inner
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32353"
FT                   /db_xref="GOA:A5E859"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A5E859"
FT                   /protein_id="ABQ32353.1"
FT                   /translation="MIRPSSIRGVALGVVLAWGWKRAAIAVAAGALSALAMAPFNAWPV
FT                   LAISFPVVVWLIDGAAAGARRGIPAAALTGFCFGMGYFVPGLYWIGNAFLVDAETFAWL
FT                   MPFAVLGLPAYLALFHALGFALARSIWTRGPTRILALAVCLTASEWLRGHALTGFPWNT
FT                   FGYALSQPLALAQSASLIGLWGMTFLAVAIFASPAVLIDGKRWRDGWHLPAAAAAVLVL
FT                   MGAFGAIRLAQHPTSLVRDLKLRIMQPNLQQDVKFNYGAKADVMRRYLALSDRASGPNS
FT                   TGVRDTNILIWPESAFPFFLTREADAMAQIADLLAPDTVLITGSVRAPDGPRNGPITRA
FT                   YNSIYVIDHDGSVLSYYDKLHLVPFGEYLPFQDLMERIGLEQLTRVQGGFIVGTARRNL
FT                   EVPHAPRVLPLICYEAIFPGDISGSDERPGWIVNLTNDGWFGISTGPHQHLQQAQWRAI
FT                   EQGLPLVRSANTGISAVIDPVGRIIAQLPLGAEGILDAALPAALRPTIYAKAGDIPAII
FT                   LLVIALGTVVRRRVAEKRP"
FT   gene            52070..52486
FT                   /locus_tag="BBta_0051"
FT   CDS_pept        52070..52486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0051"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="transcriptional regulator domain (HTH type);
FT                   Evidence: Similar to previously reported genes of unknown
FT                   function; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32354"
FT                   /db_xref="GOA:A5E860"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5E860"
FT                   /protein_id="ABQ32354.1"
FT                   /translation="MSTKAPNPVDKHVGSRVRMRRIMLGMSQEKLGEALGLTFQQIQKY
FT                   EKGTNRVGASRIQQISEVLQIPVSFLFEGVPSGSTNGEPFDGASPAYVSDFLATSEGLA
FT                   LTRAFTRIHDSKLRRSIVDLVEQIADREAPEDDA"
FT   gene            52992..54122
FT                   /locus_tag="BBta_0052"
FT   CDS_pept        52992..54122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0052"
FT                   /product="putative peptidase M20 family"
FT                   /function="Proteins/peptides/glycopeptides"
FT                   /EC_number="3.4.-.-"
FT                   /note="putative carboxypeptidase G2 (Glutamate
FT                   carboxypeptidase); Evidence: Function proposed based on
FT                   presence of conserved amino acid motif, structural feature
FT                   or limited homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32355"
FT                   /db_xref="GOA:A5E861"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A5E861"
FT                   /protein_id="ABQ32355.1"
FT                   /translation="MTVPTNPFDSRTILDGIRQWVEIETPTEAPDQINQLVSLVSEGYR
FT                   GLDAVVERVSGRDGCGDHLIARSGWGQQEPGILILSHLDTVHPIGFLRRLPFSIDGDVA
FT                   FGPGIYDMKGGAYLAYHAFRHLCLTGKRSPLGITHLFVSDEEIGSPTSRVLIEEEGRKA
FT                   KYVLVTEPARDGGRIVTGRKGVARFDVTIRGVPAHAGARPQDGRSAIRELANVIHALEA
FT                   LNDLERGITVNVGVVRGGTRPNVIAEEAYAEVDARLPTPADAEEIVPKILGLTSRSEGV
FT                   SVEVTGGVNRPPYVKGNAGAALFEHARSLAEEIGFELVDTITGGGSDGNFTAPFTATLD
FT                   GLGVDGKGAHTHYEQMYISSIEPRTRLLHRLYQTLR"
FT   gene            54119..54853
FT                   /gene="trmB"
FT                   /locus_tag="BBta_0053"
FT   CDS_pept        54119..54853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="BBta_0053"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32356"
FT                   /db_xref="GOA:A5E862"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5E862"
FT                   /protein_id="ABQ32356.1"
FT                   /translation="MSTATIMPVDHDHADTEASHRQGSFFGRRKGHKLRAHQADLMGNL
FT                   LPHLALDLASPADAVLPALFDPPIDDLRIEIGFGGGEHLAAEAKAYPRTGFIGCEPYIN
FT                   GMAKILATIEADNIGNVRLLAGDAAELLAWLPPSSVQRIDLIHPDPWPKRRHWKRRFVQ
FT                   EATIAAMARALKPGGEFRFVSDIADYCAWTLWHLLRSPDFAWTAERADDWRLPWNGYTM
FT                   TRYGRKAMREGRVANYLIFRRR"
FT   gene            55461..56222
FT                   /locus_tag="BBta_0054"
FT   CDS_pept        55461..56222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0054"
FT                   /product="hypothetical protein"
FT                   /note="YhbC-like domain; Evidence: Similar to previously
FT                   reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32357"
FT                   /db_xref="GOA:A5E863"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E863"
FT                   /protein_id="ABQ32357.1"
FT                   /translation="MTEPTFAAADTDLLTEPRLVVEPGVAARVAAVAEPVLQGMGYRLV
FT                   RIRISGEAGCTVQVMAERPDGTMQIEDCEAVSRALSPVLDIADPIDRAYRLEISSPGID
FT                   RPLVRRTDFERHIGHLVKIEMAVAHQNRKRFRGIITGLDGDGVCITRDDVAKDQDPSVV
FT                   LPMTDIGDAKLVLTDELIAESMRRGKAAEREKKRDLGLAPPLAPHAKPAAQAKPKPKLK
FT                   DGQAAKKPLPTNTKKHRLAADRARRGEIDPD"
FT   gene            56237..57850
FT                   /gene="nusA"
FT                   /locus_tag="BBta_0055"
FT   CDS_pept        56237..57850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="BBta_0055"
FT                   /product="NusA antitermination factor"
FT                   /function="Transcription related; Transcriptional level;
FT                   Cytoplasm"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32358"
FT                   /db_xref="GOA:A5E864"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A5E864"
FT                   /protein_id="ABQ32358.1"
FT                   /translation="MAVSANRLELLQIADAVAREKSIDRGIVIAAMEDAIAKAARARYG
FT                   SETDVHAEIDPRRGELRLSRHMLVVEKVENPSNQISLDDARRANPGAQIGDTIADTLPP
FT                   LEYGRIAAQSAKQVIVQKVREAERDRQYQEFKDRIGDIVNGVVKRVEYGSVILDLGRGE
FT                   AIIRRDEMLPREVFRNGDRVRAYVFDVRRETRGPQIFLSRTHPQFMAKLFAQEVPEIYD
FT                   GIVEIKAVARDPGSRAKIGVVSRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWS
FT                   PDIATFVVNALAPAEVAKVVIDEDRERIEVVVPDTNNQLSLAIGRRGQNVRLASQLTGW
FT                   DIDILTEQEESERRQADFENSTRVFMESLNVDEVVGQLLASEGFTSVEELALVDLKDLA
FT                   GIEGFDEETATELQTRAREFLEQQEAELEAKRKELGVEDAVKTVPGVTSKMLVKFGEND
FT                   IKTVDDLAGCATDDLVGWTERKDSGEQTKHAGILDGLEVSRDDAEAMVMQARVKAGWIS
FT                   EADIAKPEAEDEDASEGQPA"
FT   gene            57920..58633
FT                   /locus_tag="BBta_0056"
FT   CDS_pept        57920..58633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0056"
FT                   /product="hypothetical protein"
FT                   /note="RNA-binding domain; Evidence: Similar to previously
FT                   reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32359"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:A5E865"
FT                   /protein_id="ABQ32359.1"
FT                   /translation="MLALADPELDNGPRTEKSATMRMCAVSREVRPIEELIRFVVGPSG
FT                   EVVPDIKRKLPGRGLWITASKPVVAEAVRRHHFSRGFKANVRVPPTLADDLEALLARSA
FT                   IEALGIAAKAGQVVSGFSKVEAALSQRQSRTALAALLHASDGAADGIRKLDALVRSNDE
FT                   DQGQAPPFPIICCLTSAELDLALGRSNVIHAAVLAGPASRTFLSRSQTLVRYRSADADK
FT                   IAGTAATKSASTSKT"
FT   gene            58710..61475
FT                   /gene="infB"
FT                   /gene_synonym="ssyG"
FT                   /locus_tag="BBta_0057"
FT   CDS_pept        58710..61475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /gene_synonym="ssyG"
FT                   /locus_tag="BBta_0057"
FT                   /product="bacterial translation initiation factor 2
FT                   (bIF-2)"
FT                   /function="Translation; Cytoplasm"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32360"
FT                   /db_xref="GOA:A5E866"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E866"
FT                   /protein_id="ABQ32360.1"
FT                   /translation="MADNNTPGDKKLSVPTKTLTLKPRVETGTVRQSFPHGRSKQVVVE
FT                   KRGTKRRVGDGAPDAPHAPEPVVAKAPPPPPPSNRPSGPRPGSSQRGGSGVVLRTLTED
FT                   ERSARASALADARVRDMEERRQAEEEARRRAEREAAERAEREAAEARRKAEEERHRQEE
FT                   EAKRKAELEAKKRFGEGEAPRPATAAPQQQPAAVTAPARPAQAPGRPQGAPGSRPQQIG
FT                   TSARPGGAQPAGARPAAARPAGAGPLGRAPGVAAGPEDDEGPRQIRRGPGGAARPAPPP
FT                   KTTHKPGPQKQRGRLTVVTALTADDVRERSIASFRRRTQRLKGHAANEQKEKLVREVTI
FT                   PEAITIQELANRMSERAVDVIRLLMRQGAMHKITDVIDADTAQLIAEELGHSVKRVAAS
FT                   DVEEGLFDVVDDSTDTEPRSPVVTVMGHVDHGKTSLLDALRHANVVSGEAGGITQHIGA
FT                   YQVTAPDSGKKITFIDTPGHAAFTAMRARGAKVTDIVVLVVAADDGVMPQTIEAINHAK
FT                   AAKVPMIVAINKIDKPDARPDRVRTELLQHEVQVESLGGEVVDVEVSAKNKTNLDRLLE
FT                   MIALQADILDLKTNSDRPAEGTVIEAKLDRGRGPVATVLVQRGTLRVGDIIVAGAEMGR
FT                   VRALISDQGETLQEAGPSVPVEVLGFNGPPEAGDRLAVVENEARARQVTSYRAHQKREN
FT                   AAASISGMRGSLEQMMSQLKTAGRKEFPLVIKADVQGSLEAILGSLEKLGTDEVAARIL
FT                   HAGVGGISESDVTLAEGFNAAIIGFSVRANKEAAALAKRNGIEIRYYNIIYDLVDDVKK
FT                   AMSGLLAPTLRETMLGNAQILEVFNISKVGKVAGCRVTDGTVERGANVRLIRDNVVVHE
FT                   GKLSTLKRFKDEVKEVQAGQECGMAFESYGDMRVGDVIECYRVETIQRSL"
FT   gene            61638..62054
FT                   /gene="rbfA"
FT                   /locus_tag="BBta_0058"
FT   CDS_pept        61638..62054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="BBta_0058"
FT                   /product="ribosome-binding factor A"
FT                   /function="RNA modification"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32361"
FT                   /db_xref="GOA:A5E867"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E867"
FT                   /protein_id="ABQ32361.1"
FT                   /translation="MPRHHQRGSTASGGSQRQLRVAETVRHAVADILSQGSAHDPDLEG
FT                   HIITVPEVRMSPDLKLATIYIMPLGGRDTEIVLAALERNKKFLRGEIAHRVNLKFAPDI
FT                   RFRADERFDEAERIEKLLRTPAVQRDLNSDSEES"
FT   gene            62054..63154
FT                   /gene="truB"
FT                   /gene_synonym="yhbA"
FT                   /locus_tag="BBta_0059"
FT   CDS_pept        62054..63154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /gene_synonym="yhbA"
FT                   /locus_tag="BBta_0059"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /function="RNA modification; Cytoplasm; tRNA"
FT                   /EC_number="4.2.1.70"
FT                   /note="Localization: 2 : Cytoplasmic; Evidence: Function of
FT                   homologous gene experimentally demonstrated in an other
FT                   organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32362"
FT                   /db_xref="GOA:A5E868"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:A5E868"
FT                   /protein_id="ABQ32362.1"
FT                   /translation="MTIPPETGTVDTTHADTTAVNVKKHHAADARPRDNNDPRNKPRQH
FT                   GNQPRRDRRDIHGWVVLDKPIGMTSTQAVAVAKRLFQAKRAGHAGTLDPLASGGLPIAL
FT                   GEATKTVPFVMDGRKRYRFTVTWGEERDTDDTEGRVVQTSTSRPDVAAIRALLPQFTGR
FT                   IEQTPPRYSAIKIQGERAYDLARDGEVVELQPRPVEIHELTLVDQPDADHSVFEAECGK
FT                   GTYVRALARDMGRLLGCYGHISALRRTLVGPFTENDMIPLEQLEALCNRAASGEGSLAD
FT                   ALLPVETALDDIPALAVTRADAARLHRGQAVLLRGRDAPQSSGTVYVTVAGRLLALAEI
FT                   GNGELIPKRVFNLTGLTASSGRNERD"
FT   gene            63157..63426
FT                   /gene="rpsO"
FT                   /gene_synonym="secC"
FT                   /locus_tag="BBta_0060"
FT   CDS_pept        63157..63426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /gene_synonym="secC"
FT                   /locus_tag="BBta_0060"
FT                   /product="SSU ribosomal protein S15P"
FT                   /function="Translation; Ribosomal proteins; Ribosome;
FT                   Cytoplasm"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32363"
FT                   /db_xref="GOA:A5E869"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E869"
FT                   /protein_id="ABQ32363.1"
FT                   /translation="MSVTAERKAEIIKANATKAGDTGSPEVQVAILSERINNLTSHFKT
FT                   HGKDNHSRRGLLKLVSTRRSLLDYLKKNDEARYKALLEKHNIRR"
FT   gene            63789..65951
FT                   /gene="pnp"
FT                   /gene_synonym="bfl"
FT                   /locus_tag="BBta_0062"
FT   CDS_pept        63789..65951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /gene_synonym="bfl"
FT                   /locus_tag="BBta_0062"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /function="RNA; RNA degradation; Cytoplasm"
FT                   /EC_number="2.7.7.8"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32364"
FT                   /db_xref="GOA:A5E870"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E870"
FT                   /protein_id="ABQ32364.1"
FT                   /translation="MFTKHSVEIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVV
FT                   AAKSPREGVDFLPLTVDYQEKAYAAGRIPGGYFKREGRPTEKETLVSRLIDRPIRPLFV
FT                   DAWRNETQVIVTTLSHDMENDPDILAMVAASAALTLSGVPFKGPIGAARVGFANDEYIL
FT                   NPTLDEMTDTQLDLVVAGTSDAVLMVESEAKELNEDIMLGAVMFGHRHFQPVINAIIEL
FT                   AEKAAKEPRDVAIIDNSAIEKEMLGIAEQDLRKAYAIPVKQERYAAVAAVKEKVMAYFF
FT                   PEGQEPKYEKLRVADVFKELEAKIVRWNILDTGRRIDGRDVKTVRNIVCEVGVLPRAHG
FT                   SALFTRGETQALVVTTLGTGEDEQYIDALSGTYKETFLLHYNFPPYSVGETGRLGGTKR
FT                   REIGHGKLAWRAIHPVLPPHHEFPYTTRVVSEVTESNGSSSMATVCGSSLALMDAGVPL
FT                   KRPTAGIAMGLILEGSRYAVLSDILGDEDHLGDMDFKVAGTESGITSLQMDIKIEGITE
FT                   EIMRVALGQAREGRIHILGEMSKALTAARAELGEYAPRIETFKIPTDKIREVIGTGGKV
FT                   IREIVEKTGAKVNIEDDGTVKVASSDGEAMKAAIKWIKSIASDPEIGQIYDGTVVKVME
FT                   FGAFVNFFGTRDGLVHISQLADKRVQKTTDVVKEGDKVKVKLLGFDDRGKTRLSMKAVD
FT                   QTTGEDLEAKQKAEGGAEAPREAAGE"
FT   gene            66159..66632
FT                   /locus_tag="BBta_0063"
FT   CDS_pept        66159..66632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0063"
FT                   /product="hypothetical protein"
FT                   /note="acetyltransferase, GNAT family protein domain;
FT                   Evidence: Similar to previously reported genes of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32365"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5E871"
FT                   /protein_id="ABQ32365.1"
FT                   /translation="MDHQPVIRPARADEYNAVARLWMASWCSTGLDVPSEKLLAALQER
FT                   VPREVHNGWSLYVADDGGQLAAMLAINIPQLYLDQLMIAPSHQGRSLGRRLLAFTRELL
FT                   PDEVWLRCAEGNAKAWRWYEREGFVLEKAEADPVHGRIMKYYRWKRGRQAAAP"
FT   gene            66748..67587
FT                   /locus_tag="BBta_0064"
FT   CDS_pept        66748..67587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0064"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32366"
FT                   /db_xref="UniProtKB/TrEMBL:A5E872"
FT                   /protein_id="ABQ32366.1"
FT                   /translation="MPVPLLLIRRLAPIAFAAAFTTAAWAQAPSTPAAPAKAPPAAKKA
FT                   AKAKSAAKPSAVESGPCRLGVISALGDQLAVSKFGLTVFETEEDDVTLPGWGLDDLAVA
FT                   RVRAATGGDPTVHRISYPTGAFEPYYHPTSRFLPDPKEGLSSIVRNVTTNANCARYLVV
FT                   TKFETTIPNTTLRLRGIGAYNQGLGSLLRHSHLFANVNITLIDGQSYEKIGSFSADTGA
FT                   RLAETMRLTEDPLNKLDNADFPEPLAAAAKSAILRERLRTLVAAKLDRDLPSYLKIE"
FT   gene            67655..68470
FT                   /locus_tag="BBta_0065"
FT   CDS_pept        67655..68470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0065"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32367"
FT                   /db_xref="UniProtKB/TrEMBL:A5E873"
FT                   /protein_id="ABQ32367.1"
FT                   /translation="MTFIRRSVPLLIAMLWSCTNALAQSSPAPPNARPTPKAAASPAKG
FT                   GKSATNFRDSGPCDTGVIAALGDSFTVQKNGLTRLGDDYAEVPVSWGFDDLVFARVKAA
FT                   AGDAGVHRIAVPKGTFDSYYQSPPIRAENGTLTAIVRKLAGTARCASYLVVTRRTDSEP
FT                   STNDEVTGIGVINRGEGLGRYTHVFTMMDIRLYDGTTFETREPATSSKSFLSRLTSGVG
FT                   PPSRAGDVDNANFPASPPDAANNTVLRDMARSMLKFRLDQRLPAYFGHE"
FT   gene            complement(68594..69394)
FT                   /gene="fabI"
FT                   /gene_synonym="envM"
FT                   /gene_synonym="gts"
FT                   /gene_synonym="qmeA"
FT                   /locus_tag="BBta_0066"
FT   CDS_pept        complement(68594..69394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /gene_synonym="envM"
FT                   /gene_synonym="gts"
FT                   /gene_synonym="qmeA"
FT                   /locus_tag="BBta_0066"
FT                   /product="Enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /function="Fatty acid and phosphatidic acid"
FT                   /EC_number="1.3.1.9"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 6 : Inner
FT                   membrane-associated"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32368"
FT                   /db_xref="GOA:A5E874"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5E874"
FT                   /protein_id="ABQ32368.1"
FT                   /translation="MQGLMAGKRGLVMGIANDHSIAWGIAKTLAAHGAEMAFTYQGDAL
FT                   GKRVRPLAEELGVKHVLSCDVEDIASVDGVFAALREAWGGLDFIVHAVAFSDKNELKGR
FT                   YADTSRENFSRTMLISCFSFTEIAKRAAELMPESGGSMITLTFDGSNRVMPNYNVMGVA
FT                   KAALEASVRYLAADYGRRSIRVNAISAGPVRTLAGSGIGDARFMFAFQQKHSPLGRGVT
FT                   LEELGGSALYLLSELSGGVTGEIHYVDSGYNVISMPRPEDLKGE"
FT   gene            complement(69449..69520)
FT                   /locus_tag="BBta_0067"
FT   CDS_pept        complement(69449..69520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32369"
FT                   /db_xref="UniProtKB/TrEMBL:A5E875"
FT                   /protein_id="ABQ32369.1"
FT                   /translation="MFLGVKPDNSANDFAPMSGYRCI"
FT   gene            complement(69536..70735)
FT                   /gene="fabB"
FT                   /gene_synonym="fabC"
FT                   /locus_tag="BBta_0068"
FT   CDS_pept        complement(69536..70735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabB"
FT                   /gene_synonym="fabC"
FT                   /locus_tag="BBta_0068"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase I"
FT                   /function="Fatty acid and phosphatidic acid; Cytoplasm"
FT                   /EC_number="2.3.1.41"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32370"
FT                   /db_xref="GOA:A5E876"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A5E876"
FT                   /protein_id="ABQ32370.1"
FT                   /translation="MGIVSSIGNNTQEVLASLYEAKSGISRAEKYAELGFRSQVQGAPT
FT                   LNPADVVDRRAMRFLGEGAAWNHVAMEQAILDAGLEPSDVSNVRTGIIMGSGGPSTRTQ
FT                   VEAADITRTKGPKRVGPFAVPKCMSSTASATLATWFKIKGVNYSISSACATSNHCIGNA
FT                   YEMIQYGKQDMMFAGGCEELDWTLSVLFDAMGAMSSKHNDTPATASRPYDVTRDGFVIA
FT                   GGAGVLVLEELEHAKARGAKIYGEIVGYGATSDGYDMVAPSGEGAERCMQMALSTVRTK
FT                   VDYINPHATSTPAGDPPEIEAIRKVFGSGEKCPPIAATKALTGHSLGATGVHEAIYSLL
FT                   MMKNGFICESAHITELDPMFADMPIVRKRIDNAKLGTVLSNSFGFGGTNATLVFKHVDA
FT                   "
FT   gene            complement(70836..71357)
FT                   /gene="fabA"
FT                   /locus_tag="BBta_0069"
FT   CDS_pept        complement(70836..71357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabA"
FT                   /locus_tag="BBta_0069"
FT                   /product="3-hydroxydecanoyl-[acyl-carrier-protein]
FT                   dehydratase"
FT                   /function="Fatty acid and phosphatidic acid"
FT                   /EC_number="4.2.1.59"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32371"
FT                   /db_xref="GOA:A5E877"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E877"
FT                   /protein_id="ABQ32371.1"
FT                   /translation="MPDRRSVYEYEDLLACGRGELFGPGNAQLPLPPMLMFDRIVEITE
FT                   TGGEFGKGVVRAELDVKPDLWFFACHFKNDPVMPGCLGLDAMWQMVGFFLGWSGGEGRG
FT                   RALGLGDLKFSGQVLPTARKVVYNVDIKRVMRSKLVLGIADGWLSMDGEIIYRAKDLKV
FT                   GLFKQGATPS"
FT   gene            71793..72290
FT                   /locus_tag="BBta_0071"
FT   CDS_pept        71793..72290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0071"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /function="Transcriptional level"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32372"
FT                   /db_xref="GOA:A5E878"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5E878"
FT                   /protein_id="ABQ32372.1"
FT                   /translation="MDASNNASMSGHDRGTPEGLGSGRQPALNGCPWHDVNEMLQAAGL
FT                   RPTRQRMALGWLLFGKGARHLTAEMLYEEATLAKVPVSLATVYNTLNQLTDAGLLRQVS
FT                   VDGTKTYFDTNVTAHHHFYLENNHELVDIPDQHLALSKLPEAPDGYEIARIDMVVRLRK
FT                   KR"
FT   gene            complement(72414..72827)
FT                   /locus_tag="BBta_0072"
FT   CDS_pept        complement(72414..72827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0072"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32373"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:A5E879"
FT                   /protein_id="ABQ32373.1"
FT                   /translation="MPRYVSLKSDHVNVRAGPTKDNDVAWVYTRSGLPVEITAEYENWR
FT                   RVRDSEGSEGWVYHSLLSGRRTAVVTMKNKDDLAAVYDSPSASGAVTARLQVGVIAQVK
FT                   KCSNGWCRVLGNGFDGWIEQQRLWGVYADEQVN"
FT   gene            73301..74302
FT                   /locus_tag="BBta_0073"
FT   CDS_pept        73301..74302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0073"
FT                   /product="putative Glyoxylate reductase"
FT                   /function="2,5-ketogluconate metabolism; Glyoxylate
FT                   degradation"
FT                   /EC_number="1.1.1.26"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32374"
FT                   /db_xref="GOA:A5E880"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5E880"
FT                   /protein_id="ABQ32374.1"
FT                   /translation="MSARKKPLVVVTRKLPDSVETRMRELFDARLNLDDEPMSQDQLAD
FT                   AVRTAEVLVPTVTDHISADILNQPDCKLRMIANFGNGVDNIDVAAAVARGITVTNTPKV
FT                   LTEDTADMTMALILAVPRRLIEGASILTEGKNWAGWSPTWMLGHRIGGKRLGIIGMGRI
FT                   GQAVARRARAFGLQIHYHNRRPVAPVIADELGATYWESLDQMLARMDIISVNCPHTPAT
FT                   FHLLSARRLKLIRKDAYIVNTARGEVIDEETMTRLIEAGDIAGAGLDVFEHEPAVNPRL
FT                   VRLAKSGKVTLLPHMGSATIEGRVEMGEKVIINIKTFLDNHRPPDRVLPSML"
FT   gene            complement(74517..75320)
FT                   /locus_tag="BBta_0074"
FT   CDS_pept        complement(74517..75320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0074"
FT                   /product="putative Molybdopterin biosynthesis protein moeB"
FT                   /function="Molybdenum (molybdopterin)"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32375"
FT                   /db_xref="GOA:A5E881"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A5E881"
FT                   /protein_id="ABQ32375.1"
FT                   /translation="MLSDEELERYARHIVLRDVGGPGQAALKRASVLVIGAGGLGAPAL
FT                   MYLAAAGVGTIGIVDDDVVSLSNLQRQVIHTTPDIGRPKVESAAERITALNPHVSVIAH
FT                   RTWLNADNALALIGGYDLVLDGSDNFDTRYLASDACFLAERPLISGALGTFDASLTTIR
FT                   AHERNENGEFNPTYRCLFPEPPPPGTVPACAEAGVMGALAGMLGSMMALEAIREIVGFG
FT                   EGLVGRLLMLDARTMRFETLRYKRDPANPLNGDGPVIADLSAHRK"
FT   gene            75462..76841
FT                   /locus_tag="BBta_0075"
FT   CDS_pept        75462..76841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0075"
FT                   /product="putative exported protein of unknown function
FT                   with peptidoglycan binding domain"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32376"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A5E882"
FT                   /protein_id="ABQ32376.1"
FT                   /translation="MRRLATATFICASAISACGPALAQATPAPAAQGVLPGAKPKPVAT
FT                   QPVRPGVQAPADTANAMGQAERLALQSDLAWVGQYNGAITGDVSERMVNAIKEYQKLKG
FT                   GKPTGVLNPQERAVLADTARRKQESVGWKLVTEPVSGARLGIPTRLVPQQSSDGTGSKW
FT                   SSPTGTVQVVLSRRKEASPTSAALADREKKEPGRTVDYSVVKPDFFVLSGLQNLKKFYI
FT                   RGTFKGDEVRILTILYDQATENTVEPVVIAMSSAFTPFPATQAAAPAPRRSVDYGTGII
FT                   ATQDGAIITDREVSDGCVALTIPGFGHAERVAEDKERGLALLRIYGARGLKPLALSGGS
FT                   ARSSIDIVGIADPQSQGGGAAISTVKAQLAGVGSGDAALAPAPGLGFSGGAALDGDGRF
FT                   AGITLLKPGLLAGTAMIPATQAVMVSAEATRAFLKAHGVTPDGTSLDAKAATVRVICVR
FT                   K"
FT   gene            76871..77656
FT                   /locus_tag="BBta_0076"
FT   CDS_pept        76871..77656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0076"
FT                   /product="hypothetical protein"
FT                   /note="pentapeptide repeat; Evidence: Similar to previously
FT                   reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32377"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A5E883"
FT                   /protein_id="ABQ32377.1"
FT                   /translation="MSEHDHDALRRALQRNASLTATDLSEFSFDDDTPDSAQFMNCSAD
FT                   STRFVGGGLALSRWTTTRFSRCEFANVNFSGARFEECRFFDAERAQGCTFRFCDLRGAV
FT                   FRNCDLMLTTFNACELWDVTFSDCRMSGVMFEKPAFAFSSARTRSKKPVRLAGTFERCR
FT                   MDNAVLRETDLSSLRILDCDLSGAELQGTSLVNASLRGSDLSHAALRLADLSGADLRGA
FT                   DLTGFDLQDIKSFSGLQISASQQHHLLRSLGIDVFADEA"
FT   gene            78085..78888
FT                   /locus_tag="BBta_0077"
FT   CDS_pept        78085..78888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0077"
FT                   /product="hypothetical protein"
FT                   /note="ATPase domain involved in chromosome partitioning
FT                   (ParA family); Evidence: Similar to previously reported
FT                   genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32378"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E884"
FT                   /protein_id="ABQ32378.1"
FT                   /translation="MYTIVLATQKGGSGKSTLAIGLAVAAQQAGHRVRVIETDRQGTLS
FT                   KWQARRTTGEPIVEAVYDAKMIETRLDALARDGVTVCVIDTGAGITASTTAAIRYCDLC
FT                   LIPARPSVADIEATAPTLSVVRAWRKPFAFVLNQAPIRGGHRITDATTALDADAPRDIA
FT                   EVLAQPFIMMRNDHQDALAAGLGVSEFDPSGKSAQEIKSLWRWTAGKLAGDHVMHEAGE
FT                   LKEASEHAEVEFPILLTPPAEEPKLPVTRVYPTWADNGINWKAGL"
FT   gene            79248..79997
FT                   /locus_tag="BBta_0078"
FT   CDS_pept        79248..79997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0078"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32379"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E885"
FT                   /protein_id="ABQ32379.1"
FT                   /translation="MMRTIVLATQKGGSGKSTLAMGLAVAAQQAGEIVRLIETDPQGTL
FT                   SYWQSCRGLAEPLVEPIQQPADIGRRLDAFARGGVTLAVIDTSSGINELTRAAIEQADL
FT                   CLVPARPCIADIIASAPTVKIIRASHRRFAFVLNQAPHRGPRASEAANALCHNDRDLAD
FT                   VVARPLVTLRNDHQDALAAGLGVTEFHASGKSASEIRLLWQWVETRLIEGDESRMRLSP
FT                   RTELHSLRTNPVATSANEASSSWDAGL"
FT   gene            complement(79992..80501)
FT                   /locus_tag="BBta_0079"
FT   CDS_pept        complement(79992..80501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0079"
FT                   /product="hypothetical protein"
FT                   /note="cAMP-binding protein; Evidence: Similar to
FT                   previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32380"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A5E886"
FT                   /protein_id="ABQ32380.1"
FT                   /translation="MAVSAPALKAFLLATPFFGGLSDSSLDLLVARLVERRFASGDTIV
FT                   AEGEPGRAMFVVHSGTLGVSERLDTGGVIRMSSLTPGDFFGEMTLLEMQNRSATVVAET
FT                   PTVLYELTARELYAFYKADIHAYVIVMQNINRELCRRLRRADARIKALEMREAGSPSVR
FT                   GDAGLL"
FT   gene            complement(80573..81454)
FT                   /gene="mutM"
FT                   /gene_synonym="fpg"
FT                   /locus_tag="BBta_0080"
FT   CDS_pept        complement(80573..81454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /gene_synonym="fpg"
FT                   /locus_tag="BBta_0080"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /function="DNA repair; Cytoplasm"
FT                   /EC_number="4.2.99.18"
FT                   /note="Localization: 2 : Cytoplasmic; Evidence: Function of
FT                   homologous gene experimentally demonstrated in an other
FT                   organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32381"
FT                   /db_xref="GOA:A5E887"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E887"
FT                   /protein_id="ABQ32381.1"
FT                   /translation="MPELPEVETVRRGLQPVMEGAKIVAAEARRGDLRFPFQPDFAKRL
FT                   QGQTVRGLGRRAKYLLADLSSGDVLLMHLGMSGSFRVIKQDDEETPGEFHYPRGKDSVH
FT                   DHVVFHMSSGADIVFNDPRRFGFMKIIGRGEIEREPHLKDLGPEPLGNEFDAAMLATAC
FT                   AGKKTSLKAALLDQRVVAGLGNIYVCEALFRAHLSPRRLAATLATRKGEPTDHARRLVE
FT                   AIHAVLNEAIRAGGSSLRDHRQTSGELGYFQHSFQVYDREGEPCRTDGCGGVVKRFVQN
FT                   GRSTFWCPKCQR"
FT   gene            81560..82321
FT                   /gene="ubiE"
FT                   /gene_synonym="yigO"
FT                   /locus_tag="BBta_0081"
FT   CDS_pept        81560..82321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /gene_synonym="yigO"
FT                   /locus_tag="BBta_0081"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /function="Aerobic respiration; Anaerobic respiration;
FT                   Menaquinone (MK), ubiquinone (Q)"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32382"
FT                   /db_xref="GOA:A5E888"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E888"
FT                   /protein_id="ABQ32382.1"
FT                   /translation="MDQTDQTTHFGFRDVPLGEKQTLVNDVFHSVAQRYDLMNDLMSAG
FT                   LHRVWKDIMINTLNPPKSDAPFALLDVAGGTGDISFRAARKAGAGFHATVCDINGDMLE
FT                   VGRQRALKQYLEDKVSFVEGNAEKLAFPDRSFDAYTIAFGIRNVPQIELALAEAYRVLK
FT                   HGGRFLCLEFSTVEVPGLDKLYDLFSFNVIPQLGRAVTGDAESYRYLVESIRQFPRPNA
FT                   FAEMISAAGFSRVSWQTLSGGIVALHSGWRL"
FT   gene            82318..83892
FT                   /gene="ubiB"
FT                   /locus_tag="BBta_0082"
FT   CDS_pept        82318..83892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="BBta_0082"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /function="Menaquinone (MK), ubiquinone (Q)"
FT                   /EC_number="1.14.13.-"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32383"
FT                   /db_xref="GOA:A5E889"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A5E889"
FT                   /protein_id="ABQ32383.1"
FT                   /translation="MISALTHITRLARAAFVFAREGVFGAVDPSLAPPPGQLALKLARL
FT                   VERPGAKSGPRLSRALERMGPAYLKLGQFLATRPDVVGVVMARDLESLQDRLPPFPQAE
FT                   AEAVIATALERPISQVFVSLSAPVAAASIAQVHRGEVERDGIRHAVAVKVLRPNVAARF
FT                   RRDLSDFFFVAEKAEAHSSEARRLRLVEVINTMSRSVAMEMDLRLEAAALSEMAENTRD
FT                   DPDFRVPTVDWDRTANNVLTMEWIDGIALNDHARLAQADVDLPDIGRKVIQSFLRHALR
FT                   DGFFHADMHPGNLFLDKEGRLVAVDFGIMGRLGMKERRFLAEILLGFITRDYRRVAEVH
FT                   FEAGYVPPHHSVENFAQAIRAIGEPIHNRTAEEISMAKLLTLLLEVTGLFDMRTRPELI
FT                   LLQKTMVVVEGVARGFDPKLDIWKIADPVVREWIERNLGPIGRIEGAVTGIGELARLTA
FT                   TLPVLAARAAAVLEHMETMTRDGLRLSPETIAAMGRTEGKKSRWRAIALWVIALTFIGI
FT                   LFAVLRL"
FT   gene            84088..85515
FT                   /gene="coaBC"
FT                   /gene_synonym="dfp"
FT                   /locus_tag="BBta_0083"
FT   CDS_pept        84088..85515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /gene_synonym="dfp"
FT                   /locus_tag="BBta_0083"
FT                   /product="Phosphopantothenate-cysteine ligase /
FT                   Phosphopantothenoylcysteine decarboxylase"
FT                   /function="Coenzyme A; DNA replication; Cytoplasm"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="Localization: 2 : Cytoplasmic; Evidence: Function of
FT                   homologous gene experimentally demonstrated in an other
FT                   organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32384"
FT                   /db_xref="GOA:A5E890"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A5E890"
FT                   /protein_id="ABQ32384.1"
FT                   /translation="MASLTIRKLDETLKTYLRLRSAQNGRSVEEEVRVILRGLIEPADP
FT                   SEPPSAPPTPAPPPEPMVPQPGVAREARVTLIIGGGIAAYKSLDLIRRLKERHIQVRCV
FT                   LTKAATQFVTELAASALSGERVFTDLFDARSEFDVGHIRLARDCDLIVVAPATADLMAK
FT                   MAQGLASDLASAVLLAASRPILLAPAMNPMMWSNPATRRNAATLQRDGIQMIGPNAGEM
FT                   AEKGEAGVGRMAEPTEIADAVVAMLKPPTPRPLAGRRVLITAGPTHEAIDPVRYIANRS
FT                   SGKQGFAIAAAAQAAGADVRLIAGPVELSDPKGVRVTHVESARQMLDAVEAELPADVAI
FT                   FAAAVADWRVANEGGQKLKKTDTAIPPLTLVENPDILATISKLKERRPGLVIGFAAETE
FT                   HLIDNAKAKFARKGCDWIVANDVSPATGVMGGDRNTVHLLTKDTEGVHVASWPIMTKDE
FT                   VATTLVAEIARTIGPAA"
FT   gene            85512..85970
FT                   /gene="dut"
FT                   /gene_synonym="dnaS"
FT                   /gene_synonym="sof"
FT                   /locus_tag="BBta_0084"
FT   CDS_pept        85512..85970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /gene_synonym="dnaS"
FT                   /gene_synonym="sof"
FT                   /locus_tag="BBta_0084"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /function="2'-deoxyribonucleotide/ribonucleoside
FT                   metabolism; Nucleotide and nucleoside conversions; DNA
FT                   replication; DNA repair"
FT                   /EC_number="3.6.1.23"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32385"
FT                   /db_xref="GOA:A5E891"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E891"
FT                   /protein_id="ABQ32385.1"
FT                   /translation="MTETIAIDVQILPHGEGLPLPAYQTAHAAGMDLLAAVAADAPLVL
FT                   GPGSHAMVPTGLSLALPDGYEAQVRPRSGLAARHGVTVLNAPGTVDADYRGEICVLLIN
FT                   HGKEPFTIRRGERIAQMVIAAVARAALSITTTLSATARGSGGFGSTGR"
FT   gene            86159..88666
FT                   /locus_tag="BBta_0085"
FT   CDS_pept        86159..88666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0085"
FT                   /product="Putative sensor histidine kinase"
FT                   /function="Two-component regulatory systems (external
FT                   signal)"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32386"
FT                   /db_xref="GOA:A5E892"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5E892"
FT                   /protein_id="ABQ32386.1"
FT                   /translation="MSGVIVVMRQTLLSCTSLARKGLLGLAATALAPATPGFAGNGVPA
FT                   DAVTTLFELSRQDVAEVTAMLALLGFSVVAAVALVRTRLAAARKEARLRADVAALQLQA
FT                   DRYRALLFAEPQILIAWPAGGHRPQISGDTAMLVPQDQPQRILAFGSWLPPEPALQLDR
FT                   AVDALREAGEGFLLHLTSSHGHAIEAMGRAIGGQAIVRIRELSGLRRELAETQLRFKAL
FT                   GEETESLRALAAALPWPVWARQANGALTYVNPAYARAADARDVPDAISRNLELLDSADR
FT                   TDLQRALGAAGRFEGRLPIVTGGERRMHDVHAFTLSNGSAGVAIDASEAAALRTALVRM
FT                   AEAHRRTLDQLSSGVAVFDGQRRLSFYNDSYRRLWDLDSAFLDSQPDDSSVLDRLRAAR
FT                   KLPEQADFRAWKAKLHEAYRAVEAAKDTWFLPDGRALSVVTTPNPEGGVTYLFDDVTES
FT                   FALARRFDGLIRVQRETLDSLAEGVAVFGSNGRVELFNPAFAKMWRLSPDQLREHPHID
FT                   TVESWCRSLYDDAVAWRTIREAITSIENRLDIALKLERKDGSVLDCMSRPLPDGATMLT
FT                   FQDITDTENVERALRESNEALEAAGQMKIDFVHHVSYELRAPLTTIIGFAHFLSDPSTG
FT                   PLTPKQAEYLDYVTKSTNALLALTNNILDLATIDAGAMKLELGPVDAAKAIEAAAEGVQ
FT                   DRLATDRIRLKVQVDPNVGTFVGDERRVVQVLYNLLANAVGFSPQDSTVLVSARRTDHS
FT                   VAFSVTDSGPGIPPDLKDQMFDWFVSRSQGSRHRGAGLGLSLVRSFVELHGGKVRMDSV
FT                   VGKGTTVTCDFPTDHIAQRNAAE"
FT   gene            88663..90192
FT                   /locus_tag="BBta_0086"
FT   CDS_pept        88663..90192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0086"
FT                   /product="hypothetical protein"
FT                   /note="putative ATPase/phosphotransferase; cell wall
FT                   biosynthesis; Evidence: Similar to previously reported
FT                   genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32387"
FT                   /db_xref="GOA:A5E893"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012180"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E893"
FT                   /protein_id="ABQ32387.1"
FT                   /translation="MTDRLTFTTALADETATAALMADLALLIGPGVLITLTGDLGAGKT
FT                   AAARAMIRYLADDAELEVPSPTFTLAQSYELPSFALVHADLYRISDASELEEIGLSPLP
FT                   EATVVLIEWPERAGDELPHDRIDIALRHDASHGDTARSAEITGTGKAAAIVARLKVLRE
FT                   FLTEAGHAKSRRERMAGDASTRSYARLYKGERVFILMNSPRRPDGPAIYNGKSYSGAVH
FT                   LAEDVRPFVAIAGALRGRGISAPKINDADLDHGFLITEDLGREGVIEGDPPRPIVECYE
FT                   VATDLLAALHAQDVPSVLPLAPQVTYTVPTFDADAMLIEIGLMLEWYLPDRGVAPSQVL
FT                   RAEFLELWRDLLDAPLAARPTWVIRDYHSPNLLWLPAREGIARVGVIDFQDAVMGPPAY
FT                   DVVSLAQDARIDVPADIEQALRTRYIAARQAASTAFDAEEFAAHYAIMSAQRNTRLLGT
FT                   FARLNRRDGKPQYLKHQPRIWDYLHRSLCHPVLDPLRDWYAANVPPPVGVA"
FT   gene            90484..90789
FT                   /locus_tag="BBta_0087"
FT   CDS_pept        90484..90789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0087"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32388"
FT                   /db_xref="GOA:A5E894"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:A5E894"
FT                   /protein_id="ABQ32388.1"
FT                   /translation="MAERMKGERVVFERGIPAFMMGIDGTWRRNCTIEDVSETGAKLTV
FT                   EGSVEGLHLKEFFLLLSSTGLAYRRCELAWVNGDQIGVTFLKQGKKKANKRAAAEA"
FT   gene            90938..91660
FT                   /locus_tag="BBta_0088"
FT   CDS_pept        90938..91660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0088"
FT                   /product="Putative Nucleotidyl transferase family protein"
FT                   /function="Nucleotide and nucleoside conversions"
FT                   /EC_number="2.7.7.13"
FT                   /note="putative Mannose-1-phosphate guanyltransferase;
FT                   Evidence: Function proposed based on presence of conserved
FT                   amino acid motif, structural feature or limited homology;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32389"
FT                   /db_xref="GOA:A5E895"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5E895"
FT                   /protein_id="ABQ32389.1"
FT                   /translation="MPVQPHKAMVLAAGLGLRMRPLTETQPKPLVRVAGRPLLDHVLDR
FT                   LAEAGVTEAVVNVHYLADQIIAHTATRTAPRVMISDERDQVLGTGGGVVKALPLLGHQP
FT                   FFHVNSDTMWIEGVRHNLSRLADAFDPELMDIMLLMAPTATSIGYSGLGDYAMLADGTL
FT                   RKRREHQVVPFVYAGAAIISPAIFDGAPKGEFSLTKMFDKANEQDRLFGLRLEGVWMHV
FT                   GTPAAVAEAEEALMESAA"
FT   gene            91842..94988
FT                   /locus_tag="BBta_0089"
FT   CDS_pept        91842..94988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0089"
FT                   /product="DNA helicase/exodeoxyribonuclease V, subunit B"
FT                   /function="DNA; DNA recombination; DNA degradation"
FT                   /EC_number="3.1.11.5"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32390"
FT                   /db_xref="GOA:A5E896"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A5E896"
FT                   /protein_id="ABQ32390.1"
FT                   /translation="MRVFTVPISAPFLRSVIAALVDGRLVDGFEARSDPARLATATLYL
FT                   PTRRSLRVAREMFLDELKTDAAVLPRLVALGDIDEDELAFAEDRDAFLGPAPLEIPERL
FT                   ADLQRRLTLARLVAAWAKTPVSAPLVIGGPASTLALAGDLARLIDDMVTRGVSWEALDA
FT                   LVPDQLDKYWQYSLEFLRIARTAWPAYLQEIERIEPAARRDLLIAAEAARLSAHPDGPV
FT                   IAAGSTGSMPATAKFLLAVAKLPHGAVVLPGLDTDLDEAAWNSIGGAKDRAGRVITPPA
FT                   VNHPQYAMHLLLKRFGLERRDVIRLAHPGRGGREVLISEAMRPSEATAVWHERLRQLDV
FT                   AANIAEAMDNLAVVAAPNPEMEALAIAIAMREARHLGKSAALVTPDRTLARRVMAALTR
FT                   WHLTFDDSGGDALLETPAGIFARLAAEAAARSLEPPTLLALLKHPLCRLGRAAKGWTSA
FT                   IETLELAMLRGTRPQAGTSGLARDFARFRDEHTRLHQGEASSLHRAEPRARLSPEQLDR
FT                   AGALIAQLQTALAPLENLASPRPQDFAELAARHREVLIALSTDDVGLSTAFTDRDGAAL
FT                   ARCFDDLLASGERCGLMAPLSDYPDLFHTAFSDRAVRRPERHGAQLQIYGPLEARLMQA
FT                   DRMIIGGLIEGVWPPAPRIDPWLSRPMRHQLGLDLPERRIGLSAHDFAQLLGAPEVILT
FT                   HAAKSGGAPAVASRFLHRLEAVAGADRWKAATARGETYVRYAEVLDQPPEVKPVEQPAP
FT                   KPPLAARPLRMSVTAIEDWLRDPYTIFARYILKLDPLDPVDMPLSAADRGSAIHEAIGE
FT                   FTQTYADALPPDPAPVLRQIGEKHFAPLMERPEARALWWPRFQRIAGWFAAWESARREQ
FT                   IGAITAEIRGEIGIPLSPDRTFILSARADRIERRAEGTYAILDYKTGQPPTAKQVRMGL
FT                   SPQLTLEAAILREGGFDGIPAGSLISQLVYIRLSGNNPPGEERILELKINKSDPPQHPD
FT                   QAAQEARAKLEALIRSFEDINQGYTSLNLSMWANRYGAYDDLARIKEWSAAGGLGVEEW
FT                   "
FT   gene            94985..98455
FT                   /locus_tag="BBta_0090"
FT   CDS_pept        94985..98455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0090"
FT                   /product="DNA helicase/exodeoxyribonuclease V, subunit A"
FT                   /function="DNA; DNA recombination; DNA degradation"
FT                   /EC_number="3.1.11.5"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32391"
FT                   /db_xref="GOA:A5E897"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A5E897"
FT                   /protein_id="ABQ32391.1"
FT                   /translation="MKAPRPIPQAVRDAQTRASNPAASAFVSANAGSGKTHVLVQRVIR
FT                   LLLDGVPPEKILCITFTKAAAANMAERVFSTLGHWVTLDDEALDSAIKSTGIPTPDKKL
FT                   RASARKLFASALETPGGLKVQTIHALCTRLLQQFPFEANVPARFSVLDERDQTEMMERA
FT                   NLKVLLDAARTPDSAVGRALQVAMANAADSTFKEVVREACLSRDHFMAWTDGAGRVEVA
FT                   AQQLGQVLGIAPDETLGAIEQDILDGPNLPRADWTEIAARLDGGAKTDQKQADQLRAAL
FT                   AFSGSDQVDEYLRVFLTEDKEPRKSLLTKKFADSNPGLAGLFESEARRLDRLIEKRRAA
FT                   VVRDRTEALLQIATAAAANYRREKEERGLLDYDDLIDKTLVMLNRVSAGWVHYKLDRGV
FT                   DHVLIDEAQDTSPRQWDIVAHIIEEFTAGAGAREGLTRTIFAVGDEKQSIFSFQGADPH
FT                   EFDARRRQLQKRFTDAGLLFDPVSFTYSFRSGPTVLHAVDHVFREREVYSSIHSPDIGY
FT                   PVHNSLTDAGPSLVELWSLCERDDRKEIEGWRAPFDGVSVTSPEVKLARRIQAEIKRLI
FT                   RAGTMTGHDGARRRLSYGDMLILVRRRGTAFDAVIQALKHAGIPVAGADRLKLTEHIAI
FT                   IDLMNLADALLLPQDDLALAIALKSPLFGLDDDDLFKLAWQRRGSLRDALTAQAADDPR
FT                   LQAVLRRLQQCERRAAEDTPFAFYAWLLGGDGGRRRILARLGHEANDALDEFLELALSY
FT                   ERKAPASLQGFVAWLRAADTEVKRDMEISRDEIRVMTVHGAKGLEASVVFLVDTTSSPA
FT                   DSQRLRLIHVSHGDQEIVVWAGRKSDDPQPVATARAAMLKETEDEYRRLLYVAMTRAAD
FT                   RLVIGGCMPGNMTNIRGGSWYDLMARGLDAAGLQVEVIETEDGPIKRYARAEDIAETAK
FT                   DEARRMVEMPVELPAWLRTVAAETPGEVAVLRPSDPSADERPVRSGESLAARSLAMQRG
FT                   TLVHRLLQSLPEVLPERRRDAALRYLLRNAADWPEEQRTGLAERVLAVIQDPRFAAVFA
FT                   PGSRAEVSIVGRLALPGQPRALVSGQIDRLVVTGSEVLIVDFKTNQQPPSDLAEVPPAY
FT                   VRQLALYRAVLGQLYPQRAVRAALLWTEAPEFMEIPASALDAMLPSDPV"
FT   gene            98557..98877
FT                   /gene="trxA"
FT                   /gene_synonym="dasC"
FT                   /gene_synonym="fipA"
FT                   /gene_synonym="tsnC"
FT                   /locus_tag="BBta_0091"
FT   CDS_pept        98557..98877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /gene_synonym="dasC"
FT                   /gene_synonym="fipA"
FT                   /gene_synonym="tsnC"
FT                   /locus_tag="BBta_0091"
FT                   /product="thioredoxin 1, redox factor"
FT                   /function="Thioredoxin, glutaredoxin"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32392"
FT                   /db_xref="GOA:A5E898"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5E898"
FT                   /protein_id="ABQ32392.1"
FT                   /translation="MAVGKVSDADFESEVLQADGPVVVDFWAEWCGPCRMIAPALDEIS
FT                   SAMGDKVKIVKLNVDESPKTASKYGVMSIPTLMVFKGGEMASRQVGAAPKAKLQQWISS
FT                   AV"
FT   gene            99021..100034
FT                   /locus_tag="BBta_0092"
FT   CDS_pept        99021..100034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0092"
FT                   /product="putative ATP-dependent DNA ligase"
FT                   /function="DNA replication; DNA repair; DNA recombination"
FT                   /EC_number="6.5.1.1"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32393"
FT                   /db_xref="GOA:A5E899"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A5E899"
FT                   /protein_id="ABQ32393.1"
FT                   /translation="MEARSVDAIPRGHEWQYEPKWDGFRCLLARHGADVTMQSKAGEDL
FT                   ARYFPEVAAAARALKATRFTLDGELVVPQAKSFSFDALLQRIHPAASRVKKLSVETPAL
FT                   FLAFDLLATAKDAELMARPLHARRLALEAFAKANFTDHPTFRLSPATTRFATAQDWLAQ
FT                   SGGGSDGVIAKRIDLPYQAGNRDGMQKIKRHRSADCVIGGFRYATNKGAQGRKLVGSLL
FT                   LGLYDDDGLLHHVGFTSALKKEEKPALTDKLEPLIAPPGFTGNAPGGPSRWSTARSTEW
FT                   CPLKPKLVIEVCYDHFSGDRFRHGTSILRWRPDKSPRQCTFEQLKQTIADPLKLLA"
FT   gene            complement(100037..100777)
FT                   /locus_tag="BBta_0093"
FT   CDS_pept        complement(100037..100777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0093"
FT                   /product="hypothetical protein"
FT                   /note="phosphoesterase domain, MJ0912 type; Evidence:
FT                   Similar to previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32394"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8A0"
FT                   /protein_id="ABQ32394.1"
FT                   /translation="MRFAAIADIHGNHLALEAVLADIRDQGVTDIVDLGDMASGPLDAR
FT                   RTMDMLMALDAVHVRGNHDRWLIDRPFEKMGGWERPAYPQLDAGHLDWLRTIPATAVYR
FT                   EQVFLCHATPEDDNVYWLESVAPDGAITCASLDDIERLAAGISQSLILCGHTHTARAVR
FT                   LRDGRLIVNPGSVGSPGYSYNVPHPHVVQAGTPDARYAIVELTPAGWSVSFRHVPYDHR
FT                   AMATLARANGDTEFASALATGWIR"
FT   gene            complement(100790..102133)
FT                   /locus_tag="BBta_0094"
FT   CDS_pept        complement(100790..102133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0094"
FT                   /product="putative folC protein"
FT                   /function="Folic acid; Formyl-tetrahydrofolate
FT                   biosynthesis"
FT                   /EC_number="6.3.2.17"
FT                   /EC_number="6.3.2.12"
FT                   /note="Dihydrofolate synthase; Folylpolyglutamate synthase;
FT                   Localization: 2 : Cytoplasmic; Evidence: Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32395"
FT                   /db_xref="GOA:A5E8A1"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8A1"
FT                   /protein_id="ABQ32395.1"
FT                   /translation="MNDLAAQPRPSLDELIARLSALHPSRISLGLERMHRLLAQLDHPE
FT                   RKLPPVIHVAGTNGKGSTVAYLRAMLEAAGLRVHVFTSPWLVRINESYRLGKVGGGVLV
FT                   DDDELISALLECERVNAGAPITFFEVKTVAAFLLFAQHPADVVLLEVGLGGRLDSTNVV
FT                   DQVAASVLTPISMDHMEFLGDTRALIAAEKAAIIKRGCPVISAAQESDAMAVIEREAKR
FT                   QRAPLFAAGESWHVSVERNRLVYQDDRGLLDLPAPRLFGRHQFDNAGLAIATLRAIDQF
FT                   RLTTKAFEDGIVNAEWPARMQRLSSGALTTLGPQGAEIWLDGGHNAEGGRVVAAALGDL
FT                   EERVSRQLVVIVGMMGNKDAAAFLANFAGLTRHIIVVPIPNESKAMAPADLAAAARTLG
FT                   MRVEIADGVASALAGIARLAYEVPPRILITGSLYLAGHVLDLNGTPPT"
FT   gene            complement(102130..103068)
FT                   /gene="accD"
FT                   /gene_synonym="dedB"
FT                   /gene_synonym="usg"
FT                   /locus_tag="BBta_0095"
FT   CDS_pept        complement(102130..103068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /gene_synonym="dedB"
FT                   /gene_synonym="usg"
FT                   /locus_tag="BBta_0095"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /function="Fatty acid and phosphatidic acid; Cytoplasm"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32396"
FT                   /db_xref="GOA:A5E8A2"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8A2"
FT                   /protein_id="ABQ32396.1"
FT                   /translation="MNWLTNVVRPKIRNILRRETPENLWIKCPDSGQLVFYKDVEANQF
FT                   VIPGSNYHMRMGATARLKSMFDNETWFDVALPEVTPDPLKFRDERRYADRIKDARARTG
FT                   MNDAVKVGFGKLEGMGVVIAVQDFDFMGGSLGMAAGEAIVRGLELAVEKTSPFIVFAAS
FT                   GGARMQEGILSLMQMPRTTVAVQMLREAKLPYIVVQTNPTTGGVTASYAMLGDVHIAEP
FT                   GALIGFAGARVIEQTIREKLPEGFQRAEYLLDHGMVDMVVHRHDLRPTLARLCRLLTKS
FT                   PAVEHPKPAPQLPPPAKTVEAADAPAVAPTA"
FT   gene            complement(103163..103987)
FT                   /gene="trpA"
FT                   /gene_synonym="try"
FT                   /gene_synonym="tryp"
FT                   /locus_tag="BBta_0096"
FT   CDS_pept        complement(103163..103987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /gene_synonym="try"
FT                   /gene_synonym="tryp"
FT                   /locus_tag="BBta_0096"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /function="Tryptophan; Cytoplasm"
FT                   /EC_number="4.2.1.20"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32397"
FT                   /db_xref="GOA:A5E8A3"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8A3"
FT                   /protein_id="ABQ32397.1"
FT                   /translation="MDARFAQLKKEGRSAFVTFVMGGDPDPETSLAIVKALPQAGADII
FT                   EIGMPFTDPMADGPSIQAAGLRALKAGMTLKKTLQLVRSFREGDAATPIVLMGYYNPIY
FT                   IYGVDKFLDDAKAAGVDGLIIVDLPPEEDTELCIPALKAGLNFIRLATPTTDDKRLPAV
FT                   LANTSGFVYYVSITGITGAAAADSSAVGAAVARIKRHTALPVCVGFGIRTPETARAIAA
FT                   NADGAVVGTALVDALRASLDAEGRATPKTVSAVADLVAALAQGVRGAQQAAE"
FT   gene            complement(103996..105219)
FT                   /gene="trpB"
FT                   /locus_tag="BBta_0097"
FT   CDS_pept        complement(103996..105219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="BBta_0097"
FT                   /product="tryptophan synthase, beta chain"
FT                   /function="Tryptophan; Cytoplasm"
FT                   /EC_number="4.2.1.20"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32398"
FT                   /db_xref="GOA:A5E8A4"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8A4"
FT                   /protein_id="ABQ32398.1"
FT                   /translation="MTTARPNSYRSGPDERGHFGIFGGRFVAETLMPLILDLEKAYADA
FT                   KADPAFQAEMNSYRTHYVGRPSPLYYAERLTQHLGGAKIYFKRDELNHTGSHKVNNVLG
FT                   QIMLARRMGKRRIIAETGAGQHGVATATLCARFGLDCVVYMGAVDVERQQPNVLRMEML
FT                   GAKVVPVQSGARTLKDAMNEALRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQSVIGDE
FT                   TRVQMQEAEGRLPDSLVACIGGGSNAMGLFHPFLDDPSVEIFGVEAAGHGLTQLHAASI
FT                   AGGRPGVLHGNRTYLLMDEDGQIAEAHSISAGLDYPGIGPEHSWLFEAKRVTYLSATDD
FT                   EALAAFQLLSRLEGIIPALEPAHAIAKVMELAPKKPKEHLMVVNLCGRGDKDVPQVGEI
FT                   LRKRAKES"
FT   gene            complement(105216..105875)
FT                   /gene="trpF"
FT                   /locus_tag="BBta_0098"
FT   CDS_pept        complement(105216..105875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="BBta_0098"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /function="Tryptophan"
FT                   /EC_number="5.3.1.24"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32399"
FT                   /db_xref="GOA:A5E8A5"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8A5"
FT                   /protein_id="ABQ32399.1"
FT                   /translation="MSLLVKICGLTTPETLGAALDAGAEMVGFVFFPPSPRHVGLTAAR
FT                   ELGQQAKGRALKVALTVDADDATFENIVETLRPDLLQLHGRESVARIRDLKQRFGLPVM
FT                   KAIAVATTADLVPLAGYADVCDRILFDARAPKDATRPGGLGATFDWHVLDALALDRPFM
FT                   VSGGLSADNVAEAVRITRAGGVDVSSGVERAPGVKDCDMIRNFIRAARAAEELSVQ"
FT   gene            complement(105954..106346)
FT                   /locus_tag="BBta_0099"
FT   CDS_pept        complement(105954..106346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0099"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32400"
FT                   /db_xref="GOA:A5E8A6"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8A6"
FT                   /protein_id="ABQ32400.1"
FT                   /translation="MRRFLTVVIVVPLLVLFVVFAVANRHFVTVSFDPFNAVDPALSVS
FT                   IPLFALIIAVAILGVIAGGCATWIGQRRWRRAARRHLADAEAARAQVAQLSAAVRANQG
FT                   PSQSLVPAAPARLFAPYGRDKQGAAL"
FT   gene            complement(106425..106736)
FT                   /gene="ihfB"
FT                   /gene_synonym="himD"
FT                   /gene_synonym="hip"
FT                   /locus_tag="BBta_0101"
FT   CDS_pept        complement(106425..106736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ihfB"
FT                   /gene_synonym="himD"
FT                   /gene_synonym="hip"
FT                   /locus_tag="BBta_0101"
FT                   /product="Integration host factor beta-subunit (IHF-beta)"
FT                   /function="DNA recombination; Nucleoproteins, basic
FT                   proteins; Cytoplasm"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32401"
FT                   /db_xref="GOA:A5E8A7"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8A7"
FT                   /protein_id="ABQ32401.1"
FT                   /translation="MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVAALARGDRVEL
FT                   RGFGAFSVKHRPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNRDNPAGAADTDD"
FT   gene            complement(106906..107886)
FT                   /locus_tag="BBta_0102"
FT   CDS_pept        complement(106906..107886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0102"
FT                   /product="signal peptide peptidase A, Serine peptidase,
FT                   MEROPS family S49"
FT                   /function="Proteins/peptides/glycopeptides"
FT                   /EC_number="3.4.21.-"
FT                   /note="putative signal peptide peptidase SppA; Evidence:
FT                   Function proposed based on presence of conserved amino acid
FT                   motif, structural feature or limited homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32402"
FT                   /db_xref="GOA:A5E8A8"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8A8"
FT                   /protein_id="ABQ32402.1"
FT                   /translation="MSLDSDVIVDRRRLRRKLTFWRVVAVLIAIAALSAIGLAMSPRGR
FT                   TALSTSGSIARVNIEGLIRSDHERVEALERLENSSAEAVIVHINSPGGTTAGSEQLYDS
FT                   LVRLKAKKPLVVVVEGLAASGGYIGAIAADHIVAQQSSLVGSIGVLFQYPNVSELLKTI
FT                   GVKVEEVKSSPLKAAPNGYEPTSPEARAALDALVKDSYAWFRGLVKDRRGMDDALLEKV
FT                   ADGRVFTGRQAIELKLIDELGDEKTAVAWLVANKNVKKDLPVRDYKLVPRFGDLTFLRT
FT                   ATSLVLNAVGLSGIAHQIEQAGVVQAVDRLGLDGMLALWTPAAGN"
FT   gene            complement(108117..109826)
FT                   /gene="rpsA"
FT                   /gene_synonym="ssyF"
FT                   /locus_tag="BBta_0103"
FT   CDS_pept        complement(108117..109826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /gene_synonym="ssyF"
FT                   /locus_tag="BBta_0103"
FT                   /product="SSU ribosomal protein S1P"
FT                   /function="Translation; Ribosomal proteins; Ribosome;
FT                   Cytoplasm"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32403"
FT                   /db_xref="GOA:A5E8A9"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8A9"
FT                   /protein_id="ABQ32403.1"
FT                   /translation="MASSISANSYNPSRDDFAAMLDESFTKGNLQESSVVKGKVVAIEK
FT                   DMAVIDVGLKTEGRVALREFSGPGRDSELKVGDEVEVFLDRIENALGEAVLSRDKARRE
FT                   ESWGKLEKAFQNNEKVNGVIFNQVKGGFTVDLDGAVAFLPRSQVDIRPIRDVAPLMNNS
FT                   QPFQILKMDRRRGNIVVSRRTVLEETRAEQRQELVQNLEEGQVIDGVVKNITDYGAFVD
FT                   LGGIDGLLHVTDIAWRRVNHPTEVLSIGQTVKVKIIKINHETHRISLGMKQLLDDPWQG
FT                   IEAKYPLQARFHGRVTNITDYGAFVELEPGIEGLIHVSEMSWTKKNMHPGKIVSTSQEV
FT                   EVQVLEVDSVKRRISLGLKQTMRNPWEVFVEKHPTGSVVEGEVKNKTEFGLFLGLEGDV
FT                   DGMVHLSDLDWKLPGEQVIDNYKKGDMVKAVVLDVDVEKERISLGIKQLEGDPFAEPGD
FT                   VKKGAVVTCEVLDVKDGGIDVKIVGTEFSTFIKRSELARDRNDQRSERFAVGEKVDARV
FT                   IQFDKKARKVQVSIKALEVAEEKEAIAQYGSSDSGATLGDILGTALKNRDAK"
FT   gene            complement(110077..110715)
FT                   /gene="cmk"
FT                   /gene_synonym="mssA"
FT                   /gene_synonym="ycaF"
FT                   /gene_synonym="ycaG"
FT                   /locus_tag="BBta_0104"
FT   CDS_pept        complement(110077..110715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /gene_synonym="mssA"
FT                   /gene_synonym="ycaF"
FT                   /gene_synonym="ycaG"
FT                   /locus_tag="BBta_0104"
FT                   /product="cytidylate kinase"
FT                   /function="Pyrimidine ribonucleotide/ribonucleoside
FT                   biosynthesis; Nucleotide and nucleoside conversions;
FT                   Cytoplasm"
FT                   /EC_number="2.7.4.14"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32404"
FT                   /db_xref="GOA:A5E8B0"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8B0"
FT                   /protein_id="ABQ32404.1"
FT                   /translation="MIIAIDGPAASGKGTMAKRLAAHYGLRHLDTGVIYRAVAHAMLAA
FT                   GIDLKDEARAAEVAMTLDPSTFDNPALRSHDVGSAASVVSALPRVREALVAFQRQFASA
FT                   PPGAVLDGRDIGTVICPDAEVKIYVVADPRIRAHRRTLEARSRGEPADEAAILADILAR
FT                   DERDQNRAVAPLKQAPDAYLLDNSHLDIEGGVRAAIDIVEAVRAGRQRV"
FT   gene            complement(110712..112049)
FT                   /gene="aroA"
FT                   /locus_tag="BBta_0105"
FT   CDS_pept        complement(110712..112049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="BBta_0105"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /function="Chorismate"
FT                   /EC_number="2.5.1.19"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32405"
FT                   /db_xref="GOA:A5E8B1"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8B1"
FT                   /protein_id="ABQ32405.1"
FT                   /translation="MSAPAAPIPLESRASGPLSGTLRVPGDKSISHRALILGALSVGET
FT                   RISGLLEGEDVLNTAQAMRALGAKVERHGDFAWTVHGVGVGGFAQPAATLDFGNSGTGC
FT                   RLVMGAVAGCPITAVFDGDASLRSRPMRRILDPLELIGAKVTASAEGGKLPLTLQGASN
FT                   PVPVVYRTPVASAQIKSAVLLAGLAAPGVTTVIEQEASRDHTELMLKHFGAEIVTTLEG
FT                   THGRRIALTGQPELHGAPVIVPADPSSAAFPLVAALIVDGSDLVLSDVMTNPLRTGLFA
FT                   TLREMGASIEEDDVRGDAGEPMVRLRVRASKLRGVEVPPERAPSMIDEYLVLAVAAAYA
FT                   EGTTIMRGLHELRVKESDRLEATAAMLRVNGVKVEISDDDLIVEGRGHVPGGGLVATHM
FT                   DHRIAMSALVMGLASDKPVKVDDTAFIATSFPDFVPLMCKAGADFA"
FT   gene            112200..112604
FT                   /locus_tag="BBta_0106"
FT   CDS_pept        112200..112604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0106"
FT                   /product="hypothetical protein"
FT                   /note="FYDLN motif; Evidence: Similar to previously
FT                   reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32406"
FT                   /db_xref="InterPro:IPR012644"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8B2"
FT                   /protein_id="ABQ32406.1"
FT                   /translation="MAKSELGTKRICPTTGKKFYDLNKNPVISPYTGEVVPIAPVAPTR
FT                   AMRGEAARAAAAADVVEPAEAEELVPLEEADAEENTGKVKAVVPETEDDIEIDETLDDD
FT                   EDDDSTFIADEEEGDEDVTDIIGDVGGDEE"
FT   gene            112686..112761
FT                   /locus_tag="BBta_tRNA1"
FT   tRNA            112686..112761
FT                   /locus_tag="BBta_tRNA1"
FT                   /product="tRNA-Ala"
FT                   /note="Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT   gene            113010..113261
FT                   /locus_tag="BBta_0107"
FT   CDS_pept        113010..113261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0107"
FT                   /product="hypothetical protein"
FT                   /function="DNA repair"
FT                   /note="excinuclease ABC, C subunit domain (N-term);
FT                   Evidence: Similar to previously reported genes of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32407"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8B3"
FT                   /protein_id="ABQ32407.1"
FT                   /translation="MWYVYIIRSVTFPDQEYVGATADLRQRLKDHNAGRSAHTSKFMPW
FT                   TLVWYCALPDKSNALAFEAYLKSHSGRAFSKKRLVRPC"
FT   gene            complement(113269..113727)
FT                   /gene="ohrR"
FT                   /locus_tag="BBta_0108"
FT   CDS_pept        complement(113269..113727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ohrR"
FT                   /locus_tag="BBta_0108"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="Transcriptional level; Other stresses
FT                   (mechanical, nutritional, oxidative)"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32408"
FT                   /db_xref="GOA:A5E8B4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8B4"
FT                   /protein_id="ABQ32408.1"
FT                   /translation="MRKKSAADVPLQLGNQLCFAVYSTAHAFNRVYKPLLDRLGLTYPQ
FT                   YLVMLVLWERDGLSVKEIGERLYLDSGTLTPLLKRMEAAHLLKRTRSAADERQVLVALT
FT                   AQGAALRDKAKAIIPPAILDATGCSLAELADLHGKLVRLREQLNAAAG"
FT   gene            113897..114322
FT                   /gene="ohr"
FT                   /locus_tag="BBta_0109"
FT   CDS_pept        113897..114322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ohr"
FT                   /locus_tag="BBta_0109"
FT                   /product="organic hydroperoxide resistance protein"
FT                   /function="Other stresses (mechanical, nutritional,
FT                   oxidative)"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32409"
FT                   /db_xref="GOA:A5E8B5"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8B5"
FT                   /protein_id="ABQ32409.1"
FT                   /translation="MSVNVLYKTSAKATGGRDGEAATLDGSLSVKLSTPKELGGGGGAG
FT                   NNPEQLFAAGYAACFIGAMKFVASQGGPKVPADASVTSTVGIGPRSEGGFGITVELAVA
FT                   LPGLAKADAEALVEKAHQVCPYSNATRNNVDVKLSVI"
FT   gene            114473..115675
FT                   /locus_tag="BBta_0110"
FT   CDS_pept        114473..115675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0110"
FT                   /product="Putative caiB/baiF CoA-transferase family
FT                   protein"
FT                   /EC_number="2.8.3.16"
FT                   /note="Putative Formyl-CoA transferase; Evidence: Function
FT                   proposed based on presence of conserved amino acid motif,
FT                   structural feature or limited homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32410"
FT                   /db_xref="GOA:A5E8B6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8B6"
FT                   /protein_id="ABQ32410.1"
FT                   /translation="MTPQFAPGAMAGLRVIDLTRVLGGPYCTQILADHGADVIKVEPPA
FT                   GDEVRDWGPPFHDEDAAYFVGINRNKRSIGLDLASDGGRVVLLKMLETADVLIENFKPG
FT                   TLEKWGIGSDALREKFPKLVHCRICGFGADGPRGGNPGYDAIIQAMTGMIAATGSPESG
FT                   PMRIGVPLVDITTGLYAAIGILMALSERQRSGIGQFLEVTLYETGLAIMHPHTANYFMH
FT                   GKPPSLTGNEHPNLVPYAIFPTKTDDIFIGVGNDGTFRKLAREIGRPDLGTDPRFARNR
FT                   DRVANREALRAELAAVFSQFEAEPLCDRLLAAGLPAGPVQKIDQALTHPHTLYRGDVIE
FT                   KDWYKGVASPIRLERTKASLRTTPPAFSQHAQEVLAEFGYTPDEIEALLAEGTVCAERK
FT                   R"
FT   gene            115867..117183
FT                   /locus_tag="BBta_0111"
FT   CDS_pept        115867..117183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0111"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /function="Aerobic respiration; Anaerobic respiration;
FT                   Fatty acid and phosphatidic acid; Phospholipid; Glycerol
FT                   metabolism; periplasmic binding component; Periplasmic
FT                   space"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 9 : Periplasmic; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32411"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8B7"
FT                   /protein_id="ABQ32411.1"
FT                   /translation="MSLRQFAAAAVVTATFGFAVSPAHAVTEIQWWHAMTGGNNDIVNR
FT                   LAEEFNASQSDYKVVPTFKGAYPDTLNAGIAAFRAGTAPHILQVFEVGTATMMSAKGAI
FT                   KPVYELMKDAGEPFDPKAYLPAITGYYSTSKGDMLSFPFNSSSMVMWINKDELKKAGVA
FT                   EIPKTWPEVFDAAKKLKAAGHDTCGFSNAWASWANIEQFSAWHNVPIGTKANGLDGFDT
FT                   VLEFNTPLHVKHLQNLVELQKDKTYDYSGRGSASESRFGSGECAIFLTSSGYYATAKST
FT                   AKFDFTSAPMPYYPDAPGAPQNSIIGGASLWVMGGKSADEYKGVAKFFTFLSDTNRQAK
FT                   LHQESGYLPITKAAYEKTKADGFYEKNPTLQTPLKELTNKEPTENSRGLRFGNMVQMRD
FT                   VWAEEIEAALAGKKTAKDALDSAVARGNAMLRTFEKTAK"
FT   gene            117253..118134
FT                   /locus_tag="BBta_0112"
FT   CDS_pept        117253..118134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0112"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /function="Aerobic respiration; Anaerobic respiration;
FT                   Fatty acid and phosphatidic acid; Phospholipid; Glycerol
FT                   metabolism; membrane component; Membrane; Inner membrane"
FT                   /note="putative glycerol 3-phosphate transport protein,
FT                   ugpA-like protein; Evidence: Function proposed based on
FT                   presence of conserved amino acid motif, structural feature
FT                   or limited homology; Localization: 5 : Inner membrane
FT                   protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32412"
FT                   /db_xref="GOA:A5E8B8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8B8"
FT                   /protein_id="ABQ32412.1"
FT                   /translation="MEKSVVFNGKLLPYVLLAPQLAITLIFFYWPASQAIWQSFLREDA
FT                   FGLNSEFVGLENYQALFAQPEYYTAIGTTVVFSSLVTVLSLGVALLFATQADKNLKGAS
FT                   AYKTLMIWPYAVAPAIAGVLWFFIFHPTLGTLARPLRVMGFDWNPMLNGTHAMVLVVMA
FT                   AVWKQVAYNFLFFLAGLQAIPKSVIEAGAIDGAGPLRRFWTIIFPLLSPTTFFLLVVNI
FT                   VYVFFETFGIIDAVTSGGPAGTTTTMVYKVFADGRLGGDLGGSAAQSVVLMVIVIALTA
FT                   IQFRYVERKVQY"
FT   gene            118134..118982
FT                   /locus_tag="BBta_0113"
FT   CDS_pept        118134..118982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0113"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /function="Aerobic respiration; Anaerobic respiration;
FT                   Fatty acid and phosphatidic acid; Phospholipid; Glycerol
FT                   metabolism; membrane component; Membrane; Inner membrane"
FT                   /note="putative glycerol 3-phosphate transport protein,
FT                   ugpE-like protein; Evidence: Function proposed based on
FT                   presence of conserved amino acid motif, structural feature
FT                   or limited homology; Localization: 5 : Inner membrane
FT                   protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32413"
FT                   /db_xref="GOA:A5E8B9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8B9"
FT                   /protein_id="ABQ32413.1"
FT                   /translation="MVEHRPLRDLVAYLVLSLGVVIFAFPVYVAFVASTYDAATVVSGN
FT                   LPLVPGGRMLENYYRAVFVGGSRFMNQPVGVLLVNSFITAIGIAVGKIIISILSAFAIV
FT                   YFRFPFRKTAFWIIFITLMLPVEVRIYPTYKVVADLRMLDTYAGLILPLIASATGTLLF
FT                   RQFFMTVPDELLEASRIDGAGPLRFFWDTLLPLSMTTVAALFVIQFIYGWNQYLWPLLI
FT                   TTKDSMQTIVIGIKKMLTTTDELAEWQLAMATAVLAMLPPVAVVIFMQRLFVKGLVETE
FT                   K"
FT   gene            119120..120199
FT                   /locus_tag="BBta_0114"
FT   CDS_pept        119120..120199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0114"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /function="Aerobic respiration; Anaerobic respiration;
FT                   Fatty acid and phosphatidic acid; Phospholipid; Glycerol
FT                   metabolism; ATP binding component; Cytoplasm"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32414"
FT                   /db_xref="GOA:A5E8C0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8C0"
FT                   /protein_id="ABQ32414.1"
FT                   /translation="MANVTLRNVRKVYPGGFEAIKGIDIEVGDGQFCVLVGPSGCGKST
FT                   LLRMVAGLETITSGEIDIGGRIVNAIEPADRDIAMVFQNYALYPHMSVYNNMAYGLRNR
FT                   RVPEAEIKTRVEDAARILELGTMLERKPRQLSGGQRQRVAMGRAIVRKPKVFLFDEPLS
FT                   NLDAKLRIAMRVEIRKLQRRLNTTAIYVTHDQLEAMTLADILVVMNGGKVEQIGNPLEI
FT                   YQRPATTFVASFIGAPPMNLMPIEGVRAQLHGADAVPAEAGQLGIRPEDFELADTVPAG
FT                   GIGLDLRVDAIEHVGAETYVYGARQGSDSQDSLIAAANDVIVRLPGTAAPDIGARIRAV
FT                   APRGKLHLFSVDGRQRLPI"
FT   gene            120333..120758
FT                   /locus_tag="BBta_0115"
FT   CDS_pept        120333..120758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0115"
FT                   /product="putative small heat shock protein"
FT                   /function="Temperature extremes; Other stresses
FT                   (mechanical, nutritional, oxidative)"
FT                   /note="putative HSP20-like chaperone; Evidence: Function
FT                   proposed based on presence of conserved amino acid motif,
FT                   structural feature or limited homology; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32415"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8C1"
FT                   /protein_id="ABQ32415.1"
FT                   /translation="MSRVPSLSSPFLLGFDEIERVLDRVVKGADGYPPYNIERFERTNG
FT                   QPERLRITLAVAGFTRDQLDVTIEENQLVIRGRQQDDKSRQYIHRGIAARHFQRTFVLA
FT                   EGMHVLGADLKNGLLSVDLARPEPERIVKTIAINEHE"
FT   gene            120817..121080
FT                   /locus_tag="BBta_0116"
FT   CDS_pept        120817..121080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0116"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32416"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8C2"
FT                   /protein_id="ABQ32416.1"
FT                   /translation="MNEVNVASDSRVSPEALATLGEGHIAYVKQIRSEDVPGLFPQAPR
FT                   IAPGLKLFALHAADGTPIMLTDSREAAIANAWSHELQAVSVH"
FT   gene            121205..121711
FT                   /locus_tag="BBta_0117"
FT   CDS_pept        121205..121711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0117"
FT                   /product="putative Acetyltransferase, GNAT family"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32417"
FT                   /db_xref="GOA:A5E8C3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016890"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8C3"
FT                   /protein_id="ABQ32417.1"
FT                   /translation="MSSSITALSATELRVDDKLAAALLALNNAHASELSWLAPEALLHL
FT                   VEQAWRAWRIGAADALLIALDQDAVYDSPNYRWFRAGYDRFVYVDRIVVAPSARGRGLA
FT                   RRLYDELIRTATEAGHDRVVCEVNLDPPNPQSDAFHAALGFQPLATARIHSGTKTVRYM
FT                   ARSLR"
FT   gene            121888..122895
FT                   /locus_tag="BBta_0118"
FT   CDS_pept        121888..122895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0118"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32418"
FT                   /db_xref="GOA:A5E8C4"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8C4"
FT                   /protein_id="ABQ32418.1"
FT                   /translation="MHGSRLDAGVFRELARGTIPNRHVFLDSPQPGPSPYYVICNSVPK
FT                   AGTYLLVELVRALGGHVDLGYHTYTSSISKLNPDGSLDYGRALPAPLWASALRSGYFCA
FT                   SHTEYCPYLEQYLLGRPEHKMLFIVRDPRDIVVSWVDFVYHSASYPKMRKWNAYLRAAG
FT                   SAAHPDDASRITSTLLSLPRSGIKNFMSWLDSPACLTVRFEELYSELAADDAARSSFPV
FT                   LHRICDYLGLPRRTAAELDVLGRGLTSSGRGRKIGIYKERMLPQHFDLLRSEAFQELVV
FT                   EFGYEPTPLPIPARTNGFGAARRLASRLSRSLQGGVIRRQAAEAGGSASTEYSA"
FT   gene            complement(122847..123308)
FT                   /gene="ptsN"
FT                   /locus_tag="BBta_0119"
FT   CDS_pept        complement(122847..123308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="BBta_0119"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /function="Regulation"
FT                   /note="Phosphotransferase enzyme IIA component; Evidence:
FT                   Function of homologous gene experimentally demonstrated in
FT                   an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32419"
FT                   /db_xref="GOA:A5E8C5"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8C5"
FT                   /protein_id="ABQ32419.1"
FT                   /translation="MPITDLVAPEAILPALKVISKKQALQELAARAAALTGQNERAVFE
FT                   VLLQREKLGTTAVGYGVAIPHGKLPKLDKLFGLFARLERPIDFEAMDGQPVDLVFLLLA
FT                   PEGAGADHLKALARIARLLRDQDVAKKLRASRDAQALYSVLALPPASAA"
FT   gene            complement(123634..124236)
FT                   /locus_tag="BBta_0120"
FT   CDS_pept        complement(123634..124236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0120"
FT                   /product="sigma 54 modulation protein / SSU ribosomal
FT                   protein S30P"
FT                   /function="Transcription related; Sigma factors,
FT                   anti-sigmafactors"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32420"
FT                   /db_xref="GOA:A5E8C6"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8C6"
FT                   /protein_id="ABQ32420.1"
FT                   /translation="MTLRISGKSISVSEALRGRVSERTDEVLRKYFDGNYSGHVTLSKD
FT                   GFGFKTDCALHLDSGITLEAESNAPDAYASADQALLMIEKRLRRYKSRLKDRSARKSHA
FT                   ANAALAGLDGAVLDAPSYVIEAPAEGDEEITGYNPVIIAENTTALKRLSVSEAVLELDL
FT                   SGAPCMVFQHGSSGRVNIIYRRADGNIGWVDPPAVKP"
FT   gene            complement(124309..125946)
FT                   /gene="rpoN"
FT                   /gene_synonym="glnF"
FT                   /gene_synonym="ntrA"
FT                   /locus_tag="BBta_0121"
FT   CDS_pept        complement(124309..125946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /gene_synonym="glnF"
FT                   /gene_synonym="ntrA"
FT                   /locus_tag="BBta_0121"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN/SigL"
FT                   /function="Nitrogen metabolism; Transcription related;
FT                   Sigma factors, anti-sigmafactors; Stimulon (ie.
FT                   environmental stimulus); Prophage genes and phage related
FT                   functions"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32421"
FT                   /db_xref="GOA:A5E8C7"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8C7"
FT                   /protein_id="ABQ32421.1"
FT                   /translation="MALTQRLEFRQSQSLVMTPQLMQAIKLLQLSNLDLSTFVEEELER
FT                   NPLLERANDGPEAPVAGEQQMSERSEFSDAGEAGGEDFGDGGGAAGESFDGAPEDWMSR
FT                   DLGTRTEIEQTLDTGLDNVFSEEPAETAARNAQDAAPTTYTEWGGGASGDEDYNLEAFV
FT                   AAETTLSDHLAEQAAVAFTAPADRMIGQYLIDLVDEAGYLPADLGQAADRLGAEQADVD
FT                   AVLGVLQTFDPPGICARNLSECLAIQLRELDRYDPAMQALVEHLDILAKRDFASLRKLC
FT                   GVDDEDLVDMIGEIRRLDPKPGLKFGTTRTQTMVPDVYVRPGPDGGWLVELNSDTLPRV
FT                   LVNQVYYSELSKTIRKDGDKSYFTDCLQNATWLVRALDQRARTILKVATEIVRQQDGFF
FT                   THGVAHLRPLNLKAVADAIQMHESTVSRVTANKYMATNRGTFELKYFFTASIASADGGE
FT                   AHSAEAVRHHIKQLIDAEDPSAILSDDTIVEKLRAAGIDIARRTVAKYREAMRIPSSVQ
FT                   RRRDKQSMLAHALSGPAGADRTRDTASV"
FT   gene            complement(126158..127168)
FT                   /locus_tag="BBta_0122"
FT   CDS_pept        complement(126158..127168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0122"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /function="ATP binding component; Cytoplasm"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32422"
FT                   /db_xref="GOA:A5E8C8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8C8"
FT                   /protein_id="ABQ32422.1"
FT                   /translation="MVDLIGMFRRRPAKRSPQGSARRRDDITAMNDPFGNSYGDDPLAA
FT                   LADSVRDEATPRINPRSPQNTEQIQRKRPASQPMPAKPRSNGSGGPQLLRRPGFLAVHS
FT                   IEKSFGSRQVVRGVSIYVRRGEAVGLLGPNGAGKTTVFYMITGLIKADRGAIELDGHDV
FT                   TRLPMYQRARLGIGYLPQEASIFRGLTVEQNIRAVLEVVEPSRKKRERELDALLEEFTI
FT                   TRLRKSPSIALSGGERRRVEIARALATRPNYMLLDEPFAGIDPIAVGDIQQLVRHLTNR
FT                   GIGVLITDHNVRETLGLTDRAYIVYAGQILTEGSPEEIVADPDVRRLYLGEEFRL"
FT   gene            complement(127327..128004)
FT                   /locus_tag="BBta_0123"
FT   CDS_pept        complement(127327..128004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0123"
FT                   /product="hypothetical protein"
FT                   /note="OstA-like protein domain; Evidence: Similar to
FT                   previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32423"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8C9"
FT                   /protein_id="ABQ32423.1"
FT                   /translation="MTTCRFISAAIRGAGLVALAMVACAGAVQAQTAATGVPNALQGFS
FT                   QNRDQPIQIEAASLEMRDKKKEATFSGNVKVVQGDTTMTSKSLVVFYDGGAQGGAKPAK
FT                   TMQAAAPGPDGSSSIRRLEARGGVTVTQKEQVVTGETAVFDTKTNQITMQGNVVLTQCK
FT                   NVLRGDRLMVDMTTGVSRVESDSGRVQALLPQASSGSGGCGSSGGAAPGGGAPLSLGST
FT                   KTK"
FT   gene            complement(128009..128710)
FT                   /locus_tag="BBta_0124"
FT   CDS_pept        complement(128009..128710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0124"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32424"
FT                   /db_xref="GOA:A5E8D0"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8D0"
FT                   /protein_id="ABQ32424.1"
FT                   /translation="MNSVHNPAYDPSLQARFAVAARHSRFVRVLRVAVPAAVGLAMAVV
FT                   IGVALFNPFHMEINTKNLTGNLVISGRKITMETPHLTGFTPDQRPYDLVAKSAVQDLTD
FT                   PDHVELNILRAKVLMEDQSTVTLNAKTGVFDTKQQQLDLKKDILLTTSSGYEARLSRAF
FT                   VDMAKGTVSSDERVDVKLTNGTLSADRLRITDNGDVVRFEGNVVMNLDNINAAPAATAS
FT                   SDPGRPARNAK"
FT   gene            complement(128873..129487)
FT                   /locus_tag="BBta_0125"
FT   CDS_pept        complement(128873..129487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0125"
FT                   /product="putative 3'-5' exonuclease family protein"
FT                   /function="Information transfer"
FT                   /EC_number="3.1.13.-"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32425"
FT                   /db_xref="GOA:A5E8D1"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8D1"
FT                   /protein_id="ABQ32425.1"
FT                   /translation="MTVRLHRGDLPDLSRYTSSVAIDTETMGLNPHRDRLCVVQLSPGD
FT                   GSADVVQIPKGHTDAPNLKALLANPAITKIFHFARFDVATLFHTFGVMPQPVYCTKIAS
FT                   RLARTYTDRHGLKDLVRELLNVDLSKQQQSSDWGADNLSEPQLAYAASDVLHLHALREK
FT                   LDVMLAREGRLGLAQACFAFLPHRATLDLGGFEAEDIFAHS"
FT   gene            130257..131228
FT                   /locus_tag="BBta_0128"
FT   CDS_pept        130257..131228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0128"
FT                   /product="putative TRAP-type C4-dicarboxylate transport
FT                   system, binding periplasmic protein (DctP subunit)"
FT                   /function="Putative uncharacterized transport protein;
FT                   Periplasmic space"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 9 : Periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32426"
FT                   /db_xref="GOA:A5E8D2"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="PDB:4N8Y"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8D2"
FT                   /protein_id="ABQ32426.1"
FT                   /translation="MKALTGIIAAAVLAVSAPLATARDFRSADVHPADYPTVEAVKFMG
FT                   KQLAAASGGKLGVKVFPNGALGSEKDTIEQLKIGALDMMRINSSPLNNFVPETVALCLP
FT                   FVFRDTQHMRNVLDGPIGDEILAAMEPAGLVGLAYYDSGARSIYTVKAPVKSLADLKGL
FT                   KIRVQQSDLWVGMIQSLGANPTPMPYGEVYTALKTGLVDAAENNWPSYESSRHFEAAKF
FT                   YNITEHSLAPEVLVMSKKVWDTLSKEDQALVRKAAKDSVPVMRKLWDEREQASRKAVEA
FT                   AGVQVVTVANKQEFVDAMKPVYQKFAGDEKLSSLVKRIQDTK"
FT   gene            131340..131885
FT                   /locus_tag="BBta_0129"
FT   CDS_pept        131340..131885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0129"
FT                   /product="Putative TRAP-type C4-dicarboxylate transport
FT                   system, small permease component (dctQ subunit)"
FT                   /function="Transporters of Unknown Classification;
FT                   citrate/succinate"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32427"
FT                   /db_xref="GOA:A5E8D3"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8D3"
FT                   /protein_id="ABQ32427.1"
FT                   /translation="MTDPHVADHESPEGRPSRGPLTRINAIIARLGMYLSVAGLLVIVT
FT                   IVFYQVFGRYVLNSSPTWTENLALVLILYVTLIGAAVGVRDAGHIGMDSLLVMLPDSTR
FT                   EKIELVIHVLVALFGLAMAYNGWILGASVGTVKIPNLGLPEVIRYVPLVASGVLIVSFS
FT                   IEHIIALLRGEEVIPSWN"
FT   gene            131876..133168
FT                   /locus_tag="BBta_0130"
FT   CDS_pept        131876..133168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0130"
FT                   /product="putative TRAP-type C4-dicarboxylate transport
FT                   system, large permease component (dctM subunit)"
FT                   /function="Membrane; Inner membrane; Putative
FT                   uncharacterized transport protein; citrate/succinate"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 5 : Inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32428"
FT                   /db_xref="GOA:A5E8D4"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8D4"
FT                   /protein_id="ABQ32428.1"
FT                   /translation="MELIILGATFFGFLVLGVPVAFAIGLSAICTILYEGLPVAVIFQQ
FT                   MMSGMNIFSFLAIPFFVFSGELMLHGGVADKIVQLAKNLVGHIRGGLGMSNVVACTLFG
FT                   GVSGSPVADVSAMGAVMIPMMKKEGFDTDYAVNVTTHASLVGALMPTSHNMIIYALAAG
FT                   GKVSIGALIAAGLLPALVLMVCMLVAAYAVAVKRGYPAGKFPGWAEVFRSFAAALPGLL
FT                   IVGIILAGILSGVFTATESAAVAVTYTILLTFFIYRTMTLQNFLRAAAKAVKTTGVVLL
FT                   LIGVSTMFQYLMGLYEVADFAGDLMSKVSTQPWIIFLLINVILFLLGTFMDMAATILIC
FT                   TPIFLPIAMKAGMDPVQFGMLMLINCALGLNTPPVGTTQFVGCAIGGISVGAVMRTILP
FT                   FYAALIAALMFVTYVPAFSLWLPRLLMGYKG"
FT   gene            complement(133970..136474)
FT                   /locus_tag="BBta_0131"
FT   CDS_pept        complement(133970..136474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0131"
FT                   /product="putative outer membrane protein of unknown
FT                   function with surface antigen (D15) domain"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32429"
FT                   /db_xref="GOA:A5E8D5"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8D5"
FT                   /protein_id="ABQ32429.1"
FT                   /translation="MMRLRLPGVLALMLLALPVTTLPRMVAAAPAASATSITVEGNRRV
FT                   EADTIRSYFKPGPSGALDAAQVDDGLKALVETGLFADVKIDRQGGRLIVRVVENPVIGR
FT                   VAFEGNKKVKDEQLQAEVQSKPRGTLSRPMVQSDAQRIAEIYRRSGRYDVRVTPEIIEQ
FT                   PNNRVDLVFTVVEGVKTGVKSITFVGNNAYSAARLRDVIKTHESNWLSFLGNNDVYDPD
FT                   RVEADRDLIRRFYLKNGYADVQVVAALTEYDPEQKGFLVTFKIDEGQQYRVGSVDFQST
FT                   IAALDANALRTYSRVNVGALYNVEQLEKSVEEMQIEASRRGFAFAVVRPRGDRNLEAHT
FT                   VAIVFQVDEGPRTYIERITIRGNTRTRDYVIRREFDISEGDAYNRALVDRAERRLKNLD
FT                   FFKDVKITTEPGSSSDRVILVVGLEEKSTGDFSISGGYSTTDGALAEVSISERNFLGRG
FT                   LYAKASVSYGQYTRGVALSFVEPYLLDYRVALGLDISYRQQLANSYTSYGTRTVGFSPR
FT                   LGFQLREDTSLQLRYSLYRQEITLPSYLANCNNNSANGLLAFNPTPAYIQSVLGGVDPT
FT                   NSTSSGVYGYGCYGDGESSLAVRKELNDGAALTSALGYTLTYNTLDNTKNPTDGLLIDW
FT                   RQDFAGVGGNVSYLKSAVDAKYFTPLVSDIVSVIHLQGGVLNKIGDKDLRMLDHYQMGP
FT                   TLVRGFASNGIGPRDITYRSLGATGDALGGTRYWGASAELQMPFWFLPKEVGLKGSVYA
FT                   DAGSLWGYQGPTSWAATGEVNTAACKCAMQYDDSKVVRSSVGVGLIWASPFGPLRFDYA
FT                   VPLSKGKYDVVQEFRFGGGTSF"
FT   gene            137553..138767
FT                   /locus_tag="BBta_0132"
FT   CDS_pept        137553..138767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0132"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32430"
FT                   /db_xref="GOA:A5E8D6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8D6"
FT                   /protein_id="ABQ32430.1"
FT                   /translation="MAMTASSPAPAGASHSESERSPFARLNELLAPYSPGKPMITLAVG
FT                   EPQHPVPGFVGPVLAQHIADFGRYPAAKGIEPFRKAAAGWLARRFALPRAIDPEHEILV
FT                   LNGSREGLFFAAHAALRHVGPRRGKPAILMPNPFYPVYGVGARTAGCDSIYLPTTRDNG
FT                   FLPDLDAIDEATLARTVAVYIATPANPQGSVASADYMRKLVQLANRWGFLIFSDECYSE
FT                   IYTRQAPGSMLEHAGPDYQNVVAFQSLSKRSNVPGMRIGFASGDRRFLAAFHELRNVAA
FT                   PQVPVPLQHVAVAAYGDEAHVEENRRLYRAKFDLADQIIGNRYGYQRPDGGFCVWLDVT
FT                   ERGGDEDVTVRLYRDAGVRVVPGSYLARPQADGFNPGLGYIRLALVADASSTGEALHRL
FT                   VEVLR"
FT   gene            138779..141256
FT                   /gene="ftsK"
FT                   /locus_tag="BBta_0133"
FT   CDS_pept        138779..141256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK"
FT                   /locus_tag="BBta_0133"
FT                   /product="DNA translocase FtsK"
FT                   /function="The Septal DNA Translocator (SDT) Family; Cell
FT                   division; SOS response"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 5 : Inner
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32431"
FT                   /db_xref="GOA:A5E8D7"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8D7"
FT                   /protein_id="ABQ32431.1"
FT                   /translation="MRMPAIERVIPLVNHLPTSLRDALVRRLRELAGLGLIALCGVAAA
FT                   ALMTWSVQDPSLSHATSRAIRNIVGYPGAIGADLLMQILGLGSIMAILPIAIRGWRMMT
FT                   HRPFDREALRFGAWVLGAAIAAGFASCWPRSHAWPLPTGLGGVVGDALVRAPAVVFGPP
FT                   GLIYRLVLGSLLLIAMIGCLLVAGGMGAKEADPNLAADEEDDTPLSEAEDDDDRKAIRL
FT                   GWVFHAIMSAKAQIGWFLSTAYRALVSSGPQPRSAASGRQEPSLVRGQKKPTLAPEMTE
FT                   EDDEEEEAGEEEEEEEEEEPAPKARKKPAAKAPTKKSSDKYELPSVSMLAAPKSSDRQP
FT                   LSKSELEANSRALEGVLQDFGVRGEIVKAHPGPVVTLYELEPAPGIKSSRVIGLADDIA
FT                   RSMSALSARVAVVPGRNAIGIELPNAHREKVYLRELLVAKEATESVAKLPLCLGKNIGG
FT                   DSIIIDLARTPHMLIAGTTGSGKSVAINTMILSLVYRLRPDQCRLIMVDPKMLELSVYD
FT                   GIPHLLTPVVTDPKKAVVALKWAVREMEERYKKMAKLGVRNIDGYNARLAEARNKGEEL
FT                   TRTVHTGFDKETGKAIYEEEKLDLDPLPYIVIIVDEMADLMMVAGKDIEGTVQRLAQMA
FT                   RAAGLHVILATQRPSVDVITGTIKANFPTRISFQVTSKIDSRTILGEMGAEQLLGQGDM
FT                   LYMAGGGRISRVHGPFCSDEEVEKVVRHLKAQGSPEYLEAVTAEEPSEEDGTVFDATGM
FT                   GGGGGGDDLFAQAVAVVKRDRKASTSYIQRRLQIGYNKAASLMERMEQEGIVGQANHAG
FT                   KREILVPEEEGGF"
FT   gene            141438..142211
FT                   /locus_tag="BBta_0134"
FT   CDS_pept        141438..142211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0134"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32432"
FT                   /db_xref="GOA:A5E8D8"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8D8"
FT                   /protein_id="ABQ32432.1"
FT                   /translation="MVAAVATCVLTLAAGHAAAQTTPAPKSGPKGGAQLSASDQQRGGQ
FT                   GPATTQTTPPNPIIPDPRRNVPASIFTSFDANQKAIAGKVSAYLSSLQTLVGNFVQVGP
FT                   DGSKTKGDFYIQKPGKVRFEYDPPTPIDIIADGSSLVVRDRKLATQDVYPLSQTPLRYL
FT                   LSDRIDLLKDTNVIAVASDDLYVTITIEEKQALIGTSRLMLMLGAKDGQLKQWTVTDPQ
FT                   GYDTTIAVYNLDTTKKLDPAMFKIDFTTYPSTPPG"
FT   gene            complement(142229..143296)
FT                   /locus_tag="BBta_0135"
FT   CDS_pept        complement(142229..143296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0135"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32433"
FT                   /db_xref="InterPro:IPR019285"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8D9"
FT                   /protein_id="ABQ32433.1"
FT                   /translation="MPPAPSAAPVKMPPSEARTVSELATDMLRRTTALFLAGPRPASAE
FT                   QLDLYDQMFARLMPQVATDLLAELSMALAGVERAPYATARLLAVHPELRVAGPMLAKAA
FT                   ALTERDLAEFIRSSSPAHLVAIASRRGIGDSLTNQLIARGFPAVRMALVQNLTARLSED
FT                   GYRSLFKIAERDEDLAEKLALRTDLPAKLSRAFVAAASEGARARFIKAAPPATRATLQA
FT                   TPTRTAGAAMRAMWDYEQVKTEVAALNRSGKLSDSAVNRFCVTGDFPAVIAALALLCVV
FT                   SIQVIEALMEDDRVTDLVLACKAARLSWPTTAMILRARPGCDTIPADDLEEARKRFEKL
FT                   VLSEAQWKVRGLEAG"
FT   gene            143514..145052
FT                   /locus_tag="BBta_0136"
FT   CDS_pept        143514..145052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0136"
FT                   /product="putative enzyme"
FT                   /function="Regulation level unknown"
FT                   /note="transcriptional regulator with P-loop containing NTP
FT                   hydrolase domain (part 2)(yifB); Evidence: Function
FT                   proposed based on presence of conserved amino acid motif,
FT                   structural feature or limited homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32434"
FT                   /db_xref="GOA:A5E8E0"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8E0"
FT                   /protein_id="ABQ32434.1"
FT                   /translation="MVQRVSTVAFEGIEARAVDVQVQVAPGLPAFAIVGLPDKAVSEAR
FT                   ERVRSALIASGLALPARRITVNLAPADVPKEGSHYDLPIALGLMAAIGAIPPDALNGFT
FT                   VLGELGLDGSIAPVAGVLPAAIGANAREEGLICPAACGAEAAWASPDLQIIAATSLIQI
FT                   ANHFKGTQVLSRPQPKIQEAPASLLDLRDIKGQESGKRALEIAAAGGHHLLMIGSPGAG
FT                   KSMLAARLPSILPPLSPAELLEVSMIASVAGEIEGGALTNRRPFRSPHHSASMAALTGG
FT                   GLRARPGEISLAHQGVLFLDELPEFDPRVLDSLRQPLENGEVSISRANHRVTYPARFML
FT                   VAAMNPCRCGNAFEPGYACKRGRIDRCTSDYQMRISGPLMDRIDLRIEVPAVTAADLIL
FT                   PPSKEGSAEVAARVAAARDLQRARYAKAGLPHVRTNAEAPAAVLDDIAKLDPPGQKLLR
FT                   EAAETMRLSARGYHRVLRVARTLADLDHADTIGRLHLAEALSYRALAEDSRHAA"
FT   gene            145248..145622
FT                   /locus_tag="BBta_0138"
FT   CDS_pept        145248..145622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0138"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32435"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8E1"
FT                   /protein_id="ABQ32435.1"
FT                   /translation="MAEGADSIALDTQPFHADFHGDSADDPARVTLRDDPQAVDLVVVD
FT                   HSTVQADQGCSVTAAIQAVAIAAEAPADTPRIDLAREGATDGRTDDRIHGRSSHDTARQ
FT                   AVASVMAAHHHDVAPANALP"
FT   gene            145763..148000
FT                   /locus_tag="BBta_0139"
FT   CDS_pept        145763..148000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0139"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /function="Two-component regulatory systems (external
FT                   signal)"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32436"
FT                   /db_xref="GOA:A5E8E2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8E2"
FT                   /protein_id="ABQ32436.1"
FT                   /translation="MGASFRIRLRLRRFTRRHHTLFTILRSAMIFMAGFGGAYGFIKAS
FT                   LSETSGYNPHAFAIGASFLFALACVGLATLSMRLRFMRKKMHKLALHNEVLADRNWELQ
FT                   EAEQRARSLFEQQGDLIVMRESDGTIIFVNDAYCRMAGLDRENLLGSQFSFDLLEQGDS
FT                   ALEPSGTRVHDQRIDSAIGPRWIAWREALVRSDAGHPAVQQCVGRDVTDRTETERALAE
FT                   ARDQANAANRAKSRFLAMASHEIRTPLNGILGMSGLLLETQLTPEQTTYAKAVRSSGEA
FT                   LMSLINELLDYSKIEAGKLALEAQPFALTALIEEITELLAPRAQGKQLEIAAYLDERLP
FT                   TWVTGDAARLRQVLLNLAGNAIKFTSKGGVALIAEPGIWPNEISFQVRDTGIGIAADAQ
FT                   ERIFREFEQADDSVARSFGGTGLGLAISDRIVKRMGGRIALQSQPGAGSTFEVSVPLPP
FT                   ALERGEQNSFRGPDLTGQSIMLIAPAGLQAELIERRLQNWGAQTCLVAETEIAAALLPE
FT                   RAWHAVLIDDAIGSEAARRLGEAAHHHTTRLIVLVTPTSRHELAPAAPFNGYLVKPLRA
FT                   ASLAARVSFDLDAGAAFAEHPIPTIAPSIAARAGTGLAILVAEDNDINALLMRSLLTKL
FT                   GHHADIAVHGEAALDSWLAARAAGTPYDLILMDVQMPRLDGIAATRRIRAHEASEPGRR
FT                   TPILALTANALVEDRYACFEAGMDGFLVKPIDRDKLDEALANLAAARQVAA"
FT   gene            complement(148339..149295)
FT                   /gene="coaA"
FT                   /gene_synonym="panK"
FT                   /gene_synonym="rts"
FT                   /gene_synonym="ts-9"
FT                   /locus_tag="BBta_0140"
FT   CDS_pept        complement(148339..149295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /gene_synonym="panK"
FT                   /gene_synonym="rts"
FT                   /gene_synonym="ts-9"
FT                   /locus_tag="BBta_0140"
FT                   /product="pantothenate kinase"
FT                   /function="Coenzyme A"
FT                   /EC_number="2.7.1.33"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32437"
FT                   /db_xref="GOA:A5E8E3"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8E3"
FT                   /protein_id="ABQ32437.1"
FT                   /translation="MDMRTTEQQYNPYRVFTRQQWAELRNDTPMTLEPGEFSKLRSMHD
FT                   RLDLKEVEDIYLPLSRLLSMYVDAAQRLYYAQRQFLGIRDRKMPYIIGVAGSVSVGKST
FT                   TARVLQALLARWSPRPKVDLITTDGFLYPNAVLERQGLMQKKGFPESYDLPRLLAFLSD
FT                   IKAGRHTVRAPVYSHLTYDIVPNQWVEIDQPDILIVEGVNVLQTGPLPRDGKAVPVVSD
FT                   FFDFSVYIDADEAVLRKWYVKRFLSLRDTAFHDPRSYFNRYALLSDEEAIATAIAIWER
FT                   TNLANLEDNILPTRPRATLILKKGADHEVETVALRRL"
FT   gene            complement(149329..149652)
FT                   /gene="hisE"
FT                   /locus_tag="BBta_0141"
FT   CDS_pept        complement(149329..149652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="BBta_0141"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /function="Histidine"
FT                   /EC_number="3.6.1.31"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32438"
FT                   /db_xref="GOA:A5E8E4"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8E4"
FT                   /protein_id="ABQ32438.1"
FT                   /translation="MSRFTLHDLAAIIDARAAAGGEASYTRKLLDKGPAQCAKKMGEEA
FT                   VETVIAAVGTDREHLISESADLLFHLLVLLKSRDVRLEEVEAALGKRTGMSGLEEKASR
FT                   KTE"
FT   gene            complement(149733..150509)
FT                   /gene="hisF"
FT                   /locus_tag="BBta_0142"
FT   CDS_pept        complement(149733..150509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="BBta_0142"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /function="Histidine"
FT                   /EC_number="4.1.3.-"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32439"
FT                   /db_xref="GOA:A5E8E5"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8E5"
FT                   /protein_id="ABQ32439.1"
FT                   /translation="MFKVRVIPCLDVKDGRVVKGVNFVNLRDAGDPVEAAIAYDAAGAD
FT                   ELCFLDITATHENRGIMLDVVRRTAEACFMPVTVGGGVRTIDDIKTLLRSGADKVSINS
FT                   AAVARREFVKEAAEKFGEQCIVVAIDAKSVARPGGGSRWEIFTHGGRKSTGIDALEYAQ
FT                   EVVSLGAGEILLTSMDRDGTRQGFDIPLTRAVADSVPVPVIASGGVGNLDHLVDGIRQG
FT                   RATAVLAASIFHFGEFTIRQAKEHMVRQGLPMRLDP"
FT   gene            complement(150509..150796)
FT                   /locus_tag="BBta_0143"
FT   CDS_pept        complement(150509..150796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0143"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32440"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8E6"
FT                   /protein_id="ABQ32440.1"
FT                   /translation="MKNFLLVFDDGSGSDIDLKKYVESLDVGAEIYTLDGHVCFVKSDL
FT                   SASELSSRLLKFAGSSLFFIADISNSEYEGRMLGVFWDFLKSRTLASAAE"
FT   gene            complement(150861..151175)
FT                   /locus_tag="BBta_0144"
FT   CDS_pept        complement(150861..151175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0144"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32441"
FT                   /db_xref="GOA:A5E8E7"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8E7"
FT                   /protein_id="ABQ32441.1"
FT                   /translation="MKLEDLIRTGLSRIDTIAVRRTALNPALWLVGLVSPLSLILAAFV
FT                   TDPSARTVLFCFAGAPLLFAMIGYLILLFREPDRLQSKSTEYNSEPSIFFIGRVAALRL
FT                   "
FT   gene            complement(151172..151915)
FT                   /gene="hisA"
FT                   /locus_tag="BBta_0145"
FT   CDS_pept        complement(151172..151915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="BBta_0145"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /function="Histidine"
FT                   /EC_number="5.3.1.16"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32442"
FT                   /db_xref="GOA:A5E8E8"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8E8"
FT                   /protein_id="ABQ32442.1"
FT                   /translation="MILFPAIDLKNGQCVRLEQGDMARATVFNLDPAAQAKSFADQGFD
FT                   YLHVVDLDGAFAGKPMNAQAVEAMLKVVKMPVQLGGGIRDLKTVEAWLNKGITRVIIGT
FT                   AAVRDPELVKTAAKAFPGRVAVGLDARDGKVAVEGWAETSEVTALDIAKRFEDAGVAAI
FT                   IFTDIARDGLLKGLNLDATIALGDAVSIPVIASGGLASIEDVKAMLTPRARKLEGAIAG
FT                   RALYDGRLDPAEALALIRAARKAGA"
FT   gene            complement(151975..152625)
FT                   /gene="hisH"
FT                   /locus_tag="BBta_0146"
FT   CDS_pept        complement(151975..152625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="BBta_0146"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisH"
FT                   /function="Histidine"
FT                   /EC_number="2.4.2.-"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32443"
FT                   /db_xref="GOA:A5E8E9"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8E9"
FT                   /protein_id="ABQ32443.1"
FT                   /translation="MSVAIIDYGSGNLHSAAKAFERAARSMEDPQKVVVTRDPDTVYRA
FT                   DRIVLPGVGAFADCRRGLDAVDGMLEAMTEAVRQKARPFFGICVGMQLMATRGKEHVTT
FT                   DGFDWVAGDVEKIAPRDESLKIPHMGWNTLDLVQEHPVLERLPLGPKGLHAYFVHSYHL
FT                   NAVNENDVLARADYGGPITAIVGKDTAIGTQFHPEKSQRFGLALISNFLKWKP"
FT   gene            complement(152622..153143)
FT                   /locus_tag="BBta_0147"
FT   CDS_pept        complement(152622..153143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0147"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32444"
FT                   /db_xref="GOA:A5E8F0"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8F0"
FT                   /protein_id="ABQ32444.1"
FT                   /translation="MPVYTVHAPLAAGADLRSTDRFVFIRDGFHLWAAVLGAVWLAWHR
FT                   LWLAVIGYAALMIVIDLILARIGVASGAIAAIDLLMAILLGLEASSLKRWSYSRGNWRQ
FT                   LDVVVADDLDAAERRFFERWAARRSTIGYDNHTVDRGAPPPTRDNGQRPPPPLPHASII
FT                   GLFPEPGGGR"
FT   gene            complement(153169..153762)
FT                   /gene="hisB"
FT                   /locus_tag="BBta_0148"
FT   CDS_pept        complement(153169..153762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="BBta_0148"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /function="Histidine"
FT                   /EC_number="4.2.1.19"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32445"
FT                   /db_xref="GOA:A5E8F1"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8F1"
FT                   /protein_id="ABQ32445.1"
FT                   /translation="MRSATIKRKTKETDIEVAVNLDGTGVVNIATGIGFFDHMLDLLAR
FT                   HSRIDMTVKAVGDLHIDFHHTTEDVGIALGQAVRQALGDMAGITRYASIHMPMDETLTR
FT                   VVIDVSGRPMLVFRTTFPRDKIGEFDTELVREWFNAFAMNAGITLHVETLYGENAHHIA
FT                   ESCFKGLARALRSALAIDPRNQGEVPSTKGQLGG"
FT   gene            153957..154517
FT                   /gene="hslV"
FT                   /gene_synonym="clpQ"
FT                   /gene_synonym="htpO"
FT                   /gene_synonym="yiiC"
FT                   /locus_tag="BBta_0149"
FT   CDS_pept        153957..154517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /gene_synonym="clpQ"
FT                   /gene_synonym="htpO"
FT                   /gene_synonym="yiiC"
FT                   /locus_tag="BBta_0149"
FT                   /product="HslV component of HslUV peptidase, Threonine
FT                   peptidase, MEROPS family T01B"
FT                   /function="Proteins/peptides/glycopeptides; Chaperoning,
FT                   folding; Turnover, degradation; Proteases, cleavage of
FT                   compounds; Cell division; Cytoplasm"
FT                   /EC_number="3.4.25.-"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32446"
FT                   /db_xref="GOA:A5E8F2"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8F2"
FT                   /protein_id="ABQ32446.1"
FT                   /translation="MHATSHEPAVWHGTTILTVRKGGRVVIGGDGQVSIGQTVIKSNAR
FT                   KVRKLGKGDVIGGFAGATADAFTLFERLESKLEQYPGQLTRAAVELAKDWRTDRYLRRL
FT                   EAMMIVADKEVSLVLTGTGDVLEPEAGVMAIGSGGNYALAAARALIDTDKDAESIVRRS
FT                   LDIAADICVYTNRNITIEALAAE"
FT   gene            154521..155120
FT                   /locus_tag="BBta_0150"
FT   CDS_pept        154521..155120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0150"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32447"
FT                   /db_xref="GOA:A5E8F3"
FT                   /db_xref="InterPro:IPR019691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8F3"
FT                   /protein_id="ABQ32447.1"
FT                   /translation="MSADGIGMASRRSSGPWLVLVLALLVLQAAILFAMGRLPICACGT
FT                   VKLWHGVVQSSENSQHLTDWYTFSHIIHGFLFYALTALVVPLLPWQGRLIIAMLIEGAW
FT                   ELVENSSFIIERYRAATISLDYFGDSVVNSIGDTLAMITGFLLARVLPIWLTVLIAIAF
FT                   EIGVGLHIRDNLTLNILMLIYPTEAIRQWQAGPPLL"
FT   gene            155093..155647
FT                   /locus_tag="BBta_0151"
FT   CDS_pept        155093..155647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0151"
FT                   /product="putative Aminoglycoside N(6')-acetyltransferase
FT                   (aacA4)"
FT                   /function="Drug resistance/sensitivity; Plasmid related;
FT                   Transposon related"
FT                   /note="modular protein; Evidence: Function proposed based
FT                   on presence of conserved amino acid motif, structural
FT                   feature or limited homology; PUBMED: 2841303, 2824444"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32448"
FT                   /db_xref="GOA:A5E8F4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8F4"
FT                   /protein_id="ABQ32448.1"
FT                   /translation="MAGRTAAVVRTGAAMTIRFRRITDGDLPAIRNWLHQPHIRQWWGD
FT                   PDEQYGLIDGDRDEPAMDQYILLTDDDAAGYLQCYALTQWNEGFGPQPAETRGIDLFIA
FT                   GQERIGRGHGPRAIRAFCDLVFQHAIPRIVADPSPANARAIRAYEKEGRISARAPGRNT
FT                   GWPSASDVPRARRLATPSIRA"
FT   gene            155657..156961
FT                   /gene="hslU"
FT                   /gene_synonym="clpY"
FT                   /gene_synonym="htpI"
FT                   /locus_tag="BBta_0152"
FT   CDS_pept        155657..156961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /gene_synonym="clpY"
FT                   /gene_synonym="htpI"
FT                   /locus_tag="BBta_0152"
FT                   /product="ATPase component of the HslUV protease, also
FT                   functions as molecular chaperone"
FT                   /function="Chaperoning, folding; Turnover, degradation;
FT                   Proteases, cleavage of compounds; Cell division;
FT                   Temperature extremes; Cytoplasm"
FT                   /note="heat shock protein; Evidence: Function of homologous
FT                   gene experimentally demonstrated in an other organism;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32449"
FT                   /db_xref="GOA:A5E8F5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8F5"
FT                   /protein_id="ABQ32449.1"
FT                   /translation="MTDFSPREIVSELDRYIVGQADAKRAVSIALRNRWRRLQLDAGLR
FT                   EEVLPKNILMIGPTGVGKTEIARRLAKLAGAPFLKVEATKFTEVGYVGRDVEQIIRDLV
FT                   EVAIVQVRERKRKDVAARAQLAAEERVLDALVGANSSAATRDSFRRKLRAGELNDKEIE
FT                   IETQSSGGGFPMFEIPGMPGAQMGAISIGDIFGKLGGRTKTRRVTVESSHDILIAEESD
FT                   KLLDNDQLVQEAISVVENNGIVFLDEIDKICVRENRHGGDVSREGVQRDLLPLIEGTTV
FT                   STKHGAVKTDHILFIASGAFHIAKPSDLLPELQGRLPIRVELQALTRDDMRRILTEPEA
FT                   SLIKQYVALMKTEGVTLDITDDAIDALADIAVAVNSTVENIGARRLQTVMERVLDEISF
FT                   TASDRSGETMRVDAAYVQQHIGDLAKNADLSRFIL"
FT   gene            157199..158317
FT                   /locus_tag="BBta_0153"
FT   CDS_pept        157199..158317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0153"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32450"
FT                   /db_xref="GOA:A5E8F6"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8F6"
FT                   /protein_id="ABQ32450.1"
FT                   /translation="MTAAFSKHWRAMLAVNAAVMLGVVLHKLTLPPYIPYIHLLVDYHH
FT                   GFIKRALIGAIVGLFTTKVPVWLVFALGGTVWLITFALFVQLFRRTFGLDRTTLPLFVF
FT                   TAGSPFVFKNFLFTLGHFDVYGCLGAIILLLVPAGSLLYVLLAAFISAVLVLIHHIHLL
FT                   MYVPTITAIVVLRYYLPRTITTLDIATGAGVLAGLGALFLGAQFLGTMPLPEADFVTYL
FT                   RSRMADPSRTELLQFAYVWYQPLAKEVQDTWARLPSNLLGVPVYALLLWLHLPLWSSFK
FT                   SLIGALHEQRHRQIVIASLGVISLAYLVMFAMVFDYSRWISSWVVCMVLMLHAVKTLPA
FT                   KPAVLVDGDDRKTTILGWIVTVIPRLGIIRPF"
FT   gene            complement(158321..158896)
FT                   /locus_tag="BBta_0154"
FT   CDS_pept        complement(158321..158896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0154"
FT                   /product="hypothetical protein"
FT                   /note="Smr protein/MutS2 domain; Evidence: Similar to
FT                   previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32451"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8F7"
FT                   /protein_id="ABQ32451.1"
FT                   /translation="MSHDPEPPRGRRRRGLTEDERTLWETVARQVKPLRKIQRPVRPHP
FT                   PMVTAEPQPDKPTMTQRQVVAAAAPKPVRPAIPPLVSLGRKERSKLSRGRSEIDARLDL
FT                   HGMTQSRAHQALHHFLHRAQHDGLTFVLIITGKGTIGADPERGVLRRQVPHWLSLPEFR
FT                   SLIVGFEEAHVGHGGAGALYVRIRRPRG"
FT   gene            complement(158909..160540)
FT                   /locus_tag="BBta_0155"
FT   CDS_pept        complement(158909..160540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0155"
FT                   /product="putative membrane-bound lytic murein
FT                   transglycosylase"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 8 : Outer membrane-associated"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32452"
FT                   /db_xref="GOA:A5E8F8"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8F8"
FT                   /protein_id="ABQ32452.1"
FT                   /translation="MVREIWKRGFSAHRLSSWTAALALAVVAVVLAPYAAEAVRARHRS
FT                   APPMRHLPYPQLDWPLEITNSQYLPLAWSDVPGWTDDDQLAAYRTFRASCKPITAKPDG
FT                   TPEDKALGDSLRDPCREARASDLADNAAARAFFERHFEPLKISKLGDADGFVTGYYEPV
FT                   IEGSRTQNEVYNVPVYRRPSNLFVRGFKQDATSLPNKGPVYRKIGRRKLVPYYDRAEIE
FT                   DGAIEGRGLEIAWLRNQTDLLFAQIQGSARISLDDGSTVRINYDAYNGHPYTPVGRILI
FT                   ERGIIPREQMSMQRIREWMEQNPEGANELRRMNRSYIFFREVQLSEKDEAVGAQGIPLT
FT                   PGRSIAVDKSLHVYGTPFFITGELPIDSEKSKTAFHRLMIAQDTGSAIVGPARADLYFG
FT                   AGQDAGKVSGRLKHNIQFVMLVPRSLDPVARGRKMPLPDARPSEKIAKLFPEVLPKDAP
FT                   KETAKDQTKDQSKDQVKGPDQPNPAASTVKDAKAPAPAASASPPTTVAQNVTAPQPVPL
FT                   PEARPRLESDRNIRRLRYGRRHRNRR"
FT   gene            complement(160696..161397)
FT                   /locus_tag="BBta_0156"
FT   CDS_pept        complement(160696..161397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0156"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32453"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8F9"
FT                   /protein_id="ABQ32453.1"
FT                   /translation="MDIYTIIFLALAVFIFVRLRAVLGQRTGSERTPFDRAARNAVQGA
FT                   PDNHVMPVPGAPLDPAVATAGAEPGVPSDRWRGVAEPGTPLARGLDAVVANDPSFDPRH
FT                   FLTGARSAYEMIVLAFANGDRRALRDLLSSEVYDSFDAVIKDREKHEQKTETRFVSIDT
FT                   AELVSADLRDRTAQLTVRFVSQMISVTRDKMGNIVDGNPDKVADITDIWTFARDTGSRD
FT                   PNWKLVGTGSH"
FT   gene            161797..162285
FT                   /gene="secB"
FT                   /locus_tag="BBta_0157"
FT   CDS_pept        161797..162285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="BBta_0157"
FT                   /product="protein translocase subunit secB"
FT                   /function="Chaperoning, folding"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32454"
FT                   /db_xref="GOA:A5E8G0"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8G0"
FT                   /protein_id="ABQ32454.1"
FT                   /translation="MTNGNGANPEAAPPPQLNVLAQYIKDLSFENPNAPQSLAPQGQPP
FT                   QINIQINVGANALADTEFEVTLTIEGKAESGTQVMFSFELVYGGVFRLVNVPQEHLSPM
FT                   LLIECPRLLFPFAREIVANSVRDGGFPPLMLDPVDFVSLYRQNMERQAAAQGAQIRPS"
FT   gene            complement(162345..163043)
FT                   /gene="dnaQ"
FT                   /gene_synonym="mutD"
FT                   /locus_tag="BBta_0158"
FT   CDS_pept        complement(162345..163043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /gene_synonym="mutD"
FT                   /locus_tag="BBta_0158"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /function="DNA replication; Chaperoning, folding;
FT                   Cytoplasm"
FT                   /EC_number="2.7.7.7"
FT                   /note="epsilon subunit, 3-5 exonucleolytic proofreading
FT                   function; Evidence: Function of homologous gene
FT                   experimentally demonstrated in an other organism;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32455"
FT                   /db_xref="GOA:A5E8G1"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8G1"
FT                   /protein_id="ABQ32455.1"
FT                   /translation="MREIVLDTETTGLDALRGDRLVEIGCVEIINRMPTGQVFHRYINP
FT                   ERDMPAEAFAVHGLSSEFLADKPLFHEIVEEFLEFIGDAPLVIHNASFDIGFINAELDR
FT                   VKRAAIPRERLVDTLLLARRKHPGVSNRLDDLCSRYAIDNSRRTKHGALLDAELLAEVY
FT                   VDLVGARQSQLILTQDTQEIRVGAAGDTPRRQRETPLAARVTDAEREAHRAFIATLGDK
FT                   PIWMEFLAGT"
FT   gene            complement(163077..163676)
FT                   /gene="coaE"
FT                   /locus_tag="BBta_0159"
FT   CDS_pept        complement(163077..163676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="BBta_0159"
FT                   /product="dephospho-CoA kinase"
FT                   /function="Coenzyme A"
FT                   /EC_number="2.7.1.24"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32456"
FT                   /db_xref="GOA:A5E8G2"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8G2"
FT                   /protein_id="ABQ32456.1"
FT                   /translation="MRVLGLTGSMGMGKSTTAKLFAEAGVPVYDADATVHKVYEGEAAP
FT                   AIEAAFPGTTVGGKVDRSKLSAKVVGDPEAIRRLEAIVHPMLRSYHQDFLDKAAQSGVP
FT                   VAVVDVPLLFETGGDKRVDAVVVVSTSPEIQRQRILARGTMTEEALDALLARQMPDAEK
FT                   RARADFVVDTSNGLDPVRARIRDILAEVVKMPQRRA"
FT   gene            complement(163711..164259)
FT                   /locus_tag="BBta_0160"
FT   CDS_pept        complement(163711..164259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0160"
FT                   /product="putative maf-like protein"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32457"
FT                   /db_xref="GOA:A5E8G3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8G3"
FT                   /protein_id="ABQ32457.1"
FT                   /translation="MLLENAGLACEAVPADIDERALQSEAGLVAPYEIALHLAQAKARA
FT                   VSAAKPNCYVVGADQTLALGERMFNKPAGRQQAMQQLLALAGRTHALHSAIAVVRNGEV
FT                   LFSHVAVAWMTMRSLTESDVATYLDTAGQAVLSSVGAYQLEGLGVHLFDRIDGDHFTIL
FT                   GLPLLPLLAYFREARLLRF"
FT   gene            complement(164330..165169)
FT                   /locus_tag="BBta_0161"
FT   CDS_pept        complement(164330..165169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0161"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32458"
FT                   /db_xref="GOA:A5E8G4"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8G4"
FT                   /protein_id="ABQ32458.1"
FT                   /translation="MPTTGNYFHLHLVSDSTGETLITVARAVAAQYANVTPVEHVYPLV
FT                   RSQKQLDRVLDEIEEAPGIVLFTLLEKDLVSRLEAKCQQINIPSLSIIGPVMQLFEAYL
FT                   GASTAGRVGAQHVLNAEYFARIDALNYTMLHDDGQMVDGLEDADVVLVGVSRTSKTPTS
FT                   IYLANRGVRTANVPLVPGIPIPHQLETLKKPLVVSLHATPERLIQVRQNRLLSMGAESG
FT                   NETYVDKQSVTDEVAYARKLSARFNWVMLDVTRRSIEETAAAILKLYTDRQRQRLPE"
FT   gene            165586..166008
FT                   /locus_tag="BBta_0162"
FT   CDS_pept        165586..166008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0162"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32459"
FT                   /db_xref="GOA:A5E8G5"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8G5"
FT                   /protein_id="ABQ32459.1"
FT                   /translation="MYEWIKALHVIAVIAWMAGMLYLPRLFVYHCDTEIGSKQSETFKI
FT                   MERRLLKAIINPAMMVTWLAGLYMVWAGHWYASGWFHGKFLLVLILSGVHGLFTRWVKD
FT                   FAADRNTHTQKFYRYINEVPTILMIGIVVLVIVKPF"
FT   gene            166245..167510
FT                   /gene="rho"
FT                   /gene_synonym="nitA"
FT                   /gene_synonym="psuA"
FT                   /gene_synonym="rnsC"
FT                   /gene_synonym="tsu"
FT                   /locus_tag="BBta_0163"
FT   CDS_pept        166245..167510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /gene_synonym="nitA"
FT                   /gene_synonym="psuA"
FT                   /gene_synonym="rnsC"
FT                   /gene_synonym="tsu"
FT                   /locus_tag="BBta_0163"
FT                   /product="transcription termination factor Rho"
FT                   /function="Transcription related; Repressor; Cytoplasm"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32460"
FT                   /db_xref="GOA:A5E8G6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8G6"
FT                   /protein_id="ABQ32460.1"
FT                   /translation="MREIKLQDLKSKTPAELVSFAEENGVENASTMRKQELMFAILKQL
FT                   AIQETDIIGEGVVEVLSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGHI
FT                   RSPKEGERYFALLKVNTLNFEDPEKSKHKVNFDNLTPLFPDERFRLELEDPTRKDLSPR
FT                   VIDIVAPIGKGQRALIVAPPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDM
FT                   QRSVKGEVVSSTFDEPAARHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVV
FT                   PSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKG
FT                   TGNSELILDRKVADKRTFPAIDIARSGTRKEELITEPQNLKKMYVLRRILNPMGTMDAI
FT                   DFLLDKLRSTKSNAEFFESMNT"
FT   gene            167919..169256
FT                   /locus_tag="BBta_0164"
FT   CDS_pept        167919..169256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0164"
FT                   /product="tRNA modification GTPase trmE"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32461"
FT                   /db_xref="GOA:A5E8G7"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8G7"
FT                   /protein_id="ABQ32461.1"
FT                   /translation="MHPHDQTIFALSSGRPPSAIAIVRLSGVGAGPALQTLTGKLPPPR
FT                   LATRALLRDDRGDPIDDAVVLWFPGPASATGEDVAELHVHGSRAVITTLVSLLSAMPQM
FT                   RAADRGEFTRRAFENGKIDLTEAEGLDDLIHADTDRQRRQALRQLKGLLGDKARSWRDQ
FT                   IIQAAALIEAGIDFADEGDVPAELIAPALAWIRQLLAEIEEVLAAQGRAERLRDGLTVV
FT                   IAGPPNAGKSTLMNQLARREVAIVSPHAGTTRDLIEVALDLDGYPVTVIDTAGIRQTDD
FT                   PVEQEGVRRARDRAAQADLVLWLTEDDQAELERQTDGPIWFVRNKIDLMITEQSGAISV
FT                   SPESPVFAISARSGAGMSDLLEALVGFARDYFGATEHGLITRERQRTWLSETAAALRRS
FT                   IAAVDLGEELAAEELRIAALALGRLLGRVDVEDLLDVIFREFCIGK"
FT   gene            169512..171389
FT                   /gene="gidA"
FT                   /locus_tag="BBta_0165"
FT   CDS_pept        169512..171389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="BBta_0165"
FT                   /product="Glucose-inhibited division protein A"
FT                   /note="Evidence: Function of strongly homologous gene"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32462"
FT                   /db_xref="GOA:A5E8G8"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8G8"
FT                   /protein_id="ABQ32462.1"
FT                   /translation="MSDHLTSYDVIVIGGGHAGCEAAEASARMGARTALVTHHFATIGA
FT                   MSCNPAIGGLGKGHLVREVDALDGLMGRVADAGGIQFRVLNRRKGPAVRGPRAQADRKL
FT                   YAAAMQAAIRETANLTVVEGEADQLIVADGQITGLRLADGRPLACGAIVITTGTFLRGL
FT                   IHLGEKTWPAGRVGEAPALGLSQSLEAIGFRLGRLKTGTPPRLDGTTIDWSAVEMQPGD
FT                   DPPEPFSVLTQTITTPQIQCGITRTTTATHDVIRANVHRSPMYSGQIKSTGPRYCPSVE
FT                   DKIVRFGDRDGHQIFLEPEGLDDTTVYPNGISTSLPEEVQLALLPTIPGLERVRMIRPG
FT                   YAIEYDHVDPRELEPTLQTKRMRGLFLAGQINGTTGYEEAAAQGLVAGLNAALTAGGGE
FT                   PIVFDRADGYVGVMIDDLVTRGITEPYRMFTSRAEYRLTLRADNADQRLTDKGIALGCV
FT                   GGDRARFHRTKMDALEAARSLARSVTITPNEAAKYGLTLNRDGQRRSAFELMAYPEIGF
FT                   SEVRGIWPELGTIGPAIAVHLEIDAKYDVYVRRQSEDVDAFRRDEGLVLGDIDYALVPG
FT                   LSNEARAKLTAARPWTIGQAGRIDGMTPAALGILAAYLRREARRSKAMV"
FT   gene            171401..172069
FT                   /gene="gidB"
FT                   /locus_tag="BBta_0166"
FT   CDS_pept        171401..172069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="BBta_0166"
FT                   /product="Glucose inhibited division protein B"
FT                   /function="Replication"
FT                   /EC_number="2.1.-.-"
FT                   /note="Methyltransferase gidB; Evidence: Function of
FT                   strongly homologous gene"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32463"
FT                   /db_xref="GOA:A5E8G9"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8G9"
FT                   /protein_id="ABQ32463.1"
FT                   /translation="MKQTSAVVASKVIAADKAAALALTPVSRETEQRLDRYVALLLEWQ
FT                   AKTNLVAPSTLPHLWTRHISDSLQLLDLAPDAKIWVDLGSGGGFPGVVLACALAERPGA
FT                   EVHLVERIAKKAAFLREAIRVTGAPGIVHLSEIGDIVEKWSGGVDCVTARALAPLHQLI
FT                   GFAEPLVKRGAKALFLKGQDVEAELTESTKYWKIEPKLYSSRTGGQGWIVAIDCIERHN
FT                   "
FT   gene            172099..172950
FT                   /gene="parA"
FT                   /locus_tag="BBta_0167"
FT   CDS_pept        172099..172950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="BBta_0167"
FT                   /product="chromosome segregation ATPase"
FT                   /function="Replication"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32464"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8H0"
FT                   /protein_id="ABQ32464.1"
FT                   /translation="MAVIDQIYQEDRAPHPDGHPRILALANQKGGVGKTTTAINLGTAL
FT                   AAIGERVLIVDLDPQGNASTGLGIDRGSRNCSTYDVLIGEASLRDAVVATAVPRLHIAS
FT                   STMDLSGLELELGNSANRAFRLRDAIAGLNNNVSPENDYTYVLVDCPPSLNLLTVNAMA
FT                   ASDAILVPLQCEFFALEGLSQLLQTVEQVRSTLNPNLSIHGIVLTMFDSRNNLSNQVVA
FT                   DVRQFMGSKVYNTMIPRNVRISEAPSYGKPVLVYDLKCVGSEAYLKLATEVIQRERDLR
FT                   AN"
FT   gene            173110..174006
FT                   /gene="parB"
FT                   /locus_tag="BBta_0168"
FT   CDS_pept        173110..174006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="BBta_0168"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /function="Replication"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32465"
FT                   /db_xref="GOA:A5E8H1"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8H1"
FT                   /protein_id="ABQ32465.1"
FT                   /translation="MADESRSRLGRGLASLIGDVGREAGAPPERPRNQRKVPIEFLKPN
FT                   PRNPRKTFSDSELAELSASIKQHGVIQPIVVRPVKGQQDRYEIIAGERRWRASQAAGLH
FT                   EVPIVPVDVSDSDALELAIIENVQREDLNPMEEAQGYHALANEFKRNQEEIAKIVGKSR
FT                   SHVANMMRLTKLPAEVQGFIATGEISAGHARALINLPDPLTAAKKIIAEGLNVRQTEAL
FT                   AHDEGVPERKPQKPRSSGGGAAPEKKDADTLALEKRVGDALGLTVSISHRDPGGTVQIT
FT                   YRSLEQLDEVMRRLEQG"
FT   gene            complement(174317..175345)
FT                   /locus_tag="BBta_0169"
FT   CDS_pept        complement(174317..175345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0169"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="DNA polymerase III, delta subunit domain; Evidence:
FT                   Similar to previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32466"
FT                   /db_xref="GOA:A5E8H2"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8H2"
FT                   /protein_id="ABQ32466.1"
FT                   /translation="MVALRGKDIDAFLGRPDPARPLILLYGPDTGLVRERADTLMASAV
FT                   DNPDDPFSVVKLDGDELAAEPSRLVDEAMTVPLFGGRRAIRVRAGSRNFASGVETLSQM
FT                   TVRDCRIVIEAGDIRPDSPLRKICEKATTAAAIGCYPDTERDLARLIDEELRVAALRIA
FT                   PDARASLMALLGGDRQASRNELRKLTLFAHGEGEVTLDHVMAVVADASEMKLDPIVDGA
FT                   FGGKPDVVETEFGKAMIAGTYPGVIISAAQRHAAWLHKSALAVASGTPVSSILEGGFPR
FT                   LHFSRKPSAETALRNFSPARLLPIIDQLATAALDMRKQPGLAAAIAQRTLLSIAVNARR
FT                   KG"
FT   gene            complement(175364..175915)
FT                   /locus_tag="BBta_0170"
FT   CDS_pept        complement(175364..175915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0170"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32467"
FT                   /db_xref="GOA:A5E8H3"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8H3"
FT                   /protein_id="ABQ32467.1"
FT                   /translation="MSSARFRIAARLVAVAALAGLTAGCFQPMYAEHADGTPGLRDKLA
FT                   GIELPPVDKPNASPEARIGVGIRNALAFKLYGTATGTAPTHKLVLKFQTSRSSLIVSQT
FT                   TGLPTTENVGIDAQYNLVELATNKSVMTGTTFARTSYDIPGSYQRFSRQRAFRDAEDRA
FT                   AEQIAENIKTRLAAYFTAGT"
FT   gene            complement(175902..178526)
FT                   /gene="leuS"
FT                   /locus_tag="BBta_0171"
FT   CDS_pept        complement(175902..178526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="BBta_0171"
FT                   /product="leucyl-tRNA synthetase"
FT                   /function="Amino acid-activation; Cytoplasm"
FT                   /EC_number="6.1.1.4"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32468"
FT                   /db_xref="GOA:A5E8H4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8H4"
FT                   /protein_id="ABQ32468.1"
FT                   /translation="MTSERYNAREAEPRWQRQWDEKAIFATKNDDPRPKYYVLEMFPYP
FT                   SGRIHIGHVRNYTLGDVLARFMRAKGFNVLHPMGWDAFGLPAENAAIERKVAPKAWTYD
FT                   NIAAMKKQLRSIGLSLDWAREFATCDPSYYKHQQKMFLDFMQAGLVEREQRKVNWDPVD
FT                   MTVLANEQVIDGRGWRSGAVVEQREMNQWVFKITKYSQELLDALDGLDRWPDKVRLMQR
FT                   NWIGRSEGLLIRFALDPQTTPAGETELKIFTTRPDTLFGAKFMAISADHPLAQAAAAKN
FT                   PELAAFIAEIKRIGTAQEAIDTAEKQGFDTGIRAVHPFDPSWTLPVYVANFVLMEYGTG
FT                   AIFGCPAHDQRDLDFVNKYGLGNTPVVCPEGQDPASFVITDTAFDGDGRLINSRFLDGM
FT                   TIAQAKDEVAKRLEAEQRGGAAVGERQVNFRLRDWGISRQRYWGCPIPVIHCPTCDVVP
FT                   VPAKDLPVVLPDDVTFDKPGNALDHHPTWKHVTCPKCGGKATRETDTMDTFVDSSWYFA
FT                   RFTDPWNETAPTTPDVANRMMPVDQYIGGVEHAILHLLYSRFFTRAMKATGHVAMDEPF
FT                   AGMFTQGMVVHETYQKADGTYVNPAEVKIEVGGNGRRAVLTATGEDITIGPIEKMSKSK
FT                   KNTVDPDDIIESYGADVARWFMLSDSPPDRDVIWSDERVQGAARFVQRLWRLVNESVAA
FT                   GQEAPSSRPATFGPDALALRKAAHGALDKVTGGIERLHFNVCLAHIREFANALAEVLAR
FT                   PAKPAPDLAWAIREAAQILVQLFSPMMPHLAEECWQVLGQGGLISEASWPQIERDLLVE
FT                   DSVTLVVQVNGKKRGEVTVASNAQNPEIESAVLALDAVKLALDGKPVRKVIIVPKRIVN
FT                   VVG"
FT   gene            178850..179836
FT                   /locus_tag="BBta_0172"
FT   CDS_pept        178850..179836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0172"
FT                   /product="putative diguanylate cyclase (GGDEF)domain
FT                   protein"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32469"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8H5"
FT                   /protein_id="ABQ32469.1"
FT                   /translation="MAQQRVPPTPNNFHLWFKYSLGSASDLKRAVDILVSNKRKFDKTT
FT                   NQALFDTYIGQQGTEAAVVHKVSQQLHGVMDSAKSYLTAAIADNRTHMAAIDGVAERSE
FT                   QGVDPKILIENLVSELAQATARAAKLEASFAEKSRELDTIRDSLNKSEQRARTDTLTGL
FT                   PNRRALEEFFRHAQIESMERDEPLSILLIDVDHFKKFNDNYGHGVGDQVLRLVAKALRE
FT                   RVRDQDLPARYGGEELIAVLPQTDLEGCHAIAERIRRTIADCQFTRRSTGEVLPQITVS
FT                   IGVGQFQFGESMADLIDRCDRALYLAKKLGRNRVITELELDRKLAVG"
FT   gene            complement(179851..181548)
FT                   /locus_tag="BBta_0173"
FT   CDS_pept        complement(179851..181548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0173"
FT                   /product="diguanylate cyclase"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32470"
FT                   /db_xref="GOA:A5E8H6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8H6"
FT                   /protein_id="ABQ32470.1"
FT                   /translation="MPSIRFNRNRVKLNRLLGIRARLALLAVILVAPLMLERARSLETA
FT                   RTRQIALASEEFFNIARQSADMQREVIMSVETVLKSTAYVRASASGVSRSCDMLRASLP
FT                   TTLPWIRTLMIAGRDGRIQCSTNNQYVGLDFSERPYFRGAQETRDFVFSDYLLSKPTHM
FT                   PIVMAAYPVAAITGEPDAVMLASVNLEWMSKIMSNLGSRPGITAVLIDSEGTVLAAPTD
FT                   RTELIGRPLDSVPLLSAVAETAMSSDKPSDTVSFTAADGSKRAINFTRIADTGSRLIVS
FT                   IDETRVTAAIDRDIRNAYLQAGLVCLIVLLGALIAAEKLIVKPVNMLAATAKRFGLGQW
FT                   SARVATKNLPSEFVPLAKSFNAMAAKLGQRERELIAANDRLTVMASIDMLSGLANRRGF
FT                   QNHIDVEWARALQTGAELSLLMIDVDHFKLYNDTYGHPEGDACLSRLGETLAQIAQATD
FT                   AFAGRYGGEEFCLLIPGIDARQAFEIGEQIRYAVLELNLPHATSAYRCVTVSVGVASAR
FT                   PNDALATTDLIEAADAALYAAKHHGRNTVIAHGLVDSAREATGVARAG"
FT   gene            181658..182344
FT                   /locus_tag="BBta_0174"
FT   CDS_pept        181658..182344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0174"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32471"
FT                   /db_xref="GOA:A5E8H7"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8H7"
FT                   /protein_id="ABQ32471.1"
FT                   /translation="MPDAPTSFTSSSPSALTAVEQEILRACRDAKRERASVTLIAVSKT
FT                   FAADAIEPVIAAGQRVFGENRVQEAKGKWPALMAAHPGLSLHLIGPLQSNKAKEAVALF
FT                   DAIHSVDRPSLCAALAKEIAAQNRHPQLFVQINTGEEPQKAGIAPGEADAFVAACRKDY
FT                   GLEISGLMCIPPVDEAPGPHFALTAKIAARNGLANLSMGMSADFATAIQFGATHVRVGS
FT                   AIFGHR"
FT   gene            complement(182391..183176)
FT                   /locus_tag="BBta_0175"
FT   CDS_pept        complement(182391..183176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0175"
FT                   /product="putative Hydratase/decarboxylase"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32472"
FT                   /db_xref="GOA:A5E8H8"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8H8"
FT                   /protein_id="ABQ32472.1"
FT                   /translation="MLTPSQAVSASRILREHWREGSKFAALPPDLQPRNRTEGYAIQAE
FT                   IESQSSAPLFGWKIAATSEAGQRHINVAGPLAGRILAETVLPDDGTASMAGNAMRVAEP
FT                   EFAFRMANDLAPRTMPYDVAEVLAAVATLHPAIEIPDSRFADFVTAGEAQLIADNACAH
FT                   LFVLGAPATADWRSRDLVEERPRITLSGRDFIGHGRNVLGDPRVALAWLVNELRALGLT
FT                   LRAGQVVTTGTCHPPLPIGSGDRMDVDFGDLGRVSVRFA"
FT   gene            complement(183199..183720)
FT                   /locus_tag="BBta_0176"
FT   CDS_pept        complement(183199..183720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0176"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32473"
FT                   /db_xref="GOA:A5E8H9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8H9"
FT                   /protein_id="ABQ32473.1"
FT                   /translation="MPTTTIRVRAAAGNRRRGWLIMEGLIIPVALGRGGILANKREGDG
FT                   GTPRGLFRPRRLWWRADRHRRPQTRLPVRPIGPEDAWCEDPADRRYNRPFRLGGDQPGD
FT                   RLARSDHLYDFIIEIDHNTRPRIAGRGSAVFLHLARPNFGPTAGCVAMTRSAMLRLLQS
FT                   IGPRTRIIIE"
FT   gene            183999..184685
FT                   /locus_tag="BBta_0177"
FT   CDS_pept        183999..184685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0177"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /function="Two-component regulatory systems (external
FT                   signal)"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32474"
FT                   /db_xref="GOA:A5E8I0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8I0"
FT                   /protein_id="ABQ32474.1"
FT                   /translation="MANARKILIVDDDTDLRDTLMEQLSLHDEFEAQAVDTGAKGASAA
FT                   KANSPDLVLMDVGLPDTDGREVVRSLRKGGFKAPIIMLTGHDTDSDTILGLESGANDYV
FT                   AKPFRFAVLLARIRAQLRQHEASEDAVFSVGPYSFRPGSKMLTGANARKVRLTEKETAI
FT                   LRFLYRAGQQPVSRETLLQEVWGYNSGVTTHTLETHIYRLRQKIEKDAANPEILVTEAG
FT                   GYKLVP"
FT   gene            184778..185194
FT                   /locus_tag="BBta_0178"
FT   CDS_pept        184778..185194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0178"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32475"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8I1"
FT                   /protein_id="ABQ32475.1"
FT                   /translation="MERVPTLRLLGRESLRMLAIGSEPRNIQSGEALFREGDTADCGYV
FT                   VQRGSLRVSDQVGAEVVATPGMLIGELALLVEMRRPATATALEYASVVRLSRSLFQRVL
FT                   ESDAVAARRLREEFANRATRLAGDILKAGAKLMS"
FT   gene            complement(185303..186118)
FT                   /locus_tag="BBta_0179"
FT   CDS_pept        complement(185303..186118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0179"
FT                   /product="putative exodeoxyribonuclease III (xthA)"
FT                   /function="DNA; DNA repair"
FT                   /EC_number="3.1.11.2"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32476"
FT                   /db_xref="GOA:A5E8I2"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8I2"
FT                   /protein_id="ABQ32476.1"
FT                   /translation="MRLVLTTWNINSVRLRIDLVAKLIKQVRPDVLCLQETKCIDDAFP
FT                   LKRFKRLGYEHIALNGQKGYHGVAVISKWPFDSTGVRTFCDKVDSRHISVAFGEKAQLA
FT                   RPLVLHNFYVPAGGDIPDPALNPKFEHKLQFLDEMKACEPLHPRGDDRHILVGDLNVAP
FT                   HEHDVWSHKQLLKVVSHTPIECEKLLAAQSHGAWVDVARERIPMSEKVYTWWSYRAADW
FT                   TVGNRGRRLDHIWVSRALKDNVTDFSILRDARSWERPSDHVPVTVTLDV"
FT   gene            complement(186257..187198)
FT                   /gene="gshB"
FT                   /gene_synonym="gsh-II"
FT                   /locus_tag="BBta_0180"
FT   CDS_pept        complement(186257..187198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /gene_synonym="gsh-II"
FT                   /locus_tag="BBta_0180"
FT                   /product="glutathione synthase"
FT                   /function="Glutathione"
FT                   /EC_number="6.3.2.3"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32477"
FT                   /db_xref="GOA:A5E8I3"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8I3"
FT                   /protein_id="ABQ32477.1"
FT                   /translation="MKLNVAVQMDPIARINIRGDSTFALLLEAQRRGHGLSYYTPDKLS
FT                   LRGEELYAPVQALAVRDEIGDHFTLSEPKPTALASFDVVLLRQDPPFDLAYITSTHFLE
FT                   RIHPKTLVVNDPASVRNAPEKLFVMNFPQLMPPTLISRDLDEINAFRAQHGAVVMKPLH
FT                   GHGGAAVFRVMPQDMNFGSLFDMFSVTFKEPWVIQRFLPEVKHGDKRIILVDGEFAGAV
FT                   NRVPAADDLRSNMVRGGAAQATELSPREREICDTLGPELRARGLLLVGIDVIDGNLTEI
FT                   NVTSPTGIRAISRLGGPDIAARVWDVIEAKRR"
FT   gene            complement(187232..187642)
FT                   /locus_tag="BBta_0181"
FT   CDS_pept        complement(187232..187642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0181"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32478"
FT                   /db_xref="GOA:A5E8I4"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8I4"
FT                   /protein_id="ABQ32478.1"
FT                   /translation="MAKAEHTSTAKPSKPAAPERVAAFRTGLSAEARAAALLIAKGYRI
FT                   LAKRFRTPHGEIDIIARKRDLVTFVEVKARASLDDAAYAVTPRQQQRIIDAAQAWLMTH
FT                   PEHAEFELRFDAILVAPRSLPRHLIAAFDAST"
FT   gene            complement(187629..188522)
FT                   /locus_tag="BBta_0182"
FT   CDS_pept        complement(187629..188522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0182"
FT                   /product="putative methyltransferase"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32479"
FT                   /db_xref="GOA:A5E8I5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8I5"
FT                   /protein_id="ABQ32479.1"
FT                   /translation="MVAGHRVTAPKARPGLYLVATPIGNLADITLRALETLAGVDGILC
FT                   EDTRITRRLTERYGLSSELAAYHEHNAEAVRPRILQRLAEGAAIALVSDAGTPLISDPG
FT                   YKLVREACGAGHAVTALPGPSAVLAALSVAALPTDRFFFEGFLPAKQQARRARLSELAR
FT                   VDATLVMFESGNRVQECLADLADGLPGRQAAICRELTKLHEEVLRGAISDLAAQANELE
FT                   TRGEFVLVIGPPARDAEVLTTDQLDALLADLLQRSSVKDAVMHAVELSGRPRREVYARA
FT                   LKLAKTKRAGEADGEG"
FT   gene            188914..190161
FT                   /locus_tag="BBta_0183"
FT   CDS_pept        188914..190161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0183"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32480"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8I6"
FT                   /protein_id="ABQ32480.1"
FT                   /translation="MVGPRHPKSHGPRSFGLKSHGPDSHGVARRTALGLIVGAPLLSAC
FT                   SGVQQGMSIPNPFEQPTGPSGPPLQPAVAGNGQVKVGLLLPLSASGNAGIAAQSMKNAA
FT                   EMALAEFQNPNIQLLIKDDAGSPQGAQQGAQQACDEGAEIILGPLFAGSVPATAQVART
FT                   RNISVIAFSTDSSVAGRGVYLLSFLPESDAIRIVDYSASVGKRSFAALLPDNAYGTVVE
FT                   GAFKTAVSRRGGRIVAFEKYSGDRNTAARTVAQSLGGADALLLADDGDSVVATADALTA
FT                   AGANLRNIQLLGTGLWDNPRVYNSASLQGGLYAAPDPAGFRAFAGRYRTRFGGDPVRTA
FT                   TLAYDAVALVAALARTQGAQRFAPDVLTNASGFAGIDGLFRFRSDGTNERGLAVMRVGS
FT                   GGGQAVAGAPKSFNAT"
FT   gene            complement(190190..191347)
FT                   /locus_tag="BBta_0184"
FT   CDS_pept        complement(190190..191347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0184"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase (yggW)"
FT                   /EC_number="1.3.99.22"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32481"
FT                   /db_xref="GOA:A5E8I7"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8I7"
FT                   /protein_id="ABQ32481.1"
FT                   /translation="MTSAENEAFGVYVHWPFCLSKCPYCDFNSHVRHTAIDQDRFARAF
FT                   AREIETTAARIGARTVSSIFLGGGTPSLMQPQTVGAILDAIGKHWHVASDVEVSLEANP
FT                   TSVEATRFAGYRTAGVNRVSLGVQAMDDASLKMLGRLHTAEEAMKAVAIARQAFTRYSF
FT                   DLIYARPDQTPAMWTEELTRAIGEAAEHLSLYQLTIEEGTPFFGLHAAGKLKTPDEGLA
FT                   RTLYDVTQEVCARHGLPAYEISNHARPGAECRHNLVYWRGQEYAGIGPGAHGRLDIDGI
FT                   RHAIATDKRPEAWLMRVESNGHGVMTDDELNREERADEFLLMGLRLAEGIDPKRYAAIS
FT                   GRPLDPRRIALLREEGAIIVDGDGRLRVTQDGFPVLDAVVADLAA"
FT   gene            complement(191334..191978)
FT                   /locus_tag="BBta_0185"
FT   CDS_pept        complement(191334..191978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0185"
FT                   /product="putative HAM1 protein"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32482"
FT                   /db_xref="GOA:A5E8I8"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8I8"
FT                   /protein_id="ABQ32482.1"
FT                   /translation="MSSSHRKLSGRIVIATHNPGKLAEMRELLAPYGVEAVSAGELSLG
FT                   EPDETGETFQANARIKAVAAADAAQLPAFADDSGIVVHALDGAPGIYSARWAGPDKDFT
FT                   AAMTRIERLLQERGATGPDKRGAHFVSALCVAWPDGHVEEVEARVDGTLVWPPRGSAGF
FT                   GYDPMFLPEGHDRTFGEMTSLEKHGLPPLGLGLSHRARAFVKLAEICLDQR"
FT   gene            complement(191975..192688)
FT                   /gene="rph"
FT                   /locus_tag="BBta_0186"
FT   CDS_pept        complement(191975..192688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="BBta_0186"
FT                   /product="RNAse PH"
FT                   /function="RNA; RNA degradation"
FT                   /EC_number="2.7.7.56"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32483"
FT                   /db_xref="GOA:A5E8I9"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8I9"
FT                   /protein_id="ABQ32483.1"
FT                   /translation="MRPSRRAPDELRPVSLERGVVKYAEGSCLVKFGDTHVLVTATLED
FT                   RLPPWLKGQGRGWITAEYGMLPRATLERTRREASAGKQTGRTVEIQRLIGRSLRTAIDL
FT                   EALGERQITVDCDVLQADGGTRTASITGAWVALADCIKWMKTRNMLKTEVLRANVAAIS
FT                   CGIYNGTPVLDLDYAEDSEAETDANFVMTGDGRIIEVQGTAEKTPFTEAEFLALMALAR
FT                   KGVARLVDLQKMAVA"
FT   gene            192863..193951
FT                   /gene="hrcA"
FT                   /locus_tag="BBta_0187"
FT   CDS_pept        192863..193951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="BBta_0187"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /function="Complex regulation; Temperature extremes"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32484"
FT                   /db_xref="GOA:A5E8J0"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8J0"
FT                   /protein_id="ABQ32484.1"
FT                   /translation="MAHHDPINLMTPPAGLAQLNERSREIFRQIVESYLATGEPVGSRN
FT                   ISRLIAVPLSPASVRNVMADLEQLGLIYAPHTSAGRLPTEAGLRFFVDALMQVGDMTEA
FT                   ERQSIQSQLASVGRAQSVEAALDEALTRLSGLTRAAAVVLTAKSNTRLKHIEFVRLEPE
FT                   RALVVLVGEDGQVENRVLALPPGVPSSALTEASNFLNARIRGRTLAEARLELETALAHD
FT                   RAELDQLTQKVIAAGVASWSGGDSDDRQLIVRGHANLLEDLHALEDLERVRRLFDDLET
FT                   KRGVVDLLGRAENADGVRIFIGSENKLFSLSGSSTIVSPYSDATGRIVGVLGVIGPTRL
FT                   NYARVIPTVDYAARLVSRLLGG"
FT   gene            194084..194704
FT                   /gene="grpE"
FT                   /locus_tag="BBta_0188"
FT   CDS_pept        194084..194704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="BBta_0188"
FT                   /product="protein grpE (HSP-70 cofactor)"
FT                   /function="Chaperoning, folding; Cell division"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32485"
FT                   /db_xref="GOA:A5E8J1"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8J1"
FT                   /protein_id="ABQ32485.1"
FT                   /translation="MTDPDLHKNDPENPAQASEPVVSKPYIMPDDPETGSAEALAKEAA
FT                   DARDKMLRTLAEMENLRKRTAREVADARIYGITGFARDVLDIADNLQRALDAVPAETRA
FT                   NADPGLKALIEGVELTERSLLNTLEKNGVKKFDPTGQKFDPNFQQAMYEVPDASVPSGT
FT                   VVQVVQAGFMIGERVLRPALVGVSKGGAKPAPAANNDQPNNAA"
FT   gene            complement(194835..195548)
FT                   /locus_tag="BBta_0189"
FT   CDS_pept        complement(194835..195548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0189"
FT                   /product="Putative pyrazinamidase/nicotinamidase"
FT                   /function="Nicotinamide adenine dinucleotide (NAD);
FT                   Cytoplasm"
FT                   /EC_number="3.5.1.-"
FT                   /EC_number="3.5.1.19"
FT                   /note="Localization: 2 : Cytoplasmic; Evidence: Function
FT                   proposed based on presence of conserved amino acid motif,
FT                   structural feature or limited homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32486"
FT                   /db_xref="GOA:A5E8J2"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8J2"
FT                   /protein_id="ABQ32486.1"
FT                   /translation="MDRRGILAGLGATALMSALPARGWAAASIKPDETSALLVIDVQNF
FT                   FLPGGSLAVKDGEQVVPIINRIAKAFSNVVLTQDWHTPAHVSFASSHAGKKPFELVDLA
FT                   YGKQVLWPDHCVQGTEGAALSKDLAIPQAELIIRKGFHNAVDSYSAFTEADGKTTTGLA
FT                   AYLQARGITRVFVAGLATDFCVAWTALDARKAGLETYVVEDACRGIDTQGSLAKAWTDM
FT                   AAAGVKRISSEDIAA"
FT   gene            complement(195715..196650)
FT                   /locus_tag="BBta_0190"
FT   CDS_pept        complement(195715..196650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0190"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32487"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8J3"
FT                   /protein_id="ABQ32487.1"
FT                   /translation="MMFSRLLAAAVVSLSLLGPVSAADAIFPPGVRIGLAPLVGLTKAK
FT                   TFPGFETEDQSVKVLLTELPAAAYGEVKNAFTANPGGTGNIKPESIETAAGTAYYTVEN
FT                   GRDGAAAVRRYSMILPGTGFSGYVAVQVPETASKIYTDDAVRQMFATAVVRKDVPVDEQ
FT                   LSTMPFKVTELSGFKTVRTLGPGALLLADGEEDKGIEAAPFVVIGLVAGATPEAGDRGR
FT                   IAQQAATTIPGVREAHITMSEPIRIDGLPAYETRVDAVSGKDNTPVTVVQWLRFGGPNT
FT                   LRIIGSAPRDQWSTAFPRFRAVRDGIQPRG"
FT   gene            197144..199039
FT                   /gene="dnaK"
FT                   /gene_synonym="groPA"
FT                   /gene_synonym="grpC"
FT                   /gene_synonym="grpF"
FT                   /gene_synonym="seg"
FT                   /locus_tag="BBta_0191"
FT   CDS_pept        197144..199039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /gene_synonym="groPA"
FT                   /gene_synonym="grpC"
FT                   /gene_synonym="grpF"
FT                   /gene_synonym="seg"
FT                   /locus_tag="BBta_0191"
FT                   /product="Chaperone protein dnaK"
FT                   /function="Chaperoning, folding; Osmotic pressure;
FT                   Temperature extremes"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32488"
FT                   /db_xref="GOA:A5E8J4"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8J4"
FT                   /protein_id="ABQ32488.1"
FT                   /translation="MGKVIGIDLGTTNSCVAVMDGKSSKVIENAEGMRTTPSIVAFSDD
FT                   GERLVGQPAKRQAVTNPERTFFAVKRLIGRRYDDPMVEKDKKLVPYKIVKAGNGDAWVE
FT                   ADGKTYSPSQVSAFILQKMKETAEAHLGQKVDQAVITVPAYFNDAQRQATKDAGKIAGL
FT                   EVLRIINEPTAAALAYGLDKTKAGTIAVYDLGGGTFDVSILEIGDGVFEVKSTNGDTFL
FT                   GGEDFDMRLVSYLADEFQKEQGINLRNDKLALQRLKEAAEKAKIELSSTTQTEINLPFI
FT                   TADQSGPKHLTMKLTRAKFEALVADLVEKTIEPCRKALKDAGLTAGEIGEVVLVGGMTR
FT                   MPKIQEMVKQFFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETL
FT                   GGVFTRIIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKMLGQFDLMGIP
FT                   PAPRGMPQIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSEADIDKMVKDAEAN
FT                   AAADKKRREAVDAKNHADALVHSTEKALAEHGSKVADTERRAIEDAVSDLKEALKGDDA
FT                   EAIKAKTNTLAQASMKLGEAMYKQQAESDAARDAAKDDVVDAEFTEVDDDKKKSA"
FT   gene            199182..200309
FT                   /gene="dnaJ"
FT                   /gene_synonym="groP"
FT                   /gene_synonym="grpC"
FT                   /locus_tag="BBta_0192"
FT   CDS_pept        199182..200309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /gene_synonym="groP"
FT                   /gene_synonym="grpC"
FT                   /locus_tag="BBta_0192"
FT                   /product="Chaperone protein dnaJ, heat shock protein
FT                   (Hsp40), co-chaperone with dnaK"
FT                   /function="Chaperoning, folding; Cytoplasm; Osmotic
FT                   pressure; Temperature extremes"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32489"
FT                   /db_xref="GOA:A5E8J5"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8J5"
FT                   /protein_id="ABQ32489.1"
FT                   /translation="MSTKRCYYETLEVERDADETKLKAAFRKLAMKWHPDKNPGDASSE
FT                   VKFKEINEAYEVLRDADKRAAYDRYGHAAFEQGAGGPHGFGAGFASSFSDIFEDLFGMA
FT                   GQRRGGTGRERGADLRYNMEITLEEAFQGKTAQIEIPVSVTCESCSGTGAKAGTKPKTC
FT                   AMCGGAGRVRQAQGFFTLERTCPGCHGRGQMIEDPCPSCSGSGRVTRDRTLSVNIPQGV
FT                   EDGTRIRLAGEGEAGLRGGPPGDLYIFLSLSQHEFFQRDGADLHCRVPISMVTAALGGE
FT                   FEVPTIDKGKTKVKIPAGAQSGRRFRIASKGMPVLRSRQTGDMYVQIVVETPQNLTKKQ
FT                   QELLAEFEKLSSGATQPEAAGFFTKVKDFFGKAAS"
FT   gene            200523..201125
FT                   /gene="pmtA"
FT                   /locus_tag="BBta_0193"
FT   CDS_pept        200523..201125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmtA"
FT                   /locus_tag="BBta_0193"
FT                   /product="phospholipid N-methyltransferase"
FT                   /function="Phospholipid"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32490"
FT                   /db_xref="GOA:A5E8J6"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8J6"
FT                   /protein_id="ABQ32490.1"
FT                   /translation="MPLQTSVRASKKPLRLDDEVRFLRSWIEKPLHMGAVMPSGRLLAR
FT                   TMAQYVDPHGTGPVIELGPGTGAITNALVQHGIDQKRLVLVEYNPGFCALLRDRYPQAK
FT                   VVQGDAYRLRDTLWNVLGMPASAVVSGLPLVTKPMLTRMKLVRDAFAAMAPNAPFVQFT
FT                   YSVVPPIPKSLPGVTTEASERIWMNLPPARVWVYRKP"
FT   gene            201171..201749
FT                   /locus_tag="BBta_0194"
FT   CDS_pept        201171..201749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0194"
FT                   /product="putative NADPH-dependent FMN reductase"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32491"
FT                   /db_xref="GOA:A5E8J7"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8J7"
FT                   /protein_id="ABQ32491.1"
FT                   /translation="MSALKILIIPGSTRAGSHNVKLAAVAAYQFVQAGADVTRISLADY
FT                   PLPIYDADHEARSGVPREAVNLKRMIAVHHGVLLVTPEYNAAPPPLLSNALAWLSRVEE
FT                   PPEARGRVFRTRPFAIAAASEHRFGGVRALAALRLMLTACDAQVIPSQLALAFADKAYN
FT                   DMDRLRLPADIAALDALVRQLIDLAQHTM"
FT   gene            201756..202487
FT                   /gene="pyrF"
FT                   /locus_tag="BBta_0195"
FT   CDS_pept        201756..202487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="BBta_0195"
FT                   /product="orotidine-5'-phosphate decarboxylase"
FT                   /function="Nucleotide and nucleoside conversions;
FT                   Pyrimidine biosynthesis"
FT                   /EC_number="4.1.1.23"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32492"
FT                   /db_xref="GOA:A5E8J8"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8J8"
FT                   /protein_id="ABQ32492.1"
FT                   /translation="MPTEIAPRDRLIVALDLPGVAEAEAMITRLGDAVTFYKIGMELTY
FT                   AGGLGLAERLAADGKQVFMDLKLHDIPNTVERATRQIARLGARFLTVHGFSQSMTAALA
FT                   GAAGSPLELLAVTVMTSYDDADLAAAGYAMGVKELVARRAVQAKQIGIHGLILSPEETQ
FT                   LVRPLVGPDMQLVTPGIRPAGSDVGDQKRIMTPALAIAGGADRLVVGRPVTGAADPAAA
FT                   AESIVADIASALALVGKTNRT"
FT   gene            202538..202840
FT                   /locus_tag="BBta_0196"
FT   CDS_pept        202538..202840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0196"
FT                   /product="hypothetical protein"
FT                   /note="dimeric alpha-beta barrel domain; Evidence: Similar
FT                   to previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32493"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8J9"
FT                   /protein_id="ABQ32493.1"
FT                   /translation="MAKAYWIARIDVHNMDGYKDYVAQNGAVFHQYGARFLVRGGQYET
FT                   KEGTSRSRNVVIEFKDYETALACYNSPEYQRLVAMRSPHSEGDLVIIEGYDGPQP"
FT   gene            202934..203752
FT                   /gene="dapB"
FT                   /locus_tag="BBta_0197"
FT   CDS_pept        202934..203752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="BBta_0197"
FT                   /product="dihydrodipicolinate reductase"
FT                   /function="Lysine, diaminopimelate; Peptidoglycan (murein);
FT                   Cytoplasm"
FT                   /EC_number="1.17.1.8"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32494"
FT                   /db_xref="GOA:A5E8K0"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8K0"
FT                   /protein_id="ABQ32494.1"
FT                   /translation="MSKMRLIVAGAGGRMGRALVRAIADSDGAELAGALEAPGSELIGK
FT                   DAGVLAGLPANGIKLSGDLWTMSAEADGILDFTVPAATIANVAIAAERGIAHIIGTTGL
FT                   SASDDAVIKSVTKRAIVVQSGNMSLGVNLLSALVKQVAKSLDAGFDIEILEMHHKHKVD
FT                   APSGTALMLGRAAAEGRGVVLDQHSARGRDGITGERRSGDIGFASLRGGTAAGDHSVIF
FT                   AGPSERLVLSHQAEDRMIFAHGALKAALWAHGKPPGYYTMSDVLGLKDLF"
FT   gene            203777..204400
FT                   /gene="gpmA"
FT                   /gene_synonym="gpm"
FT                   /locus_tag="BBta_0198"
FT   CDS_pept        203777..204400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmA"
FT                   /gene_synonym="gpm"
FT                   /locus_tag="BBta_0198"
FT                   /product="phosphoglycerate mutase"
FT                   /function="Galactose degradation; Glycolysis;
FT                   Gluconeogenesis"
FT                   /EC_number="5.4.2.-"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32495"
FT                   /db_xref="GOA:A5E8K1"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8K1"
FT                   /protein_id="ABQ32495.1"
FT                   /translation="MSERLLVLVRHGQSEWNLKNLFTGWKDPDLTEQGVSEAKEAGRKL
FT                   KAHGLTFDVAFTSELTRAQHTLKLILDELGQPGLPTSRNLALNERDYGDLSGLNKDDAR
FT                   AKWGEEQVHVWRRSYDVPPPGGESLKDTLARALPYYVQEILPGVLRGQRTLVAAHGNSL
FT                   RALIMVLEKLTPEGILKRELATGVPIIYRLKADSTVESKLDLAG"
FT   gene            complement(204725..205624)
FT                   /locus_tag="BBta_0199"
FT   CDS_pept        complement(204725..205624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0199"
FT                   /product="DNA-O6-methylguanine--protein-cysteine
FT                   S-methyltransferase / Transcriptional regulator Ada"
FT                   /function="DNA repair; Transcription related; Activator;
FT                   Repressor"
FT                   /EC_number="2.1.1.63"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32496"
FT                   /db_xref="GOA:A5E8K2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8K2"
FT                   /protein_id="ABQ32496.1"
FT                   /translation="MMTLAIHDSALAKPGPHQSAALRDYDAVRRAIAFISEHWRRQPTI
FT                   EDMADAASLTPDELHHLFRRWAGLTPKAFMQALTLDHAKGLLKGSASVLDAALDSGLSG
FT                   PGRLHDLFVTHEAMSPGEWKTGDAGTTLRYGFHPCPFGMALVMATPRGLAGLAFADPGE
FT                   EASALSDMKSRWPRAAYIEDVPGTAGLAQRIFDKSLWRPDQPLRVVLIGTDFEVRVWET
FT                   LLKIPMGRAVCYSDIATRLESPKASRAVGAAVGKNPISFVVPCHRALGKTGALTGYHWG
FT                   LTRKQAMIGWEAGQVGMG"
FT   gene            complement(205873..206403)
FT                   /locus_tag="BBta_0200"
FT   CDS_pept        complement(205873..206403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0200"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32497"
FT                   /db_xref="GOA:A5E8K3"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8K3"
FT                   /protein_id="ABQ32497.1"
FT                   /translation="MPSNAFASQETGTDAADQELFAARLTPHRSLNRTGFVVLMVVVCA
FT                   ISFIGGIASLLMGAWPVFGFFGLDALAIYWAFKVNFRRARAYEEVSITLTELRLRRVSH
FT                   KGHVMEWRFNPLWVRLDQVSHEEFGIENLYLVARGQRVAIASFLGPEEKASFAKALTAG
FT                   LQAAKRGPVYNPL"
FT   gene            206429..207253
FT                   /gene="nth"
FT                   /locus_tag="BBta_0201"
FT   CDS_pept        206429..207253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="BBta_0201"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase /
FT                   endonuclease III"
FT                   /function="DNA; DNA degradation; Radiation; Cytoplasm"
FT                   /EC_number="4.2.99.18"
FT                   /EC_number="3.2.2.-"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32498"
FT                   /db_xref="GOA:A5E8K4"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8K4"
FT                   /protein_id="ABQ32498.1"
FT                   /translation="MAKITRPQRAKPAPVRSPAKKAAKAAPKTAPKTAAKAPKTAANAK
FT                   TVPKTPARAVKKALKAAKPWTPAEIREAFSRFAASNPEPKGELEHLNPYTLLVAVVLSA
FT                   QATDAGVNKATRPLFAVADTPQKMIALGEEQLRDYIKTIGLYRTKAKNVIALSQKLISE
FT                   FGGEVPRTRAELESLPGAGRKTANVVLNMAFGEHTMAVDTHVFRVGNRTGLAPGKTPLE
FT                   VELGLEKVIPAEFMLHAHHWLILHGRYTCLARKPRCELCLIKDLCRWPEKTA"
FT   gene            207464..208516
FT                   /locus_tag="BBta_0202"
FT   CDS_pept        207464..208516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0202"
FT                   /product="putative Type III polyketide synthase"
FT                   /EC_number="2.3.1.74"
FT                   /note="putative chalcone synthase; Evidence: Function
FT                   proposed based on presence of conserved amino acid motif,
FT                   structural feature or limited homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32499"
FT                   /db_xref="GOA:A5E8K5"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8K5"
FT                   /protein_id="ABQ32499.1"
FT                   /translation="MDHTAALMSLATAVPPHQFRQNEVTEAARVVLSPRFPQFETMASL
FT                   FANTGIRQRYGVKPIEWYMERRGWPERTEAYLQGAEALFIDATTKALAQADLKADEIDT
FT                   IVSVSSTGIATPTLEARVAGRMGFRSDVSRVPVFGLGCAGGVSGLSIAARLAQARPGTN
FT                   VLFVTFELCTLAVRHDELTKANIVALSLFGDGAAAAILRAGDGGAIRVEATGEKLWPET
FT                   LDIMGWSVDPEGFGVIFQRTIPDFVTENMGPAVNEILGGMKLASSDVDRFVCHPGGAKV
FT                   ITALERALSLGQGTLDHEREIIADYGNMSAPTVLFVLERARARGLPPRSVLTALGPGFT
FT                   ASCVSLRHAA"
FT   gene            208549..209019
FT                   /locus_tag="BBta_0203"
FT   CDS_pept        208549..209019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0203"
FT                   /product="putative exported protein of unknown function
FT                   with isoprenylcysteine carboxyl methyltransferase domain"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32500"
FT                   /db_xref="GOA:A5E8K6"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8K6"
FT                   /protein_id="ABQ32500.1"
FT                   /translation="MQRLGELVLARHNTRRLRAMGAVEVGADHYPLMITMHAAWLVSLW
FT                   LLGTDQEVDPWLLSGFVLLQGLRWWVLATLGPRWTTRIIILPGAPLVTDGPYRYISHPN
FT                   YLVVAAEIALLPLALHLPLIALIFSGLNAAVLVIRIRAESEALSGISRSQTA"
FT   gene            209016..210635
FT                   /locus_tag="BBta_0204"
FT   CDS_pept        209016..210635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0204"
FT                   /product="putative Multidrug resistance protein"
FT                   /function="Drug resistance/sensitivity; Membrane; Inner
FT                   membrane; Transport; The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 5 : Inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32501"
FT                   /db_xref="GOA:A5E8K7"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8K7"
FT                   /protein_id="ABQ32501.1"
FT                   /translation="MSAPATPQETPGLATWLGFILMCVGMFMAILDIQVVATSLPTIQE
FT                   ALGITPDAMSWVQTAYLIAEIIAIPLTGLLTRVFSLRWLFVGAVSIFTAASLGCAMSGS
FT                   FHMLLAFRVLQGFFGGLLIPVVFSAVFLLFPARLHAVATTIGGVVAVLAPTIGPVVGGF
FT                   ITNTWSWPWLFLINIVPGIIAALMTPSLLPKQRMNLIELDKLDLLALMLLAVSLASLEL
FT                   GLKEAPKGGWLSSNCIALLVLSGSCLTLLIQRLLASPHPILRLGSFQRRSFTLGCVSSF
FT                   CLGIGLFGSVYLMPVFLAFVRQHDAFEIGKIMLVTGVAQLIAAPLVTALDGKVDARLLT
FT                   SFGFALFSAGLAASAFQPASADYQEMFWPQVVRGVGIMFCLLPPTRIALGDLPQAEVAD
FT                   ASGLFNLMRNLGGAIGIALIDTIIYGRVGLHAQAFRDRLMAGDTAAAKAIGLAPELLRN
FT                   RPRGVSEEAAIAYVRPLVEKASLALCVNEAWALLAGVALLGFILIPFARNRTESPSPRR
FT                   LALEAAQPALRRRLDQLGPRSG"
FT   gene            complement(210573..211325)
FT                   /locus_tag="BBta_0205"
FT   CDS_pept        complement(210573..211325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0205"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32502"
FT                   /db_xref="GOA:A5E8K8"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8K8"
FT                   /protein_id="ABQ32502.1"
FT                   /translation="MIDAAVKAISQILSPPMRSILWRSIGLALVLVTVLAIGLQRLLSW
FT                   LATAGEGWAESMLGPNSHGTLEVLTWIISIAAGFGVVFGGIMLMPAITSLIASLFVDDV
FT                   ADLVEREHYPAERPGVALPFGVAIIEGLKAAGLTILVYLVALPFVFLAGAGFVIFFLAT
FT                   AWLLGREYFELAAMRFRPPAEAKAMRRDNAVTVFTAGLIIAAFVTIPIVNLATPLFGMA
FT                   FMVHLHKRLSGPRPELIEPSSERRLRSL"
FT   gene            complement(211531..213996)
FT                   /gene="actP"
FT                   /gene_synonym="copA"
FT                   /locus_tag="BBta_0206"
FT   CDS_pept        complement(211531..213996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actP"
FT                   /gene_synonym="copA"
FT                   /locus_tag="BBta_0206"
FT                   /product="copper-transporting P-type ATPase"
FT                   /function="The P-type ATPase (P-ATPase) Superfamily;
FT                   Membrane; Inner membrane; Cu"
FT                   /EC_number="3.6.3.4"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 5 : Inner
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32503"
FT                   /db_xref="GOA:A5E8K9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8K9"
FT                   /protein_id="ABQ32503.1"
FT                   /translation="MSVDPATSKHRFEHQGQTFHFCSAGCRSKFAADPAKYLAPVAAAG
FT                   SCCAGHDHHAHHPDATTVIDPVCGMSVDPATSKHRFDHQGHAFHFCSAGCRTKFSADPV
FT                   KYLEKREPPPEMPAGTIYTCPMHPEIRQEGPGTCPICGMALEPDVISLDDAPNPELADM
FT                   TKRFWIGAVLAAPVVVLEMGGHLVGGHGLVDPVLSNWIQFVLATPAVLWAGWPFFVRGW
FT                   QSVRTRNLNMFTLIAMGTSVAYGYSVIATLAPQAFPPAFRGHGGAVPVYFEAASVITIL
FT                   VLLGQLLELRAREATSGAIKALLQLAPKTARRLDADGNDHEVEIAALAVGDRLRVRPGE
FT                   KVPVDGVLLEGRSSLDESLVTGESMPVTKDEGARVIAGTLNQTGSFVMRADKVGRETLL
FT                   SQIVQMVADAQRSRAPIQRLADQVAGWFVPTVIAAAIAAFVAWYAFGPEPRFAFGLVAA
FT                   VSVLIIACPCALGLATPMSIMVGVGRGAQAGVLIKSAEALERMEKVDTLVVDKTGTLTE
FT                   GKPKVTSIVTADGIDETGALRLAASVERASEHPLAEAIVRHAAERNVKLAEVKNFDAPT
FT                   GKGARGDIDGKAVVLGNATYLASLGIITDTLGVESKRLRSEGATVITMAVDGKPVALFA
FT                   IADPVKASTPDALKALAADGIKVIMLTGDNRTTATAVARKIGITEVEAEVLPEQKSAVV
FT                   ARLRASGKVVAMAGDGVNDAPALAAADVGIAMGTGTDVAMESAGITLLQGDLGGIARAR
FT                   KLSAAVMRNIRQNLFFAFIYNAAGIPIAAGILYPVFGILLSPIIAAAAMSLSSVSVVGN
FT                   ALRLRATKL"
FT   gene            214268..214543
FT                   /locus_tag="BBta_0207"
FT   CDS_pept        214268..214543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0207"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32504"
FT                   /db_xref="GOA:A5E8L0"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8L0"
FT                   /protein_id="ABQ32504.1"
FT                   /translation="MREDIKTSCQKRLSRIEGQVRGLSKMVEDNRYCIDIVTQISAVRA
FT                   ALRRVEEEILRDHVAHCVEHAIASGDRADQRQKIAELMDVISRSDR"
FT   gene            complement(214556..215536)
FT                   /locus_tag="BBta_0208"
FT   CDS_pept        complement(214556..215536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0208"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32505"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8L1"
FT                   /protein_id="ABQ32505.1"
FT                   /translation="MGIVLDQIGKLIAAYLQKEIPGYEPFTPSDPEYLRKDMQPGDVLL
FT                   VEGNSRISGIIKYLTQSTWSHAALYVGPIDGAVEPDGEPHVLVEAYVGDGVISAPLSKY
FT                   FDYHTRLCRPVGLTFEDRHTVCRYAINRIGFGYDTKNIVDLMRYLIPLPIPQRWRRRMI
FT                   ALGSGDPTKMICSALIAQAFDAVRYPILPKITRAPSRRAKREILHIRDSSLYMPRDFDI
FT                   SPYFEIVKPTIVNGFDYTTLHWADKQKPLAEVAGEFAVFPGSVQAPPLVPEAADQEAAQ
FT                   PVAAQEIAVEKLGERLIINEHFLVAEPVRTMAPRAAARRRNKVAV"
FT   gene            215728..217137
FT                   /locus_tag="BBta_0209"
FT   CDS_pept        215728..217137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0209"
FT                   /product="putative exported protein of unknown function
FT                   with flavin containing amine oxidoreductase domain"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32506"
FT                   /db_xref="GOA:A5E8L2"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8L2"
FT                   /protein_id="ABQ32506.1"
FT                   /translation="MSFTRRGFLSASTALAALPLVGRRALAAVPREADIVVIGAGAAGI
FT                   AAARRIVAANRKVVLIEASSQIGGRCSTDLATFGVPFDRGARWLLNADSNPIGKLARGV
FT                   GVDVVAAPVGQKIRVGRRNARPGETEQFLAGLVRANRAIDEASRGKLDTSCATALPKDL
FT                   GDWTNTTAFVLGASATGKDLVDLSAMDKARAQDRSAPLACRQGLGTLVSKLGEALPVSL
FT                   STPATRIVWGNRDVAVETPAGRIATRAVILTVSTNVLASGTIKFAPELPKRQLDAAAKL
FT                   SLGSMDHIALMLTGNPLGLSRDEVIIEQSNSNRTGLLLANIGGSSLCTIDVAGAFGRDL
FT                   SAQGEAAMAAFAKDWIGKLFGSEAAAAVKSTAATRWNQAPGVLGAMSAAAPGSQGARKI
FT                   LAEPLGPLFLAGEATHETLWGTVDGAWDSGERAAEAALRRIGALKEPEPDQASERQRGR
FT                   RRKLRSASPED"
FT   gene            complement(217261..218205)
FT                   /locus_tag="BBta_0210"
FT   CDS_pept        complement(217261..218205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0210"
FT                   /product="putative hydrolase"
FT                   /EC_number="3.-.-.-"
FT                   /note="putative Metal-dependent hydrolase of the
FT                   beta-lactamase superfamily III; Evidence: Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32507"
FT                   /db_xref="GOA:A5E8L3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8L3"
FT                   /protein_id="ABQ32507.1"
FT                   /translation="MINRRTMLSLAMGTAAAMATRSVIAQGARTGTRIVFLGTKGGPRV
FT                   GIGASNPANLVVVNGTPFVIDCGMGVSRQLVNAGVPIPSVKYILISHHHSDHNLEYGNL
FT                   VYNAWAAGLSTPIQSFGPKGLEAMTRSFWETNKFDVDTRIGDEGRPDPRPLLIAKDIDA
FT                   DGVVVKTADVTVTAFRTPHPPITDNFAYKFETPDGTIVFSSDTAYNPKLAEFARGADVL
FT                   VHECLYVPAVDRLVIKTKNGATLKKHLLESHTTTEDVGRIAAAAGVKALVLSHFVPGDD
FT                   PEVTDEDWTRDVKKNYSGRIVVAKDLMELKLPV"
FT   gene            complement(218239..219015)
FT                   /locus_tag="BBta_0211"
FT   CDS_pept        complement(218239..219015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0211"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32508"
FT                   /db_xref="GOA:A5E8L4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8L4"
FT                   /protein_id="ABQ32508.1"
FT                   /translation="MSLSGLIPADLSLFAAVALAVVALIAATARGFSGFGAALIFMPLA
FT                   SSFATPRLVAPLLLVIDFVSMAPTVPAAWHEADRRATAVIVAGALVGVPLGTWFLTRLD
FT                   PVTVRWIITGFVVALLALLISGWRYRGKDYAALSVAVGAVSGFCSGVAQTGGPPIVGYW
FT                   LGRPIAPKVARANIVLFFGASDCFAMVSYAASGLITWDSLKLSLLIGPVYALGVALGAS
FT                   LFGRASEQMFRVICYALIAIAVIAGLPALDGVLGRG"
FT   gene            complement(219012..221420)
FT                   /gene="pheT"
FT                   /locus_tag="BBta_0212"
FT   CDS_pept        complement(219012..221420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="BBta_0212"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /function="Amino acid-activation; Cytoplasm"
FT                   /EC_number="6.1.1.20"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32509"
FT                   /db_xref="GOA:A5E8L5"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8L5"
FT                   /protein_id="ABQ32509.1"
FT                   /translation="MKFTLSWLKDHLDTDESVETLANKLTMIGLEVEHLEDKAKLLAPY
FT                   KIARVVSAEQHPNADRLRVCMVDTGDGGAPVQVVCGAPNARAGLISVFSPPGTYIPGKN
FT                   ITLSVGTIRGVESRGMLCSAAELQISDDHDGIMELPADAPIGKPYAEWAGLGDPQFEIN
FT                   LTPNRQDCTGVHGIARDLAAADMGKLNDPAIKPIKGEFPCPVKVAVEDERLCPGFALRL
FT                   VRGVKNGPSPAWLQQRLTSIGLRPINALVDITNYMTFDRARPLHVFDAKKVKGNLVVRR
FT                   ARDGETLLALDGRTYTLDSSMCVIADDAGVESLAGIMGGEASGCDETTTDVLIESALWN
FT                   EINIAQTGRKLGINSDARYRFERGVDPAFMVPGLELATKLVLELCGGTPSENVVLGNRF
FT                   GDDRIIDFPLTEVKRLAGIEVSLTEMRRILTHLGFVVAGAGPVVKVAVPSWRSDVHGKA
FT                   DIVEEIVRMVGVDKVPMTPFERGDAPRKPVLTPLQLRTRRAKRALAARGMVEAVTWSFI
FT                   SKPAAELFGGGKAELALANPIAADLSDMRPSLLPGLIATVQANADRGFGDAAIFEVGQV
FT                   FKGDRPEDQFVAASGIRRGIASSNGLGRHWTGSQAANAYDAKADALAVLAAAGAPMASL
FT                   QIVAGGPAWMHPGRSGTIQMGPQNVLGHFGELHPRALEALKADGPLVAFEVILDRIPAA
FT                   KAKPTRAKPVLELSAFQPVSRDFAFIVDRKVKAGDIVRAAQGVDKKLITDVTVFDVYEG
FT                   KGIEDGKKSIAIAVTLQPRDKTMTDEEIDAVAAKITADVGKKTGGTLRG"
FT   gene            complement(221439..221858)
FT                   /locus_tag="BBta_0213"
FT   CDS_pept        complement(221439..221858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0213"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32510"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8L6"
FT                   /protein_id="ABQ32510.1"
FT                   /translation="MDDDKPTWKVSQKLRSNARALRQNSTDAEQILWSELRGHRLLGAG
FT                   FRRQAPVDRYIVDFVCHAARLVIELDGGQHFSTEGEQRDAARSAVIEAKGFHILRFANN
FT                   DVLANRAGVLETIAAAVAARAPTLTLPRKRGREQD"
FT   gene            complement(221957..223039)
FT                   /gene="pheS"
FT                   /gene_synonym="phe-act"
FT                   /locus_tag="BBta_0214"
FT   CDS_pept        complement(221957..223039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /gene_synonym="phe-act"
FT                   /locus_tag="BBta_0214"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /function="Amino acid-activation; Cytoplasm"
FT                   /EC_number="6.1.1.20"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32511"
FT                   /db_xref="GOA:A5E8L7"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8L7"
FT                   /protein_id="ABQ32511.1"
FT                   /translation="MSDLASLETSILDQIAAAGDEAALEAVRVAALGKKGSISALLATL
FT                   GKMSPDERKTQGAAINLAKDKVTQALAARRDVLKAAALDARLAAETIDVTLPLQDSPAE
FT                   TGRIHPLSQVMDELTTIFADMGFSIAEGPDVETDDYNFTKLNFPEGHPAREMHDTFFFN
FT                   PKPDGSRMLLRTHTSPVQVRTMLTQKPPIRVICPGRTYRIDSDATHTPQFHQVEGLVID
FT                   KGSHLGHLKWILHEFCKAFFEVDHINMKFRPSFFPFTEPSLEVDIQCRRDKGEIRFGEG
FT                   EDWLEILGCGMVHPNVLRACGIDPDEYQGFAWGMGIDRIAMLKYGMSDLRQLFEGDVRW
FT                   LSHYGFKPLEVPTLAGGLST"
FT   gene            complement(223182..223541)
FT                   /gene="rplT"
FT                   /gene_synonym="pdzA"
FT                   /locus_tag="BBta_0215"
FT   CDS_pept        complement(223182..223541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /gene_synonym="pdzA"
FT                   /locus_tag="BBta_0215"
FT                   /product="LSU ribosomal protein L20P"
FT                   /function="Translation; Ribosomal proteins; Regulation
FT                   level unknown; Ribosome; Cytoplasm"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32512"
FT                   /db_xref="GOA:A5E8L8"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8L8"
FT                   /protein_id="ABQ32512.1"
FT                   /translation="MSRVKRGVTAHAKHKKVFKAAKGYYGRRKNTIRTAKQAVEKAGQY
FT                   AFRDRKRKKRTFRALWIQRLNAAVRPFELTYSRFIDGLSKSGITVDRKVLSDLAINEPA
FT                   AFQAIVEKAKAALAA"
FT   gene            complement(223619..223819)
FT                   /gene="rpmI"
FT                   /locus_tag="BBta_0216"
FT   CDS_pept        complement(223619..223819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="BBta_0216"
FT                   /product="LSU ribosomal protein L35P"
FT                   /function="Translation; Ribosomal proteins; Ribosome;
FT                   Cytoplasm"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32513"
FT                   /db_xref="GOA:A5E8L9"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8L9"
FT                   /protein_id="ABQ32513.1"
FT                   /translation="MPKLKTKSGAKKRFKVTATGKVMHAQRGKRHGMIKRTKKQIRQLR
FT                   GTRVLFKTDGDNVKKYFLPNA"
FT   gene            224079..224450
FT                   /locus_tag="BBta_0217"
FT   CDS_pept        224079..224450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0217"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32514"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8M0"
FT                   /protein_id="ABQ32514.1"
FT                   /translation="MARVIPSAAIAAVLTAGLALLHPLPAHAAGFDGPWTVLIITEAGN
FT                   CDQGYSFPIQISGGRVLSTGSANITGSVGRGGAVTVRVSQGGSSASGNGRLGATSGFGR
FT                   WSGKGSAGTCSGRWQATRS"
FT   gene            complement(224542..225144)
FT                   /gene="infC"
FT                   /gene_synonym="fit"
FT                   /gene_synonym="srjA"
FT                   /locus_tag="BBta_0218"
FT   CDS_pept        complement(224542..225144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /gene_synonym="fit"
FT                   /gene_synonym="srjA"
FT                   /locus_tag="BBta_0218"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /function="Translation; Cytoplasm"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32515"
FT                   /db_xref="GOA:A5E8M1"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8M1"
FT                   /protein_id="ABQ32515.1"
FT                   /translation="MPAKAYSFKLAAFFHNLGELPIRRPNRAPPAAVKDGPRTNDEIRN
FT                   AQIQLIDAEGTNRGVVETVVAIKMAAEAGMDLVEISPNNSPPVCKIMDYGKYKYSAQKK
FT                   AAEARKKQKVVEIKEIKLRPMIDDHDYDVKMRAMQRFFEEGDKVKITLRYRGREMAHQE
FT                   IGTKLLDKVKSDVAAFAKVEQDAKFEGRQVVMVLAPR"
FT   gene            225407..226192
FT                   /locus_tag="BBta_0220"
FT   CDS_pept        225407..226192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0220"
FT                   /product="hypothetical protein"
FT                   /note="alpha/beta hydrolase superfamily domain; Evidence:
FT                   Similar to previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32516"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8M2"
FT                   /protein_id="ABQ32516.1"
FT                   /translation="MNHAVESADLPAFIAVGAGEQSRQIAVRARTGHPPGLFWLGGFNS
FT                   DMKGTKALALDAWAAERGRACVRFDYSGHGESGGRFVDGTISRWLEESVAVFRQFCRGP
FT                   QVVIGSSMGGWMALLLARELLRQPAEATLAGLVLIAPAPDFTEELMWKGFSAEIRREIE
FT                   ANGVWMRPSEYGEPYPITKVLIEDGRNHLLLGGAITVGCPVRILQGAQDPDVPWQHAFA
FT                   LAHRLPAEDVVLTMIQDGDHRLSRPQDIARMLAAVGEIG"
FT   gene            complement(226202..227179)
FT                   /locus_tag="BBta_0221"
FT   CDS_pept        complement(226202..227179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0221"
FT                   /product="hypothetical protein"
FT                   /note="iron-sulfur cluster binding protein domain;
FT                   Evidence: Similar to previously reported genes of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32517"
FT                   /db_xref="GOA:A5E8M3"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8M3"
FT                   /protein_id="ABQ32517.1"
FT                   /translation="MDWLAREPSRRTDPRTLWSEVRSVVMLGVNYGPDDDPCTILAERS
FT                   RAAISVYARGDDYHDVIKKNLKALARWLVAQAGCDVKVFVDTAAVMEKPLAESAGLGWQ
FT                   GKHTNLVSRGFGSWLFLGAIYTTLTLPADAPEHDHCGSCRACLDSCPTAAFPAPYSLDA
FT                   RRCISYLTIENKGPIPREFRNAMGNRIYGCDDCLAACPWNKFAQAGREAKLAARDALRA
FT                   PSLAELAALDDAAFRALFTKSPIKRIGRDRFLRNVLIAIGNSGDAALTPAVERLTADPT
FT                   PLVRGAAAWALAQLLDADAYARRAATALACESDDSVRAEWRTPC"
FT   gene            complement(227335..228027)
FT                   /locus_tag="BBta_0222"
FT   CDS_pept        complement(227335..228027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0222"
FT                   /product="putative Glutathione S-transferase family
FT                   protein"
FT                   /EC_number="2.5.1.18"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32518"
FT                   /db_xref="GOA:A5E8M4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8M4"
FT                   /protein_id="ABQ32518.1"
FT                   /translation="MYTLFHHPFCPHSRFVRLVLGEYGLDLRLVEERAWERREAFLVLN
FT                   PAGTTPVLSVEGQPAVPGVGVIAEFLDETCGPDMGDRRLMPTSPAERIEVRRLMDWFNT
FT                   KFFEEASNLLVTERIYKRFMSEEDGGGPPSTDVIRAAKTNVRYHLAYIGWLAQRRNFLA
FT                   GDRLTYADLAAAAHLSAIDYLGDVPWIEDDAAKAWYARVKSRPSFRPLLSDWLAGVPAS
FT                   RTYVDLDF"
FT   gene            228364..229170
FT                   /gene="uppP"
FT                   /gene_synonym="bacA"
FT                   /gene_synonym="upk"
FT                   /locus_tag="BBta_0223"
FT   CDS_pept        228364..229170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppP"
FT                   /gene_synonym="bacA"
FT                   /gene_synonym="upk"
FT                   /locus_tag="BBta_0223"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /function="Drug resistance/sensitivity; Membrane; Inner
FT                   membrane; Peptidoglycan (murein)"
FT                   /EC_number="3.6.1.27"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 5 : Inner
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32519"
FT                   /db_xref="GOA:A5E8M5"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8M5"
FT                   /protein_id="ABQ32519.1"
FT                   /translation="MMSDTLRAVLLGIIEGVTEFLPVSSTGHLLLAERFFGLGEDGFWK
FT                   SFAILIQLGAILAIVALYFFKLSRVAIGALSNADDRRFIIGVLIAFLPAVIIGLIAGKY
FT                   IKALLFDPWVVCFSLIVGGAILLWVDQIDLKPREHDATRYPLLMYLWIGVAQCLAMIPG
FT                   VSRSGATIVAAMLLGGDKRSAAEFSFFLAIPTMVGAFVYDFYKSRAEMTSDHLGLVAIG
FT                   FVVSFITAMIVVKAFLGYVTRHGFVLFAWWRVIVGTLGLIALALGK"
FT   gene            complement(229290..230258)
FT                   /locus_tag="BBta_0224"
FT   CDS_pept        complement(229290..230258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0224"
FT                   /product="hypothetical protein"
FT                   /note="NAD dependent epimerase/dehydratase family domain;
FT                   Evidence: Similar to previously reported genes of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32520"
FT                   /db_xref="GOA:A5E8M6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8M6"
FT                   /protein_id="ABQ32520.1"
FT                   /translation="MASNLDTLVTVFGGSGFVGRNVVRALAKRDYRIRVAVRRPELAGH
FT                   LQPLGRVGQIHTVQANLRYPESVAAALRDSHVAINLVGILTESGAQTFEAVQAEGAANV
FT                   AKAAAAAGARLVHVSAIGADAESTASYARAKAAGEAAALAAVPEAVIMRPSVVFGPEDQ
FT                   FTNRFAGLARISPFLPLIGGGETKMQPVYVGDVATAVADAVDGKAQAGATYELGGPEVL
FT                   SFREILKIILDITDRDRALLPLPFGLARLQAALLQFAPGPLKLTPDQVELLRSDNVVSE
FT                   TAKAAGLTLQGLGITPDSLEAIGPQYLWRFRPAGQFQRKNA"
FT   gene            230495..230581
FT                   /locus_tag="BBta_tRNA2"
FT   tRNA            230495..230581
FT                   /locus_tag="BBta_tRNA2"
FT                   /product="tRNA-Leu"
FT                   /note="Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT   gene            complement(230793..231551)
FT                   /locus_tag="BBta_0225"
FT   CDS_pept        complement(230793..231551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0225"
FT                   /product="putative 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase 1 (fabG1)"
FT                   /function="Fatty acid and phosphatidic acid"
FT                   /EC_number="1.1.1.100"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32521"
FT                   /db_xref="GOA:A5E8M7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8M7"
FT                   /protein_id="ABQ32521.1"
FT                   /translation="MTKRKRIAWITGGGTGIGEAGALALAADGWTVIVSGRRKAALETV
FT                   AAKIAAAGGTAEAVPLDVAKAAEVQAAADAILARHGRIDLLVNSAGVNVPKRRWDDMTL
FT                   DGWNQLVEINLNGVLYCMKAVLPAMRAQADGTIINVSSWAGRHVSKMPGPAYTSTKHAV
FT                   LALTHSFNMEECMHGLRACCLMPGEVATPILEQRPVVPSAEEQARMLQPEDLGRTIAFV
FT                   ANMPPRVCVNEILISPTWNRGFIQTPANRD"
FT   gene            231731..233257
FT                   /locus_tag="BBta_0226"
FT   CDS_pept        231731..233257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0226"
FT                   /product="putative O-succinylbenzoate--CoA ligase (menE)"
FT                   /function="Menaquinone (MK), ubiquinone (Q)"
FT                   /EC_number="6.2.1.26"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32522"
FT                   /db_xref="GOA:A5E8M8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8M8"
FT                   /protein_id="ABQ32522.1"
FT                   /translation="MNQTANANLFARLFDGLDDPSRLAIETHDGQRITYGDLIARAGQM
FT                   ANVLVSRGVKPGDRVAAQTEKSVSGLVLYLATVRAGGVYLPLNTAYTLNELDYFIGDAE
FT                   PTVVVCDPAKAEGIRTLAAKVGATVDTLDASGKGSLTEAADKAATAFTTVPRGADDLAA
FT                   ILYTSGTTGRSKGAMLSHDNLASNSLTLIDYWRFTKDDVLIHALPIYHTHGLFVASNVT
FT                   LFARASMIFLPKLDPDLIINLMARATVLMGVPTFYTRLLQNPRLNKETTSHMRLFISGS
FT                   APLLADTHREWFARTGHAVLERYGMTETNMNTSNPYDGERVPGAVGFPLPGVSVRVTDP
FT                   ETGKELARDEIGMIEVKGPNVFKGYWRMPEKTKSEFRPDGFFITGDLGKIDTQGYVHIV
FT                   GRGKDLVISGGFNVYPKEIESEIDAMPGVVESAVIGVPHADFGEGVTAVVVRHPGADVN
FT                   EASVLKGLDGRLAKFKMPKRVFVVDELPRNTMGKVQKNVLRDQYKDIYTK"
FT   gene            complement(233264..233521)
FT                   /locus_tag="BBta_0227"
FT   CDS_pept        complement(233264..233521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0227"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32523"
FT                   /db_xref="GOA:A5E8M9"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8M9"
FT                   /protein_id="ABQ32523.1"
FT                   /translation="MPVPTVRPTTTERPAALPARQASSHEPAEEPLTCILGFTAAGLFA
FT                   ACLALAIQHEVASFAVLELILICAAPPLAALVGLRIGRRR"
FT   gene            234160..234495
FT                   /gene="sdhC"
FT                   /gene_synonym="cybA"
FT                   /locus_tag="BBta_0228"
FT   CDS_pept        234160..234495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /gene_synonym="cybA"
FT                   /locus_tag="BBta_0228"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /function="Tricarboxylic acid cycle; Aerobic respiration;
FT                   Electron donor; Electron carrier; Cytochromes; Membrane;
FT                   Inner membrane"
FT                   /EC_number="1.3.5.1"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 6 : Inner
FT                   membrane-associated"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32524"
FT                   /db_xref="GOA:A5E8N0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8N0"
FT                   /protein_id="ABQ32524.1"
FT                   /translation="MILSIVHRATGVALYFGTLLLAWWLIAAASGPSAYSYVQGFMGSF
FT                   LGRLIMFGYTWALLHHLLSGIRHFVWDLGYGFKPNERETLTWGALIGGITLTVLVWIVA
FT                   YAVGGGR"
FT   gene            234516..234890
FT                   /gene="sdhD"
FT                   /locus_tag="BBta_0229"
FT   CDS_pept        234516..234890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="BBta_0229"
FT                   /product="succinate dehydrogenase subunit D"
FT                   /function="Tricarboxylic acid cycle; Aerobic respiration;
FT                   Electron donor"
FT                   /EC_number="1.3.5.1"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 6 : Inner
FT                   membrane-associated"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32525"
FT                   /db_xref="GOA:A5E8N1"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8N1"
FT                   /protein_id="ABQ32525.1"
FT                   /translation="MRTPLGRVRNLGAAHSGTSDFWRQRITAVAMTLLIVPVVVVVIML
FT                   LGRNQAGAAQILGSLPIALIMLLFVIASCWHMKIGMQVVIEDYVHSEPLKLVAIMANNF
FT                   FAVTVALASIYALIKLSTGV"
FT   gene            234894..236729
FT                   /gene="sdhA"
FT                   /locus_tag="BBta_0230"
FT   CDS_pept        234894..236729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="BBta_0230"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /function="Tricarboxylic acid cycle; Aerobic respiration;
FT                   Electron donor; Cytoplasm"
FT                   /EC_number="1.3.5.1"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 6 : Inner
FT                   membrane-associated"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32526"
FT                   /db_xref="GOA:A5E8N2"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8N2"
FT                   /protein_id="ABQ32526.1"
FT                   /translation="MAGGANGSANGAPATNGKAYPIEDHTYDVVVVGAGGAGLRAVVGC
FT                   SEAGLRTACITKVFPTRSHTVAAQGGISASLGNMHQDDWRWHMYDTVKGSDWLGDQDAI
FT                   EYMVRNAPDAVYELEHWGVPFSRTEDGKIYQRPFGGMTIDFGKSQAQRTCAAADRTGHA
FT                   MLHTMYGQSLRHAAEFFIEFFAIDLIMDDQGVCRGVIALKLDDGTLHRFRAQTTILATG
FT                   GYGRAYASCTSAHTCTGDGGGMALRAGLPLQDMEFVQFHPTGIYGSGCLVTEGARGEGG
FT                   YLVNAEGERFMERYAPSAKDLASRDVVSRAMTIEIREGRGVGKKKDHIFLHLDHLDPKV
FT                   LAERLPGISESAKIFANVDVTREPIPIVPTVHYNMGGIPTNYHAEVLTKKDGDDNAIVP
FT                   GLMAVGEAACVSVHGANRLGSNSLIDLVVFGRAAALRLAEKLTPNGKQPDLPKDSADMA
FT                   LSRLDRYRYASGGTPTAKLRESMQHVMQTNCAVFRTGEVLQEGHNLIHKVHGGIGDIAV
FT                   SDRSLVWNSDLIETLEFDNLIAQAVVTMDSAANRTESRGAHAREDFPDRDDKNWMKHTL
FT                   AWIDQNGQTTIDYRPVHNYTMTNDVQYIPPKARVY"
FT   gene            236763..237545
FT                   /gene="sdhB"
FT                   /locus_tag="BBta_0231"
FT   CDS_pept        236763..237545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="BBta_0231"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /function="Tricarboxylic acid cycle; Aerobic respiration;
FT                   Electron donor; Cytoplasm"
FT                   /EC_number="1.3.5.1"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 6 : Inner
FT                   membrane-associated"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32527"
FT                   /db_xref="GOA:A5E8N3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8N3"
FT                   /protein_id="ABQ32527.1"
FT                   /translation="MAEFALPKNSQITGGKTWPKPVGATEVREFKVYRWNPDDGKNPSV
FT                   DTYYVDVNDCGPMVLDGLIWIKNHIDPSLTFRRSCREGVCGSCAMNIDGQNTLACTKSM
FT                   HDVKDGAVKINPLPHQPVVKDLVPDLTNFYAQYASIEPWLKTTSPTPQKEWRQSHEDRE
FT                   KLDGLYECILCACCSTSCPSYWWNSQRYLGPAALLQANRWVKDSRDEATGERLDNLEDP
FT                   FRLYRCHTIMNCAKACPKGLNPAEAIAELKLKLVERQI"
FT   gene            237677..239827
FT                   /locus_tag="BBta_0232"
FT   CDS_pept        237677..239827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0232"
FT                   /product="putative sensor histidine kinase with a Response
FT                   regulator receiver domain"
FT                   /function="Two-component regulatory systems (external
FT                   signal)"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32528"
FT                   /db_xref="GOA:A5E8N4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8N4"
FT                   /protein_id="ABQ32528.1"
FT                   /translation="MQTAQRKSLIMLRWMMVASLALPVALFLVAAYVSYGSTCEEADRD
FT                   IRRSLDVVHEHAEKVFETIDRSLSEIDEIVRDLSDAEIKAREQALHGRLRQLSDTLPQM
FT                   KSAWVFDVQGRPLVSSMIYPAPDMIFADRDYFSAHVTTNAGSFVGAALTPRPPDHGAAF
FT                   FSVSRRRQSADGRFTGVIQASVLPDYFEHFYARIGRAPGSYFALRRFDGLVLARFPAAQ
FT                   RSAGPPPNDVPAAAADTEQLVTETSPIDGLERRVGYQRLAGFPVYVSAGLETATIRDRW
FT                   LGTMGRHLIFGIPATALLVVFLAMARRRTERFYIEAARRLEAEDALRHGQRMEALGQLT
FT                   GGVAHDFNNLLTVIRASADLLRRANLPEERRLRYIDAISDTVARASKLTSQLLAFARRQ
FT                   TLKPEVFDISRSVVTLRDMVKTLVGSRIEIVTSVPDEPCYVNADAGQFETALINMAVNA
FT                   RDAMAGQGQLVISVTAASDLPTPAAPQERPPLGYVALAVQDTGIGIPQQQFSRIFEPFF
FT                   TTKTIGQGTGLGLSQVFGFAKQSGGEIGVTSELGKGTTFTLYLPRVAPAEQPRGDAGGH
FT                   AVPIGGRGMAVLVVEDNIDVGRSATEALAELGYLTTLVDNARDALEELIDGGSRFDVVF
FT                   TDVVMPGMTGLELAEEIRRLELNIPIVLASGYSHVLAQQGTNGFELLRKPYSIEELSRV
FT                   LHKVVPVPLHRAPPVAPSSEMR"
FT   gene            239885..241840
FT                   /locus_tag="BBta_0233"
FT   CDS_pept        239885..241840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0233"
FT                   /product="putative ABC transporter (fused ATP-binding and
FT                   permease components)"
FT                   /function="ATP binding and membrane component"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32529"
FT                   /db_xref="GOA:A5E8N5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8N5"
FT                   /protein_id="ABQ32529.1"
FT                   /translation="MGQVQDIARPAVSSADEAPIIEIAAENGAQVEPPPPEVVEPDPEL
FT                   SPEEAEQVRKRYLLTRFWISAHGYWGAAGDRLAWPFTIGLLTPIVGTVAFQYGINVWNR
FT                   SIFDAIEKRDSATVFHLTAIFFPLAIGSVILAVAQVYARMAIQRRWRAWLTNSIITRWL
FT                   ASGRYYQLNLVSGDHKNPEYRIAEDLRIATDSPVDFVAGVTSALLSAATFIVVLWTIGG
FT                   ALTLRLGGTELTIPGFLVLAAVIYAAIASGSIVTIGRRFVQTSEDKNQAEADFRYALTR
FT                   VRENGESIALLGGEAEERAGIDRTFGNVLGQWARLAGQHMRTTLVSQGSSLIAPVVPLL
FT                   LCAPKFLDGSMTLGQVMQAASAFTIVQTAFGWLVDNYPRLADWNACARRIASLMMSLDA
FT                   LERAERGDGLGRIKHGETTGDAMLSLNDLSVTLDDGTAVVGETEVVVDPGERLLVAGES
FT                   GTGKSTLVRAIAGLWPWGGGSINFHPDRRLFMLPQRPYVPSGSLRRAVAYPGAAEDWPV
FT                   EQVADALHKVGLDHLKDRIEEEAPWDQTLSGGEKQRLAFARLLLHSPDIVVLDEATSAL
FT                   DEKSQDRMMQVVTSELPKATIVSVAHRAELEAFHSRKIVLERRKGGAKLVSDIDLIPRK
FT                   GKRRLIGRFLRQRKQL"
FT   gene            241978..242805
FT                   /locus_tag="BBta_0234"
FT   CDS_pept        241978..242805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0234"
FT                   /product="hypothetical protein"
FT                   /note="methyltransferase domain; Evidence: Similar to
FT                   previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32530"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8N6"
FT                   /protein_id="ABQ32530.1"
FT                   /translation="MTPDNDPSPAPFGAFAPNAAQALVVRVARGSGLKRGAFRPMLTRI
FT                   VNLLRAGPLDVDYQGARFRFHHQVSATERGALFNPEYNREELDFLRSHIPPGGVAVDVG
FT                   ANVGTFALPLARHVGPTGLVIAIEPHPVTHARLAFNRDASALPQVKLFAVAAGDSDGEV
FT                   MIETDGVNLGASHIVVGAAGSEAIKVPSLRLQAILEQAGATRIDALKIDVEGFEDRVLT
FT                   CFFRHAPDLLWPRAVVIEHLSRDEWQNDCLADMIGRGYREIGRTRSNTLLLRG"
FT   gene            242891..243376
FT                   /locus_tag="BBta_0235"
FT   CDS_pept        242891..243376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0235"
FT                   /product="hypothetical protein"
FT                   /note="general stress protein 26 domain; Evidence: Similar
FT                   to previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32531"
FT                   /db_xref="GOA:A5E8N7"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8N7"
FT                   /protein_id="ABQ32531.1"
FT                   /translation="MSNNDMRDQDRAWDLMKKIGFAMLVTRDGNKLRARPMSAYLARDE
FT                   NMIYFLTDARHHKDEEIARNPQVNLSFADAGSQTYVSLTGTAAVSNDRNKIRDLFTTTA
FT                   KAWWDSAEDPNIRLLKITPDDAEFWDSPGTVVSYVKMAAAAVTGTRPDIGDNRKVSM"
FT   gene            243376..243594
FT                   /locus_tag="BBta_0236"
FT   CDS_pept        243376..243594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0236"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32532"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8N8"
FT                   /protein_id="ABQ32532.1"
FT                   /translation="MPIEPPEIPPATPGRPMEPPPEDPLGNPNPEVPPPMHEPDMPAPP
FT                   RELPGETPSEVPARGPQGPTTPNPATD"
FT   gene            243928..246111
FT                   /locus_tag="BBta_0237"
FT   CDS_pept        243928..246111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0237"
FT                   /product="putative exported protein of unknown function
FT                   with OmpA family domain"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32533"
FT                   /db_xref="GOA:A5E8N9"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8N9"
FT                   /protein_id="ABQ32533.1"
FT                   /translation="MVVAQGPGGGEVGPDGRPKQQPQGQPQRPGPGAPPPHQAAPPPPP
FT                   APPPAAAPRPAPPPPAPPPAAAPRPAPAPPPPPPPPRAEPPRPAPPPPPPPPRAEPPRP
FT                   AAPPPPPPPPRAEPPHAAPPPSRAEPPAPPPSRPAPPVAAPPVHTPPPPAPPPASPHEP
FT                   ARPATPPAPPPAAAPVRPTPPTPPAATPAPPPPSSSAPNQRPGTPPSPVTPPPSPPAAG
FT                   NAPPPAHTPPRSAAPSPQPTPAPTPPGGPGQRPPIQPGAGAPPPGAPQGAPPPRGAPTP
FT                   PAGTVAPGPGTPPSPATPPAAQTPPPNAQPGTPSPGPRPGTPPTPPPAAGPGPAAGPGA
FT                   AGPGPGTAAPGPGGPAATPAPGPGSGPGAGAQGAVPPAGPPAMTNRPPPQVAAPIPAPP
FT                   PPSPQQLTPIAPGAPLVGPQRLEDFRGQRREVQEGGRTLIYEPGRVIVRDPGGQEFVRH
FT                   DELERFRYGARDIRVMREDRGETRTVVIRPDGSQIVTITAPDGRLLRRIRRDIGGREII
FT                   IIDNTYRDPQAVGGFYVDLPPPEIRIPYNRYIVDAEEAPPDVIYDTLVAPPVERVQRRY
FT                   SLDEVRYSPSVRQLMPSIDLNTITFETGSWEIGPDQVAKLQVIADGLNQAIQRNPREVF
FT                   LIEGHTDAVGNETDNLSLSDRRAESVATLLTQQFGVPAENLTSQGYGEQYLKEQTQGPS
FT                   RINRRVTVRRITPLLNGGQAALPPPPPGIAPPR"
FT   gene            complement(246354..247691)
FT                   /gene="argG"
FT                   /gene_synonym="Arg6"
FT                   /gene_synonym="argE"
FT                   /locus_tag="BBta_0238"
FT   CDS_pept        complement(246354..247691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /gene_synonym="Arg6"
FT                   /gene_synonym="argE"
FT                   /locus_tag="BBta_0238"
FT                   /product="argininosuccinate synthase"
FT                   /function="Arginine; Cytoplasm"
FT                   /EC_number="6.3.4.5"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32534"
FT                   /db_xref="GOA:A5E8P0"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8P0"
FT                   /protein_id="ABQ32534.1"
FT                   /translation="MTTILKGLPKGEKVGIAFSGGLDTSAALLWMKQKGARCFAYTANL
FT                   GQPDESDYDEIPRKAMSFGAEKARLVDCRTQLVHEGIAAIQSGAFHISTGGATYFNTTP
FT                   LGRAVTGTMLVAAMKEDGVNIWGDGSTYKGNDIERFYRYGLLTNPNLKIYKPWLDQQFI
FT                   DELGGRAEMSAFLTANGFDYKMSAEKAYSTDSNLLGATHEAKDLENLNSGIRIVNPIMG
FT                   VPFWREDCVVKPETVVVRFEEGQPVALNGQTFTDPVALFLEANAIGGRHGLGMCDQIEN
FT                   RIIEAKSRGIYEAPGMALLHIAYERLLTGIHNEDTIEQYRINGLRLGRLLYQGRWFDSQ
FT                   ALMLRETAQRWVASAITGEVTLELRRGNDYSLLNTESPNLTYQPERLSMEKVEDAAFTP
FT                   ADRIGQLTMRNLDITDTRTKLKLYSETGLLTGSEGAQIFQLGHDKG"
FT   gene            complement(247784..248569)
FT                   /locus_tag="BBta_0239"
FT   CDS_pept        complement(247784..248569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0239"
FT                   /product="putative membrane protein of unknown function
FT                   with phosphatase domain"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32535"
FT                   /db_xref="GOA:A5E8P1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8P1"
FT                   /protein_id="ABQ32535.1"
FT                   /translation="MNRTGLFIALSLALVIGVLFGVYPELDLKLAALFYDPHTRSFPLK
FT                   LDGYAAFARDAAMWVAWGLALPSLVALVVKLIRPDRPLLIRGRTVAFLLLTLSLSAGVL
FT                   TNFTFKSYWGRPRPVVVTEFGGDMQFVPWWDPRGGCGRNCSFFSGEGATAFWTLAPAAL
FT                   TPPAVRPIAYGAAVLFGLATSVLRMAFGGHFFTDVAAAGLVTFLVIWLTHGYIYRWPST
FT                   RLTDAGIDAALTRFAWPGFRLMRRLFRSRRRTAGANPAA"
FT   gene            complement(248615..249100)
FT                   /locus_tag="BBta_0240"
FT   CDS_pept        complement(248615..249100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0240"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32536"
FT                   /db_xref="GOA:A5E8P2"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8P2"
FT                   /protein_id="ABQ32536.1"
FT                   /translation="MALIGRLVVIAFAFLVACFVAGLVVVTAILFPELSDLGIAPIDQS
FT                   AFQIVIGFGFIFVSGFALIPAMLIALITEALSIRSVLAYAIGGGLVGAACYLGLIPFDP
FT                   ETFRFDSIDHRQFEILSGAGILGGLVYWLIAGRNAGRWREPPPAFPPPPPLPSGSPR"
FT   gene            complement(249265..250476)
FT                   /locus_tag="BBta_0241"
FT   CDS_pept        complement(249265..250476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0241"
FT                   /product="23S rRNA m(2)A-2503 methyltransferase"
FT                   /function="Inhibition / activation of enzymes"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32537"
FT                   /db_xref="GOA:A5E8P3"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8P3"
FT                   /protein_id="ABQ32537.1"
FT                   /translation="MARTAGLREPAAPLEKTPLETYVPPAKPSLIGLSRAELAARLGDV
FT                   GVPERQQKMRVQQLWHWIYFRGARSFDEMSSVSKDTRTALAERFTVDRPEVVAEQISND
FT                   GTRKWLLRLPSGDDLQKAHEVECVYIPETDRGTLCVSSQVGCTLNCAFCHTGTQRLVRN
FT                   LTAGEIVGQVMVARDRLNDWADRETPHGNRLITNIVMMGMGEPLYNFDAVRDALLIVSD
FT                   NEGIGISRRRITLSTSGVVPNIKRAGEEIGVMLAISLHAVRDELRDELVPLNRKYPIAE
FT                   LLQACRDYPGASNARRITFEYVMLKGVNDSLDDARLLVKLLKGIPAKINLIPFNPWPGS
FT                   AYECSDWEQIEKFSEYVFNAGYSSPVRTPRGRDILAACGQLKSETEKLSARERQALRAM
FT                   AMTD"
FT   gene            complement(250593..251153)
FT                   /locus_tag="BBta_0242"
FT   CDS_pept        complement(250593..251153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0242"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32538"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8P4"
FT                   /protein_id="ABQ32538.1"
FT                   /translation="MALAQTAAPKAGAKAAAPQPKASPKTEAKPTVPNIGGVEPTLIGQ
FT                   FGGWGAYTAAPGGKKVCFALAKPASSKTNPANRPRDPAYAFVSTRPAEKVINEVSIMIG
FT                   YALKPGSEATLDVGGASYAMYTQGDGLWIKNAAEEERMVDAMRKAPEAVVKGVSAKGTE
FT                   TTDVFSLKGLAQALDRIAQDCRR"
FT   gene            251554..252528
FT                   /locus_tag="BBta_0243"
FT   CDS_pept        251554..252528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0243"
FT                   /product="putative quinone oxidoreductase (NADPH) and
FT                   Zn-dependent alcohol dehydrogenase"
FT                   /EC_number="1.6.5.5"
FT                   /EC_number="1.1.1.1"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32539"
FT                   /db_xref="GOA:A5E8P5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8P5"
FT                   /protein_id="ABQ32539.1"
FT                   /translation="MKAILCSQFCQPDDLVLADVPDPVAGPGEAVIAIKAAALNFFDIL
FT                   MIQGKYQMKPPFPFSPGAEVAGVIESVGEGVTDLKAGDRVVASCGHNGARQKIALPAAA
FT                   IVKIPDNLDFDRAAGIIIIYGTALHALEDRASPKPGETLAVLGAAGGTGLAACELGKLM
FT                   GLKVIACASSDEKLEFARQHGATLTLNYAKEDLKEGLRRLTDGKGADIIFDPVGGTYAE
FT                   AALRSIAWEGRFLVIGFAAGDIPKMPLNLALLKGCDIRGVFWGAWTRLNPEKNRANLEK
FT                   LVQWTAEGKLSSHVDRTFPLAQTADALKVLAGRQAMGKVILHP"
FT   gene            253075..254070
FT                   /locus_tag="BBta_0244"
FT   CDS_pept        253075..254070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0244"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32540"
FT                   /db_xref="GOA:A5E8P6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8P6"
FT                   /protein_id="ABQ32540.1"
FT                   /translation="MAERTTRGRFEDRNQPESGFGPFPDDPPPERNRTYRFGRSAQDNY
FT                   PADESMPMFLSEYESGHPIESTQFEEQWPARARRTSISSRILLAVLAAAGVAMLFALVT
FT                   SDATRDLIATAKASIIGSTPDPTAPPQPSGTQLTARDMQLNEPARLPPEVSAAASPVQT
FT                   AAVAPSRDDIANAYQTALQNRVVTQPAPAAPNAAAAPAGPSAMAPSSITSPGAGAAIVA
FT                   PGLGAVTAAPPPVQTRRLEPDELAGIMKRAKGLLAAGDIPSARLLLERAAEAQEPAAAL
FT                   MLAQTYDPHVLGTKDIRNINADPTAARNWYRRAAQLGSSEAQRRLDQLQN"
FT   gene            254213..255388
FT                   /locus_tag="BBta_0245"
FT   CDS_pept        254213..255388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0245"
FT                   /product="putative exported protein of unknown function
FT                   with TRAP-type uncharacterized transport system domain"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32541"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8P7"
FT                   /protein_id="ABQ32541.1"
FT                   /translation="MRRLFGAAVAAIVLALGFSAHAEESEFDPAKVSDSLKAIFQFGSV
FT                   QTKQALNANTVTLITGTIGGTYVQFGADLASLLDDGNNLRVLPIVGRGSVQSVADILFL
FT                   QGVDLGVVRADTLDYLERKGFAKDIKKQFTYVTKLYNEEMQVIAPRAVRNLRDLEGRRV
FT                   SVDLPNGGTFVTALTVFERLGLRANFLYIEQRIAMEKLKRGELDAVIVVGGKPYKSVSN
FT                   FVNDGRFHLVNVDYDRPLQNDYLPATLTAKDYPNLIAEGEKVDTIAVPAVLAAYNWAPN
FT                   TDRYRKLATFVDAFFTKFPAFQNPPFHPKWKEVSLSAPLAGWQRLPSASKWLESHAMEG
FT                   AQRDRFDDFLKQSNAGKNLQSDAEREALFKQYQAWEAEKTGSARAQARGQR"
FT   gene            complement(255498..255905)
FT                   /locus_tag="BBta_0247"
FT   CDS_pept        complement(255498..255905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0247"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32542"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016983"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8P8"
FT                   /protein_id="ABQ32542.1"
FT                   /translation="MASDTTDYSVGFEPADRLAQDRDTVRRRFWVKFKQVVARLPFAED
FT                   LLAAYYCAFDKETPRHVQAALLGAIAYFILPFDFLPDVMPVLGFTDDAAVLATAIRMVA
FT                   SHITPDHRAAARDALARLAAKHDPDAEADAG"
FT   gene            complement(256002..256301)
FT                   /gene="phhB"
FT                   /gene_synonym="DCOH"
FT                   /locus_tag="BBta_0248"
FT   CDS_pept        complement(256002..256301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phhB"
FT                   /gene_synonym="DCOH"
FT                   /locus_tag="BBta_0248"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /function="Complex regulation"
FT                   /EC_number="4.2.1.96"
FT                   /note="Evidence: Function of strongly homologous gene"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32543"
FT                   /db_xref="GOA:A5E8P9"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8P9"
FT                   /protein_id="ABQ32543.1"
FT                   /translation="MVERLSAEARTDALRKLSGWSELDGRDAISRSFTFRDFNEAFGFM
FT                   TRVALVAEKRDHHPEWRNVYRTVDVVLSTHDAGGVTLLDVELAEAMDAIAASMA"
FT   gene            256661..258007
FT                   /locus_tag="BBta_0249"
FT   CDS_pept        256661..258007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0249"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32544"
FT                   /db_xref="GOA:A5E8Q0"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Q0"
FT                   /protein_id="ABQ32544.1"
FT                   /translation="MFIVIAGILAIVGALAGAYYFAMRPVTLKIAVGPPNSDDLKVVQA
FT                   LTQAFSQSHAAVRLRPVPTEGAAESAQALAAAKVDLAIVRGDLEVPKNAQAVATLRKNV
FT                   AVLWVPPVAKGKGRKSGAKITKISQLPGHKVGIIGRTPANVNLLKIVLHQYGVDASKVD
FT                   IVQFPISEAAEAVRNQKADVYLAAGPINSKITADAIAAATKDGGVPTFLAIDSAEAIAQ
FT                   NHPEYEATEIPAGAFGGSPDRPEDEVKTISFNHHIVARKGLSDSTVSTFARQLFSVRQQ
FT                   LMSEFPLAAKIETPDTDKDAAIPAHPGAAAFVDGEEKTFLDRYSDYIWWGLMTLSAMGS
FT                   AGAWFAGYLKRDERTINSSLRDRLLEMITIARKSDSTEELDQLQGEADEILRNTLTCFE
FT                   DGAIEHAALTAFNIALEQFHNAVADRKLILMSMPANLQRTGAQLRAAGT"
FT   gene            258156..259730
FT                   /locus_tag="BBta_0250"
FT   CDS_pept        258156..259730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0250"
FT                   /product="putative alkaline phosphatase (phoD)"
FT                   /note="putative signal peptide; Evidence: Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32545"
FT                   /db_xref="GOA:A5E8Q1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Q1"
FT                   /protein_id="ABQ32545.1"
FT                   /translation="MTIHLSRPQLSRLSRRRFLSTAAAAGVTTLSMPYLSRAADRPQIT
FT                   HGVQSGDVSMDGGVVWARADRPSQMLVEVATTESFKNARSLPPIAALPESDFTAKMLLE
FT                   NLPSGQDIFYRVKFRDLSHSAVESEAVVGRFRTAPGNKRDVSFVWGGDVAGQGWGINPD
FT                   DGGMFTFATMKKHRPDFFLHSGDTIYADGPIKSEVKLPDNKVWKNLTVEEKAKVAETLD
FT                   EFRAAHKYNFLDENVRAFNAEVPIFVQWDDHEVTNNWSASKELPAAYKERNIQLLAARA
FT                   ARAFHEMYPMRESIAEPGRVYRTINYGPHLDVFVLDERSYRGANGPNLEDKYGPSSYFI
FT                   GPEQMRWLKQALLNSRATWKVIASDMPLSLIVYDDAANKKGSEAIAQGDGPARGRELEI
FT                   AEILRFIKTAPIQNTVWLTADVHYAAAHYYDPNKAQFQDFEPFWEFVSGPLHAGTFGPN
FT                   ELDNTFGPEVRFIKAPGLDKQNLPPSAGMQFFGHVKIEGETGQMTVTLRDRADVALWST
FT                   TLDPKLG"
FT   gene            complement(259777..260151)
FT                   /locus_tag="BBta_0251"
FT   CDS_pept        complement(259777..260151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0251"
FT                   /product="hypothetical protein"
FT                   /note="two-component response regulator domain; Evidence:
FT                   Similar to previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32546"
FT                   /db_xref="GOA:A5E8Q2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Q2"
FT                   /protein_id="ABQ32546.1"
FT                   /translation="MTSSQSSVPEHYQDVLVVEDDPIIALGLEDTITDLGIAVIRVAAN
FT                   VASALAMIEERAPQFALLDVGLVREKSFAIAERLTTLGIPFAFSTGYGADRVPAAFADR
FT                   PRLPKPCPTEALEAVLRRQA"
FT   gene            260315..261076
FT                   /locus_tag="BBta_0252"
FT   CDS_pept        260315..261076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0252"
FT                   /product="putative transcriptional regulator with a
FT                   cAMP-binding domain-like, Crp/Fnr family"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32547"
FT                   /db_xref="GOA:A5E8Q3"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Q3"
FT                   /protein_id="ABQ32547.1"
FT                   /translation="MLNQGVTTLSRERPYNNLLRRLSPADYALIAPHLVEDEAAPNDLL
FT                   YRPGDDVQIVHFPCGPALTSYLVANEDGRDVETILVGREGAVGGIVSEGFLPAYTRIVV
FT                   KFGGPFARLPLSRLAAAKLQSKTLRNVFARYADCMLAQVFQSTACNAIHSIEQRTAKWI
FT                   VAAMDRTDGEPIVPLTHEQLATLLGVGRSYVSRVVQTFRAEGILDTRRGAFIVRDFDAL
FT                   KQCSCLCNEAVKTHFEEVLRGVYPTEQAATG"
FT   gene            261158..261877
FT                   /locus_tag="BBta_0253"
FT   CDS_pept        261158..261877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0253"
FT                   /product="putative membrane protein of unknown function
FT                   with prolipoprotein diacylglyceryltransferase domain"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32548"
FT                   /db_xref="GOA:A5E8Q4"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Q4"
FT                   /protein_id="ABQ32548.1"
FT                   /translation="MDGAVLHAIFDVAAWLSAAAAGWWLARFGGVSFPRQSTEWPYIAA
FT                   LVFGAGLGAYLFGTLNLWLSGMAGLARSVEGALAGGIIAVELYKWRHGITLRTGARFAL
FT                   PLAVGVAVGRIGCFAAGLDDFTYGTPTALPWGHDFGDGIQRHPVQLYESLAMASFAAAY
FT                   IVAVIRRNAAVIASGFYLALLVYGLQRFVWEFLKPYGPVVGPFTLFHLLSLAIAAYALA
FT                   MLATAPQSKVTHERAAA"
FT   gene            261858..263273
FT                   /locus_tag="BBta_0254"
FT   CDS_pept        261858..263273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0254"
FT                   /product="hypothetical protein"
FT                   /note="Fe-S oxidoreductase domain; Evidence: Similar to
FT                   previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32549"
FT                   /db_xref="GOA:A5E8Q5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034474"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Q5"
FT                   /protein_id="ABQ32549.1"
FT                   /translation="MNAPLRKSRPYVFWGQTQSLCETCLALVPTKIQIQDNEVWYEKRC
FT                   KAHGVQSTLVSDDAAYWRRCKAFIKPGDTPLSFQRRTEYGCPYDCGLCPDHEQHSCLAL
FT                   IEITDHCNLTCPVCFAESSPQRSHFTPLATVERMLDALVKSEGEPDLVQISGGEPTLHP
FT                   DFFDILAAVRARPIRHVMINTNGLRIAREPDFVAKLAETKRGLEVYLQFDSLSRAGLTN
FT                   IRGADLRRIRQQALENLEHQGISTTLVATIKRGVNDDEIGDIVRHALEWRCVRGVTLQP
FT                   VQDAGRNADFDKDTDRIMLSEIRRRVVETGVFGEQDMIPLPCNPESISIGYGLRNGTTV
FT                   LPLTAMVPQEELLSVMPNTISPEKYPVLRDKFVELFSLSSGPLNTSERVAEFLCCLPSV
FT                   QVPDNLGYEHVFRVTIVQFLDRFNFCVGNVKRSCIHFVTERGEIIPFDTYNLFYRNGAI
FT                   DGIRARLAKGEQA"
FT   gene            263270..263524
FT                   /locus_tag="BBta_0255"
FT   CDS_pept        263270..263524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0255"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32550"
FT                   /db_xref="GOA:A5E8Q6"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Q6"
FT                   /protein_id="ABQ32550.1"
FT                   /translation="MSEPEKKSPPPPASEQPGELRSGCLTAVLFVVGVILLLPGACAVV
FT                   FGYLGLQEKNWPAELTAWVVAGLAVGAGGILLIITAWRR"
FT   gene            263573..263821
FT                   /locus_tag="BBta_0256"
FT   CDS_pept        263573..263821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0256"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32551"
FT                   /db_xref="GOA:A5E8Q7"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Q7"
FT                   /protein_id="ABQ32551.1"
FT                   /translation="MIDRPILPPELPPQQARSGCLTALAVIAGLILLFPMACVLVIFPN
FT                   QITRNDLVDPIGLLFVGAAIAGVVLIILAVRRGRSRS"
FT   gene            263876..264049
FT                   /locus_tag="BBta_0257"
FT   CDS_pept        263876..264049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0257"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32552"
FT                   /db_xref="GOA:A5E8Q8"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Q8"
FT                   /protein_id="ABQ32552.1"
FT                   /translation="MLLVGLVLFAPGLLCFVMELREPSPDDVIKGLLFWAAAIGLLLVF
FT                   FGIRRMIPRRHG"
FT   gene            264075..264311
FT                   /locus_tag="BBta_0258"
FT   CDS_pept        264075..264311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0258"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32553"
FT                   /db_xref="GOA:A5E8Q9"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Q9"
FT                   /protein_id="ABQ32553.1"
FT                   /translation="MSPFLEDVRRAREPAGLVATLGAILGGLVLMFPFGCVMALMRREW
FT                   NEFGGLLGPGAILAGMAVTGLVMIVLAVYRRWG"
FT   gene            264322..265086
FT                   /locus_tag="BBta_0259"
FT   CDS_pept        264322..265086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0259"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32554"
FT                   /db_xref="GOA:A5E8R0"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8R0"
FT                   /protein_id="ABQ32554.1"
FT                   /translation="MTSPERPESQADRAMPPLPKERWKGPPEGIPDEDRPRGKGCLNPL
FT                   IMVCSLALIAWGLYAAIYFAFFVRWHMGGYFGFFLEGLAASIVGAVLMLSAHHRLRPTT
FT                   PGRPEAASGCLPSVMLIAGVVLLLPGACSMLFGLSAMGSITHIGDPSPLLTGFTLGAVG
FT                   VAALWWGAARPAGLAGPLMATGIVLVIPGLFLAVYGFSRLYWINQMPSVLLPIGLLAGV
FT                   IGILYVRAARQRWLAEASADPPAESPGPASDS"
FT   gene            265312..267138
FT                   /gene="typA"
FT                   /gene_synonym="bipA"
FT                   /gene_synonym="yihK"
FT                   /locus_tag="BBta_0260"
FT   CDS_pept        265312..267138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /gene_synonym="bipA"
FT                   /gene_synonym="yihK"
FT                   /locus_tag="BBta_0260"
FT                   /product="GTP-binding protein typA/bipA (Tyrosine
FT                   phosphorylated protein A)"
FT                   /note="Evidence: Function of strongly homologous gene"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32555"
FT                   /db_xref="GOA:A5E8R1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8R1"
FT                   /protein_id="ABQ32555.1"
FT                   /translation="MNLRNIAIIAHVDHGKTTLVDRLLQQSGTFRENQKVAERAMDSND
FT                   LERERGITILAKAASVQWKDTRINIVDTPGHADFGGEVERILNMVDGALVLVDAAEGPL
FT                   PQTKFVVSKALKVGLKPIVVINKVDRPDARPTEVINEVFDLFAALDASEEQLDFPILYG
FT                   SAKQGWMADSPEGPQDRGMEPLFELVLRHVPPPKTEEGPFRMIGTIIEANPYLGRIITG
FT                   RITSGTLKPNQQVKVLAADGKMIEQGRITKILAFRGLERTPLDDAEAGDIVAIAGLTKG
FT                   TVADTFCDPSVETPLPAQPIDPPTVSMSFIVNNSPLAGTEGDKVTSRMIRDRLLREAEG
FT                   NVALRVREADDKDAMEVSGRGELQLAILIETMRREGFELSVSRPRVVFQKDPATGQTLE
FT                   PIEEVVIDVDEEHSGVVVQKMSERRAELIEMKPSGGNRQRLVFYAPTRGLIGYQGELLT
FT                   DTRGTAIMNRLFHNYAPYKGEIQGRRNGVLISNDQGEAVAYAMFKLEDRGPMMIEPGWK
FT                   VYRGMIVGEHTRDNDLEINVLKGKQLTNIRTTSKDEAVRLTPPIKMTLEKALAYIEDDE
FT                   LVEVTPKSIRLRKKHLDPNERKRAEKQKEAVA"
FT   gene            267351..268598
FT                   /locus_tag="BBta_0261"
FT   CDS_pept        267351..268598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0261"
FT                   /product="hypothetical protein"
FT                   /note="amine oxidase domain; Evidence: Similar to
FT                   previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32556"
FT                   /db_xref="GOA:A5E8R2"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8R2"
FT                   /protein_id="ABQ32556.1"
FT                   /translation="MSSLPSSIDIAIIGAGAAGLGAAHALQRRSVSCIVLEARDRIGGR
FT                   AHTIMASPDVTFDLGCGWLHSADRNAFVAIAEQLSFAIDKSRPPWRDQAYEAAFPREER
FT                   EEFIGALEAFFTRTAEAAARGHDAPASDYLEPGNRWNGMIDAICTYLNGCELEQMSLLD
FT                   FEAYADTEVNWRIRRGYGALVAAYGAGLPIALNCNVTLIDHGDTRIRLTTSQGTLTADK
FT                   VIVTVPTNLIADEAIRFNPPLPAKVEAAAGLPLGLDNKVTLALDGWEHLPKDSGMRGRS
FT                   HTARVGSFQLRPFGQPCIEGFYGGSFAREIEAAGAGALAAQAIDDVVALLGHDIRKSLK
FT                   PLAESRWGADPFARGAYSHALPGHAGKRAVLAAPVDDRLFFAGEATPPDFFSTAHGARD
FT                   SGERAAREALASLGKR"
FT   gene            complement(268638..269522)
FT                   /locus_tag="BBta_0262"
FT   CDS_pept        complement(268638..269522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0262"
FT                   /product="transcriptional regulator, LysR family"
FT                   /function="Transcription related; Activator; Repressor"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32557"
FT                   /db_xref="GOA:A5E8R3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8R3"
FT                   /protein_id="ABQ32557.1"
FT                   /translation="MTLEQLRIFVAVATREHVTQAARELHLTQSATSAAVAALEARYQT
FT                   RLFDRVGRRIVLTAAGKAFLVEAKAVLARAAAAETVLDDLAGLKRGRLALAASQTIAGY
FT                   WLPAFIHRFHDAHPAITLGLSIGNTEQVAAQVRDGSADLGFVEGDIDDPLLAAQPVAED
FT                   EMVLVGPAGHPLCRAASLTVGDLKAARWVLREQGSGTRAVLEAALGRFGITPAQLDIAF
FT                   DLPSNEAVRGAVEAGAGVTVLSRLVVMRAVTAGLLAIANIELPKRHFYSLRHKQHHQTQ
FT                   AAREFLRMVSAAG"
FT   gene            complement(269531..270505)
FT                   /locus_tag="BBta_0263"
FT   CDS_pept        complement(269531..270505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0263"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32558"
FT                   /db_xref="GOA:A5E8R4"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8R4"
FT                   /protein_id="ABQ32558.1"
FT                   /translation="MPGLALSAALAAGAFGLHQLPGFRLFSPMILAIMAGMALHNVVGT
FT                   PVRAKPGVAFAMRRVLRIAIILLGLQLTAAQIVEVGARGLAVIALSLAGTFLFTVWMGR
FT                   LLGVDSKLAELIAAGTSICGASAVIATNTVTRAPDEDVAYAVACVTVFGSIAMFAYPLL
FT                   PALLQLDAHAFGLWSGASIHEIAQVVAAAFQQGQQAGEFGTIAKLARVTLLAPVVLTLG
FT                   LLATRRARRHGQDHVSAQPPLPWFVFGFIALVGINSVITVPAEAKTVIVTVTGFLLSMA
FT                   LAAMGLETDFVKLKAKGLRPLALGLAAFLFIAIFSLALVKLTT"
FT   gene            complement(270705..271112)
FT                   /locus_tag="BBta_0264"
FT   CDS_pept        complement(270705..271112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0264"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32559"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8R5"
FT                   /protein_id="ABQ32559.1"
FT                   /translation="MTTWPDDDVILYDGICVFCSRWVQFVIARDAAKRFRFTPIQSPYG
FT                   TRLAQAFGIDPKEPDTNAVVHGGRAHLKSDAALTVLSNLPGWGWTRALFAVPKPLRNAV
FT                   YSVVARNRYRIFGKYDSCFVPDAELRRRVLE"
FT   gene            complement(271112..272434)
FT                   /locus_tag="BBta_0265"
FT   CDS_pept        complement(271112..272434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0265"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32560"
FT                   /db_xref="GOA:A5E8R6"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR025695"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8R6"
FT                   /protein_id="ABQ32560.1"
FT                   /translation="MTAYPRILVLGASGLIGRYLTDDLRRRGFVTIGLARAFSASQRMS
FT                   PLDIELPIMALDPSALAGLIRAHEIDVVVNGLGVLQDGPGSSTDAVHRDIVARLLAAFA
FT                   ACGRNVRFVHISIPGAAEEDHTAFATTKREAERLIAASEFPYAILRPGFVIAPTAYGGS
FT                   AMVRALAALPLDLPAKDAATPFQPVAVADIAATVAWLATRPIDDETTRAVSWDLMQPQP
FT                   VTLGDVIGGFRRSFGTVQWPRIALPLTVLKLGAVAGDLSSWLGWRPPIRTTAMAELRRG
FT                   VRGDPQPWIAATGLTPTPLADAIGGHGASIQDKWFARLFLVKALIITSLVLFWIASGSI
FT                   ALFVSFPATTAILTTRGWPEGFAIPFAAITSMMDISVGVLISFRRTAVFGLIAGIVVSL
FT                   GYMAGCALLTPDLWLEPLGALVKTGPAIVLMLVALLTMDNR"
FT   gene            complement(272448..272915)
FT                   /locus_tag="BBta_0266"
FT   CDS_pept        complement(272448..272915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0266"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32561"
FT                   /db_xref="GOA:A5E8R7"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8R7"
FT                   /protein_id="ABQ32561.1"
FT                   /translation="MTLYFLVKYLHVLGAIVILGTGTGIAFFMLMAHLSGQAAFIARTA
FT                   GVVVIADMLFTLSAVLLQPISGGTLMWLSSTSLSERWLTTSLVLYALAGLFWVPVIFMQ
FT                   IELRDLARAADADAQPLPPRYFTVFRRWFICGIPGFGSVMAILWLMIAKPF"
FT   gene            273324..273833
FT                   /locus_tag="BBta_0267"
FT   CDS_pept        273324..273833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0267"
FT                   /product="putative N-acetyltransferase"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32562"
FT                   /db_xref="GOA:A5E8R8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8R8"
FT                   /protein_id="ABQ32562.1"
FT                   /translation="MSTTLIEVRPAKAADAAAVASAHDEAWRSAYQGIIPGAELEKLIN
FT                   RRGPQWWDSAIRKGSRVSVLVFNDKVAGYANYGRNRARSLHFDGEVYELYLRPEFQGLG
FT                   FGRRLFQAAKRDLAQSGLKSMVVWALSDNDPATEFYRALGGRMVARSSERFGPKSLDKV
FT                   AFAWTN"
FT   gene            274036..274572
FT                   /gene="ppa"
FT                   /locus_tag="BBta_0268"
FT   CDS_pept        274036..274572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="BBta_0268"
FT                   /product="Inorganic pyrophosphatase"
FT                   /function="Unassigned reversible reactions; Phosphorous
FT                   metabolism; Cytoplasm"
FT                   /EC_number="3.6.1.1"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32563"
FT                   /db_xref="GOA:A5E8R9"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8R9"
FT                   /protein_id="ABQ32563.1"
FT                   /translation="MRIDAIPIGKDPPREVNVVIEVPVGGEPIKYELDKEAGTLFVDRF
FT                   LYTAMRYPGNYGFIPHTLSNDGDPCDVLVANTRAIVPGAVMSVRPVGVLIMEDEAGGDE
FT                   KIIAVPSSKLTQRYDKVRTYSDLPDITLQQIQHFYEHYKDLEPGKWVKVLRWGNADDAH
FT                   QLISEGIARAKAAKK"
FT   gene            complement(274720..275604)
FT                   /gene="folD"
FT                   /gene_synonym="ads"
FT                   /locus_tag="BBta_0269"
FT   CDS_pept        complement(274720..275604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /gene_synonym="ads"
FT                   /locus_tag="BBta_0269"
FT                   /product="5,10-methylenetetrahydrofolate dehydrogenase
FT                   (NADP+) / methenyltetrahydrofolate cyclohydrolase"
FT                   /function="Folic acid; Formyl-tetrahydrofolate
FT                   biosynthesis"
FT                   /EC_number="3.5.4.9"
FT                   /EC_number="1.5.1.5"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32564"
FT                   /db_xref="GOA:A5E8S0"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8S0"
FT                   /protein_id="ABQ32564.1"
FT                   /translation="MTARIIDGKVIAADLRGQVAREVERVKRDHGLTPGLAVVLVGNDP
FT                   ASEVYVRSKHTQTQAAGMASFEHKLPADVAQSELLALIDKLNHDPSVHGILVQLPLPKG
FT                   LETEIVINAIDPAKDVDGLHPHNAGRLSGGQPALAPCTPLGCIILSKTVHPSLEGLNAI
FT                   VIGRSNLVGRPLVQLLLNENATVTIAHSRSRDLAALTARADLVYAAVGRPEMVKRDWIK
FT                   PGATVIDVGINRIPTAEGKTRLVGDVAYAEVAEVAGAITPVPGGVGQMTVACLLVNTLR
FT                   AACAIAGLPKPAV"
FT   gene            complement(275874..276209)
FT                   /locus_tag="BBta_0270"
FT   CDS_pept        complement(275874..276209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0270"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32565"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8S1"
FT                   /protein_id="ABQ32565.1"
FT                   /translation="MSPLPWRPASDGLTVALRVTPRGGRDAIDGIETLSDGRSVLKLRV
FT                   RAVADGGEANRAVTELLAKAIGVTKAAVRITSGATARLKQVTITGDASRLDQALRDLVA
FT                   AHKPTGK"
FT   gene            complement(276223..276513)
FT                   /locus_tag="BBta_0271"
FT   CDS_pept        complement(276223..276513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0271"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32566"
FT                   /db_xref="GOA:A5E8S2"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8S2"
FT                   /protein_id="ABQ32566.1"
FT                   /translation="MKPIIYVLIQVISLYMYLLVASAILSWLIAFNVVNTRNQFVAGIA
FT                   EFLYRITEPVLSPIRRRLPNFGGLDISPIIVFFLLMLIQMYLADYVYPFVP"
FT   gene            276743..276818
FT                   /locus_tag="BBta_tRNA3"
FT   tRNA            276743..276818
FT                   /locus_tag="BBta_tRNA3"
FT                   /product="tRNA-Ala"
FT                   /note="Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT   gene            complement(276961..277770)
FT                   /locus_tag="BBta_0273"
FT   CDS_pept        complement(276961..277770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0273"
FT                   /product="putative glutamine amidotransferase class-I"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32567"
FT                   /db_xref="GOA:A5E8S3"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8S3"
FT                   /protein_id="ABQ32567.1"
FT                   /translation="MLRQDPSRQPNGTAKTDVRQRPSIPARAATPRRPVLIILHQETSS
FT                   PGRVGNALRARGYPLDIRRPRFGDPLPETLDEHAGAVIFGGPMSANDPDEFVRREIDWI
FT                   DVPLREQRPFLGICLGAQMLAMQLGAKVAPHPEGRAEIGYYPIRPTQAGRRLCPHWPDH
FT                   VYHWHREGFDLPAGAELLAEGGDFPVQAYQYDNATGLQFHPDVTYAMMCRWTTRGHARL
FT                   DTPGARPRHHHFDGRAVHDTAERAWLQHFLDGWLARRPVAAMAEAAE"
FT   gene            complement(277852..278631)
FT                   /locus_tag="BBta_0274"
FT   CDS_pept        complement(277852..278631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0274"
FT                   /product="putative short chain dehydrogenase/reductase
FT                   family member"
FT                   /EC_number="1.1.1.100"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32568"
FT                   /db_xref="GOA:A5E8S4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8S4"
FT                   /protein_id="ABQ32568.1"
FT                   /translation="MGERVTLITGASAGIGTELARVFAANGHRLALAARREDRLAALAR
FT                   EIVTQGGPEPLVIPCDLTSPDAGDTIEAALSAAGVELEFLVNNAGFGLFGKAVQLSRTE
FT                   QLDMIAVNVRALTELSLRFADQLIRNKGGILNLGSVAGFLPGPGMAVYYASKAYVISFT
FT                   EALRKELAPHGVRVTVLCPGPVPSEFQDRAGFKPGVDSVILNVSPKAVAEAGYRGLMAD
FT                   KRVVLPGLGIKIVPFLLRWFPRGFILDAVGRLQLKRS"
FT   gene            complement(278849..279316)
FT                   /locus_tag="BBta_0275"
FT   CDS_pept        complement(278849..279316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0275"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32569"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8S5"
FT                   /protein_id="ABQ32569.1"
FT                   /translation="MLEGLRQFIADVVSPQQTPAFDDNGYQLAATALLIHVISLDGEPS
FT                   EAERRKLHTLIELRFGLDPGSADRLIAQAMLAEGDAVDLYRFTSVIMREVDEAGRLRIV
FT                   EMMWELVYADGRVTEFEDNVVWRASELLGISTRDRVDLKHRVAARRPANPA"
FT   gene            complement(279461..280843)
FT                   /locus_tag="BBta_0276"
FT   CDS_pept        complement(279461..280843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0276"
FT                   /product="putative cytochrome P450 hydroxylase superfamily
FT                   protein"
FT                   /EC_number="1.14.14.1"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32570"
FT                   /db_xref="GOA:A5E8S6"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8S6"
FT                   /protein_id="ABQ32570.1"
FT                   /translation="MSTAEIHYLPQARAPLVPPMPPRAPDSMGAFRRVLLMGENAIATW
FT                   SQRAYEDEIVRGRFFGSSSYILNTPDTIKHVLVDNWENYVRTDGAIRVLRPVLGEGLLI
FT                   AEGRAWKHQRRTLAPAFTPRAVAGLIPHMIAVTDDTVTRLKQQCDAPVDLREIMQRMTL
FT                   DIAGRTMFSFEMGRHGATLRDFVFEYGARLASPHLLDIVLPLSWPTPRDIARRRFRKRW
FT                   TAFVTLLMAERRAAGKLDDAPPRDLFDLMGAARDPETGAAFTDAQLADEVATMILAGHE
FT                   TTATALFWALYLIALDPASQSKLAQEAGAASDLGDPDRLPFTRAVIDETLRLYPPAFLI
FT                   ARAASGPDRLADFPVKRGDVVLISPWLLHRHEKLWRAPNAFMPERFLPGAAPPERFAYL
FT                   PFGAGARVCIGAHFALVEAVLALARLVGAFKIELIDRAPVMPIGVVTTQPDRSPLFRIT
FT                   PR"
FT   gene            complement(281072..282436)
FT                   /locus_tag="BBta_0277"
FT   CDS_pept        complement(281072..282436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0277"
FT                   /product="hypothetical protein"
FT                   /note="hydrolase domain; Evidence: Similar to previously
FT                   reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32571"
FT                   /db_xref="GOA:A5E8S7"
FT                   /db_xref="InterPro:IPR002472"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR040664"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8S7"
FT                   /protein_id="ABQ32571.1"
FT                   /translation="MKLTRRTILKSMGTLPLLTGGLSLPAWGQAAPAGADLPPVLFVHG
FT                   NGDHAALWMTTLWRMESNGVPRTHLAALNFTDPLARNDDAVAQPNRSSTDDQRRELAEA
FT                   VKALKERTGAARVALVGSSRGGNAIRNLVKNGGGADVSHAVLCGTPNHGVFDWEDSPNS
FT                   EFNGRGPFLRGLNAGDSEVTAGTAFMTLRSDGLDKYAQADGRLLGKPGVPTGITADGPA
FT                   LKGATNLVIGALDHREVAFHPRAFREIYKFIAGREPALIAIQPEREVRISGLVTGTPGG
FT                   APTNRPVAGASVEVYRIAAETRARNGEPVYRGQTGADGRWGPAEIDPASYIEIVLTSPG
FT                   APITHFYRSPFPRSSDVVHLRAARPLGQADAGAGAIVIMARPRGYFGLPRDIVLLDGKE
FT                   PADIQKGVPTDAATTLRLPAGEVGRSVTGLFNEERIAARLWPASESRIAVIELTN"
FT   gene            282616..284298
FT                   /locus_tag="BBta_0278"
FT   CDS_pept        282616..284298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0278"
FT                   /product="putative permease of the major facilitator
FT                   superfamily (MFS) transporter"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32572"
FT                   /db_xref="GOA:A5E8S8"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8S8"
FT                   /protein_id="ABQ32572.1"
FT                   /translation="MNAPQKREPFAAEGIAAPLRHMVFRRIWLASLLSNLGLLIQAVGA
FT                   AWAMTQMTSSADKVALVQTALMLPVMFISMPAGAIADMYDRRIVALVSLLVALGGAVTL
FT                   TVLAWLGLVTPERLLALCFVIGSGMALMGPAWQSSVSEQVPPETLPAAVALNGISYNIA
FT                   RSFGPAIGGVVVAAAGAVAAFAANALLYLPLLAALFLWRRVVEPSRLPREPLNRAIVSG
FT                   VRYIIHSPSIRIVLIRTLVTGVIGGSISALMPLVARDLLHGGAQTYGIMLGAFGMGAVV
FT                   GALNIGEIRKRLSGEAAIRSCALTLGAATAAVGLSGEPVLTAAALVVAGAVWMLAVALF
FT                   NIGVQLSAPRWVAGRALAAFQAAISGGIAIGSWGWGHLTDAAGVEVALLVSGALMMVSP
FT                   LLGLWLRMPPIGARNEDGETLADPEVQLELTSRSGPLVVEIEYRVAEDDARAFHDLMQD
FT                   VQLSRQRNGAYGWSIARDIADPELWTERYHCPTWIDYLRQRNRATRAERELHQRAIGFH
FT                   IGPDPVRIRRMLERPFGSVRPKDDVDRTAEQAPAVATAARSGP"
FT   gene            complement(284344..284547)
FT                   /locus_tag="BBta_0279"
FT   CDS_pept        complement(284344..284547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0279"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32573"
FT                   /db_xref="GOA:A5E8S9"
FT                   /db_xref="InterPro:IPR001893"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8S9"
FT                   /protein_id="ABQ32573.1"
FT                   /translation="MVVIPLMLAVSAASAQQQANQDACARDVSRHCRAVMNNGDQAVLA
FT                   CLKEHRAKLSKACDKVLTEHGQ"
FT   gene            complement(284676..284963)
FT                   /locus_tag="BBta_0280"
FT   CDS_pept        complement(284676..284963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0280"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32574"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8T0"
FT                   /protein_id="ABQ32574.1"
FT                   /translation="MTKSFNLLRTTVLTAVSVAAISAVTSSTSFAFSAEAQQMCTGDAF
FT                   RLCSSEIPNIPAVTACMIKNRSSLSSGCRAVLDKEVAKRSGKIAEINDAN"
FT   gene            285291..286343
FT                   /locus_tag="BBta_0282"
FT   CDS_pept        285291..286343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0282"
FT                   /product="putative exported protein of unknown function
FT                   with polysaccharide deacetylase domain"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32575"
FT                   /db_xref="GOA:A5E8T1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8T1"
FT                   /protein_id="ABQ32575.1"
FT                   /translation="MRNALGLLLATVVAALAITGVWYWLSKPNPANAAAQSAAAKPSES
FT                   APPPARVAAKASKDAPKDDVEITGTLPSKTAAASSALALPKSTCANPDALGISRTVVVD
FT                   TTGGPGFGLDHFKQFDFLADREVVLTFDDGPWPVNTPAVLKALADECTTGIFFSIGKHA
FT                   TYHPEILRQVLAAGHTVGVHTWSHANLNGKKMTDEAAKEELEKGFSAVKFALGTNPAPF
FT                   FRFPQLQHRPSAVAYLGSRNVAMFSCDVDSFDFRSKDPDQVVNTVMTGLDKKGKGIILM
FT                   HDFQKNTALALPTLLRRLKAGGYKVVAMKAKGTLDTLPEYDAMVGQDPKLPTTMTNARP
FT                   ISSVIQTVSQ"
FT   gene            complement(286438..286866)
FT                   /locus_tag="BBta_0283"
FT   CDS_pept        complement(286438..286866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0283"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32576"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8T2"
FT                   /protein_id="ABQ32576.1"
FT                   /translation="MNKMMLIGAIALASATTAQAGGTRSLSLAPNDTAAPAPRPAYVQQ
FT                   AGEVTITPAPVPAGAAGQPATQPVQPAPAAAAPVANSTPATQPAAAAAPTPDPTGSVQK
FT                   SSRRSTSAAKSARAGKPRGKSWTEARIIRELHRHGIYW"
FT   gene            287281..287859
FT                   /locus_tag="BBta_0284"
FT   CDS_pept        287281..287859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0284"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32577"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8T3"
FT                   /protein_id="ABQ32577.1"
FT                   /translation="MRRFVMALSLAVTALLPATGRVWAQSGENDVEEIFVARTVRHGRV
FT                   VPSDFCAPTKTGFAPALEDQLTIHAVTVRPSDGRMTDTGEKSIGELRVCIGQAMDPTLL
FT                   GTYTEGQLNGIAFNGVGDCRLVRGNQPEEGLLTHRCFLALSGLPEPYVGGFLISSSLYS
FT                   RTPFGPESSPPGYAQAGIVIIRLWRKRLP"
FT   gene            complement(287893..289296)
FT                   /locus_tag="BBta_0285"
FT   CDS_pept        complement(287893..289296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0285"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32578"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014982"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8T4"
FT                   /protein_id="ABQ32578.1"
FT                   /translation="MSTTALDNHTQFQSIVGQIRTLAYKYIEDKDFVSAQLAFQKLLEL
FT                   DPKDINARFIYAQLIDDGSHKKRAEARDMMLAILDEHPEIFNDPSEGNLHLIRSAAVRC
FT                   SHVGPFTRSMELFRKLARASNQAADYFSLSEILTQGNEFEEAVAALEKAIQLNPAYDNP
FT                   INRETLELARSNAKKGKAKDVKARAKVGRYPETKDFLGDLQTLITSHIAVNLAAAPKFL
FT                   DKSTRFFTMGSCFARNLSKSLNDSGYSSHHMEISEYINTTFANRVFVDWLRDAKINPEI
FT                   EERIVELLPPGSSKWSTLTAIKQADVFILTLGVAAAFFDRETGAFVLPRPSALNSRALA
FT                   EKYKFRTASVQENVDNVLYLIDFIRSIKPGIKVIVTVSPVPLLTSFEYESVVQADCLSK
FT                   STMRLVAHEVVNNSNLPDIWYWPSFEVFRWGGSNASSFFAADDGAAWHVSEDKVAATVR
FT                   AFVQTFSPA"
FT   gene            complement(289648..289723)
FT                   /locus_tag="BBta_tRNA52"
FT   tRNA            complement(289648..289723)
FT                   /locus_tag="BBta_tRNA52"
FT                   /product="tRNA-Thr"
FT                   /note="Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT   gene            complement(289879..291804)
FT                   /locus_tag="BBta_0286"
FT   CDS_pept        complement(289879..291804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0286"
FT                   /product="putative exported protein of unknown function
FT                   with HemY domain (porphyrin biosynthesis)"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32579"
FT                   /db_xref="GOA:A5E8T5"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016982"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8T5"
FT                   /protein_id="ABQ32579.1"
FT                   /translation="MLRIVVFLILVGLAAAGSAWVAEQTGDVVLNWGPWRIAMTLPVFV
FT                   LALGLTITACVLVWNLISALLRAPGRIRNHHRARRHQRGRHAITHGLLAIGHGDLTAAR
FT                   QHADAAKRLAGDDPLTLLLHAQAAQLGGDRDGAQRAFRAMAERHDTRLLGLRGLFIEAQ
FT                   RADDAYAAVMIADEALKLAPNATWASHAVLGFRCAQGDWNGALAILDSNYTAGMIDKPT
FT                   YRRQRGVLLTARAIALETENRDLARASAMEAVKLAPTLIPAAVLAAKFESEAHQVRRAM
FT                   KIIEAAWTAGPHPDLADAYAHVRLGDSARQRLTRIENLAARTRDHIEGALAIARAAIDA
FT                   AEFGRARAALAPFTDDPTQRVAMLMAELERTEHGDAGKSREWTLRAVRARHDPAWTADG
FT                   YVSDHWRPISPVTGRLDAFQWQTPVASLPSERNSVIESSEFADAVLAPPTRATIPEGLA
FT                   EPPREVARQSQLDVIAPTPQDNVPPRPAETAVSDPAVDTPVQEAVDKPVDRPVDNPVEK
FT                   TEDNRLIEVSSATPAEPAPPLQASGPTDADSETPEAERDEAESEAEAPAKPADPVATAP
FT                   TPLFRTRSDLGKPPETPLQTIVPIMRPPDDPGVDDEDQTRDEFAEQIAPKAQAGGWRGF
FT                   WSRFGS"
FT   gene            complement(291812..293110)
FT                   /locus_tag="BBta_0287"
FT   CDS_pept        complement(291812..293110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0287"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32580"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8T6"
FT                   /protein_id="ABQ32580.1"
FT                   /translation="MVDEPDTVAPASDTGRPKRPPPTIDLEPTSREERPSAAESAAERP
FT                   TASPWSAPAEAVAEGSSGAASQSHPHAAPDAAPEAAESATPEEPVAAAEPPRADTPPPP
FT                   RPVSPWIIAPFSGAAAAALVIGIGWMLGWPPVQPPSATTPQDAAVTELTSRVAGLEQRI
FT                   GRPDTAVTGRLDAADKAIAAVRNDIAGLRAQSDKTIAALNDVKAQPRDGAASAPAPAPV
FT                   DLSGLIARIDALERASRSQSAALAQESQKLADAAKPADDAPLRRVVAAALLDVAVRHGD
FT                   PYAAALSTAKSLAPDAAALKPLDAFAATGVPSPAALSRDLLTIVPKLAPPAPEGTTGSS
FT                   ILSKLSAGAAGLVKVERTDGAGTDRGAVVARITAAALRNDFAEARRELKGLSPDERAPA
FT                   KDWLDKADARDAALSTARKFADDAMTALAKPAQ"
FT   gene            complement(293161..293898)
FT                   /locus_tag="BBta_0288"
FT   CDS_pept        complement(293161..293898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0288"
FT                   /product="putative uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32581"
FT                   /db_xref="GOA:A5E8T7"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8T7"
FT                   /protein_id="ABQ32581.1"
FT                   /translation="MAVLVTRPAPDNDRSATALRARGFEVLLAPMLRFEPVALPDDAGR
FT                   DAAAVIVTSSNALRAAAPQLARSALLTLPLFAVGEHTAAAARQAGFTQVMSADGDAGAL
FT                   RDLVTRERANGRIKADAPLLYLAGADISRDLAGELAGRGFEVITQTVYRMAPVTTLPRD
FT                   VCDAFAKNAITAVLHYSRRSAAAFVAAIRADGVEISALAVPHCCMSANVAEVLREAGAT
FT                   QVTIAAHPNENDMLEGLTRALRS"
FT   gene            294039..295106
FT                   /locus_tag="BBta_0289"
FT   CDS_pept        294039..295106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0289"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /function="Proteins/peptides/glycopeptides"
FT                   /EC_number="3.4.24.57"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32582"
FT                   /db_xref="GOA:A5E8T8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8T8"
FT                   /protein_id="ABQ32582.1"
FT                   /translation="MLGIETTCDETAAAVVARDSDGKGRILSNVVRSQTDEHALYGGVV
FT                   PEIAARAHVDMLDHLIDAAMREAGIDYADLNGVAAAAGPGLIGGVIVGLTTAKAIALVH
FT                   DTPLIAVNHLEAHALTPRLTDAIDFPYCLFLASGGHTQIVAVAGVGDYVRLGTTVDDAM
FT                   GEAFDKVAKMLGLPYPGGPQVEEAAQRGDAARFAFPRPMLGRSDANFSLSGLKTAVRNE
FT                   IGRIAHVSAQDIADLCASFQAAVLESTADRLRVGLDLFKQRFGAPTALVAAGGVAANQA
FT                   IRAALDDVAQQAGTRLIMPPPALCTDNGAMIAWAGLERLALGMIDGMDAAPRARWLLDA
FT                   NASVPGKFANTRAGF"
FT   gene            295338..296318
FT                   /gene="gpsA"
FT                   /locus_tag="BBta_0290"
FT   CDS_pept        295338..296318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="BBta_0290"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD+)"
FT                   /function="Galactose degradation; Glycerol metabolism;
FT                   Phosphorous metabolism; Cytoplasm"
FT                   /EC_number="1.1.1.94"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32583"
FT                   /db_xref="GOA:A5E8T9"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8T9"
FT                   /protein_id="ABQ32583.1"
FT                   /translation="MTCFQTIAVIGAGAWGTALAAVAARAGRDVTLYARDADHASHIAS
FT                   ARENPRLPGIPLASRIAVTADLARAARADTVLIVVPAQHLRGAVMHVAPLLAPGTPLVA
FT                   CAKGIEHGTHKFMTEVIAEAAPCATPAILSGPSFAHDVARGLPTAVTLAAPDEALAAAL
FT                   VQALGSPTFRPYHSTDVRGVEIGGAAKNVLAIAAGIVAGRQLGASALAALTTRGFAELV
FT                   RLGRAHGARSETLTGLSGLGDLILTCAGPQSRNFAAGLALGRGEPLPAGKLAEGQYTAP
FT                   VLVELAAARGVEMPVAQAVAAILAGAVTIDAAIEALMLRPFKAEE"
FT   gene            296533..296946
FT                   /locus_tag="BBta_0291"
FT   CDS_pept        296533..296946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0291"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32584"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8U0"
FT                   /protein_id="ABQ32584.1"
FT                   /translation="MSYWLVKSEPSVWSWDQQVEKGAKGEAWTGVRNYTARQNLVAMKK
FT                   GELAFYYHSNEGKEIVGIAEIIKEAYPDPTDKTGKFVCVDIKAHKPFKTPVTLAAIKAE
FT                   PKLAEMALVKQSRLSVQPVTPEEWKLVCKMGGV"
FT   gene            complement(297483..298985)
FT                   /gene="amtB2"
FT                   /gene_synonym="ybaG"
FT                   /locus_tag="BBta_0292"
FT   CDS_pept        complement(297483..298985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB2"
FT                   /gene_synonym="ybaG"
FT                   /locus_tag="BBta_0292"
FT                   /product="ammonium transporter"
FT                   /function="The Ammonium Transporter (Amt) Family; Membrane;
FT                   Inner membrane"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 5 : Inner
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32585"
FT                   /db_xref="GOA:A5E8U1"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8U1"
FT                   /protein_id="ABQ32585.1"
FT                   /translation="MTFKRPTSAGWVTLAVAGLCVAGLVDVAFAEDAPAAAAAAAPVPN
FT                   KGDTAWMLVSSALVLMMSVPGLALFYGGLVRTKNMASVLTQVFAIVAMVGVVWTLYGYS
FT                   LAFTDGGSMTSWIGGFSKAFLHGVDANSVAATFSNGVVIPELAYFVFQMTFAMITPALI
FT                   VGAFAERIKFSAVMLFVLLWVTFIYFPIAHWVWYIAAPDDVAAAAKAVAAATDAAAKTA
FT                   AQAKLDELTGAVGWLAGAGALDFAGGTVVHINAGIAGLVGAVLIGKRTGYGKELMAPHS
FT                   LTMTMIGASLLWVGWFGFNAGSNLESNGVTALAFVNTMVATAGAALSWLLCEWAVKGKP
FT                   SLLGICSGAVAGLVAVTPASGLAGPIGALVLGLIVSPVCLFFVSTVKNSLGYDDALDVF
FT                   GVHCIGGIIGALATGILVNPALGGVGITDYTNITGNNAGTYDFATQMLAQVKAVVATLV
FT                   WSGVGSAILYKVVDVVIGLRPTVEQEREGLDITDHGERAYNY"
FT   gene            complement(299025..299276)
FT                   /locus_tag="BBta_0293"
FT   CDS_pept        complement(299025..299276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0293"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /function="Transcriptional level; Nitrogen metabolism"
FT                   /note="fragment; Evidence: Function of strongly homologous
FT                   gene; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32586"
FT                   /db_xref="GOA:A5E8U2"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8U2"
FT                   /protein_id="ABQ32586.1"
FT                   /translation="MTEVKGYGRQKGHTEIYRGAEYAVSFLPKIKIEVAIPSDQVDKTI
FT                   DAISSAAKTGQIGDGKIFVISLDHAVRIRTGEADAAAL"
FT   gene            complement(299696..301006)
FT                   /gene="amtB1"
FT                   /gene_synonym="ybaG"
FT                   /locus_tag="BBta_0294"
FT   CDS_pept        complement(299696..301006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB1"
FT                   /gene_synonym="ybaG"
FT                   /locus_tag="BBta_0294"
FT                   /product="ammonium transporter"
FT                   /function="The Ammonium Transporter (Amt) Family; Membrane;
FT                   Inner membrane"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 5 : Inner
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32587"
FT                   /db_xref="GOA:A5E8U3"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8U3"
FT                   /protein_id="ABQ32587.1"
FT                   /translation="MGTYASRCLRASAASAAAGAAIFTTPALAAAPSTIEPADTAWMIV
FT                   ATALVLMMTIPGLALFYSGMVRKKNVLATMAQSLAAVMLISILWVAFGYSLAFVGDGAW
FT                   IGTLDRAFLAGMGMESVHPGAKTIPEALFMLYQMTFAIITVALVAGSVADRMRFSAYLV
FT                   FGVAWFVFVYVPLAHWIWGGGFLAQAGVVDFAGGLVVHLSAGTGGLVAAVVMGRRHGYG
FT                   SENLSPFDLSLAVVGTGLLWVGWFGFNGGSALGANAHAVMAILTTHLAACAGAVTWGAL
FT                   EWSTRRKPSVLGMISGAVAGLGTITPASGFVAPWHGLVIGALAGIICYWACTSLKHRFN
FT                   YDDSLDVFGVHGIGGLTGTVLAGVFATAAIGGTAGLIEGNPKQLAAQLYGVAVTLVWSG
FT                   GVTWGLLKLVSVFVPLRVSREQELEGLDISQHGEALQ"
FT   gene            complement(301091..301429)
FT                   /gene="glnK1"
FT                   /gene_synonym="ybaI"
FT                   /locus_tag="BBta_0295"
FT   CDS_pept        complement(301091..301429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK1"
FT                   /gene_synonym="ybaI"
FT                   /locus_tag="BBta_0295"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /function="Nitrogen metabolism; Regulation level unknown"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32588"
FT                   /db_xref="GOA:A5E8U4"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8U4"
FT                   /protein_id="ABQ32588.1"
FT                   /translation="MKLVVAIIKPFKLDEVRQALTAIGVHGMTVTEVKGYGRQKGHTEI
FT                   YRGAEYIVNFLPKLRIEIAVNSDIADKAVEVITTHARTGQIGDGKIFVTPIDHARRIRT
FT                   GETDSDAL"
FT   gene            301635..302507
FT                   /locus_tag="BBta_0296"
FT   CDS_pept        301635..302507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0296"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32589"
FT                   /db_xref="GOA:A5E8U5"
FT                   /db_xref="InterPro:IPR025640"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8U5"
FT                   /protein_id="ABQ32589.1"
FT                   /translation="MSNRSWYYAAQGQQQGPISEDELRDLIARSVVTADTLLWSDGMAG
FT                   WEKAGRIPGLMSGVPEIPPAAPAFDIGGPASAGALSAKLDTWPYFGWALLYVVGQLVII
FT                   LAPWTAVYLYRYVVERIRVPGRPNLSFTGQPLDIWYVFVGLGVLTYIGTSDRPFLQLVS
FT                   VVGQALLGWMILRWVATKIASNGEPLPLRFEGSPLAYFGWYLATLVSAITIIGWAWVLT
FT                   AWMRWICRNVQGSRRELVFNASGLDVLWRTLLFAVGCAFIIPIPWLLRWYSTWYVSQFA
FT                   LVPRTAQPV"
FT   gene            complement(302514..303389)
FT                   /gene="tesB"
FT                   /locus_tag="BBta_0297"
FT   CDS_pept        complement(302514..303389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="BBta_0297"
FT                   /product="acyl-CoA thioesterase II"
FT                   /function="Unassigned reversible reactions"
FT                   /EC_number="3.1.2.2"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32590"
FT                   /db_xref="GOA:A5E8U6"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8U6"
FT                   /protein_id="ABQ32590.1"
FT                   /translation="MSKGLIDLISILDLEPIEVNLFRGNSPKTSWQRVFGGQVIGQAMM
FT                   AACRTVEGRLPHSLHCYFILPGDPQVPIIYQVERLRDGKSYATRRVTAIQHGNAIFSIM
FT                   VSFHSDEESAFNHQDRMPDVPPPEKLTAEEISKQPMFQEVFQRMPDFIRRYYESDRPIE
FT                   LRPVELSRYFGQKIDDGRIHVWIKTAATLPDDPALHMCALAYASDFSLLDAVMARYGRT
FT                   LFDKRMMPASLDHAMWFHRPFRADEWLLYAQDSPSAQGGRGLTRGSIFKPDGTLVASVA
FT                   QEGSIRERRS"
FT   gene            303544..304764
FT                   /locus_tag="BBta_0298"
FT   CDS_pept        303544..304764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0298"
FT                   /product="putative 2-polyprenyl-6-methoxyphenol hydroxylase
FT                   and related FAD-dependent oxidoreductases (UbiH)"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32591"
FT                   /db_xref="GOA:A5E8U7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8U7"
FT                   /protein_id="ABQ32591.1"
FT                   /translation="MTTQRSIVICGGAFAGLALALALRQGLGAEVPVIVADPALANRPS
FT                   RDPRASAIVAACRKLFDAIGVWADVAPQAQPILDMVITDSKLEDATRPAFLTFAGQVEA
FT                   GEPFAHMVENRLLIDALVRHAEAAGVELKAMPVTGFKTRTDAVTVTLGDGSEVEASLLV
FT                   AADGARSKLRERAGIQTHGWDYDQSGIVVTVGHERDHGGRAEEHFLPPGPFAILPLTGK
FT                   RSSLVWTERRKEAKRLVELSADEFHAELEKRAGLHLGELKVLDQPRAFPLSYFVARSFI
FT                   APRLALVGDAAHVIHPIAGQGLNMGLKDVAALAQVVVDAARMGIDPGQVDVLESYQRWR
FT                   RFDTMAMGVATNSLNFLFSNKSTLLRAVRDIGLGIVDRAPPLKELFIKQAAGLTGEMPR
FT                   LLKGEAL"
FT   gene            complement(304825..305748)
FT                   /locus_tag="BBta_0299"
FT   CDS_pept        complement(304825..305748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0299"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32592"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8U8"
FT                   /protein_id="ABQ32592.1"
FT                   /translation="MRSALIRGALALVVLTSAATAEESTIRVGALDAVLTTPAGIERPP
FT                   VALLIAGSGSTDRDGNGPQLKPATLKKLADQLAARGIASLRFDKRGARGWKAEFGRPED
FT                   FRFKDYVGDTASLVDFLRGKFARIALVGHSEGGLVAILTARRTPVDRLILLATSARRQG
FT                   DLLKTQLERKLPAAKMEPVAKAIDAIMAGQIVDPPPPDLPIAPQMQPGIGSAFAEDPID
FT                   PLKQITIPILIVGGARDSQIARLDMVALAAAAPAAKTLWLPEMNHVLVDVANEDENLAS
FT                   YNDPDRPLDPDMVEAVAGFIAAAGPR"
FT   gene            complement(305751..305948)
FT                   /locus_tag="BBta_0300"
FT   CDS_pept        complement(305751..305948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0300"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32593"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="InterPro:IPR038053"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8U9"
FT                   /protein_id="ABQ32593.1"
FT                   /translation="MNAPLDRPANSVDPKLLEILVCPMTKGPLEYDAAKQELISRSAKL
FT                   AYPIRDGIPIMLPEEARKIG"
FT   gene            complement(306005..306547)
FT                   /locus_tag="BBta_0301"
FT   CDS_pept        complement(306005..306547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0301"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32594"
FT                   /db_xref="GOA:A5E8V0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8V0"
FT                   /protein_id="ABQ32594.1"
FT                   /translation="MNEQLSAKDWLDQGLKVLASRGFTALKAEPMAKVMGVSRGSFYWH
FT                   FADVAAFHAALLKHWRDIAAEQIISGVEASAGDEPAIAVLLRRSFTIRLSLERAVRSWA
FT                   ASDAAAQHAVQAIDKRRLGYIEGLLTARGLPPDVAQARAQVLYWAFLGHALSGRPLPAG
FT                   QQEAALGELIRIALHEP"
FT   gene            306637..306987
FT                   /locus_tag="BBta_0302"
FT   CDS_pept        306637..306987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0302"
FT                   /product="hypothetical protein"
FT                   /note="permease domain; Evidence: Similar to previously
FT                   reported genes of unknown function; Localization: 11 :
FT                   Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32595"
FT                   /db_xref="GOA:A5E8V1"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8V1"
FT                   /protein_id="ABQ32595.1"
FT                   /translation="MRDMLLQCAGLAVIVVALIHGLLGETTVFARASIAPERLRTLLRL
FT                   VWQAGTVAWIGYGLLLIAAPWMGSEPARHWIAITAIVVFASAACANAVATRARHFGWVM
FT                   LAGAVVLAAAGY"
FT   gene            307306..307653
FT                   /locus_tag="BBta_0303"
FT   CDS_pept        307306..307653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0303"
FT                   /product="putative exported protein of unknown function
FT                   with cupredoxins superfamily domain"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32596"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8V2"
FT                   /protein_id="ABQ32596.1"
FT                   /translation="MLVDVVRKLMVVAGSLGVMLAMTQAQADGRNEICLTYANGQFEPK
FT                   EPTVPADAPLTIRVKNLDAKAMEFESETLKIEKVVAGNSEAVLNVRAVKSGRYEFHNDF
FT                   NEKARGFLIVQ"
FT   gene            307665..308495
FT                   /locus_tag="BBta_0304"
FT   CDS_pept        307665..308495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0304"
FT                   /product="hypothetical protein"
FT                   /note="high-affinity Fe2+/Pb2+ permease domain; Evidence:
FT                   Similar to previously reported genes of unknown function;
FT                   Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32597"
FT                   /db_xref="GOA:A5E8V3"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8V3"
FT                   /protein_id="ABQ32597.1"
FT                   /translation="MLAALIIVFREVFEAGLIVGIVLAVTSSVPYRLRWIGGGLFAGLV
FT                   GACAVAAFAGTLTQLFEGMGQELFNAAILSTAVIMLTWHNVWMARHGREMANELRTMGQ
FT                   AVVDGARPLVALATVIAIAVLREGSEVALFLYGVAATSEGGGRALLGGGALGLLLGVAV
FT                   CLATYFGLMRIPPRALFRTTTVLITLLSAGMAAQAVFFLARANWLTSFDQVVWDSSAVL
FT                   PEGGVAGRTLKALIGYTDQPTVMQLAAYVGVILLTVILMRLTAGTRAPRVIAAE"
FT   gene            complement(308496..309170)
FT                   /locus_tag="BBta_0305"
FT   CDS_pept        complement(308496..309170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0305"
FT                   /product="putative Lon family ATP-dependent protease"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32598"
FT                   /db_xref="GOA:A5E8V4"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8V4"
FT                   /protein_id="ABQ32598.1"
FT                   /translation="MPINAEYRGPAELPKVIPVFPLAGALLLPRGQMPLNIFEPRYLAM
FT                   VDDAFRDGRRLIGMIQPDVSHSSSEERPALFKVGCVGRITQLAESGDGRYILELTGVSR
FT                   FKVVEEMSVLTPYRQCKVDYFPYVDDFKARKGEDAVDREALLAVLTDFLKANNLKVDWA
FT                   GIEAAPNEALVNALAMMSPYGPAEKQAMLEAPDLKTRAEILIAVTEMDLAKKRTSGDPP
FT                   LQ"
FT   gene            complement(309225..310142)
FT                   /locus_tag="BBta_0306"
FT   CDS_pept        complement(309225..310142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0306"
FT                   /product="putative thioredoxin"
FT                   /function="Energy production/transport"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32599"
FT                   /db_xref="GOA:A5E8V5"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8V5"
FT                   /protein_id="ABQ32599.1"
FT                   /translation="MTIVEQGGGTAQVPDLIKDTTTQSFVKDVIEESKRQPVLIDFWAP
FT                   WCGPCKQLTPILEKAVKAAKGKVKLVKMNIDEHPAIPGQMGIQSIPAVIAFVGGRPADG
FT                   FMGAVPESQVSAFIEKLTKGVPGVGEPDIGEILKEAEAVLAEGDPTGAAQIYAEILSFD
FT                   AANIAALAGLAKCYVETGAIEQARETLAQVPEAKRGDSAVSAVQAAIDLAEQAQSLGPI
FT                   GELEQKVAANPLDHQARFDLATALNAAGKRKEATDQLLEIVKRDRKWNEDGARKQLVQF
FT                   FEAWGGADEATIEGRKRLSTILFS"
FT   gene            310428..310502
FT                   /locus_tag="BBta_tRNA4"
FT   tRNA            310428..310502
FT                   /locus_tag="BBta_tRNA4"
FT                   /product="tRNA-Gly"
FT                   /note="Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT   gene            complement(310573..311991)
FT                   /locus_tag="BBta_0307"
FT   CDS_pept        complement(310573..311991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0307"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32600"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8V6"
FT                   /protein_id="ABQ32600.1"
FT                   /translation="MHGLSGRGTQLWSAIIIVIAMFTAAEPAAADKRVALVIGNSIHEH
FT                   APLLDEPATDARLLADRLTRLGFTLSGGAAQIDLDRKGFDRALAEFKGRIADADLALIY
FT                   YAGYGLNLNGTSYLVPVDAAPAKADDLATELRDLGAILRELDGPSGRQNVVILDAFRAN
FT                   PFAARGIAGLAAGLVPVGMPARTVLSFAAQAGTIGQRGPDGHSAFTAALADVLQQPGPR
FT                   LIDIFNQTNMAVQRATSGAQQPFVMFTLLDGGAQLSPAAAKPASPVASQAPAPPRPAAS
FT                   AVAADARTPGLAVLYDEDVSEPRGKRYSGSVVWRIETVKSAQSGADTAAIRAEIDIPER
FT                   KLKVSLQLRRNDDPTLPASHVAELTFKPAPEFVGGAISNVPGMLMKTSEQARGTPLAGL
FT                   AVKITEGSFLVGLSNVEADRARNEELLAGREWFDIPLVYASQRRGILAIGKGPSGDRVF
FT                   ADAFAAWGRSQAAK"
FT   gene            complement(312105..313409)
FT                   /gene="pncB"
FT                   /locus_tag="BBta_0308"
FT   CDS_pept        complement(312105..313409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="BBta_0308"
FT                   /product="Nicotinate phosphoribosyltransferase"
FT                   /function="Nicotinamide adenine dinucleotide (NAD)"
FT                   /EC_number="6.3.4.21"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32601"
FT                   /db_xref="GOA:A5E8V7"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8V7"
FT                   /protein_id="ABQ32601.1"
FT                   /translation="MTVTDIASRTYNHGWRLDPIVRSLLDTDFYKLLMLQMIREFYPDQ
FT                   KVTFSVINRTKRVRLGDVIDEGELRAQLDHARTIRFTKKELIWLAGNTFYGKTHMFSPD
FT                   FLAWLAHFRLPDYELHKADGQYELHFHGPWTHTTMWEIPALAIVNELRSRQAMKGQGRF
FT                   ALDVLFARAKAKLWAKVERLRRLEGLRLSDFGTRRRHGFLWQRWCVEAVKEGLGPSFTG
FT                   TSNVLLAMDNDLEAIGTNAHELPMVAAALARDDDELRFAPYRILDQWRQTYAGNLLIAL
FT                   PDAFGTKAFLRDAPDWVADWTGFRPDSAPPIEAGEEIIAWWKSKGRDPKQKLLVFSDAM
FT                   DVESIEQIHHRFSDRVRLSFGWGTNLTNDFVGCAPDGSVDLDPISLVCKVTSVDGQPAV
FT                   KLSDNPEKATGDPAEIARYLRVFGDAGRVRTPVVV"
FT   gene            complement(313508..314854)
FT                   /locus_tag="BBta_0309"
FT   CDS_pept        complement(313508..314854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0309"
FT                   /product="putative amidase (amiD)"
FT                   /EC_number="3.5.1.4"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32602"
FT                   /db_xref="GOA:A5E8V8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8V8"
FT                   /protein_id="ABQ32602.1"
FT                   /translation="MSDAFILPPPQAGAGVLDLLRQFAADPQAAESYGADCLKRTEAIE
FT                   ARLKSFEYLPKDVSAKNGPLGGIPVAVKDIIATSDMPTSNGSPIYRDHVPAADAWVVAR
FT                   LRNLGATIFGKTVSTEFAWRHPGPTVNPWNPAHTPGGSSSGSAAAVAAGLVPLALGTQT
FT                   LGSVIRPAAFNGVVGFKPSFGAIPRVGVHPLSPSLDHVGFFARRVDDVALALSLLAGRS
FT                   DDDPHGRPLPGFTVDIAHGLRPLASPRLAVVRFAKWELAEPEQKAVFEAAVERLRSAGA
FT                   VVEEIALPALDAAHWDAINTIMLSEATTIFSDLIARFPDRVSDVMKAHVASGRSKTAME
FT                   YLTAKAAQAERQHALATELGGFDAVLTLPAFGEAPHGLDWTGDAEYCAPWTFVGAPAVS
FT                   LPAGFGRHGLPLGVQIAGVYRNDLHVLRVAKWAEAALAFDPGLPLLARH"
FT   gene            315184..316461
FT                   /locus_tag="BBta_0311"
FT   CDS_pept        315184..316461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0311"
FT                   /product="putative Glucose/sorbosone dehydrogenase"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32603"
FT                   /db_xref="GOA:A5E8V9"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8V9"
FT                   /protein_id="ABQ32603.1"
FT                   /translation="MTSAFHRSILALATIGLLAGTSIAGAQQQSDQGKGLKKYESGTKE
FT                   FWTHPPDDWFLGDETEAQKGLAPPSGPPTGASDAELAKIVKQVKLPDGFKMEVWASGVL
FT                   AARQMAWGDKGTLFVGSFGLGNVYAISDKGGKREVKTVLKGLNMPTGLAFQDGNLYVIA
FT                   VDKLIKYENAEANLDNLGQGKVVYDDMPSYAAHGWKYIAVDKEGWFYIPFGPPFNIGIP
FT                   PTSVSQIRRVDPRTGNAEIWALGVRNSVGGDVDPRTGRYWFTENARDWVSDDLPSDKLN
FT                   MISKIGEHFGYPYCHQGDMPDPKFAMGHKCSEFTPPVLNLGAHVAPLGMKFYTGDQFPA
FT                   EYKNNILIAEHGSWNRHKYQGARIMRVIVGPDGKDAKQEVFASGWIEGDQGYLGRPDDI
FT                   ILAKDGSILVADDWAGAIYRISYEKK"
FT   gene            316604..317185
FT                   /locus_tag="BBta_0312"
FT   CDS_pept        316604..317185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0312"
FT                   /product="putative cytochrome c4 precursor"
FT                   /function="Electron donor"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 9 : Periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32604"
FT                   /db_xref="GOA:A5E8W0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8W0"
FT                   /protein_id="ABQ32604.1"
FT                   /translation="MRHGVVAGGALALALMSVSVQAADLEAGKAKAELCAGCHGENGVS
FT                   QTENIPSLAGQQDQFVQWQLVFFRAGTRKNEAMKPIVDQLTNEDIRNLGAYFASLTPAK
FT                   APPDNDPDLSRKGAEAAAGRRCASCHLDSYAGTKGVARLAGQREEYLVKALHDYKSGQR
FT                   VGGSQAAMTDVAYPLSAEEITALAHYLAHL"
FT   gene            complement(317251..318174)
FT                   /gene="panE"
FT                   /gene_synonym="ApbA"
FT                   /locus_tag="BBta_0313"
FT   CDS_pept        complement(317251..318174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panE"
FT                   /gene_synonym="ApbA"
FT                   /locus_tag="BBta_0313"
FT                   /product="ketopantoate reductase"
FT                   /function="Pyrimidine biosynthesis; Coenzyme A"
FT                   /EC_number="1.1.1.169"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32605"
FT                   /db_xref="GOA:A5E8W1"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8W1"
FT                   /protein_id="ABQ32605.1"
FT                   /translation="MRILVVGAGAIGGYFGGRLLQSGADVTFLVRPRRAAELASAGLVI
FT                   RSPAGDATLPNPPTVQADSLKQTFDVVLLSCKAYDLDDAITSFAPAVGPHTSIIPLLNG
FT                   MKHLDVLDAKFGRERVLGGLCAIAATLNERREVVQLQPMQSLTFGERDGGSSDRIRAIS
FT                   EVFARGNFNASASDHIMQDMWEKWVFLASLAASTTLMRAPVGVILTAPGGKDFLLGMLD
FT                   ECSATAAAAGYAPAGAFFQRVSGMITAEGSPMTASMFRDLHAGLPVEADHVIGDLVARA
FT                   DAAKVPVPRLRISYTQLKVYEALRGQ"
FT   gene            complement(318292..319029)
FT                   /locus_tag="BBta_0314"
FT   CDS_pept        complement(318292..319029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0314"
FT                   /product="putative Acetoin(diacetyl) reductase"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32606"
FT                   /db_xref="GOA:A5E8W2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8W2"
FT                   /protein_id="ABQ32606.1"
FT                   /translation="MQQRNATVAVIGAGDYIGAEIVKKFASEGFTVFAGRRNGDKLAPL
FT                   VAEVEAAGGRIVARSLDARKEEETTAFLNEADKHAPLEVVIFNVGANVNFPILETTDRV
FT                   FRKVWEMACWAGFVTGREAARLMLPRGGGKIFFTGATASLRGGSGFAAFASAKFGLRAV
FT                   AQSMARELMPKNIHVAHLIIDSGVDTAWVRERRVQLWGEEALDNPDLLMPPASVAGAYW
FT                   QLYQQPRTAWTFEMEIRPFGEKW"
FT   gene            complement(319101..319706)
FT                   /locus_tag="BBta_0315"
FT   CDS_pept        complement(319101..319706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0315"
FT                   /product="hypothetical protein"
FT                   /note="2-hydroxychromene-2-carboxylate isomerase domain;
FT                   Evidence: Similar to previously reported genes of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32607"
FT                   /db_xref="GOA:A5E8W3"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8W3"
FT                   /protein_id="ABQ32607.1"
FT                   /translation="MSRPAPEFLFDFGSPNAYLSHEAIPAIEQRIGVRFSYVPVLLGGI
FT                   FKATNNKSPAESLAGIKNKREFHEIETQRFLKRYHVQPWVWNPHFPVNTLNLMRAAVAA
FT                   QFEGVFEAYVDAAFHHMWREPKKMDDPATAIAAITSSGLDGAKLFARAQEPEVKAKLVE
FT                   NTQAAVERGAFGSPTFFVGTDMFFGKEQLRDVEEMILG"
FT   gene            complement(319813..321123)
FT                   /locus_tag="BBta_0316"
FT   CDS_pept        complement(319813..321123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0316"
FT                   /product="putative multi antimicrobial extrusion protein
FT                   (MatE)"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32608"
FT                   /db_xref="GOA:A5E8W4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8W4"
FT                   /protein_id="ABQ32608.1"
FT                   /translation="MFLAPMMLSNILQSLFGTINNVYLGQMIGVDALAAVSVFFPAMFF
FT                   FVAFVMGLGSGASILIGQAWGAKEPAKVKAIAGTTLTITLLLAALIAVGGLFSRDLLSA
FT                   LATPANILDAAAGYARIMMITMPLTFAYILLSSQMRAVGDTVTPLAALAASTVLGLVLT
FT                   PIFIRGWLGAPQLGVASAAWASAISTLVTLGGLHLHLLRRKHPLAIDAAFLRGMRPDPK
FT                   LLRIVLRLGIPAAIGMIVMSLAEMVLIGLVNGFGSDATAAYGAVNQVLGYVQFPALSIA
FT                   ISVSIFGAQAIGRGSPEQIGRIVRTGVEMNVVLTGGLVVLGYLFSRTLMGFFITDPEVI
FT                   EVAQRSLHIVLWSSVLFGMSTTFSAAMRAGGTVWMPLAISAFSIAAIEVPAATWLSRSI
FT                   GLDGVWLAYPITFTAMMLLQMSYYLLVWRKRTVRRMV"
FT   gene            complement(321265..321837)
FT                   /locus_tag="BBta_0317"
FT   CDS_pept        complement(321265..321837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0317"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32609"
FT                   /db_xref="InterPro:IPR018715"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8W5"
FT                   /protein_id="ABQ32609.1"
FT                   /translation="MDTYTAFGGHTRITTGPLAKVALVLKHAAPTDAPVMIFSDRTGQP
FT                   IDLDLRGSDREILARLPSDAGSAATEQPTEPRGRGRPKLGVVAREVTLLPQHWEWLNAQ
FT                   PGGASVALRKLVHDARRASGDTDRAREARDAAYHFMSGIGSHLPQFEEASRALFAGDLP
FT                   RLAALIATWPADIRDHVVALANRHRGE"
FT   gene            322005..322670
FT                   /locus_tag="BBta_0318"
FT   CDS_pept        322005..322670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0318"
FT                   /product="putative Glutathione S-transferase III (GST-III)"
FT                   /function="Glutathione"
FT                   /EC_number="2.5.1.18"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32610"
FT                   /db_xref="GOA:A5E8W6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8W6"
FT                   /protein_id="ABQ32610.1"
FT                   /translation="MLTVHHLNNSRSQRVLWLLEELGVPYDIIRYERQPDMRAPKELRA
FT                   IHPLGKSPVITDNGNTVAESGAIVEYLIDTYGNGRLIPPPKTPERLRYSYWLHYAEGSA
FT                   MPLLLLKLLFNIMPKRAPALLRPLVRKVSNQALTTLVNPQLKQHMAFWESELQKSEWFA
FT                   GDQFTAADIQMSFPLQAAASRGGLEHGHPRAMDFLARIEARPAYKIALEKGGPYEVGR"
FT   gene            complement(322675..324042)
FT                   /locus_tag="BBta_0319"
FT   CDS_pept        complement(322675..324042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0319"
FT                   /product="putative beta-lactamase"
FT                   /EC_number="3.5.1.46"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32611"
FT                   /db_xref="GOA:A5E8W7"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8W7"
FT                   /protein_id="ABQ32611.1"
FT                   /translation="MGLLVAGWLTYRPDRALRSATTAVAQMVCAKTFVSGLDPQTTFAE
FT                   TMERPGLRRLRAVMRYRVERDTRIVDASLLGLHVSRASYHDGLGCVSLQGQKPPYLPHS
FT                   NVGALRAAAPAPDLPDIAAADPVEPADAGLRAALDHAFEEPASPPLRRTKAVVVIKDGR
FT                   LIAERYAATIGVDTPLIGFSMTKTVTNALLGILTRQGRLSPQMPAPVAEWRDAADGRHD
FT                   ITLEQLMRMTSGLALDETNSGFDPSSQMEIHRDMAAFAVHAPLIAPPGQRWAYSSASTQ
FT                   ILARIIRDAAGGPEQTIELAWRELFGPLGMRSATLQYDGTGTMQGYANMLASARDWAKL
FT                   GLLYLGDGVVGDRRILPEGWVAMSAKATLDTDYGAGLWTNRSQHAHALGRAKQGIPADA
FT                   FFAFGLLGQRLVIMPSQRMVVVRLGDSVDPDGDIRGVARLVREVIAATESPATAVK"
FT   gene            324076..324327
FT                   /locus_tag="BBta_0320"
FT   CDS_pept        324076..324327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0320"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32612"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8W8"
FT                   /protein_id="ABQ32612.1"
FT                   /translation="MHQNVRRRLAGEPSLRPGLLLARPGRHANGANGRMDAPDGGKSSC
FT                   CLILAARLASHLPPAGSARERQIMVRHDRDRSFQDIMI"
FT   gene            complement(324324..326093)
FT                   /gene="ggt"
FT                   /locus_tag="BBta_0321"
FT   CDS_pept        complement(324324..326093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="BBta_0321"
FT                   /product="gamma-glutamyltransferase 1, Threonine peptidase,
FT                   MEROPS family T03"
FT                   /function="Glutathione"
FT                   /EC_number="2.3.2.2"
FT                   /note="Gamma-glutamyltransferase small chain; Gamma-
FT                   glutamyltransferase large chain; Evidence: Function of
FT                   homologous gene experimentally demonstrated in an other
FT                   organism; Localization: 9 : Periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32613"
FT                   /db_xref="GOA:A5E8W9"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8W9"
FT                   /protein_id="ABQ32613.1"
FT                   /translation="MRTFTFDRRRFLSRLAWAAGVTLLLAGGAPARAFDAQGIDIPLPP
FT                   GVTAPAQPPAHGMVVAQERIAAQVGERILALGGNAIDAAVATGFAMAVTYPVAGNIGGG
FT                   GFMVIHLAASHEDVAIDYRETGPAAMTRDSFLGADGKPDNAKSRDSALSIGVPGSVAGL
FT                   ALALEKYGSGKFTLAQLLHPAIVLAREGIPVADDVAVTLPMMAPRLAKWTSSAAIFMRP
FT                   DGAALKEGDRLVQRDLATTLTAIAEQGPRGFYEGPVADKLAKAIQDAGGIMTTDDLKSY
FT                   QPVLRTPVRGTYRGHDIVSMPLPSSGGTVLVEMLNILEGFPLAELKQGSPASLHLLIEA
FT                   MKRAYADRARYLGDPAFVDAPVRAMLSKDYAARQRASIDPMRATSAGDVLNIKPLREGS
FT                   NTTHFSVVDNDGNAVSNTYTLNFPYGVGLVAAGTGVLLNNELDDFTAAPGASNAFGLVG
FT                   FEANLPGPGKRPLSSMSPTIVLKDGQPVLVTGSPGGSRIISTVLQVIVNVLDYQLDVRE
FT                   AVKAPRLHHQWMPDEVRVEKGFADDVLADLRALGHRIEEPMGRTSANSILVTPAGLIGA
FT                   PDPRSKGAAAAGR"
FT   gene            326194..327597
FT                   /locus_tag="BBta_0322"
FT   CDS_pept        326194..327597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0322"
FT                   /product="putative major facilitator superfamily (MFS)
FT                   transporter"
FT                   /note="putative membrane protein; Evidence: Function
FT                   proposed based on presence of conserved amino acid motif,
FT                   structural feature or limited homology; Localization: 11 :
FT                   Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32614"
FT                   /db_xref="GOA:A5E8X0"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8X0"
FT                   /protein_id="ABQ32614.1"
FT                   /translation="MAVTTIETSDAAQQRVYPRRAAVVSWIFFDWAAQPYFTLITTFVF
FT                   APYFAAHVAPDAASGQALWGFATAAAGIVIALLSPVFGAIADATGRRKPWIAAFGAMLV
FT                   VGSCLMWIGRPGAPELIVPLLAAYVLATIGVEFATVFNNAMMPTLVPPERIGRLSGTGW
FT                   ATGYIGGIVSLILVLGFLAANPDSGRTLFGLQPLFGLDPVTHEGDRISGPLTGLWFIVF
FT                   VLPMFLFTPDYPARHRLGAAMREGLGQLQATLRSLPQQRDIALFLIANMIYTDGLVSLF
FT                   AFGGIYAAGTFGWNTIQIGTFGIILAAAGTLGGWFGGKLDDRLGPKRVIAGSMTLLLLA
FT                   IIAILLVSRDSILFIPVTPAMPGGPLFASLPERAYLLLGCIIGACGAPLQAASRSLLIR
FT                   MVPRDQVAQYFGLFALTGKVTSFIGPLLIGTVTALTASQKAGMAVLVLFFAAGLLLLAR
FT                   VNAHGHARA"
FT   gene            complement(327673..329265)
FT                   /gene="purH"
FT                   /locus_tag="BBta_0323"
FT   CDS_pept        complement(327673..329265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="BBta_0323"
FT                   /product="IMP cyclohydrolase"
FT                   /function="Purine biosynthesis; Nucleotide and nucleoside
FT                   conversions; Cytoplasm"
FT                   /EC_number="3.5.4.10"
FT                   /note="Localization: 2 : Cytoplasmic; Evidence: Function of
FT                   homologous gene experimentally demonstrated in an other
FT                   organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32615"
FT                   /db_xref="GOA:A5E8X1"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8X1"
FT                   /protein_id="ABQ32615.1"
FT                   /translation="MTNQLRPVHRALLSVSDKTGLVEFARSLAARGIELISTGGTAKAI
FT                   ADAGLKVKDVSDLTGFPEMMDGRVKTLHPKVHGGLLAIRGNDEHAEAMKTHGIAPIDLL
FT                   VVNLYPFEATVERSAPFSDCIENIDIGGPAMIRAASKNHEDVAVVVDVNDYDAVLEDLA
FT                   RHEGSTTLLLRRRLAAKAYARTAAYDAAISNWFAATIQNDAPDYRAFGGRLIQSLRYGE
FT                   NPHQHAAFYALPGRRPGVATARQVQGKELSYNNINDTDAAYECIAEFDPARTAACVIVK
FT                   HANPCGVAEGPDLITAYQKALACDSTSAFGGIIAMNRKLDAATARAITGIFTEVIIAPD
FT                   ATEEAIAVIAARKTLRLLLAGALPDPREAGLTAKTVAGGLLVQSRDNAVVDDMTLKVVT
FT                   KRAPTEAELRDLRFAFRVAKHVKSNTIIYAKDSATVGIGAGQMSRVDSARIAARKALDA
FT                   ASELKLAEPLTKGSVVASDAFFPFADGMLACIEAGATAVIQPGGSVRDDEVIKAADEHG
FT                   IAMVLTGVRHFRH"
FT   gene            complement(329424..331139)
FT                   /locus_tag="BBta_0324"
FT   CDS_pept        complement(329424..331139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0324"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32616"
FT                   /db_xref="GOA:A5E8X2"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8X2"
FT                   /protein_id="ABQ32616.1"
FT                   /translation="MGRFARSLISNVSGVSVSLSGVWPGRADRLIIAPHDLRTSDATRA
FT                   AEIYAGRFVFAGKIVTCHGRSIFDLEPPSEDWEVALLGFGWLRHLRAADTALTRANARA
FT                   LVDDWITNQIGRHPLSRRADVLARRVISLLSQAPLVLADSDGKFYRRYLRGLTREIRFL
FT                   RYSTIDIPDGAPRLQVLIALCYAALCLANQAKHIRSASRKLSDELQRQILPDGGHVSRN
FT                   PGALIELLIDLLPLRQTFAARNIAPPPALLNAIDRMMPMLRFFRHGDGNMALFNGMGGT
FT                   PSDLLATLLAYDDTHGTPMASMPHSGFQRLDAGGMTVIVDTGPPPPPHLSHEAHAGCLA
FT                   FELSSGACRIVINCGMPSTGRENWRTFARSTVAHSTLTYHNTSSCTFVEMSAMKRLLHG
FT                   APIVSGPTRVENFREVVPDGTVLSTSHNGYAAKFGLIHRRVLVAAEDGSRLDGEDTVTP
FT                   AQGARLRGGGSDYALRFHLHPAVKASRLSDGRGAMLVLPNREVWTFETFEDRVELEDSV
FT                   FLAGNDGPRRTTQLVIRQDAQQAASIRWSFVRSSTSPSDSNGRRNARREPEPPL"
FT   gene            complement(331381..332733)
FT                   /locus_tag="BBta_0325"
FT   CDS_pept        complement(331381..332733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0325"
FT                   /product="putative Ribosomal RNA small subunit
FT                   methyltransferase B"
FT                   /function="RNA modification"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32617"
FT                   /db_xref="GOA:A5E8X3"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8X3"
FT                   /protein_id="ABQ32617.1"
FT                   /translation="MPPPRFATSSEVPGLAARRIAADVVDGVLHKHRTLDDQLDGTGAH
FT                   PGLKQLADRDRALMRRLVATTLRRLGTLGHVLSRLLDRGVPTDAPRAQSALLIGAAQIL
FT                   WMDVPDHAAVDLSVRLVQADRRAAKYAGLVNAVLRRCAREGAGLLDDVQGQPLDIAPWL
FT                   LTRWIAHYGEATAKNIAAALGQEPSLDLTVKSDAAQWAARLHGEVLPTETVRTLLHGSV
FT                   TVLPGFAEGQWWVQDAAAALPARLFGDVAGKTMADLCAAPGGKTAQLAHGGAHVTAVDR
FT                   SPARMARLKDNMTRLQLTAETAVADAAEWQPAATGGFDGILVDAPCTSTGTIRRHPDVG
FT                   WLRSEADIAALSSVQRRLLTRAASLLKPGGMLVYCTCSLEPEEGEQVVESALADTTELR
FT                   RVPITPSEVAGLAELITEAGDLRTLPCHLPHQDPRLGGLDGFYAARLERRP"
FT   gene            332930..333160
FT                   /locus_tag="BBta_0326"
FT   CDS_pept        332930..333160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0326"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32618"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8X4"
FT                   /protein_id="ABQ32618.1"
FT                   /translation="MSNEPPRKPALSVVASHDAPKKPLTPAAQRALAEAEERRRRAAEE
FT                   AMPRPKELQGPKGPEPTRYGDWENKGIISDF"
FT   gene            complement(333188..335083)
FT                   /locus_tag="BBta_0327"
FT   CDS_pept        complement(333188..335083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0327"
FT                   /product="sulfate adenylyltransferase subunit 1 /
FT                   adenylylsulfate kinase"
FT                   /function="Sulfur metabolism"
FT                   /EC_number="2.7.7.4"
FT                   /EC_number="2.7.1.25"
FT                   /note="Adenylyl-sulfate kinase (APS
FT                   kinase)(NodQ/CysNC-like) (part 2); Localization: 2 :
FT                   Cytoplasmic; Evidence: Function proposed based on presence
FT                   of conserved amino acid motif, structural feature or
FT                   limited homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32619"
FT                   /db_xref="GOA:A5E8X5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8X5"
FT                   /protein_id="ABQ32619.1"
FT                   /translation="MAVHEPVLGRTRESATISTDDRPTLHLVTCGSVDDGKSTLVGRLL
FT                   YDSKMLLDDQLDALASDSKLAGTAGPALDFALLVDGLQAEREQGITIDVAYRFFATQRR
FT                   RFVIADTPGHVQYTRNMATGASHADLAVVLIDARKGVISQTRRHTHILALLGVRHVVLA
FT                   VNKMDLIGFDADRFMAISADFRSMAKRLGIADVQCIPVAARDGDNIFRASPRMPWYAGP
FT                   SVMAHLESIDVTDGIDDRPFRFPVQWVNRPNADFRGYSGRVVSGTVRCGDAVVVHPSGR
FT                   RSRISGIVTADGRLQQAVAGESVTLLLADEVDASRGDVLASGAPPIVADRIASHLIWLD
FT                   DAAMQAGRRYLLKSGTSSTGAVISALKHRVCIDSMAQESAQTLEANEIGYADLTLDRPL
FT                   VCDAYRDSRELGSFILIDPVNRRTVAAGLIDAPLRHATDVRWHTLDIDKSVRAGLKQQK
FT                   PCVLWFTGLSGAGKSTIANLVDRRLCELGRHSALLDGDNLRHGINQDLGFAPEARVENI
FT                   RRVSEIAALFVDAGLITLVSLISPFRADRDAARRRFADGEFIEVHVATPLATCEARDPK
FT                   GLYKRARAGELSNFTGIDQPYEAPDRPEIAIDGATLSASDAADLIVSYLREQHYF"
FT   gene            complement(335083..336051)
FT                   /locus_tag="BBta_0328"
FT   CDS_pept        complement(335083..336051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0328"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /function="Sulfur metabolism"
FT                   /EC_number="2.7.7.4"
FT                   /note="NodP-like; Evidence: Function proposed based on
FT                   presence of conserved amino acid motif, structural feature
FT                   or limited homology; PUBMED: 2185135, 2828368"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32620"
FT                   /db_xref="GOA:A5E8X6"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8X6"
FT                   /protein_id="ABQ32620.1"
FT                   /translation="MSSLRHATEIATTRWPAAAEPRPAALNHLHQLEAESIAILREVAA
FT                   EFRKPVMLYSIGKDSSVLLHLAMKAFHPAKPPFPLLHIDTTWKFRDMIAFRDQRARELG
FT                   LELLVHVNPEGLAQKISPFTHGSALYTDVMKTQALRQALDAHGFDAAIGGARRDEEKSR
FT                   AKERIFSHRSATHRWDPKNQRPELWHLYNTMLAPGESMRVFPLSNWTELDVWDYIQLER
FT                   IPIVPLYFAARRPVVERDGALIMVDDERMPLRPGETPQWRSIRFRTLGCYPLTGATPST
FT                   ASDLAAIIREMRTSRTSERQGRVIDRDSAASMERKKVEGYF"
FT   gene            complement(336048..337028)
FT                   /locus_tag="BBta_0329"
FT   CDS_pept        complement(336048..337028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0329"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32621"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8X7"
FT                   /protein_id="ABQ32621.1"
FT                   /translation="MAALIRAEHPSLDTMPLSPVGAFQSRTVALATLMREVTDCLADNF
FT                   RDRAAQDFPMLYFACGKARVGSTALSNLFGMTGMPSYYQPLKAMLRDAMVGRPLTPWVI
FT                   PSATGEPNLFSKETIGPYVLAESLFNPLQLLIEAGYPPSRLHLIALDREPASALASWLD
FT                   KLISRASHSTLLAHYVIAALSAARVASYARQHGIPVTHYVYEVSKEPLSSIRVLFDRLG
FT                   LSGIFAEKAVTSWQEPGHAQGTNARVIFPAEATIYKVPNLHTSDSAYRYQFRATSSLSD
FT                   HQLAVLERCGVNDVYRNSVAACVRDLDLNASTAARLFGERAGVAA"
FT   gene            complement(337174..339204)
FT                   /locus_tag="BBta_0330"
FT   CDS_pept        complement(337174..339204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0330"
FT                   /product="putative methyl-accepting chemotaxis
FT                   receptor/sensory transducer"
FT                   /function="Motility (incl. chemotaxis, energytaxis,
FT                   aerotaxis, redoxtaxis)"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32622"
FT                   /db_xref="GOA:A5E8X8"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8X8"
FT                   /protein_id="ABQ32622.1"
FT                   /translation="MFRFNFKIGTKLGITAGIGVVLVAGMLANQIIGNQSIEQSSKLVV
FT                   INTANRANAQAAEAAMLRAQISAQDIGSVAAPDRLQASLQALQDHLAAAAKEVDAARQR
FT                   ATRAVAREMYGEIRTLIDKAAAAGTDYAKAQADVLAKVAARGQASEAWERSFPKLLTNP
FT                   SLAASPNHFSLEAELRAADAALAAVRAASWHFAKTGDVKQRDVATASVDRLVAALQKAR
FT                   SLATEKDLQAGIDELIAIATSFKTAALDYFRADEVSKRVFNDNVATTSKEIAKRIGEAA
FT                   TMGSEMMALRQNQLVAELERVGTVALIVGALVVLVLIGSAVFSSLSIARPIRRVGEVLL
FT                   ELAGGNKSVTIPYTERGDEVGDNARAASTFRDNLIRIEQMELAQKNQDKIAAQQRKAEM
FT                   IKLADAFQAAVGGIVTTVSSAAHQLEGAAGTLSGTANQTQVLSSMVAAASEEASTNVGA
FT                   VASATEEMSASVTEISRQVHDSSRIANEAVKQAERTDARINELQAAAGRIGDVVKLITA
FT                   IAEQTNLLALNATIEAARAGESGRGFAVVASEVKALAAQTAKATEDIGTQIAGMQAATQ
FT                   ESVAAIKEIGATITQISDIAATIAATVEQQGAATREIARNVGEAAKGTAEVAERITEVN
FT                   RGASATGNASGQVLDSARSLTSQSSNLKTEVERFLETVRAA"
FT   gene            complement(339372..339908)
FT                   /locus_tag="BBta_0331"
FT   CDS_pept        complement(339372..339908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0331"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32623"
FT                   /db_xref="GOA:A5E8X9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8X9"
FT                   /protein_id="ABQ32623.1"
FT                   /translation="MRFAAIRTATAKAVVFAAAALGAGLATTAPASARPELVDMAGDFS
FT                   PGTIVVKTGERKLYLVLDGRHAMRYPVGVGKAGRQWAGTTKIDGKYKYPAWAPPAEVKR
FT                   DKPNLPDVIAGGSPHNPMGVAAMTLAGGDYAIHGTNVPGSVGGFVSYGCIRMLNADITD
FT                   LYERVSIGTTVVVTR"
FT   gene            complement(340084..340860)
FT                   /locus_tag="BBta_0332"
FT   CDS_pept        complement(340084..340860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0332"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32624"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Y0"
FT                   /protein_id="ABQ32624.1"
FT                   /translation="MGCVLWLFAGGIGPSAAQLIPQSPELKTSIAFFYRDPRIETLTHV
FT                   FATLTTEGRDWTAYPPVAGLLGRTFALHPDWIDRLAPSPGNSKAASAFLAAVRLSGHAA
FT                   EAGKYRSRFGPNDLDSTLEDQFGSAPDRLEDIRIRTPTDLDLLWGASFAEGDGRYVRMI
FT                   LDFFASITNQSELIALDTARITVAMVGGPKDIYDALKHRYDAAQRGRMVVAAAALWATG
FT                   SNVRQHDYVRQATTAYIHDHPGTYAVRALSAITGIK"
FT   gene            complement(340909..342861)
FT                   /gene="acsA"
FT                   /gene_synonym="yfaC"
FT                   /locus_tag="BBta_0333"
FT   CDS_pept        complement(340909..342861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acsA"
FT                   /gene_synonym="yfaC"
FT                   /locus_tag="BBta_0333"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /function="Propionate degradation; Acetate catabolism"
FT                   /EC_number="6.2.1.1"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32625"
FT                   /db_xref="GOA:A5E8Y1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Y1"
FT                   /protein_id="ABQ32625.1"
FT                   /translation="MSEKIYDVPAEWAKRAFVDDAKYQEMYARSIKDPNGFWAEQAKRV
FT                   DWVKAPTIIENVSYAPGNISIKWFEDGVLNAAYNCIDRHLATRANQTAIIWEGDDPSQS
FT                   KNITYRELHDEVCKMANILRNRNVKKGDRVTIYLPMIPEAAYAMLACARIGAIHSVVFA
FT                   GFSPDSLAQRIKDCDSKVVITADEGLRGGRKVPLKANVDAALNKVDNVDWVVVVKRTGG
FT                   KVEMNPTRDLWYHEAAEMVTTECPCEPMHAEDPLFILYTSGSTGQPKGVLHTTGGYLVY
FT                   AAMTHQYVFDYHEGDVYWCTADVGWVTGHSYILYGPLANGAVTLMFEGVPNYPDNSRFW
FT                   NVIDKHKVNIFYTAPTAIRALMQGGDAPVTKTSRASLRLLGSVGEPINPEAWEWYHRVV
FT                   GGGRCPIVDTWWQTETGGILITPLPGATKLKPGSATRPFFGVVPEIVDADGKTLEGATE
FT                   GNLCLTRSWPGQMRTVYGDHARFEMTYFSTYKGKYFTGDGCRRDADGYYWITGRVDDVI
FT                   NVSGHRMGTAEVESALVAHAKVSEAAVVGYPHDIKGQGIYAYVTLMAGETPSEELRKEL
FT                   VAWVRKEIGPIASPDQIQFAPGLPKTRSGKIMRRILRKIAEDEPSALGDTSTLADPGVV
FT                   DDLVQHRQNRKEKQA"
FT   gene            343243..344430
FT                   /locus_tag="BBta_0334"
FT   CDS_pept        343243..344430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0334"
FT                   /product="hypothetical protein"
FT                   /note="DNA topoisomerase I domain; Evidence: Similar to
FT                   previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32626"
FT                   /db_xref="GOA:A5E8Y2"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR035447"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Y2"
FT                   /protein_id="ABQ32626.1"
FT                   /translation="MTDQQNFESSRVGPADAEVALAKALGQWPPKPPRRKLTLKDLAHT
FT                   KAANAQANAKTSVEELAQRIGLKLGDQTELTIRRIKRGKSYSFIRANGTPIRHAGTIRR
FT                   LHAMAVPPAYRDVRYAPDPSLHLQAVGIDAAGRLQYRYHADWEKVREHRKAHRLAKLVG
FT                   ALPRIRRAVSKNLAGDEPTREFALAAVIELIARTAIRPGNESYARLNGTRGATTLLKSN
FT                   VILEDDGLVLTFKAKGGKAVRKECDAAKLVRAVGILRGLPGRRMFQYRDAQGVVRAVST
FT                   TQVNAFLREIAGIKISLKDFRTLMASAVALETLSRITPAASARGRKKQILEAIRAAADE
FT                   LTNTPAICRKSYVHDTIVTAFEDGILERFAATMKGQRSQTRREQLLAQVVMAVAA"
FT   gene            complement(344443..344589)
FT                   /locus_tag="BBta_0335"
FT   CDS_pept        complement(344443..344589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32627"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Y3"
FT                   /protein_id="ABQ32627.1"
FT                   /translation="MRAAHKKQVLRPLKRHVEPVKTVAVPCRELDPIARFLASSKIGPG
FT                   CQA"
FT   gene            345313..345867
FT                   /locus_tag="BBta_0336"
FT   CDS_pept        345313..345867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0336"
FT                   /product="putative exported protein of unknown function
FT                   with Fas1 domain"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32628"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Y4"
FT                   /protein_id="ABQ32628.1"
FT                   /translation="MSKRIAYLAAAAFSALSLTSTFVAPARAEEKTVMVGGAAMYPSKN
FT                   IIQNAVNSKDHTTLVAAVKAAGLVQTLEGKGPFTVFAPTNTAFGKLPAGTVDTLVKPEN
FT                   KATLTKILTYHVVPGKLEAADLKDGQTLKTVEGEQLTVKREGKNVMIVDAKGGTSMVTI
FT                   PNVNQSNGVIHVVDTVLMPAS"
FT   gene            346075..346704
FT                   /locus_tag="BBta_0337"
FT   CDS_pept        346075..346704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0337"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32629"
FT                   /db_xref="GOA:A5E8Y5"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Y5"
FT                   /protein_id="ABQ32629.1"
FT                   /translation="MSSIAATATTISTSRTKVIQPAWVRVMHWINAAAMIVMIMSGWQI
FT                   YNASPLFDFRFDRSITLGGWLGGALLWHFAAMWVLMLNGLAYLVTGLVTGRFRRKLLPL
FT                   SPASVIADLKAALTFKLSHDDLSAYNAVQKLLYLGIILVGIVVVLTGLSMWKPVQLHWL
FT                   VSLFGDYPAARYVHFVCMALICAFLVIHILLALLVPKSLRAMITGR"
FT   gene            346719..347501
FT                   /locus_tag="BBta_0338"
FT   CDS_pept        346719..347501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0338"
FT                   /product="putative oxidoreductase molybdopterin binding
FT                   protein"
FT                   /function="Electron carrier"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32630"
FT                   /db_xref="GOA:A5E8Y6"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Y6"
FT                   /protein_id="ABQ32630.1"
FT                   /translation="MAKRPFLIPGVDKRLLIKDSLKTMPDLTRRRFLTGGASLGALTLL
FT                   TGCDVVDSDTAEELLKKVSKFNDAVQAWMFNPDALAPTFPESAITKPFPFNAYYTLDEA
FT                   PEIDAADWKLDVRGLVDNKKSWTLDELHALPQVTQVTRHICVEGWSAIGSWTGTPLRDF
FT                   LKLIGADTRAKYVWFNCADKDGYNSPLDMRTALHPQTQMTFKFADQILPRAYGYPMKIR
FT                   VPTKLGFKNPKYVVAMEVTNDYKGGYWEDQGYNSFSGS"
FT   gene            complement(347575..348774)
FT                   /locus_tag="BBta_0339"
FT   CDS_pept        complement(347575..348774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0339"
FT                   /product="putative permease of the major facilitator
FT                   superfamily"
FT                   /function="Putative uncharacterized transport protein"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32631"
FT                   /db_xref="GOA:A5E8Y7"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Y7"
FT                   /protein_id="ABQ32631.1"
FT                   /translation="MPTSQSVPTAVRPALTNLTLSLGPIIGLGIGRFAYALVLPDMRDS
FT                   LHWSYSAAGFMNTVNAAGYLLGALIAAQLAQRVGGLAAVRGGTLAALASLAVCAMTSDF
FT                   AALSLARLMTGIGAGVALVAGGALAARVALAQPARASFVLSLFYAGPPLGIVVSGLIAP
FT                   FVLQAFGPGSWWIVWAVLAALGAVLIVPLLVMPIPASAAAVETRADRVSLRPMAIYLVS
FT                   YFLYGAGYIAYLTFMIAYVRDLGGGAVAQSAFWCLIGVAGFSTPWVWRRVLALDRGGRP
FT                   TAFILTVNAIGAALPSLGHSPAMLALSAAVFGIAFSTVTTATTAFVRFNLPQSAWPRAI
FT                   AALTISFGIGQTMGPFGVGAITDAMGSLTYALNVSAALLLLGAAMAAMQSKLKRTDRAS
FT                   "
FT   gene            349043..350155
FT                   /gene="leuB"
FT                   /locus_tag="BBta_0340"
FT   CDS_pept        349043..350155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="BBta_0340"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /function="Leucine; Cytoplasm"
FT                   /EC_number="1.1.1.85"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32632"
FT                   /db_xref="GOA:A5E8Y8"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Y8"
FT                   /protein_id="ABQ32632.1"
FT                   /translation="MATHKLLLLPGDGIGPEVMAEVKRLIGWLNGKGLASFETEEGLVG
FT                   GAAYDAHGASISEADMDKAKAADAIIFGAVGGPKWDGVPYEVRPEAGLLRLRKDLGLFA
FT                   NLRPAVCYPALADASSLKREIVEGLDIMIVRELTGGVYFGEPKTITDLGNGQKRAVDTQ
FT                   VYDTYEIERIARVAFDLARKRRNKVTSMEKRNVMKSGVLWNEVVTAVHNREYKDVTLEH
FT                   QLADSGGMNLVKYPKMFDVIVTDNLFGDMLSDIAAMLTGSLGMLPSASLGEVDAKTHKR
FT                   RALYEPVHGSAPDIAGKGLANPIAMLTSFGMALRYSFDLGALADKLDAAIAAVLASGLR
FT                   TADIKAEGSTPASTAQMGEAIIKELEKLTA"
FT   gene            complement(351193..351561)
FT                   /locus_tag="BBta_0342"
FT   CDS_pept        complement(351193..351561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0342"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32633"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Y9"
FT                   /protein_id="ABQ32633.1"
FT                   /translation="MIEFSAATRALTLAVIAATGLAVTSADAAPTKRRATVAYSGNGPN
FT                   YSYQSGPRTRVYVSKRSWLDGGTEVLPGDRKFSDYAFPPAVGYPSFARENLNRPIDRQP
FT                   LMAPSDLGGYPTRIPIPY"
FT   gene            complement(351790..352590)
FT                   /locus_tag="BBta_0343"
FT   CDS_pept        complement(351790..352590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0343"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32634"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Z0"
FT                   /protein_id="ABQ32634.1"
FT                   /translation="MHSDSARTATASRSAYVLQGLESFADEVCGTVARLFAYVGALALL
FT                   AMLGVAGWQHLDGDDAPTGRAGWTLADGAVPAFSLRLTDQPDKTATYTVLTHPEGGRKD
FT                   VLRWGEPADRPAAELEVYRFGPERDARRDPRADLAIRMGQGGAADLETAGVIDSRFGPV
FT                   SLIRPAGASEGPRACLGFLKTIAEPALRISGWSCQGVTMPTRRAMVGCMLNRLTLLAPE
FT                   QDRALGQLFAGPEPRRGGCDAPATAGSAGDWVMSTANPRLRGAL"
FT   gene            352705..353739
FT                   /gene="asd"
FT                   /locus_tag="BBta_0344"
FT   CDS_pept        352705..353739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="BBta_0344"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /function="Lysine, diaminopimelate; Threonine; Methionine"
FT                   /EC_number="1.2.1.11"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32635"
FT                   /db_xref="GOA:A5E8Z1"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Z1"
FT                   /protein_id="ABQ32635.1"
FT                   /translation="MGYKVAVVGATGNVGREMLNILDERKFPADEVVALASRRSVGVEV
FT                   SYGDRTLKVKALEHYDFADVDICLMSAGGTVSKEWSPKIGAAGAVVIDNSSAWRMDPDV
FT                   PLIVPEVNADAAAGFTKKHIIANPNCSTAQLVVALKPLHDKAHIKRVVVSTYQSVSGAG
FT                   KDAMDELFSQTKAVYTNDELVNKKFPKRIAFNVIPHIDVFMEDGFTKEEWKMMAETKKI
FT                   LDPKIKLTATCVRVPVFVGHSEAVNVEFEQPITADEAREILRRAPGCLVIDKQEPGGYA
FT                   TPYEAAGEDATYISRIREDATVENGLAFWCVSDNLRKGAALNAIQIAEVLINRKLITAK
FT                   KKAA"
FT   gene            353782..354348
FT                   /locus_tag="BBta_0345"
FT   CDS_pept        353782..354348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0345"
FT                   /product="putative membrane protein"
FT                   /function="Membrane"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32636"
FT                   /db_xref="GOA:A5E8Z2"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Z2"
FT                   /protein_id="ABQ32636.1"
FT                   /translation="MAEKTTTEPTRVQAPVSGQHAPSKLERGLEGFLFKSRWLMAPFYV
FT                   GLIVSLAVLLFKFVLLLWENVVHLPTAKESDIILGVLSLIDVCLTGNLVLIVVFSGYEN
FT                   FVSRIDPGGHPDWPEWMTKVDFAGLKQKLLASIVAISAIQLLKAFMNLDAGYDSVKLAW
FT                   LVGVHMTFVVSTVMLALSDRWSGGH"
FT   gene            complement(354415..355059)
FT                   /locus_tag="BBta_0346"
FT   CDS_pept        complement(354415..355059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0346"
FT                   /product="putative carbonic anhydrase 2"
FT                   /function="Central intermediary metabolism"
FT                   /EC_number="4.2.1.1"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32637"
FT                   /db_xref="GOA:A5E8Z3"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Z3"
FT                   /protein_id="ABQ32637.1"
FT                   /translation="MVSFPQRLLDGYRAFTTQRLPTEQSRYLELSERGQSPDVMVIGCC
FT                   DSRVSPEVIFDVGPGELFVLRNIANLVPIYQPDANAHGVSAALEYAVTVLKVKHIVILG
FT                   HAQCGGIRAFVDKAAPLSPGDFIGRWMSMFIKPGEVVEQRNHESFQDFVTRIEKAAVFR
FT                   SLENLMTFPFVRSRVEAGDLQLHGAYFGVAEGSLFVLDTATKEFKSARSGE"
FT   gene            355160..356038
FT                   /locus_tag="BBta_0347"
FT   CDS_pept        355160..356038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0347"
FT                   /product="putative citrate lyase beta chain"
FT                   /function="Unassigned reversible reactions; Cytoplasm"
FT                   /EC_number="4.1.3.34"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32638"
FT                   /db_xref="GOA:A5E8Z4"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Z4"
FT                   /protein_id="ABQ32638.1"
FT                   /translation="MIRPRRSLLFMPGSNARALEKGRNLPADGLILDLEDSVAPDAKAA
FT                   AREQIAKAVAADGYGKRELLIRINSLDTAWWADDVAMAGQAATDGILVPKVSTVEDLRL
FT                   VSDRLAEVGADPALKVWAMIETARAVLDADRLAATVHEAGSRLAGFVFGPNDISRETRI
FT                   RMLPGRATMLPMISHCILATRAHGLEILDGPYSDFANTDGFAQECIQARDLGFDGKTLI
FT                   HPGQIDACNAIFTPPAEEVAAARRIIAAFELPENASRGAIQIDGRMVERLHADMARRTI
FT                   AIADAIAAVGK"
FT   gene            complement(356042..356413)
FT                   /locus_tag="BBta_0348"
FT   CDS_pept        complement(356042..356413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0348"
FT                   /product="putative Cytochrome c precursor"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32639"
FT                   /db_xref="GOA:A5E8Z5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Z5"
FT                   /protein_id="ABQ32639.1"
FT                   /translation="MSLPKLHRNTWLHVGAAILLALGAMLLIRLHNAGGVTPATESVQA
FT                   GRKLAEAWCSSCHAIDAGGSRAQTTTAPDFVAVANMPSTTELALKVFLQSSHPTMPNVV
FT                   LTAEQRGDLVNYILSLKHI"
FT   gene            complement(356453..356869)
FT                   /locus_tag="BBta_0349"
FT   CDS_pept        complement(356453..356869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0349"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32640"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Z6"
FT                   /protein_id="ABQ32640.1"
FT                   /translation="MTAQAKPYPRVQFLIDTFAQWLRHRRELSELRQLDRDDFERIAMD
FT                   LQVTPADLDELVRHGEHAADELPQMLKALGIDEAALGRAEPLVLRDMERVCAMCKDKPR
FT                   CHRDLAAGTSAAHYEDYCLNAPTIDRLGAAAAKH"
FT   gene            complement(356980..357777)
FT                   /locus_tag="BBta_0350"
FT   CDS_pept        complement(356980..357777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0350"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Z7"
FT                   /protein_id="ABQ32641.1"
FT                   /translation="MTRVLPEVVTFWRGPLDRLRQTCLRSQLAAGHKVTVYSFDPLPGL
FT                   PDGVGNAEAEAILPYAFSERLRPPQPDGSWRDWTTLQFSDFFRMRLMAQGAGLWLDADV
FT                   LLLRPVEIDPAKPYFAWERPRQLGNSVLYLPPNDPIVAEFDALMAQEELTPNWLSLRHR
FT                   LTFALRRLRGVSNRLSDIRVAIFGPAALTALARRHGLLRHALPKRSFYAVHAEPKAFFD
FT                   PSDFAGLIGDPAIIGLHISPKGRGGEAPLPGSLYGWAADRFGA"
FT   gene            complement(357863..358465)
FT                   /gene="leuD"
FT                   /locus_tag="BBta_0351"
FT   CDS_pept        complement(357863..358465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="BBta_0351"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /function="Leucine; Cytoplasm"
FT                   /EC_number="4.2.1.33"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32642"
FT                   /db_xref="GOA:A5E8Z8"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E8Z8"
FT                   /protein_id="ABQ32642.1"
FT                   /translation="MDKFTTLEGVAAPLKIINVDTDMIIPKQYLKTIKRTGLGKGLFSE
FT                   QRYKDDGSENPDFVLNQPAYRNAKILVAGDNFGCGSSREHAPWALLDFGIRCVISTSFG
FT                   DIFYNNCFKNGILPIRVSQADLDKLFDDAERGANATLTVDLASQEIRGPDGGTVKFDID
FT                   PFRKHCLLNGLDDIGLTLEKKASIDSYEAKLAERAWA"
FT   gene            complement(358559..358921)
FT                   /locus_tag="BBta_0352"
FT   CDS_pept        complement(358559..358921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0352"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32643"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:A5E8Z9"
FT                   /protein_id="ABQ32643.1"
FT                   /translation="MEVMAHEMFERLPEHFRTMCEGVIIRVDDFPTEEVLDQLDAESEF
FT                   DLLGLFQGTGVPFRSNDDLPRLPNMIWLYRRPILDYWAEHDESLGHIVRHVLIHEIGHH
FT                   FGMSDDDMAAIEASVD"
FT   gene            359099..359404
FT                   /locus_tag="BBta_0353"
FT   CDS_pept        359099..359404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0353"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32644"
FT                   /db_xref="UniProtKB/TrEMBL:A5E900"
FT                   /protein_id="ABQ32644.1"
FT                   /translation="MLAGTALAAAFLISIPARAEQPTGAQLRSIPSGASTDVSAQRRPR
FT                   RVPIYPRYEGHWEPDVVPRYNPGPNAVRVCDATYVQENRPSGTVIVPHMSCTWRRG"
FT   gene            359683..359955
FT                   /locus_tag="BBta_0355"
FT   CDS_pept        359683..359955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0355"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32645"
FT                   /db_xref="UniProtKB/TrEMBL:A5E901"
FT                   /protein_id="ABQ32645.1"
FT                   /translation="MTVTKLLGIAAIGAVLALAAPAERAQALSLINPGAATAVQQGTVQ
FT                   ETSQVHWHGRRHWHPRRHYWHPRRHWHPHRHWHPHRHWHRHHRHW"
FT   gene            360038..360361
FT                   /locus_tag="BBta_0357"
FT   CDS_pept        360038..360361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0357"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32646"
FT                   /db_xref="GOA:A5E902"
FT                   /db_xref="UniProtKB/TrEMBL:A5E902"
FT                   /protein_id="ABQ32646.1"
FT                   /translation="MGSAMNAPLDTIRHNTTWHNKTWLGIGIVTVAMLLASSAATSPVV
FT                   SSPEKRQASRQAMVTALDLRLRPRPCKPADCWVEAPHYYGRPVHYRPSYPPGPVVLFTP
FT                   FLH"
FT   gene            complement(360374..360688)
FT                   /locus_tag="BBta_0358"
FT   CDS_pept        complement(360374..360688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0358"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32647"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A5E903"
FT                   /protein_id="ABQ32647.1"
FT                   /translation="MQLKIIDRAAYDRYLAGFFDVFRNYNVRLPAADEAPISVEGRWDG
FT                   DKIVLISFPDEYDFRAWAESAAYQELAPDRKAGAEAIVLLVRGFGERPDRTATLIRRRS
FT                   "
FT   gene            360884..361591
FT                   /locus_tag="BBta_0360"
FT   CDS_pept        360884..361591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0360"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32648"
FT                   /db_xref="UniProtKB/TrEMBL:A5E904"
FT                   /protein_id="ABQ32648.1"
FT                   /translation="MMRMKDQRAGLARRLSLAAAALFLLAGASSRPALAMSPVSPGVGS
FT                   RAQAPSDALTIQVRGPGGHGGGGGFHGGGGFHGGGGFHGGGGFHGGGGGFHAGPAFHGG
FT                   GAMFRGGGGPAFHGGHAFGGGGPRPVFHGGGPVFHGGGGPRPIFHGGGYHHHPHYAYRP
FT                   YFHHHRRHFYGYRSYYYPTYTTGYYYPYRRCRVVWTHYGPRRICHYRHWRGHHWRHHHR
FT                   WHHRHHRHHWRYY"
FT   gene            complement(361676..361891)
FT                   /locus_tag="BBta_0362"
FT   CDS_pept        complement(361676..361891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0362"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32649"
FT                   /db_xref="UniProtKB/TrEMBL:A5E905"
FT                   /protein_id="ABQ32649.1"
FT                   /translation="MADKPEFVDLIRDATRQRRRTPPAKIIAKPEAPKDERRLSNWPPG
FT                   RFAKWRLETLVPWKLTVKNWQFKDWL"
FT   gene            complement(362083..363489)
FT                   /gene="leuC"
FT                   /locus_tag="BBta_0363"
FT   CDS_pept        complement(362083..363489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="BBta_0363"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /function="Leucine; Cytoplasm"
FT                   /EC_number="4.2.1.33"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32650"
FT                   /db_xref="GOA:A5E906"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A5E906"
FT                   /protein_id="ABQ32650.1"
FT                   /translation="MSKPTTLYDKIWNDHLVHEAEDGTCLLYIDRHLVHEVTSPQAFEG
FT                   LRMTGRKVHAPEKTLAVVDHNVPTTDRSKPNPDPESIEQIKTLAENAREFGIEYYNEFD
FT                   RRQGIVHVIGPEQGFTLPGTTIVCGDSHTSTHGAFGALAHGIGTSEVEHVLATQTLIQK
FT                   KAKNMRVTVDGKLPDGVTGKDIILAIIGEIGTAGGTGYVLEYAGEAIRALSMEGRMTVC
FT                   NMSIEGGARAGLVAPDEKAYDFLRGRPKAPKGAAWDAAMRYWETLRSDDGAHFDHEIRL
FT                   DAAKLPPIVTWGTSPEDVISVTGVVPDPDKIADEAKRISKHRALKYMGLTAGTKITDIK
FT                   LDRVFIGSCTNGRIEDLRAAAKIAEGKTVSAHVNAMVVPGSGIVKEQAEAEGLDKIFIK
FT                   AGFEWREPGCSMCLAMNPDKLTPEERCASTSNRNFEGRQGFKGRTHLVSPAMAAAAAIA
FT                   GHFVDVRDWR"
FT   gene            complement(363892..364275)
FT                   /gene="rplS"
FT                   /locus_tag="BBta_0364"
FT   CDS_pept        complement(363892..364275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="BBta_0364"
FT                   /product="LSU ribosomal protein L19P"
FT                   /function="Translation; Ribosomal proteins; Ribosome;
FT                   Cytoplasm"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32651"
FT                   /db_xref="GOA:A5E907"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E907"
FT                   /protein_id="ABQ32651.1"
FT                   /translation="MNLIQQLEKEQFDKLSANKTIPEFGPGDTVIVNVKVVEGDRTRVQ
FT                   AYEGVCIGRSGGGINESFTVRKISYGEGVERVFPILSPMIDSIKVVRRGKVRRAKLYYL
FT                   RQLRGKSARIVEKQDRQQAAVNE"
FT   gene            complement(364383..365141)
FT                   /gene="trmD"
FT                   /locus_tag="BBta_0365"
FT   CDS_pept        complement(364383..365141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="BBta_0365"
FT                   /product="tRNA (Guanine37-N(1)-) methyltransferase"
FT                   /function="RNA modification; Cytoplasm"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32652"
FT                   /db_xref="GOA:A5E908"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A5E908"
FT                   /protein_id="ABQ32652.1"
FT                   /translation="MTASPAAPWRATVLTLFPEMFPGPLGVSLAGRALTGGIWSLEARD
FT                   IRASATDKHRSVDDTPAGGGPGMVLRADVLAAAIDAADVAPERPRLLMSPRGRPLTQAA
FT                   VRDLAAGPGPLIVCGRFEGIDQRVIDARELIEVSIGDYVLSGGEIAALVLIDACVRLLP
FT                   GVMGKLESGTDESFSDGLLEYPQYTRPQLFEGRTIPDVLTSGDHAKVAAWRRSQSEALT
FT                   QARRPDLWAEWQTREQSRTGQKAPKSTTDG"
FT   gene            complement(365309..365905)
FT                   /gene="rimM"
FT                   /locus_tag="BBta_0366"
FT   CDS_pept        complement(365309..365905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="BBta_0366"
FT                   /product="16S rRNA processing protein RimM"
FT                   /function="RNA modification"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32653"
FT                   /db_xref="GOA:A5E909"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E909"
FT                   /protein_id="ABQ32653.1"
FT                   /translation="MSKLICVAKIGAAHGVRGEVRLWTFTEDPLAVLHYGPLTTKDGSR
FT                   SFEVAKAREAKDHLVATIKGVTDRNAAERLNGLELYVPRDRLPETDDDEYYHADLIGLA
FT                   AETTAGAPLGRVLAIHNFGAGDIIEIAPPSGSTLMLPFTNAVVPTVDLAGGRVIIELPA
FT                   EIEGEDQDSSDNAGSPEGDAAASNSARHPRESGDP"
FT   gene            complement(366034..366366)
FT                   /gene="rpsP"
FT                   /locus_tag="BBta_0367"
FT   CDS_pept        complement(366034..366366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="BBta_0367"
FT                   /product="SSU ribosomal protein S16P"
FT                   /function="Translation; Ribosomal proteins; Ribosome;
FT                   Cytoplasm"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32654"
FT                   /db_xref="GOA:A5E910"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E910"
FT                   /protein_id="ABQ32654.1"
FT                   /translation="MSVVIRLARAGTKKRPVYHVVVADSRFPRDGRFIERLGYFNPLMP
FT                   KDNEARLKLDMEKVKGWLAKGAQPSDRVARFLDAAGVKKREARQNPIKAVPRKERKAQA
FT                   EAAAKG"
FT   gene            complement(366506..368053)
FT                   /gene="ffh"
FT                   /locus_tag="BBta_0368"
FT   CDS_pept        complement(366506..368053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="BBta_0368"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /function="The Type II (General) Secretory Pathway (IISP)
FT                   Family"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32655"
FT                   /db_xref="GOA:A5E911"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="UniProtKB/TrEMBL:A5E911"
FT                   /protein_id="ABQ32655.1"
FT                   /translation="MFDNLSERLGGILDRLTGRGSLSEADVDAAMREVRRALLEADVAL
FT                   EVVRSFTERVREQAIGATVVKSVTPGQMVVKIVHDELVKTLGDDGQTIDLNAVPPVPIM
FT                   MVGLQGSGKTTTTAKLARRMVQRDKRKVLMASLDVYRPAAMEQLAVLGRDLDIPTLPIV
FT                   AGQMPPQIARRAIEAAKLGGYDVVLLDTAGRTTLDEDMMKEAAEIKAVANPHEVLLVAD
FT                   SLTGQDAVNLARAFDQRVGLTGIALTRIDGDGRGGAALSMRAVTGKPIKLLGTGEKTDA
FT                   LEDFYPSRIAGRILGMGDIVSLVEKAAANIDAEKAARAAEKMRKGQFDLNDMREQLLQM
FT                   AQMGGISGLMGMMPGISKMKNQIAAAGIDDKILKRQVAIIDSMTREERKHPDLLKASRK
FT                   KRIAAGSGQSVEHVNKLLKMHRNMADVMKAMGSGKRGPLAGIAQAMGFGGGGGMPSPEQ
FT                   LKALAEKMPGGMPGGLPNLPKDLPAGLRGGLPNLPGLTGLSGKPTLPGLGLPPGKKK"
FT   gene            368399..369391
FT                   /locus_tag="BBta_0369"
FT   CDS_pept        368399..369391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0369"
FT                   /product="putative metallo-hydrolase/oxidoreductase"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32656"
FT                   /db_xref="GOA:A5E912"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A5E912"
FT                   /protein_id="ABQ32656.1"
FT                   /translation="MLRRSRTYSGPVTDHFDGKRFYDPDGAPPKSLSEVLRWQFDRNGK
FT                   RARWPKWAPSPHADTPPHKVHGQAARLSFIGHASWLVQTGGLNILIDPVWSERVSPFSF
FT                   AGPRRHNDPGIAFEALPHIDVVLVSHGHYDHLDLRTLSRLTARFAPRVVTPLGNDLTMT
FT                   AADAKIRAEAYDWHDRVALNDEVAVTLVPTRHWTARGVFDRNKALWASFVLETPRGKFY
FT                   IVCDSGYGTGKHFRRVAELHAPIRLAILPIGAYEPRWFMRDQHMNPEEAVQALQDCGAE
FT                   TALAHHHGTFQLTDEAIDAPVHALHAALDLAGIPRDRFGTLKPGQVVEV"
FT   gene            complement(369478..370188)
FT                   /locus_tag="BBta_0370"
FT   CDS_pept        complement(369478..370188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0370"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32657"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:A5E913"
FT                   /protein_id="ABQ32657.1"
FT                   /translation="MMIRPILAAAIASCVALPAVAQDGPRLDMPAITVSGEASVSAPPD
FT                   LAQIDAGVASDAKTAREAAEANNAAMAKVLQALKTAGLADKDVQTSRLSLQPQYAPNRP
FT                   GQTQVTGYRASNRVTIKLREVGKVASVIDTVVGAGANDVGNVYFTVAEPSKLLDDAREK
FT                   AVADARRKAEIYAKAAGVTLGKPLSISEDGASAPVFRAKNFGAPMAATPTPVAQGEETL
FT                   SITVNVTWAIKAGP"
FT   gene            complement(370194..370916)
FT                   /locus_tag="BBta_0371"
FT   CDS_pept        complement(370194..370916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0371"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32658"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:A5E914"
FT                   /protein_id="ABQ32658.1"
FT                   /translation="MNFSTFRLVLAVSSVAVALGGPVARAQAPAAPTAPAVSATPSPAP
FT                   STPPAPAAAAPAASPTPAASASPSPPPSPAPGQAPAAAPTQTTDAFGDEIKLEAKKVVL
FT                   VKGTANWDNAFDTLIDSFKALSTMLDKQGVKPAGNGMIVYTSTDDNGFTFLAEMPIEQE
FT                   PKTLGKGMSIGQSPEGKALKFVHRGSYDNMDNTYEAITNHLDERRLEAKDTFIEEYMTD
FT                   PLKTAEDKLVINVYVPLK"
FT   gene            371086..371955
FT                   /gene="dapF"
FT                   /locus_tag="BBta_0372"
FT   CDS_pept        371086..371955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="BBta_0372"
FT                   /product="diaminopimelate epimerase"
FT                   /function="Lysine, diaminopimelate"
FT                   /EC_number="5.1.1.7"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32659"
FT                   /db_xref="GOA:A5E915"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E915"
FT                   /protein_id="ABQ32659.1"
FT                   /translation="MSALANHSFVKMNGIGNEIVVLDLRDVKHVVTPDEARAVAARVPY
FT                   DQLMVLQPPRLDGTEAFIRIYNNDGSESGACGNGMRCVVRQVFEKTGQASATFETRAGL
FT                   LNCWQGPAPDLYTVDMGVPKFGWQEIPLAEEFRDTRYIELQIGPIDAPILHSPSVVNMG
FT                   NPHAVFWVDGDVNSYDLERFGPLLENHPIFPERANITLAHIVDRDHITMRTWERGAGLT
FT                   KACGSAACATAVAAARLKRANRIVQMTLPGGELTIEWRERDDHVLMTGTATFEFEGRFE
FT                   PQLFASVA"
FT   gene            371952..373256
FT                   /locus_tag="BBta_0373"
FT   CDS_pept        371952..373256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0373"
FT                   /product="putative MiaB-like tRNA modifying enzyme"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32660"
FT                   /db_xref="GOA:A5E916"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:A5E916"
FT                   /protein_id="ABQ32660.1"
FT                   /translation="MSVDVVTFGCRLNAFESELIARHAEAAGASDTIVINSCAVTNEAV
FT                   AQARQTIRKLKRERPAARIVVTGCAAQTQAGMFADMPEVDRVMGNEDKLQLDAWRATAQ
FT                   ALAPPRFGIDTSEKVAVSDIMAVTEMAPHLVEGFQRGLPRVFVQVQNGCDHRCTFCIIP
FT                   FGRGNSRSVPMGAVVDQVRALAARGHAEIVLTGVDLTSYGHDLPGTPKLGRLVKQILRH
FT                   VPELQRLRISSIDSIEADADLLDALADDARLMPHLHLSLQAGDDLILKRMKRRHSRADA
FT                   VAFCDHVRLLRPDIALGADLIAGFPTETEDMFVRSLELVEECGLAFLHVFPYSPRPGTP
FT                   AARMPQVDGAVIRERARRLRAAGEVALRQRLDAEIGCEREVLIESATQGRTEHYLPVAV
FT                   TGAASGTVQRLKIAGHDESKLLVQSSLSSLGQAGR"
FT   gene            complement(373309..374196)
FT                   /locus_tag="BBta_0374"
FT   CDS_pept        complement(373309..374196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0374"
FT                   /product="putative RNA pseudouridine synthase (Uracil
FT                   hydrolyase)"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32661"
FT                   /db_xref="GOA:A5E917"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A5E917"
FT                   /protein_id="ABQ32661.1"
FT                   /translation="MLARVLHRDGLMLVIDKPAGIPVHKGPKGGANLEASFDALRFGLP
FT                   RPPVLAHRLDKETSGCLVLGRHRKATASLGLLFKHGKISKTYWAVVEGGPDADEGVIEL
FT                   PLGKLNAERGWWQKPDPQGQPAVTKWRVLGRSYSLVPPSPNSASTCSTDSPPPYGGQTS
FT                   ESRSAGSGVGVPTGSLARSHPPPQPSPTRGEGAQGAGGESVHATGSPRLTWLAMEPITG
FT                   RTHQLRVHAASQGWPIVGDNIYGNGPRFGEPRLHLHAREISIPLSKNKPPVHVVAPAPM
FT                   HMHERLRLCGWNGE"
FT   gene            374287..375234
FT                   /gene="ftsY"
FT                   /locus_tag="BBta_0375"
FT   CDS_pept        374287..375234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="BBta_0375"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /function="The Type II (General) Secretory Pathway (IISP)
FT                   Family; Cell division; Membrane"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 11 :
FT                   Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32662"
FT                   /db_xref="GOA:A5E918"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="UniProtKB/TrEMBL:A5E918"
FT                   /protein_id="ABQ32662.1"
FT                   /translation="MNDTTSETPKLSWWRRLSAGLKRTSGALGTAVADLVTKRKLDRAM
FT                   LDDIEDVLLRADLGTQVAARIAEAVGAGRYDKAISADEVKAVVATEVEKVLSPVAKPLV
FT                   VEASHKPFVILVVGVNGSGKTTTIGKLAAKFASDGKQVMLAAGDTFRAAAIEQLKVWGE
FT                   RTKAPVIAGAQGSDSASLAFTAITAAKEQARDILLIDTAGRLQNKAELMNELEKVVRVI
FT                   RKVDASAPHAVLLVLDATVGQNALSQVEAFHRTAGVTGLVMTKLDGTARGGILVALSEK
FT                   FKLPVHFIGVGEGVDDLQPFAARDFARAIAGIDD"
FT   gene            375321..375923
FT                   /locus_tag="BBta_0376"
FT   CDS_pept        375321..375923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0376"
FT                   /product="putative intracellular septation protein
FT                   (ispA/ispZ family), putative membrane protein"
FT                   /function="Cell division; Membrane"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32663"
FT                   /db_xref="GOA:A5E919"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E919"
FT                   /protein_id="ABQ32663.1"
FT                   /translation="MDKTQPHPLFKLATELGPLIVFFVVNAKFNLFAATGAFMVAIVAA
FT                   MIASYVVTKHVPLMAIVTGIVVLVFGTLTLVLHDETFIKLKPTIIYGLFAAVLGGGLLF
FT                   NRSFIAIMFDQMFNLTPAGWRILTFRWALFFAAMAVLNEIIWRTQSTDFWVGFKAFGVV
FT                   PLTMIFAIAQMPLIKRYHQDPASLEASDAAEGDVSKG"
FT   gene            complement(376030..376626)
FT                   /gene="ccmG"
FT                   /gene_synonym="cycY"
FT                   /gene_synonym="dsbE"
FT                   /gene_synonym="yejQ"
FT                   /locus_tag="BBta_0377"
FT   CDS_pept        complement(376030..376626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmG"
FT                   /gene_synonym="cycY"
FT                   /gene_synonym="dsbE"
FT                   /gene_synonym="yejQ"
FT                   /locus_tag="BBta_0377"
FT                   /product="periplasmic thioredoxin (cytochrome c
FT                   biogenesis)"
FT                   /function="Cytochromes; Thioredoxin, glutaredoxin;
FT                   Chaperoning, folding; Periplasmic space"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 9 : Periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32664"
FT                   /db_xref="GOA:A5E920"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5E920"
FT                   /protein_id="ABQ32664.1"
FT                   /translation="MTEQAATEPAPRRRSFLMLLPLVVFLGLAALFWFRLGNGDPSRIP
FT                   SALIGRPAPNTPLPALPELAKDGTPVPGLDPAALKGKVSIVNVWASWCVPCHDEAPLLV
FT                   ELGRDKRFQIIGINYKDGADNARRFLGRYGNPYDVVGVDGNGRAGIEWGVYGVPETFVV
FT                   GREGTIVYKLVGPITAQNLDAVLKPEIEKALKAGG"
FT   gene            complement(376623..376802)
FT                   /gene="ccmD"
FT                   /gene_synonym="cycX"
FT                   /locus_tag="BBta_0378"
FT   CDS_pept        complement(376623..376802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmD"
FT                   /gene_synonym="cycX"
FT                   /locus_tag="BBta_0378"
FT                   /product="heme exporter protein D (Cytochrome c biogenesis
FT                   protein)"
FT                   /function="Cytochromes; Chaperoning, folding"
FT                   /note="Evidence: Function of strongly homologous gene"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32665"
FT                   /db_xref="GOA:A5E921"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:A5E921"
FT                   /protein_id="ABQ32665.1"
FT                   /translation="MDLGPYTSFIATSYLAAALVVVLLIAWIAIDYRTQKARLRALEES
FT                   GIVRRSGRAATDIQ"
FT   gene            complement(376804..377580)
FT                   /gene="ccmC"
FT                   /gene_synonym="cycZ"
FT                   /gene_synonym="yejT"
FT                   /gene_synonym="yejU"
FT                   /locus_tag="BBta_0379"
FT   CDS_pept        complement(376804..377580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmC"
FT                   /gene_synonym="cycZ"
FT                   /gene_synonym="yejT"
FT                   /gene_synonym="yejU"
FT                   /locus_tag="BBta_0379"
FT                   /product="heme ABC transporter (heme exporter protein C),
FT                   permease protein (cytochrome c biogenesis)"
FT                   /function="Cytochromes; Chaperoning, folding; Membrane;
FT                   Inner membrane"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32666"
FT                   /db_xref="GOA:A5E922"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:A5E922"
FT                   /protein_id="ABQ32666.1"
FT                   /translation="MSLIDLANPTRFLALTARLLPWLALVTVVLLAAGLYLSALAPDDY
FT                   QQGATVKIMFIHVPNAWLSMFVWGVMSLASLGTLVWRHPLADVAAKAAAPIGASFTFLA
FT                   LLTGSLWGRPMWGTYWEWDARLTSVLILFLMYLGLMALWRAVEDPTRAARAAAVLTLVG
FT                   AINLPIIKFSVDWWNTLHQPASVMRMGGPALDKSFLIPLLVMAIGFSFLFVTLHVAAMR
FT                   NEILRRRVRSLQMMQARAYTGSAPASGATGPIVGAA"
FT   gene            complement(377673..378341)
FT                   /gene="ccmB"
FT                   /gene_synonym="cycW"
FT                   /gene_synonym="yejV"
FT                   /locus_tag="BBta_0380"
FT   CDS_pept        complement(377673..378341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmB"
FT                   /gene_synonym="cycW"
FT                   /gene_synonym="yejV"
FT                   /locus_tag="BBta_0380"
FT                   /product="heme ABC transporter (heme exporter protein B),
FT                   permease protein (cytochrome c biogenesis)"
FT                   /function="Cytochromes; Chaperoning, folding; membrane
FT                   component; Membrane; Inner membrane"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32667"
FT                   /db_xref="GOA:A5E923"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:A5E923"
FT                   /protein_id="ABQ32667.1"
FT                   /translation="MTALAALIRRDIRIALRIGGGALIGVLFFLTVVVLMPFAVGPDLA
FT                   LLTRLGPAILWLGALLASLLTLDRLFTADHEDGSLDLIVMSRTPLELACAAKALAHWLA
FT                   AGLPLVIATPVLGLLLNLDATATGAVALTLLAGTPALTFIGMIGAALAVTMSRGGLLLA
FT                   VLVLPLSIPVLIFGVAASQAAIVGPLPFGAPFSILCALSLVSFVIGPFAAATSLRNGLD
FT                   "
FT   gene            complement(378727..379296)
FT                   /gene="ccmA"
FT                   /gene_synonym="cycV"
FT                   /gene_synonym="yejW"
FT                   /locus_tag="BBta_0381"
FT   CDS_pept        complement(378727..379296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /gene_synonym="cycV"
FT                   /gene_synonym="yejW"
FT                   /locus_tag="BBta_0381"
FT                   /product="heme ABC transporter (heme exporter protein A),
FT                   ATP-binding protein (cytochrome c-type biogenesis)"
FT                   /function="Heme, porphyrin; Cytochromes; Chaperoning,
FT                   folding; ATP binding component; Cytoplasm"
FT                   /EC_number="3.6.3.41"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32668"
FT                   /db_xref="GOA:A5E924"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E924"
FT                   /protein_id="ABQ32668.1"
FT                   /translation="MRGGREVFAGLAFEAVAGEALAVTGHNGAGKTSLLRLIAGLLLPA
FT                   GGTIAIEGSEAELTVPEQAHYLGHRDALKPALSVRENLAFWADFLGGGTTRPIPDCLAA
FT                   VGIAHAIDLPAGYLSAGQRRRLSLARLLAVPRLLWLLDEPTAALDVAGQAMFAGLMREH
FT                   LAGGGLIVAATHGPLGIDTRELRIGA"
FT   gene            379562..382279
FT                   /gene="acnA"
FT                   /gene_synonym="acn"
FT                   /locus_tag="BBta_0382"
FT   CDS_pept        379562..382279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnA"
FT                   /gene_synonym="acn"
FT                   /locus_tag="BBta_0382"
FT                   /product="aconitase"
FT                   /function="Tricarboxylic acid cycle; Anaerobic respiration;
FT                   Other stresses (mechanical, nutritional, oxidative)"
FT                   /EC_number="4.2.1.3"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32669"
FT                   /db_xref="GOA:A5E925"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A5E925"
FT                   /protein_id="ABQ32669.1"
FT                   /translation="MTSLDSFKCRKTLKVGTKSYIYYSLPTAEKNGLKDISKLPYSMKV
FT                   LLENLLRNEDGRTVTKDDIVAVSKWLRKKSLEHEIAFRPARVLMQDFTGVPAVVDLAAM
FT                   RNAMQKLGGDAEKINPLVPVDLVIDHSVIVNYFGDNKAFGKNVAEEYKQNQERYEFLKW
FT                   GQKAFSNFSVVPPGTGICHQVNLEYLAQTVWTKKEKMTVGRTKGTFEVAYPDSLVGTDS
FT                   HTTMVNGLAVLGWGVGGIEAEACMLGQPLSMLLPDVVGFKLTGALKEGVTATDLVLTVT
FT                   QMLRKLGVVGKFVEFFGPGLDHLSVADKSTIANMAPEYGATCGFFPVDAATIDYLKTSG
FT                   RKAPRVALVEAYAKAQGLFRTAKSPDPVFTQTLTLDLGDVVPSMAGPKRPEGRIALPAV
FT                   AEGFATALAGEYKKSDATQRFPVEGKDFDIGHGDVVIAAITSCTNTSNPSVLIGAGLLA
FT                   RNAAAKGLKAKPWVKTSLAPGSQVVAEYLANSGLQKDLDKVGFNLVGFGCTTCIGNSGP
FT                   LPEEISKSINDNGVVAAAVLSGNRNFEGRVSPDVQANYLASPPLVVAYALAGTVTKDLA
FT                   VEPIGIGKDKKPVYLKDIWPTTKEVNDFVKKFVKASIFKKRYADVFKGDTNWRKIKTVE
FT                   SETYRWNMSSTYVQNPPYFEGMKKEPEPIKDIVEARVLALFGDKITTDHISPAGSIKLT
FT                   SPAGKFLSEHQVRPADFNQYGTRRGNHEIMMRGTFANIRIKNFMLKGADGNIPEGGLTK
FT                   HWPDGEQMSIYDAAMKYQEEGVPLVVFAGAEYGNGSSRDWAAKGTRLLGVRAVICQSFE
FT                   RIHRSNLVGMGVLPLTFQEGTSWSSLGLKGDEKVTIKGLQGDLKPRQTLTAEIVSADGA
FT                   AQQVPLLCRIDTLDELDYYRNGGILHYVLRKLAA"
FT   gene            382469..383209
FT                   /locus_tag="BBta_0383"
FT   CDS_pept        382469..383209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0383"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32670"
FT                   /db_xref="InterPro:IPR010634"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5E926"
FT                   /protein_id="ABQ32670.1"
FT                   /translation="MSWWSRAALSVCAVIAFVRPAASDPRAVIELFTSQGCSSCPPADK
FT                   VLGDLARDPSVIALSLPIDYWDYLGWKDTLADSRFTARQRAYSRVRGDREVYTPQAVVN
FT                   GSVHVIGSDREAIEGAIEETAQGGAAMSVPVRLSIEGQELTVSIAAADEHMPRRHGEVW
FT                   VCSISRAVPIQVGRGENSGRELTYYNVVRNLLKLGDWTGASTSWSVPLEKIAKEGVDGA
FT                   VVYVQDGSRDRPGPMLGAAYSELH"
FT   gene            383636..384001
FT                   /locus_tag="BBta_0384"
FT   CDS_pept        383636..384001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0384"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32671"
FT                   /db_xref="InterPro:IPR021252"
FT                   /db_xref="UniProtKB/TrEMBL:A5E927"
FT                   /protein_id="ABQ32671.1"
FT                   /translation="MKLTPEDADPSENRAAARSAAAAPNRVTFDRLELNRILNLYGRMV
FT                   ADGEWRDYSIDFLRDRAVFSVFRRASEVPIYRIEKDPRLARKQGMYSVISATGLILRRG
FT                   HELERVLLVIAPKPALV"
FT   gene            complement(384087..384617)
FT                   /gene="pat"
FT                   /gene_synonym="bar"
FT                   /locus_tag="BBta_0385"
FT   CDS_pept        complement(384087..384617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pat"
FT                   /gene_synonym="bar"
FT                   /locus_tag="BBta_0385"
FT                   /product="phosphinothricin acetyltransferase (PPT
FT                   N-acetyltransferase)"
FT                   /function="Drug resistance/sensitivity"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence: Function of strongly homologous gene"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32672"
FT                   /db_xref="GOA:A5E928"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5E928"
FT                   /protein_id="ABQ32672.1"
FT                   /translation="MPDIDIRPTGEADLPAITAIYGQAVREGTATFELDAPDLTEMTRR
FT                   FRALTDGGFPYFVALLDGEVVGYAYAGPYRPRPAYRFTVENSIYLAPASQRRGIGRRLM
FT                   QRLITACEERGFRQMIAVIGDSANAGSVGLHRACGFQMIGTHPSVGLKFGRWLDTVMMQ
FT                   LPLGAGGSNVPAA"
FT   gene            complement(384800..385591)
FT                   /locus_tag="BBta_0386"
FT   CDS_pept        complement(384800..385591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0386"
FT                   /product="putative transport protein"
FT                   /function="Transport; Membrane; Inner membrane"
FT                   /note="putative membrane protein; Evidence: Function
FT                   proposed based on presence of conserved amino acid motif,
FT                   structural feature or limited homology; Localization: 11 :
FT                   Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32673"
FT                   /db_xref="GOA:A5E929"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:A5E929"
FT                   /protein_id="ABQ32673.1"
FT                   /translation="MSDLDRNYASPFGRVAGRADAATVDAGLRAYMLRIYNYMSIGLAI
FT                   TGLAALGVYMASVTGDPAAGVFKFGNAYLTQFGYAMFVSPLKWLFILAPLVMVFAISAG
FT                   INRLAPSTAQILFWVFSALMGISLSSIFLVYTHTSIVRVFFITAATFGALSLYGYTTKR
FT                   DMTGMGSFLFMGLIGIVLASLVNLFLASSMLQFIVSVVGVFVFAGLTAWDTQRLKNEYI
FT                   YGYASAGGDIAERAAITGALSLYLNFINLFTLLLQLLGQRD"
FT   gene            complement(385855..388425)
FT                   /locus_tag="BBta_0387"
FT   CDS_pept        complement(385855..388425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0387"
FT                   /product="putative ABC transporter, permease protein"
FT                   /function="membrane component"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32674"
FT                   /db_xref="GOA:A5E930"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:A5E930"
FT                   /protein_id="ABQ32674.1"
FT                   /translation="MSSVAEPIPAGRMAWLPVRYALRELRGGLRGFYVFIACIALGVLA
FT                   IAGVGSVAASLNDGLVREGRTLLGGDVAFSLFQREAKPEEIAFLRSRGEVSLAATLRAM
FT                   VRSNDAKLALVELKAVDDAYPLLGKAELQPDLPLSDILAERGGAYGAAADPALLARLDL
FT                   KVGDTVSIDTVRFQIRSALQAEPDKLSGGIGLGPRFLISEAGLRATPLLQPGSLVRWTY
FT                   RVRLPDNAKDDHAAASFIADTRLTLPSAGWEIRSRSNASPQLERTIGRFTQFLTLVGLA
FT                   ALLVGGVGVANAVKSHVDRRTEVIAAFKALGATSRDVFGIYLVQVMVLATIGSIIGLCA
FT                   GAALPFVIVGLFGKILPLPVIPALHPDELALSFVYGLLTALAFGLWPLGRIRDVPVAAL
FT                   FREAVIAEWHRPRWSYLALIAGTVALLVAVVIGLSYDKNIAAVFVVAAALVFVLLRGIA
FT                   AVVMASARAMPRSRFPMLRLAVSNIYRPGALTPSVVLSLGLGLAVLVTITQIDGNLRRQ
FT                   FLAQLPEQAPSFFFIDVPSGEAERFRGFLKELAPQSSVDDVPMLRGRIVSARGVRAEDL
FT                   KATAETEWVLQSDRGLTYTGEIPKGSKVVEGEWWGESYSGPPLVSIEKRIADGLGLKLG
FT                   DDIVVNVLGRDIAARIGNMRTIDWQGLGINFVLVFSPNAFKGAPHTHVATLTEVRSDAA
FT                   EDARVIRKVADAFPMVTSVRVREVMETVGTVVSNLALAIRGASAVTLISAILVLGGALA
FT                   AGHRHRVYDAVILKTLGATRLRLLGAYVLEYLMIGFATAAFGVIAGSVAAWLIVTRLMT
FT                   LSFAWQAGSAAMVVLAALVVTVGLGLAGTLLALNQKPASVLRNL"
FT   gene            complement(388422..389129)
FT                   /locus_tag="BBta_0388"
FT   CDS_pept        complement(388422..389129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0388"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /function="ATP binding component; Cytoplasm"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32675"
FT                   /db_xref="GOA:A5E931"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E931"
FT                   /protein_id="ABQ32675.1"
FT                   /translation="MAGTAPDTITIANVNLSLGTGAARVHILKDISLRVGQGETIGLIG
FT                   PSGSGKSTLLMVMAGLERPDSGQVVVNGTAFNALDEDALARFRGRQVGIVFQSFHLIPT
FT                   MTALENVAVPLELAGHSGAAERAARELDSVGLGHRLHHYPTQLSGGEQQRVALARALAP
FT                   DPAILVADEPTGNLDETTGRQIVDLLFTKHAERGMTLVLVTHDSGLAHRCDRVVRLRSG
FT                   RIEADGAHEPALA"
FT   gene            389212..389844
FT                   /gene="tesA"
FT                   /gene_synonym="apeA"
FT                   /gene_synonym="pldC"
FT                   /locus_tag="BBta_0389"
FT   CDS_pept        389212..389844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesA"
FT                   /gene_synonym="apeA"
FT                   /gene_synonym="pldC"
FT                   /locus_tag="BBta_0389"
FT                   /product="multifunctional acyl-CoA thioesterase I"
FT                   /function="Unassigned reversible reactions; Periplasmic
FT                   space"
FT                   /EC_number="3.1.2.-"
FT                   /EC_number="3.1.1.5"
FT                   /note="protease I; lysophospholipaseL(I); Localization: 9 :
FT                   Periplasmic; Evidence: Function of homologous gene
FT                   experimentally demonstrated in an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32676"
FT                   /db_xref="GOA:A5E932"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A5E932"
FT                   /protein_id="ABQ32676.1"
FT                   /translation="MHILVLMLAMMTMGPAFAGAEAGKPIKLVVLGDSLSAGLGLSASD
FT                   AFPAKLQKALNDKGLKVEMTNAGVSGDTSSGGRDRLDWSVADGTEAVIVELGANDALRG
FT                   IDPSVTRQALTEIVQRLKARGIAVMLCGMLAPPNYGSDYAAKFNAIYPDLAKQFDVQLY
FT                   PFFLDGVAADPKLNQADGIHPTAAGVDIIVSRMLPMVEAFLRPLREQ"
FT   gene            390050..390589
FT                   /locus_tag="BBta_0390"
FT   CDS_pept        390050..390589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0390"
FT                   /product="putative 2'-5' RNA ligase"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32677"
FT                   /db_xref="GOA:A5E933"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:A5E933"
FT                   /protein_id="ABQ32677.1"
FT                   /translation="MPRLFTGLEIPAEVGQTLSNLRGGLPGARWIDPENYHVTLRFIGD
FT                   IDGASANEIAAMLWRVNRKPFEVTVQGLSSFGGRKPRAVVANIAPSRPLIELQAELERM
FT                   MQRIGLDPEGRKFVPHVTLARLHDASSQDVADYLSVRGYFPSRVFVAERFVLFSSRAST
FT                   GGGPYVVEDAYDLCAV"
FT   gene            390794..391975
FT                   /locus_tag="BBta_0391"
FT   CDS_pept        390794..391975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0391"
FT                   /product="putative ATPase (yhcM) AFG1 family"
FT                   /function="Unassigned reversible reactions"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32678"
FT                   /db_xref="GOA:A5E934"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E934"
FT                   /protein_id="ABQ32678.1"
FT                   /translation="MLSTPSDAFRAQYQSLVDTGAIEADPAQAEVADALAALERRLSTY
FT                   KPARKQSLLGRLFFDKSEPPRGLYVHGEVGRGKTMLMDLFYQNCPVEHKRRAHFHEFMA
FT                   EVHERIYGYRQNIARGELADTDVIGLTAQAIFEQSWLLCFDEFHVTDIADAMILGRLFA
FT                   RLFELGTVVVATSNVAPEDLYKGGLNRALFLPFIKHIADHMDVVRLDARTDFRLEKLAG
FT                   VKMWLVPADVEARTALDNAWGRLTGHARCRSRDITIKGRLLHVPCSANGVARFGFADLC
FT                   EKPLAASDYLRLAHDYHTILIDHIPVMDYAERNAAKRFITLIDTLYDNAVKLIASAEAD
FT                   PISLYVATDGIEAMEFKRTSSRLIEMGSESYLALPHGRKDSAASGTSTGLVET"
FT   gene            392201..393169
FT                   /gene="mdh"
FT                   /locus_tag="BBta_0392"
FT   CDS_pept        392201..393169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="BBta_0392"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /function="Glycol degradation; Tricarboxylic acid cycle;
FT                   Gluconeogenesis; Glyoxylate degradation; Aerobic
FT                   respiration"
FT                   /EC_number="1.1.1.37"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32679"
FT                   /db_xref="GOA:A5E935"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E935"
FT                   /protein_id="ABQ32679.1"
FT                   /translation="MARDKIALIGSGQIGGTLAHLIGLKELGDVVMFDIAEGVPQGKAL
FT                   DIAQSSPVDGFDAHYSGANSYEALDNAKVCIVTAGVPRKPGMSRDDLLSINLKVMEQVG
FT                   AGIKKYAPDAFVICITNPLDAMVWALQKASGLPAKKVVGMAGVLDSARFRYFLADEFNV
FT                   SVEDVTAFVLGGHGDTMVPLTKYSTVAGIPLPDLVKMGWTSQARIDEIVDRTRNGGAEI
FT                   VNLLKTGSAYYAPAASAIAMAESYLRDKKRVLPCAAHLNGEFGVKDMYVGVPVVIGSKG
FT                   VERIVEIELAGKDREAFDKSVAAVQGLVDACKKIAPDLLGR"
FT   gene            393292..394488
FT                   /gene="sucC"
FT                   /locus_tag="BBta_0393"
FT   CDS_pept        393292..394488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="BBta_0393"
FT                   /product="succinyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /function="Tricarboxylic acid cycle; Aerobic respiration"
FT                   /EC_number="6.2.1.5"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32680"
FT                   /db_xref="GOA:A5E936"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E936"
FT                   /protein_id="ABQ32680.1"
FT                   /translation="MNIHEYQAKALLHEFGVPISKGVPVLRPEDSDAAAKALGGPVWVV
FT                   KSQIHAGGRGKGKFKEASAGDKGGVRLAKSIDEVNAFAKQMLGATLVTVQTGPDGKQVN
FT                   RLYIEDGSDIDKEFYLSLLVDRETSKVAFVVSTEGGVNIEDVAHSTPEKIITFSVDPAT
FT                   GVMPHHGRAVAKALKLSGDLAKQAEKLTIQLYTAFVAKDMAMLEINPLVVTKQGQLRVL
FT                   DAKVSFDSNALFKHPEVVALRDETEEDAKEIEASKYDLNYVALDGTIGCMVNGAGLAMA
FT                   TMDIIKLYGMEPANFLDVGGGASKEKVAAAFKIITADPNVKGILVNIFGGIMKCDVIAE
FT                   GVVAAVKEVGLKVPLVVRLEGTNVDLGKKIISESGLNVLPADNLDDAAQKIVKAVKGG"
FT   gene            394545..395429
FT                   /gene="sucD"
FT                   /locus_tag="BBta_0394"
FT   CDS_pept        394545..395429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="BBta_0394"
FT                   /product="succinyl-CoA synthetase (ADP-forming) alpha
FT                   subunit"
FT                   /function="Tricarboxylic acid cycle; Aerobic respiration"
FT                   /EC_number="6.2.1.5"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32681"
FT                   /db_xref="GOA:A5E937"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5E937"
FT                   /protein_id="ABQ32681.1"
FT                   /translation="MSILIDKNTKVICQGFTGKNGTFHSEAAIAYGTKMVGGTSPGKGG
FT                   STHLGLPVFDTVKEAREATGADASVIYVPPPGAADAICEAIDAEVPLIVCITEGIPVLD
FT                   MVRVKRSLQGSKSRLIGPNCPGVMTAGECKIGIMPANIFKPGSVGIVSRSGTLTYEAVF
FT                   QTTSEGLGQTTAVGIGGDPVKGTEFIDMLEMFLADPKTESIIMIGEIGGSAEEDAAQFI
FT                   KDEAKRGRKKPMVGFIAGVTAPPGRRMGHAGAIISGGKGDAGSKTAAMEAAGITVSPSP
FT                   ARLGKTLVEKLKS"
FT   gene            395571..398528
FT                   /gene="sucA"
FT                   /gene_synonym="lys"
FT                   /locus_tag="BBta_0395"
FT   CDS_pept        395571..398528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /gene_synonym="lys"
FT                   /locus_tag="BBta_0395"
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /function="Tricarboxylic acid cycle; Aerobic respiration"
FT                   /EC_number="1.2.4.2"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32682"
FT                   /db_xref="GOA:A5E938"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="UniProtKB/TrEMBL:A5E938"
FT                   /protein_id="ABQ32682.1"
FT                   /translation="MSRQDANAAFALSSFLQGTNATYIDEIYARYEKDPSSVDADWQEF
FT                   FKSLKDAPADVQKNASGPSWERSNWPVSPRDELTSALDGNWAVVEKKVGEKIAAKAQTK
FT                   GVELSPADINQATRDSVRALMLIRAYRMRGHFHAKLDPLGIEAPRNREELDPRSYGFTE
FT                   ADYDRKIFLDHVLGLEYGSLREIVAICERTYCQTLGVEFMHISNAAQKAWIQERIEGPD
FT                   KEISFTREGRRAILTKLIEAEGFEKFCDVKFTGTKRFGLDGGESLIPALEQIIKRGGNL
FT                   GVKEIVLGMPHRGRLNVLTQVMGKPHRALFHEFKGGSANPDAVEGSGDVKYHLGASSDR
FT                   EFDGNRIHLSLTANPSHLEIVDPVVLGKVRAKQDQHGDPPDMRISVLPLLMHGDAAFAG
FT                   QGVVAECFALSDLKGYRTGGSIHFIVNNQIGFTTYPRYSRSSPYPSDVAKMIDAPIFHV
FT                   NGDDPEAVVFAAKVATEFRQKFHKPVVIDMFCYRRHGHNEGDEPAFTQPVMYKKIAGHP
FT                   STLEIYSKRLVAEGVMTEGEVEKAKADWRARLDAEFEAGTSYRPNKADWLDGKWAGLKS
FT                   ADQEEEARRGVTGVEIDRLKEIGRKITKVPDGFRLHRTIQRFLENRAKAIDSGVGLDWA
FT                   TGEALAYCSLLLEGHKVRLSGQDSERGTFSQRHSVLIDQEDESRYTPFNHLAPEQGHFE
FT                   VINSLLSEEAVLGFEYGYSLAEPTALTLWEAQFGDFANGAQVLFDQFISSGERKWLRMS
FT                   GLVCLLPHGYEGQGPEHSSARLERYLQMCAEDNMQVVYPTTPANYFHVLRRQLHREIRK
FT                   PLIVMTPKSLLRHKRAVSRLEELAKGTTFHRILYDDAQMQADDKTKLVPDDQIRRIVLC
FT                   SGKVYYDLYDEREKRGLNDIYLMRIEQLYPVPLKALVAELGRFKNAEVVWCQEEPRNMG
FT                   AWHFIEPYLEWVLNQTGGKSKRPRYAGRAASAATATGLMSKHLAQLKALLDEALN"
FT   gene            398665..399900
FT                   /gene="sucB"
FT                   /gene_synonym="odhB"
FT                   /locus_tag="BBta_0396"
FT   CDS_pept        398665..399900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /gene_synonym="odhB"
FT                   /locus_tag="BBta_0396"
FT                   /product="2-oxoglutarate dehydrogenase E2 component"
FT                   /function="Tricarboxylic acid cycle; Aerobic respiration"
FT                   /EC_number="2.3.1.61"
FT                   /note="acid-inducible; Evidence: Function of homologous
FT                   gene experimentally demonstrated in an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32683"
FT                   /db_xref="GOA:A5E939"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A5E939"
FT                   /protein_id="ABQ32683.1"
FT                   /translation="MTEIRVPTLGESVTEATIGRWFKKAGDAVAVDEPLVELETDKVTI
FT                   EVPAPSAGTLGEIIAKDGETVAVGALLGQINDGAVAAKPAAAAPAPAKPAAAPAAAAPA
FT                   PAKALPADTPQAPSVRKLSAESGVDATTVPGSGKDGRVTKGDMLAAIERAASAPTPVNQ
FT                   PAAAVQVRAPSPADDAAREERVKMTRLRQTIARRLKDVQNTAAMLTTFNEVDMTNVMAL
FT                   RSQYKDVFEKKHGSKLGFMGFFTKAVVQALKDIPAVNAEIDGSDLIYKNYYHIGVAVGT
FT                   DKGLVVPVVRDCDHKSIADIEKGIADFGRRARDGQLKIDEMQGGTFTITNGGIYGSLMS
FT                   TPILNAPQSGILGMHKIQERPVVVGGKIEIRPMMYLALSYDHRVIDGKEAVTFLVRVKE
FT                   SLEDPARLVLDL"
FT   gene            399968..400714
FT                   /locus_tag="BBta_0397"
FT   CDS_pept        399968..400714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0397"
FT                   /product="putative oxidoreductase (YgfF), NAD(P)-binding
FT                   domain protein"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32684"
FT                   /db_xref="GOA:A5E940"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5E940"
FT                   /protein_id="ABQ32684.1"
FT                   /translation="MTDRVAVITGGSRGIGRATALAAASRGFKIVVGYASNEAAAQSTV
FT                   AAIEASNGKAIAVKCDVGREHDILALFKAADKFGTLGALINNAGIVGPTTRVDEMSAER
FT                   IERLMAVNVTGSILCAREAVKRMSTRHGGKGGVIINLSSVAAKLGSPNTYVDYAASKGA
FT                   IDSFTVGLGHEVASEGIRVAAIRPGLIDTDIHASGGEPDRAHRLAPMVPMKRVGTADEI
FT                   ANAIVWLLSDEASYVTSAILDVSGGR"
FT   gene            400760..402163
FT                   /gene="lpd"
FT                   /gene_synonym="dhl"
FT                   /gene_synonym="lpdA"
FT                   /locus_tag="BBta_0398"
FT   CDS_pept        400760..402163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpd"
FT                   /gene_synonym="dhl"
FT                   /gene_synonym="lpdA"
FT                   /locus_tag="BBta_0398"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /function="Glycol degradation; Glycine cleavage; Pyruvate
FT                   dehydrogenase; Tricarboxylic acid cycle; Aerobic
FT                   respiration; Anaerobic respiration; Formyl-tetrahydrofolate
FT                   biosynthesis; Glyoxylate degradation; Cytoplasm"
FT                   /EC_number="1.8.1.4"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32685"
FT                   /db_xref="GOA:A5E941"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5E941"
FT                   /protein_id="ABQ32685.1"
FT                   /translation="MANYDLVVIGTGPGGYVCAIRAAQLGMKVAVVEKNATLGGTCLNV
FT                   GCMPSKALLHASELFEEAGHSFAKMGIKVPAPEIDLPAMMNFKQQGIDGNVKGVEFLMK
FT                   KNKIDVLQGKGKILGTGKVQVTGNDGTAQTVETKNIVIATGSDIARLKGIEIDEKRIVS
FT                   STGALSLDKIPSSLLVVGAGVIGLELGSVWRRLGAKVTVVEFLDRILPGMDLEIAKQFQ
FT                   RILEKQGFAFKLGAKVTGVDTSGATLAATIEPAAGGAAEKIEADVVLVAIGRVPYTDGL
FT                   GLQEAGVVLDNRGRVQIDHHFATSVPGVYAIGDVVAGPMLAHKAEDEGVAVAEILAGQA
FT                   GHVNYDVIPGVVYTTPEVASVGKTEDELKQAGVAYTVGKFPFTANGRSKVNQTTDGFVK
FT                   ILADAKTDRVLGAHIIGREAGELIHEAAVLMEFGGSAEDLARTCHAHPTRSEAVKEAAL
FT                   AVGKRAIHM"
FT   gene            402293..402832
FT                   /locus_tag="BBta_0399"
FT   CDS_pept        402293..402832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0399"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32686"
FT                   /db_xref="GOA:A5E942"
FT                   /db_xref="UniProtKB/TrEMBL:A5E942"
FT                   /protein_id="ABQ32686.1"
FT                   /translation="MLRRLLQPFWVLLAIIFLIEAWLWDHLEPIVARIVAAIPLRSLKH
FT                   WLAARIETLSPALTLVVFVVPVVLLFPLKLLGMWLLMHHQWKLALGTIVFGKMVGVGIT
FT                   AFIFDVTRSKLLQMPWFAWLYDAVLTLRRKAAALVDPIKQRIREIVSDVLGGNTRGWSA
FT                   RLVRQITRFRRSVQAR"
FT   gene            complement(403028..403618)
FT                   /locus_tag="BBta_0400"
FT   CDS_pept        complement(403028..403618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0400"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32687"
FT                   /db_xref="GOA:A5E943"
FT                   /db_xref="InterPro:IPR025570"
FT                   /db_xref="UniProtKB/TrEMBL:A5E943"
FT                   /protein_id="ABQ32687.1"
FT                   /translation="MSAHESMEHAEHAEHASGENKKIALLIAVIALFLALSETLGKGAQ
FT                   TESISKNVEASNLWAFFQAKTVRRTVVQTAAEQGKLNLPALPDEATKAALQKQIDDWQK
FT                   NAARYRSEPETGEGSEQLAARAKHAEEERDLATAKYHHYELASAAFQIGIVLASATIIT
FT                   GMLVLAWASGALAVVGIAMTVLGLFQPHLLHLH"
FT   gene            complement(403699..404673)
FT                   /gene="xerC"
FT                   /gene_synonym="ripX"
FT                   /locus_tag="BBta_0401"
FT   CDS_pept        complement(403699..404673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /gene_synonym="ripX"
FT                   /locus_tag="BBta_0401"
FT                   /product="tyrosine recombinase XerC subunit"
FT                   /function="DNA recombination"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32688"
FT                   /db_xref="GOA:A5E944"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A5E944"
FT                   /protein_id="ABQ32688.1"
FT                   /translation="MEKDISDAPQAPDLLGADEGVIRAMMQWLAHLRSERRLSPKTVEA
FT                   YARDLRQCLQFLCTHWGGPVTLARFAALEAADIRAFMAMRRADDIAGRSLMRTLAGLRS
FT                   FGRFLEREGQGKVGALAGIRAPKIAKSLPKPLPMDAAKRLADADERAGETRETWVLARD
FT                   AAVMALLYGSGLRISEALGLKRREVPRPGEGDVLVVTGKGNKTRMVPVLQNVLQLIDDY
FT                   ARLCPYPLPAEGPMFLGAKGGPLSPRIIQLAMERLRGALGLPDSATPHALRHSFATHLL
FT                   SRGGDLRAIQELLGHASLSTTQVYTGIDSERLLQVYASAHPRR"
FT   gene            404918..407128
FT                   /gene="priA"
FT                   /gene_synonym="srgA"
FT                   /locus_tag="BBta_0402"
FT   CDS_pept        404918..407128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /gene_synonym="srgA"
FT                   /locus_tag="BBta_0402"
FT                   /product="replication restart DNA helicase PriA"
FT                   /function="DNA replication; Cytoplasm"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32689"
FT                   /db_xref="GOA:A5E945"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="UniProtKB/TrEMBL:A5E945"
FT                   /protein_id="ABQ32689.1"
FT                   /translation="MDRATDLFPGAPSTAGVVDVLVPVALDHTYSYRVPRGMALKPGDV
FT                   VGVPLGAREVLAVVWAENANPDPRLHNRLKDVSEKLDVPPLKPELRSLVDWVANYTLSP
FT                   RGMVLRMCLRMGEHLGPERVRLGVRLVGDAPKRLTPARRRVIEAVSDGLLHGKSDLVRE
FT                   IGVSGSVIDGLVDEGTLTVEAMPRTLPPPAPDPDFARPEFFDAQLAGVAAMRTLAANGT
FT                   FQVALLDGVTGSGKTEVYFEAVAETIRRGRQSLILMPEIALTGQFLERFSRRFGVRPLE
FT                   WHSELTPRTRQRNWASIAAGEAPVVVGARSALFLPYADLGLIVVDEEHDQAYKQDEGAH
FT                   YHARDMAVVRGHIAKFPVVLASATPSVETEVNARKGRYQRVALPSRFGGQHMPHIEAID
FT                   LRREPPPRGRYISPRLAGEIRTAIERGEQALLFLNRRGYAPLTLCRACGHRFACTICDA
FT                   WLVDHRFRQRLVCHHCGFSMPRPPTCPHCAAEESLVAVGPGVERLQEEAAALFPDARSM
FT                   VLSSDLITSIETMRAELTEIAEGRVDLIIGTQLVAKGHNFPRLNLVGVVDADLGLGNGD
FT                   PRAAERTWQLLNQVIGRAGREQGRGRGYLQTHQPEHPVMKALVACDREAFYTSEIEARE
FT                   RTGYPPFGRLGSLIISAGDRPTAEGFARRLVASAPREEGVLLLGPAEAPLAVIKGRYRF
FT                   RLLLKSARNFDLSDYLRHWLAHAEKPKGNLKLEVDVDPQSFL"
FT   gene            complement(407285..407833)
FT                   /locus_tag="BBta_0403"
FT   CDS_pept        complement(407285..407833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0403"
FT                   /product="hypothetical protein"
FT                   /note="rare lipoprotein A (RlpA-like) domain; putative
FT                   secreted protein; Evidence: Similar to previously reported
FT                   genes of unknown function; Localization: 10 : Secreted"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32690"
FT                   /db_xref="GOA:A5E946"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A5E946"
FT                   /protein_id="ABQ32690.1"
FT                   /translation="MLKLKNLSAGKIAGSRTALAVAVTLIVGGSATEASARSRHHHHHA
FT                   RHHHHHMARQAAQPAADSFSNGWSSNGSSWMNANASVTPTSGTGRTFSGMASYYGNESG
FT                   SRTASGQRMNANAMTCAHRSLPFGTKLRVTHGGQSVIVTVNDRGPFIRGRVLDLSTGAA
FT                   RAIGLTRAGVGRVTAEVVS"
FT   gene            408484..409044
FT                   /gene="atpH"
FT                   /locus_tag="BBta_0405"
FT   CDS_pept        408484..409044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="BBta_0405"
FT                   /product="ATP synthase F1 subcomplex delta subunit"
FT                   /function="ATP proton motive force interconversion; The
FT                   H+/Na+-translocating F-, V- and A-type ATPase (F-ATPase)
FT                   Superfamily; Membrane; Inner membrane"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 5 : Inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32691"
FT                   /db_xref="GOA:A5E947"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E947"
FT                   /protein_id="ABQ32691.1"
FT                   /translation="MAAEDPPVSGVSGRYATALFELARDEKSVDAVKADLDKFNALLDE
FT                   SADLKRLVRSPVFGADVQLKALNAVLDKAGIAGVAANVLRVLTANRRLFAVADVIRAFN
FT                   ALVAKYKGEATADVTVAEPLSDKNLDALKASLKTVTGKDVALNVKVDPAIIGGLVVKLG
FT                   SRMIDSSLRTKLNSIKHAMKEAG"
FT   gene            409044..410573
FT                   /gene="atpA"
FT                   /gene_synonym="papA"
FT                   /gene_synonym="uncA"
FT                   /locus_tag="BBta_0406"
FT   CDS_pept        409044..410573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /gene_synonym="papA"
FT                   /gene_synonym="uncA"
FT                   /locus_tag="BBta_0406"
FT                   /product="ATP synthase F1 subcomplex alpha subunit"
FT                   /function="ATP proton motive force interconversion; The
FT                   H+/Na+-translocating F-, V- and A-type ATPase (F-ATPase)
FT                   Superfamily; Membrane; Inner membrane"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 5 : Inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32692"
FT                   /db_xref="GOA:A5E948"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E948"
FT                   /protein_id="ABQ32692.1"
FT                   /translation="MDIRAAEISAILKDQIKNFGQEAEVTEVGQVLSVGDGIARVYGLD
FT                   NVQAGEMVEFENGTRGMALNLETDNVGVVIFGADREIKEGQTVKRTRAIVDAPVGKGLL
FT                   GRVVDALGNPIDGKGPIQFTERKRVDVKAPGIIPRKSVNEPMATGLKAIDALIPIGRGQ
FT                   RELIIGDRQTGKTAIALDTILNQKPLNAQPDEKIKLYCVYVAVGQKRSTVAQFVKVLEE
FT                   QGALEYSIVVAATASDPAPMQYLAPFTGCTMGEYFRDNGMHAVIIYDDLSKQAVAYRQM
FT                   SLLLRRPPGREAYPGDVFYLHSRLLERAAKLNETQGAGSLTALPVIETQANDVSAYIPT
FT                   NVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYRE
FT                   MAAFAQFGSDLDAATQRLLNRGSRLTELLKQPQFSPLKMEEQVCVIWAGTNGYLDALPL
FT                   GKVRAFEDGLLSLLRGKHADLLNTIRDTRDLSDDSAAKLKAAVEGFAKTFS"
FT   gene            410727..411605
FT                   /gene="atpG"
FT                   /gene_synonym="papC"
FT                   /gene_synonym="uncG"
FT                   /locus_tag="BBta_0407"
FT   CDS_pept        410727..411605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /gene_synonym="papC"
FT                   /gene_synonym="uncG"
FT                   /locus_tag="BBta_0407"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /function="ATP proton motive force interconversion; The
FT                   H+/Na+-translocating F-, V- and A-type ATPase (F-ATPase)
FT                   Superfamily; Membrane; Inner membrane"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 5 : Inner
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32693"
FT                   /db_xref="GOA:A5E949"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E949"
FT                   /protein_id="ABQ32693.1"
FT                   /translation="MASLKDMRVRIASTKATQKITKAMQMVAASKLRRAQLAAEAARPY
FT                   AEKMDAVISNIAAASAGSPASSKLLAGTGRDQVHLLLVCTGERGLSGAFNSSIVRLARE
FT                   RALALMNQGKDVKFFCVGRKGYEQLRRQFEKQIIAHVDLRSVRQIGFVHAEDIAKQVIA
FT                   RFDAGEFDVCTLFYSRFKSVIAQIPTAQQIIPLVVEAPAANAAPVALYEYEPEEDEILS
FT                   ALLPRNVGVQIFRALLENNASFYGAQMSAMDNATRNAGEMIRKQTLVYNRTRQAQITKE
FT                   LIEIISGAEAV"
FT   gene            411696..413138
FT                   /gene="atpD"
FT                   /gene_synonym="papB"
FT                   /gene_synonym="uncD"
FT                   /locus_tag="BBta_0408"
FT   CDS_pept        411696..413138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /gene_synonym="papB"
FT                   /gene_synonym="uncD"
FT                   /locus_tag="BBta_0408"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /function="ATP proton motive force interconversion; The
FT                   H+/Na+-translocating F-, V- and A-type ATPase (F-ATPase)
FT                   Superfamily; Membrane; Inner membrane"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 5 : Inner
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32694"
FT                   /db_xref="GOA:A5E950"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E950"
FT                   /protein_id="ABQ32694.1"
FT                   /translation="MATAANQIGRITQVIGAVVDVQFEGHLPAILNSLETKNAGNRLVL
FT                   EVAQHLGESTVRTIAMDTTEGLVRGQEVTDTGAPIRVPVGEGTLGRIINVIGEPIDEAG
FT                   PVKADSLRAIHQEAPSYTDQSTEAEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVL
FT                   IQELINNVAKAHGGYSVFAGVGERTREGNDLYHEFIESKVNADPHNPDPSVKSKCALVF
FT                   GQMNEPPGARARVALTGLTIAEDFRDKGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAV
FT                   GYQPTLATDMGALQERITTTTKGSITSVQAIYVPADDLTDPAPATSFAHLDATTTLSRS
FT                   IAEKGIYPAVDPLDSTSRMLSPLVVGEEHYAVARQVQQVLQRYKALQDIIAILGMDELS
FT                   EEDKLTVARARKVERFMSQPFHVAEIFTGSPGKFVELADTIKGFKGLVEGKYDHLPEAA
FT                   FYMVGTIEEAVEKGKKLAAEAA"
FT   gene            413238..413645
FT                   /gene="atpC"
FT                   /gene_synonym="papG"
FT                   /gene_synonym="uncC"
FT                   /locus_tag="BBta_0409"
FT   CDS_pept        413238..413645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /gene_synonym="papG"
FT                   /gene_synonym="uncC"
FT                   /locus_tag="BBta_0409"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /function="ATP proton motive force interconversion; The
FT                   H+/Na+-translocating F-, V- and A-type ATPase (F-ATPase)
FT                   Superfamily; Membrane; Inner membrane"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 5 : Inner
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32695"
FT                   /db_xref="GOA:A5E951"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E951"
FT                   /protein_id="ABQ32695.1"
FT                   /translation="MATFHFDLVSPEKIAFSGEVDQVDVPGQEGDFGVLAGHAPFVATL
FT                   RPGILTVTAGGTQQKIIVLGGLAEISEKGLTILADVATSLKELDQTAFAAEISGMEAKL
FT                   NEKQGNELDRAIERLDHFKTIQQQLNTTALH"
FT   gene            413810..415471
FT                   /locus_tag="BBta_0410"
FT   CDS_pept        413810..415471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0410"
FT                   /product="Putative adenylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32696"
FT                   /db_xref="GOA:A5E952"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A5E952"
FT                   /protein_id="ABQ32696.1"
FT                   /translation="MAGQIVLKRKIAAILAADIAGYSRLVAEDEEETLRRLAAYREVVD
FT                   DFIARAGGRIFNTAGDAVLAEFPSAVEAVRCAIDIQESLRTRNRDFPPNRQMSYRIGIT
FT                   IGDVVERDGDLLGDGVNIAARLEGLADVGGICISRAVHEQVANKLSVQFADMGAREVKN
FT                   IPTPVHAFRVAMRREDGTFAATVTKKARALRLLGWLALTAVTLAAIGVGTALYLDYRDP
FT                   PPAQRDAAKAAAEALARLSATPASPVSSSSKPPASPGAQPPSTPEPQSSPQASPVIAAE
FT                   RFAADAVPFVSERTRIALARDYVPAPAHKAFATTINGVSAYVTGQSSEEAAKAAALEQC
FT                   RQRAETSNGSRKCELYAVGDSVVFPHSKPPLPPLPWVRHDPTTERAFSAAEMPLVNDSG
FT                   RARLEANYAPGRRSKAIALGPKGHFVFSVGADLVEDAVRRNLESCGAQAGTPCMIVALD
FT                   DAFVVPVPTVLKATGFFHATSAPAIAADSRDEVVRRLAASPSGWNAVAVGTAGHPGFGL
FT                   NGDREETAIGGALADCSTQDSDCRVIAIGPFTVEPN"
FT   gene            complement(415468..415989)
FT                   /gene="nudH"
FT                   /gene_synonym="ialA"
FT                   /gene_synonym="invA"
FT                   /gene_synonym="ygdP"
FT                   /locus_tag="BBta_0411"
FT   CDS_pept        complement(415468..415989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudH"
FT                   /gene_synonym="ialA"
FT                   /gene_synonym="invA"
FT                   /gene_synonym="ygdP"
FT                   /locus_tag="BBta_0411"
FT                   /product="(Di)nucleoside polyphosphate hydrolase"
FT                   /function="Defense/survival"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence: Function of strongly homologous gene"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32697"
FT                   /db_xref="GOA:A5E953"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/TrEMBL:A5E953"
FT                   /protein_id="ABQ32697.1"
FT                   /translation="MDESMTETRPYRPNVGIALFNADGLVFLGRRFRDDGPEIILPGLE
FT                   WQMPQGGVDPGEDLQAAARRELWEETGIRDAEILGESDWLTYEFPPFKDPNHRLAGFRG
FT                   QRQKWFAMRFTGREADIDPVTPRNGQPAEFDAWRWEQLARVPDLVVPFRREVYRAVAQA
FT                   FSGIARSGGY"
FT   gene            complement(416129..416635)
FT                   /gene="nudH"
FT                   /gene_synonym="ialA"
FT                   /gene_synonym="invA"
FT                   /gene_synonym="ygdP"
FT                   /locus_tag="BBta_0412"
FT   CDS_pept        complement(416129..416635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudH"
FT                   /gene_synonym="ialA"
FT                   /gene_synonym="invA"
FT                   /gene_synonym="ygdP"
FT                   /locus_tag="BBta_0412"
FT                   /product="(Di)nucleoside polyphosphate hydrolase"
FT                   /function="Defense/survival"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence: Function of strongly homologous gene"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32698"
FT                   /db_xref="GOA:A5E954"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E954"
FT                   /protein_id="ABQ32698.1"
FT                   /translation="MTRYEDLPYRTCVGIALINSEGLVFIGRRAGGIEHVDDAHVWQMP
FT                   QGGVDPGEDAWEAAKRELYEETSVRSVEKLAEIDDWLTYDIPRTVAGRAWKGRYRGQRQ
FT                   KWFALRFTGTDTEIDVERPGGGVHKAEFISWRWEPMQNLPTLIVPFKRPVYERVVKEFA
FT                   ALAGK"
FT   gene            complement(416713..417936)
FT                   /locus_tag="BBta_0413"
FT   CDS_pept        complement(416713..417936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0413"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32699"
FT                   /db_xref="GOA:A5E955"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A5E955"
FT                   /protein_id="ABQ32699.1"
FT                   /translation="MTETADELSAPLGQTEKRRRRRIRLPFTLLQALAVLLGLFLVVFA
FT                   GFALFGDNPLGGEPIARIAINAGAKPDDKSGAAKPDAKHGATAEHGAAAPAKQDGGDRK
FT                   TVTIIDGSSGARQEVAIGGGGSETAEPGAAAPAASQMPGVDPRLLEKSRYGMIPVMADG
FT                   VKPFTAYAAEADRAKAARMPAVAIVIGGLGVGAAKTVEAIMKLPPAVTLAFTPYGADPT
FT                   KLAERARAQRHEILLQVPMEPYDYPDNDPGPQTLLATLGPDQNIDRLFWHMSRLQGYVG
FT                   IGNFMGARFVATEAAMQPIVNEAAKRGLALFDDGAAPRSVAASLAAGRAMPFAKGDVAI
FT                   DAVPTPVEIDNALAKLESLAKERGIAIGTASALPVSIDRIGAWIKGLDRKGILLVPLTT
FT                   AMLKSKSN"
FT   gene            complement(418112..419383)
FT                   /gene="ctpA"
FT                   /locus_tag="BBta_0414"
FT   CDS_pept        complement(418112..419383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="BBta_0414"
FT                   /product="C-terminal processing peptidase-3, Serine
FT                   peptidase, MEROPS family S41A"
FT                   /function="Proteases, cleavage of compounds"
FT                   /EC_number="3.4.21.102"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32700"
FT                   /db_xref="GOA:A5E956"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A5E956"
FT                   /protein_id="ABQ32700.1"
FT                   /translation="MGSTARAATADTYRQLNLFGDVFERVRSDYVEKPDDSKLVESAIS
FT                   GMLSGLDPHSSYMDAKSFRDMQVQTRGEFGGLGIEVTMEDGLIKVVSPIDDTPASKAGI
FT                   QANDIITNLDEEAVQGLTLNQAVEKMRGPVGTKIKLKVVRKGADNPLDITLTRDNIRVR
FT                   SVRSRIESDDIAYIRITTFNEQTTEGLKKSIADLQTQIGDKLKGYVIDLRNNPGGLLEE
FT                   AVTVSDAFLERGEIVSTRGRNAEETQRRSAHAGDLTKGKPVIVLINGGSASASEIVAGA
FT                   LQDHKRATLVGTRSFGKGSVQTIIPLGAGNGALRLTTARYYTPSGKSIQAKGIVPDIEV
FT                   LQDVPDELKSRTDTKGEASLRGHLKNDGDEKTGSQSYVPPDAKDDKALKLAADLLHGIK
FT                   NSANTPAPTTDKAAADKPATKAAN"
FT   gene            complement(419467..420804)
FT                   /locus_tag="BBta_0415"
FT   CDS_pept        complement(419467..420804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0415"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function; Localization: 10 : Secreted"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32701"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A5E957"
FT                   /protein_id="ABQ32701.1"
FT                   /translation="MTAAVSLAALALAPLGLTPLTSTPAAAQTGLRPSIAGTPSPTPPT
FT                   PEQLKQRAQELEAARAAQKAAAEAQERLKAEIATLGEDRGKLNQQLIDVASQVRSVEVR
FT                   VGEAETRLRGLDGREQDLRNSLEARRTEIIEVLAALQRAGRRTPPALLVRPEDALQSLR
FT                   TAMLLGSVVPEMRGRAEKLSTDLGELVALRKTIATERDKLAADRDKLRTDQTRLAALVE
FT                   ERQRKQATAEKDMEAESLRAVALAQQIDTLQGLISTMELDIKSAAKAASTASLQGVPVN
FT                   SKPDANALRNPGRKTPAIAFASTKGMLTYPVNGTKLREFGASDGAGGVDKGISLAARPG
FT                   AQVTTPCDGWVVYAGPFRSYGQLLILNAGGGYHVLIAGMERISVNIGQFVQTGEPVATM
FT                   GTTSQVASILATNASQPVLYVEFRKDGTPIDPGPWWAANEGEKVRG"
FT   gene            complement(420907..421389)
FT                   /locus_tag="BBta_0416"
FT   CDS_pept        complement(420907..421389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0416"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32702"
FT                   /db_xref="GOA:A5E958"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E958"
FT                   /protein_id="ABQ32702.1"
FT                   /translation="MRIVVIAVGRLKQGPERELAERYRERFDDLGRKLGFRGLDLHELP
FT                   ESRARDAATRISEEAAAIAALIPGRSVLVCLDERGQNIDSASLAAQIGRWRDEGVPAAV
FT                   FVIGGADGLSPELRRRAKLGVAFGAATWPHQIVRVLLFEQIYRTATILAGHPYHRA"
FT   gene            complement(421488..421934)
FT                   /locus_tag="BBta_0417"
FT   CDS_pept        complement(421488..421934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0417"
FT                   /product="hypothetical protein"
FT                   /note="Iojap-related protein domain; Evidence: Similar to
FT                   previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32703"
FT                   /db_xref="GOA:A5E959"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:A5E959"
FT                   /protein_id="ABQ32703.1"
FT                   /translation="MSQSALPKTKATTSKSATAKARKTPTHDAALQAQPDADKTLRTIL
FT                   SRLEDMKAEETVTIDLHGKSAYSDYMVITTGRSNRHVGSIAENVAKGLKEAGAKKVHIE
FT                   GLPNCDWVLIDSGDVIVHVFRPEVREFYNLERLWTQGPNPAKTL"
FT   gene            complement(422150..422728)
FT                   /locus_tag="BBta_0418"
FT   CDS_pept        complement(422150..422728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0418"
FT                   /product="putative nicotinate-nucleotide
FT                   adenylyltransferase"
FT                   /function="Nicotinamide adenine dinucleotide (NAD)"
FT                   /EC_number="2.7.7.18"
FT                   /note="NadD-like; Evidence: Function proposed based on
FT                   presence of conserved amino acid motif, structural feature
FT                   or limited homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32704"
FT                   /db_xref="GOA:A5E960"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E960"
FT                   /protein_id="ABQ32704.1"
FT                   /translation="MRIGLLGGSFNPPHQAHRAISLFALKRLQLDRVWWLVTPGNPLKD
FT                   NGGLHALAERAAAARKVAADPRIEISCLESVIGTRYTADTIDYLRRRASRLRFVWIMGA
FT                   DNLAQFHRWQKWQHIAAQVPMAVVDRPPRSFRALNAPAARALARYRLPEADAGRLADRA
FT                   APAWVYLTGLKLSLSSTGLRNPDGSWKSI"
FT   gene            complement(422837..424126)
FT                   /gene="proA"
FT                   /gene_synonym="pro (1)"
FT                   /locus_tag="BBta_0419"
FT   CDS_pept        complement(422837..424126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /gene_synonym="pro (1)"
FT                   /locus_tag="BBta_0419"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /function="Proline; Cytoplasm"
FT                   /EC_number="1.2.1.41"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32705"
FT                   /db_xref="GOA:A5E961"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E961"
FT                   /protein_id="ABQ32705.1"
FT                   /translation="MTAPLKAIDGSADLPALMNDLASRARAAARVLALAPAAQKNRALE
FT                   AMERLIRARVDTIIAANAEDVVEAKAAGITSSFLDRLTLTPARVAAMADGIAAVREVAD
FT                   PIGIVTESWQRPNGMTIERVRVPLGVIGVIFESRPNVAADAGVLCLKSGNAVILRGGSD
FT                   SFRSCRAIHECLVEGLREAGLPDAAITLVPTRDRAAVGLLLSGLNGGVDVIVPRGGKNL
FT                   VARVEAEARVPVFAHLEGVNHVYVDGAADLEMAKSIVLNAKMRRTGVCGAAETLLIDRA
FT                   SQDKIKPLVDTLINAGCEVRGDDAVRAADARVKPASNEDWDTEYLDAVIAAKVVDGVEG
FT                   AIAHIQAHGSHHTDAIVTADVAAADKFLNEVDSAIVLHNASTQFADGGEFGFGAEIGIA
FT                   TGKFHARGPVGVEQLTSFKYRIHGTGQTRP"
FT   gene            complement(424206..424673)
FT                   /locus_tag="BBta_0420"
FT   CDS_pept        complement(424206..424673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0420"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32706"
FT                   /db_xref="UniProtKB/TrEMBL:A5E962"
FT                   /protein_id="ABQ32706.1"
FT                   /translation="MSEIVTRATLPKRPLPGLVICYSYLWHREAEKRQIEGLKNRPCAV
FT                   VLTYERIRAFPDRIVADVVPITHAASRDAIEIPIAVKRRMGLDQDHSWIVTSELNRFFW
FT                   PGHDIRRAREDWQPGGPMWHWGFLPVSLFSSVKDAVLRHRAAATLSVTPRS"
FT   gene            complement(424670..424930)
FT                   /locus_tag="BBta_0421"
FT   CDS_pept        complement(424670..424930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0421"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32707"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A5E963"
FT                   /protein_id="ABQ32707.1"
FT                   /translation="MAKNFGEWHDKAMREPVVITKHGRESAVLLSAETFQKLVDGYREV
FT                   ILATDLTDALAGAVVNSEIPEQYRWEADDDVTDERRGVGGE"
FT   gene            complement(425021..426157)
FT                   /gene="proB"
FT                   /gene_synonym="pro (2)"
FT                   /locus_tag="BBta_0422"
FT   CDS_pept        complement(425021..426157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /gene_synonym="pro (2)"
FT                   /locus_tag="BBta_0422"
FT                   /product="glutamate 5-kinase"
FT                   /function="Proline; Cytoplasm"
FT                   /EC_number="2.7.2.11"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32708"
FT                   /db_xref="GOA:A5E964"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E964"
FT                   /protein_id="ABQ32708.1"
FT                   /translation="MASPRLENFRRIVVKVGSSLLVDSEAGEVRASWLAALAADIARLH
FT                   GRGCELLVVSSGSIALGRSRLKLPRGPLKLEESQAAAAVGQIALARIWSEVLGDHGIGA
FT                   GQILVTLQDTEERRRYLNARSTIAKLLDWRAVPVINENDTVATAEIRYGDNDRLAARVA
FT                   TMASADLLVLLSDIDGLYTAPPAQDPNARLIPVVESITADIEAMAGSAASEFSRGGMRT
FT                   KIEAAKIATTGGTHMLIASGKIEHPLAAIANGGRCTWFLTPANPVTARKRWIAGSLEPK
FT                   GTLTIDAGAVTALRAGKSLLPAGVIRVDGQFARGDAVVVRGPDTHEIGRGLVAYDADDA
FT                   ERIKGRSSPDVAVILGISGRAEMIHRDDLVIGPAGAMG"
FT   gene            complement(426315..427385)
FT                   /gene="obgE"
FT                   /gene_synonym="cgtA"
FT                   /gene_synonym="obg"
FT                   /gene_synonym="yhbZ"
FT                   /locus_tag="BBta_0423"
FT   CDS_pept        complement(426315..427385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="obgE"
FT                   /gene_synonym="cgtA"
FT                   /gene_synonym="obg"
FT                   /gene_synonym="yhbZ"
FT                   /locus_tag="BBta_0423"
FT                   /product="GTP-binding protein with nucleoside triP
FT                   hydrolase domain"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32709"
FT                   /db_xref="GOA:A5E965"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E965"
FT                   /protein_id="ABQ32709.1"
FT                   /translation="MKFLDEAKVYVRSGDGGNGCVAFRREKFIEFGGPNGGNGGRGGDV
FT                   VIEAVDGLNTLIDYRYQQHFKAQRGGNGSGKDCHGAGGKSVVLKVPVGTQIFDEDRETL
FT                   IHDFTTVGERFVLAQGGNGGFGNAHFKSPTNRAPRHANPGQPGEERWIWLRMKLIADAG
FT                   LVGLPNAGKSTFLSKVSAAKPKIADYPFTTLHPQLGVVNADGREFVLADIPGLIEGAHE
FT                   GAGLGDRFLGHVERCRVLLHLVDATCEHAGKAYKTVRHELEAYGGDLTDKVEIVALNKI
FT                   DAVDPDELKKQKDRLKRAAKKTPLLISGATGEGVKEALRKLADVISEQPVSIKAKSTSD
FT                   SAATEEPWAAPLPPQG"
FT   gene            427587..428504
FT                   /locus_tag="BBta_0424"
FT   CDS_pept        427587..428504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0424"
FT                   /product="putative permease of the drug/metabolite
FT                   transporter (DMT) superfamily"
FT                   /function="The Drug/Metabolite Transporter (DMT)
FT                   Superfamily"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32710"
FT                   /db_xref="GOA:A5E966"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A5E966"
FT                   /protein_id="ABQ32710.1"
FT                   /translation="MSVLSRISTANDERSARLAGIGLMLLSIAMFSFGDALGKFLVSTY
FT                   AVGQLLWLRACAALLLLAPFIWRNRAAFLQLERPWLQLVRVILSTLEVAAFFLATVYLP
FT                   LADVITYYLAGPIFVTALSALVLREHVGWRRWTAILIGFCGVLIALRPSAQTFSLPALI
FT                   ALGGSLSFAVLMLITRSLRSTPDIVMASSQFVGTFLLGAAMSSFGWVTPTPGSLLLFAA
FT                   AGIISVTALFCVNRSLKLAPASVVVPYQYTMIVWAVLFGFVVFGDVPHPATIIGASIII
FT                   GAGLYIYLRERSLGQGTGAVNPPA"
FT   gene            complement(428543..429130)
FT                   /locus_tag="BBta_0425"
FT   CDS_pept        complement(428543..429130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0425"
FT                   /product="hypothetical protein"
FT                   /note="acetyltransferase domain; Evidence: Similar to
FT                   previously reported genes of unknown function;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32711"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5E967"
FT                   /protein_id="ABQ32711.1"
FT                   /translation="MLQDITTPTLREARPCVLETPRLTLRPPVLADVKAIAQLADDRRI
FT                   AENTRRLPHPYSEVDAARFVRGLEQTGETAFLIEHLDAPIGLVGINRPAPGRAELGYWL
FT                   GVAHWGRGFGTEAARAAIDYFFDGSDETVLIGHARVSNPASRNILEKCGFQWTGVELHR
FT                   FEVIGSSAPVDAFRLTRGVWASLKAWANAGRR"
FT   gene            complement(429274..429543)
FT                   /gene="rpmA"
FT                   /gene_synonym="rpz"
FT                   /locus_tag="BBta_0426"
FT   CDS_pept        complement(429274..429543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /gene_synonym="rpz"
FT                   /locus_tag="BBta_0426"
FT                   /product="LSU ribosomal protein L27P"
FT                   /function="Translation; Ribosomal proteins; Ribosome;
FT                   Cytoplasm"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32712"
FT                   /db_xref="GOA:A5E968"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E968"
FT                   /protein_id="ABQ32712.1"
FT                   /translation="MAHKKAGGSSRNGRDSKGKRLGIKAFGGERVIPGNIIARQRGTTW
FT                   HPGLNVGMGTDHTLFAKIEGVVEFHARANRTFISVRPVAAQAAE"
FT   gene            complement(429677..430060)
FT                   /gene="rplU"
FT                   /locus_tag="BBta_0427"
FT   CDS_pept        complement(429677..430060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="BBta_0427"
FT                   /product="LSU ribosomal protein L21P"
FT                   /function="Translation; Ribosomal proteins; Ribosome"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32713"
FT                   /db_xref="GOA:A5E969"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E969"
FT                   /protein_id="ABQ32713.1"
FT                   /translation="MFAVIKTGGKQYRVAPDDVLEIGKIDGEPGTIVQLNEVLVVGGDT
FT                   PVLGVPAVAGASVAVEVLDHKRGPKVIAFKKRRRKNSRRKRGYRDELTLIRVSEILTDN
FT                   AKPTKGPRPKKAKAEAPAADAAE"
FT   gene            430423..431562
FT                   /locus_tag="BBta_0428"
FT   CDS_pept        430423..431562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0428"
FT                   /product="hypothetical protein"
FT                   /note="glucokinase domain; Evidence: Similar to previously
FT                   reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32714"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A5E970"
FT                   /protein_id="ABQ32714.1"
FT                   /translation="MADDVMTTTGIARHGAARLPSVEIDSFNIEIKDEDGFLGDRASKG
FT                   AFRKILERWRKPLRKSGKDPFGDEDSDTISKKALDAILVGDDTEASAVVHSAIEEFAQE
FT                   LAHVTRRFLRTKAWAKTECIVVGGGFRDSRLGELAIARTEIILKDEGFGVELEPIRYHP
FT                   DDAGLIGALHLAPSWIFEAHDSILAVDIGGTNIRCGVVETCWKKTPDLSKASVWKSELW
FT                   RHADDEPTREGAVKRLAKMLKGLIDEADTEGLKLAPFIGIACPGVINEDGSIEKGAQNL
FT                   PGNWESSKFNLPASLVEAIPMIGDHDTAVLMHNDGVVQGLSEVPFMQDFERWGVLTIGT
FT                   GLGNARFTNRRKENGRKDKDDKAKDDKADEKKAAKKKKD"
FT   gene            432049..432708
FT                   /locus_tag="BBta_0429"
FT   CDS_pept        432049..432708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0429"
FT                   /product="putative 31 kDa outer-membrane immunogenic
FT                   protein precursor"
FT                   /function="Membrane"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 7 : Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32715"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A5E971"
FT                   /protein_id="ABQ32715.1"
FT                   /translation="MRITGASHWAAAVAATALAMTGARAADMPATTYKAPAYASAPAPF
FT                   SWTGFYAGANVGGAFTGNDSVTNLAGGNGGKLSGVIGGMQAGYNYQVSPLFVVGIENDL
FT                   DFTGLSRQGDLVNPAVSVPWLTTGRARAGFTMLDQRLFLYGTAGLAAGELKDGPVHKVK
FT                   MGWTAGGGAEWAFLPKWSAKLEYLYTDLKHDALPDWRAAKIHSVRVGLNYHFDLFR"
FT   gene            432947..433036
FT                   /locus_tag="BBta_tRNA5"
FT   tRNA            432947..433036
FT                   /locus_tag="BBta_tRNA5"
FT                   /product="tRNA-Ser"
FT                   /note="Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT   gene            complement(433004..434626)
FT                   /locus_tag="BBta_0430"
FT   CDS_pept        complement(433004..434626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0430"
FT                   /product="putative Resolvase"
FT                   /function="Integration, recombination"
FT                   /note="Recombinase; Evidence: Function proposed based on
FT                   presence of conserved amino acid motif, structural feature
FT                   or limited homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32716"
FT                   /db_xref="GOA:A5E972"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A5E972"
FT                   /protein_id="ABQ32716.1"
FT                   /translation="MTVPLRAALYLRVSTARQAEHDVSIPDQKRQGEAYCEARGYQLVE
FT                   TFVEPGASATNDRRPEFQRMIEAGTSKPAPFDVVIVHSFSRFFRDAFDMEFYVRKLAKN
FT                   GVKLLSITQEIGDDPVHQMMRQIMALFDEYQSKENAKHVMRALKENARQGFWNGSLPPI
FT                   GYRVVAAEQRGAKTKKKLEIDPLHADTVRLIYRLALEGDGTTGQMGVKNIVSYLNSRRI
FT                   FTRDGGRWGIGQVHRILTRRTYMGEHEFNKRSKTKELKPVSEIVTVPVQPIIDRETFDT
FT                   VQALLKARNPKVTPSAVISGPTMLTGLIHCAKCGGAMTIRTGKGGRYRYYACSMKARQG
FT                   PTACEGLAVPMDKLDELVASHLEDQLLQPERLETILASVLDRRQEQSERRREHIAELNK
FT                   RAAESELRLKRLYDAIEAGVAGIDDPALKDRIDGLKAIRDQAKTDAERAQAMLDTSGAK
FT                   AITPQMVRTFAKTARQRIRLEGGGYRRDHLRALAQRVEVADGEVRIMGSKTRLLQALTG
FT                   KTGVNSVPTQGLNWRRGRDSNPR"
FT   gene            complement(434688..435014)
FT                   /locus_tag="BBta_0431"
FT   CDS_pept        complement(434688..435014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0431"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32717"
FT                   /db_xref="GOA:A5E973"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:A5E973"
FT                   /protein_id="ABQ32717.1"
FT                   /translation="MRTRQTMLTTKRKPASVGEILTEEFMEPMGLTQGALAEAMGVQRK
FT                   HVNELCGNRRNVTAATALILARVFGNSPDFWLNVQRRNDLWEVMNTPKERERVERARPV
FT                   KKAA"
FT   gene            complement(435011..435199)
FT                   /locus_tag="BBta_0432"
FT   CDS_pept        complement(435011..435199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0432"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32718"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A5E974"
FT                   /protein_id="ABQ32718.1"
FT                   /translation="MIDDATTDQDLLVPPSNHFEKLKGNLAGLRSIRVNKQYRLVFRWD
FT                   GERGEAGGIYLDDHSYR"
FT   gene            complement(435368..435535)
FT                   /locus_tag="BBta_0433"
FT   CDS_pept        complement(435368..435535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0433"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32719"
FT                   /db_xref="UniProtKB/TrEMBL:A5E975"
FT                   /protein_id="ABQ32719.1"
FT                   /translation="MGYPWPFPGRPPKHDLSTWTVTDDWPHPVPVTEAEIEVFEQWFGD
FT                   IFDELFGSKG"
FT   gene            complement(435603..435821)
FT                   /locus_tag="BBta_0434"
FT   CDS_pept        complement(435603..435821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0434"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /function="Regulation; Activator; Transcription related"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32720"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:A5E976"
FT                   /protein_id="ABQ32720.1"
FT                   /translation="MLASDRIVRLKTVLARTGLSRSTIYRKIAEGTFPPQIKISVNGAG
FT                   WRESDIDRWVANPVAWRPGSGRGLDGV"
FT   gene            complement(435951..438857)
FT                   /locus_tag="BBta_0435"
FT   CDS_pept        complement(435951..438857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0435"
FT                   /product="plasmid mobilization system relaxase"
FT                   /function="The Type IV (Conjugal DNA-Protein Transfer)
FT                   Secretory Pathway (IVSP) Family"
FT                   /note="TraA; Evidence: Function proposed based on presence
FT                   of conserved amino acid motif, structural feature or
FT                   limited homology; Localization: 3 : Fimbrial"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32721"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="InterPro:IPR014136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E977"
FT                   /protein_id="ABQ32721.1"
FT                   /translation="MAIYHFSVQVIGRAAGRSAVAAAAYRSASRLRDNRLGRDQDFSAK
FT                   RGVVHSEVMLPENAPEEWHDREKLWNDVEAFEKRKDAQLCREVEFAIPREMPQAQGVEL
FT                   ARDFVKAEFVDRGMIADLNVHCDMGADGQPKPHAHVMLTMRSVDENGFGPKARDWNRTE
FT                   FVEHWRERWADHVNERLAELDIDARIDHRSLEAQGIGLEPQTKIGAPAQRIEAAGLEAD
FT                   RAEDHRRIARENGARIVADPSTALDAITRQQSTFTRRDLAMFAHRHSDGVEQFNEVMGA
FT                   MRNAPDLVELGKDGRGEERFTTREMIEAEQRLHRAAAMMAERERHEVSGRNREAALARA
FT                   ADRGLVLSGEQAEALAHVTDGRDLGIVVGYAGTGKSAMLGVAREAWEDAGYTVRGAALS
FT                   GIAAENLEGGSGIASRTIASMEHGWAQGRDLLTSRDVLVIDEAGMVGTRQFERVLSHAA
FT                   DAGAKVVLVGDPQQLQSIEAGAAFRSIHERHRGAEMGEVRRQRQDWQRDATRDLATGRT
FT                   GDAIHAYDAHGMVHEAASREQARGELIDRWDRERQANPDASRIILTHTNAEVRALNEVA
FT                   RGRMREAGNLGDDVYVAAERGARNFAPGDRVMFLANERGLGVKNGTLGTIEQVNAQSMT
FT                   VRTDDGRDVAFDLKDYNRIDHGYAATIHKAQGMTVDRAHVLATPGMDAHGSYVALSRHR
FT                   DGMDLHYGRDDFASQDKLISVLSRDRAKDMASDYEPARDYAERRGITFRERVDRVVEIV
FT                   RQVPEKVRGMFDGLRLPAESEQGPERKVEEDPEEALRRSRGRALVRHARAVDAIFTAQD
FT                   QGGRASPDQIRELQEARQRFEEVRPYGSHDAEAAYKKNPELAAEAALGDARRAIRALQL
FT                   ETELRTEPARRADRFVERWRNLHRASEERYAAGDYAGHRAARTEMGNMAQSLERDPQME
FT                   SLLAGRKRELGISFDSGMSVGRDLTLTFGLGRGRGLGL"
FT   gene            439029..439355
FT                   /locus_tag="BBta_0436"
FT   CDS_pept        439029..439355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0436"
FT                   /product="putative conjugual transfert protein, traC"
FT                   /function="Genetic exchange, recombination"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32722"
FT                   /db_xref="GOA:A5E978"
FT                   /db_xref="InterPro:IPR009444"
FT                   /db_xref="UniProtKB/TrEMBL:A5E978"
FT                   /protein_id="ABQ32722.1"
FT                   /translation="MRKPRDFDAELKALEDKARDLKARKVQQLGELVISTGADALSADE
FT                   LAGALIVLTETKDTGKREAWAKRGAAFFQGRARRSVSAPDRDGGDPPAQPGGAQPTSGG
FT                   AGAT"
FT   gene            439357..439575
FT                   /locus_tag="BBta_0437"
FT   CDS_pept        439357..439575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0437"
FT                   /product="Conjugal transfer protein traD"
FT                   /function="The Type IV (Conjugal DNA-Protein Transfer)
FT                   Secretory Pathway (IVSP) Family"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 3 :
FT                   Fimbrial"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32723"
FT                   /db_xref="GOA:A5E979"
FT                   /db_xref="InterPro:IPR009444"
FT                   /db_xref="UniProtKB/TrEMBL:A5E979"
FT                   /protein_id="ABQ32723.1"
FT                   /translation="MRTWQLERRKRTRHLIELGGLVVKAGIVDLTGDDRAMIYGALLWM
FT                   ADKLQSDQGEHARTLWNAKGKQAFEDD"
FT   gene            439811..440107
FT                   /locus_tag="BBta_0438"
FT   CDS_pept        439811..440107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0438"
FT                   /product="putative transposase"
FT                   /function="transposases"
FT                   /note="fragment; Evidence: Function proposed based on
FT                   presence of conserved amino acid motif, structural feature
FT                   or limited homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32724"
FT                   /db_xref="GOA:A5E980"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A5E980"
FT                   /protein_id="ABQ32724.1"
FT                   /translation="MRNGARALLAKAIEAEVADFLGQHADLKTADGHQRVVRHGHLPER
FT                   EVMTGIGPVAVRQPRVRDREAAATDPDRTRFSPSILPPYMRRSKSIETLLPIL"
FT   gene            440177..440293
FT                   /locus_tag="BBta_0439"
FT   CDS_pept        440177..440293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0439"
FT                   /product="putative transposase"
FT                   /note="fragment; Evidence: Function proposed based on
FT                   presence of conserved amino acid motif, structural feature
FT                   or limited homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32725"
FT                   /db_xref="UniProtKB/TrEMBL:A5E981"
FT                   /protein_id="ABQ32725.1"
FT                   /translation="MSASAIGRLKDGWLDEHTAWQKRDLSAKRYVYDLTGLF"
FT   gene            440331..440615
FT                   /locus_tag="BBta_0440"
FT   CDS_pept        440331..440615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0440"
FT                   /product="putative transposase"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32726"
FT                   /db_xref="GOA:A5E982"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5E982"
FT                   /protein_id="ABQ32726.1"
FT                   /translation="MIMPKKRFNAEQIVVLLRQIEVLMSQGKAAPVACREAGISQQSYY
FT                   RWRKEYGGLELDQAKRMKDLERENIRLKRLVADLSLEKQVLKDVASGNL"
FT   gene            440951..441475
FT                   /locus_tag="BBta_0441"
FT   CDS_pept        440951..441475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0441"
FT                   /product="Transposase"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32727"
FT                   /db_xref="GOA:A5E983"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5E983"
FT                   /protein_id="ABQ32727.1"
FT                   /translation="MRPQHRNHVWSYDFVEAQTHDGRKLRLMTLIDEFTRECLAIRVAR
FT                   RINSFGVIETMADVMLERGVPEHIRSDNGAEMTAKVVRNWFAKLGAKTLYIAPGSPWEN
FT                   GYCESFNGKLRDECLNGEIFYSLKEATVVIEQWRKHFNTIRPHSSLSYRPPAPQTSAPT
FT                   LQHLDRSAAMQ"
FT   gene            complement(441552..442694)
FT                   /locus_tag="BBta_0442"
FT   CDS_pept        complement(441552..442694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0442"
FT                   /product="transposase"
FT                   /function="transposases"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32728"
FT                   /db_xref="GOA:A5E984"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A5E984"
FT                   /protein_id="ABQ32728.1"
FT                   /translation="MTRTALEGFGKTLLANDEVVVEATANSMAVSRVLAPFVARVIIAN
FT                   PLQVKAIAQAHVKTDKIDAGTLASLQAAGYLPQIWTPDAETERKRRLVARRYQVVRHRT
FT                   RLKNEVHSILHAHLIPKCPHADLFNARGRAWLAAQQLPDDERAAIDRHVRELDRLAEDL
FT                   ALLDREIAQDAIDDSAVNRLMTITGVNLAVAAGIVAAIGDVSRFSSPQKLVSYFGLNPR
FT                   VRQSGLVAAHHGRISKIGRSHARAILVEAAWAAAKAPGPLHAFFVRIRARRGHQIAAVA
FT                   VARKLTVLCWHLLTKGEDYLWARPALVANKTRAMQLQAGHPQQKGNRRGPAYAYNIKAL
FT                   RDREMVIAAQAERNYEQFVSQWKPRRPKTGARAPQLGRTK"
FT   gene            443005..443274
FT                   /locus_tag="BBta_0443"
FT   CDS_pept        443005..443274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0443"
FT                   /product="putative transposase"
FT                   /function="transposases"
FT                   /note="fragment; Evidence: Function proposed based on
FT                   presence of conserved amino acid motif, structural feature
FT                   or limited homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32729"
FT                   /db_xref="GOA:A5E985"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A5E985"
FT                   /protein_id="ABQ32729.1"
FT                   /translation="MAPRHLIPVTNPIESTFATVRHRTIRSKGCLSNKTALAMVFKLVE
FT                   GAQRSWRRLDGHNQLSKLVLGVTFNDGIEVIAKSTDRQPTTAAA"
FT   gene            complement(443334..444332)
FT                   /gene="cbbR"
FT                   /locus_tag="BBta_0444"
FT   CDS_pept        complement(443334..444332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbR"
FT                   /locus_tag="BBta_0444"
FT                   /product="HTH-type transcriptional regulator cbbR"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 2 : Cytoplasmic; PUBMED: 8376325"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32730"
FT                   /db_xref="GOA:A5E986"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5E986"
FT                   /protein_id="ABQ32730.1"
FT                   /translation="MTHAKGKIKKIFAALNKATTMIHEQAITLKQLRALAAIVAGGNLS
FT                   LAASRLNVTVPAVSTQLRNLEANLGEPLLERGPDGKTLLTAIGREVLAAAEQIDAILSS
FT                   CIQKVSAISAGHEGLVFLGAVSTAKYFAPHLIAQLRRQVPRIKIEFRIGNREEIISALK
FT                   SRRIELAIMGRPPREPEVDTDLLGDHPHVLIAPPKHPLVGRHDISSSDLLTNAFLVREK
FT                   GSGTRALMERLFDRIGVGSDYESIEFGSNETIKQAVMAGLGIAVISAHTVQAELMGGRL
FT                   AMLSFPGFPIIRQWFLVRRRDTPMTPSAKRVRDVILALKGSFLPGALSRSG"
FT   gene            444370..445386
FT                   /gene="cbbF"
FT                   /locus_tag="BBta_0445"
FT   CDS_pept        444370..445386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbF"
FT                   /locus_tag="BBta_0445"
FT                   /product="D-fructose 1,6-bisphosphatase"
FT                   /function="Energy metabolism (carbon); Pentose phosphate
FT                   shunt, oxidative branch"
FT                   /EC_number="3.1.3.11"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32731"
FT                   /db_xref="GOA:A5E987"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E987"
FT                   /protein_id="ABQ32731.1"
FT                   /translation="MTAPEGTLESFLEGDCSVSEPLAITVTALAFVAETLAGVISSGPL
FT                   NGRLGEEVGANSDGDRQKKLDVVADELFAGALAPTPVRWYASEERPTAEMLNPEGTLAL
FT                   AIDPLDGSSNIDVNISIGTIFSVFEAKESGVESFLRPGREQIAAGYVVYGPQTVFILAT
FT                   RTTLAQFVLHRGHFFLVSDSLRIPDRTTEFAINASNYRHWSRPIRAFVDDCIAGDEGPW
FT                   GENFNMRWVASLVAETHRILTRGGIFLYPADARRGYGQGRLRLVYECAPIAFIVERAGG
FT                   KATDGIDRILDLTPSELHQRTPLVFGTAEKVSQVCAYHDLPESEVSPLFGTRGLFRA"
FT   gene            445413..446300
FT                   /gene="cbbP"
FT                   /gene_synonym="prkB"
FT                   /gene_synonym="yhfF"
FT                   /locus_tag="BBta_0446"
FT   CDS_pept        445413..446300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbP"
FT                   /gene_synonym="prkB"
FT                   /gene_synonym="yhfF"
FT                   /locus_tag="BBta_0446"
FT                   /product="Phosphoribulokinase"
FT                   /function="Energy metabolism (carbon)"
FT                   /EC_number="2.7.1.19"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32732"
FT                   /db_xref="GOA:A5E988"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E988"
FT                   /protein_id="ABQ32732.1"
FT                   /translation="MSEQHPIISVVGSSGAGTSTVKHTFDQIFRREGIKAVSIEGDAFH
FT                   KFDRASMKAELQRRYDAGDRTFSHFSFEANELSELEKVFASYGATGTGRTRHYVHDDEE
FT                   AERYGVPPGRFTEWEDFDKGSDILLYEGLHGAVRTQDIRIADHADLKIGVVPVINLEWI
FT                   QKVHRDKASRGYTAEAVTDVILRRMHAYVHCICPQFSETDINFQRVPVVDTSNPFIARW
FT                   IPTAGESLVVIRFKNPRGIDFPYLVQMIRDSWMSRANSIVVPGDKLDLAMQLILTPMIL
FT                   RLVDQSKRLKRASS"
FT   gene            446297..448312
FT                   /gene="cbbT"
FT                   /gene_synonym="tkt"
FT                   /gene_synonym="tktA"
FT                   /locus_tag="BBta_0447"
FT   CDS_pept        446297..448312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbT"
FT                   /gene_synonym="tkt"
FT                   /gene_synonym="tktA"
FT                   /locus_tag="BBta_0447"
FT                   /product="transketolase"
FT                   /function="Ribose degradation; Pentose phosphate shunt,
FT                   non-oxidative branch; Nucleotide and nucleoside
FT                   conversions"
FT                   /EC_number="2.2.1.1"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32733"
FT                   /db_xref="GOA:A5E989"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A5E989"
FT                   /protein_id="ABQ32733.1"
FT                   /translation="MNLVAERRAALDEAQMANAIRALAMDAVEAAKSGHPGMPMGMADV
FT                   ATVLFKHFVKIDPTQPNWPDRDRFVLSAGHGSMLLYALHHLLGFHDMPMDQLRRFRQLG
FT                   SRTAGHPEFGHAAGIETTTGPLGQGIATAVGMALSERMLNARFGDDLVDHHTYVIAGDG
FT                   CLMEGISHEAIDLAGHLGLGRLIVLWDDNQITIDGPTSLSTSLDQKARFVAAGWHVAAV
FT                   DGHDGEAVANAIIEARADPRPSLIACRTIIGFGAPNKQGTSATHGAPLGKEEVAAARES
FT                   LGWIYSPFEVPEAIVHAWRVVGARGTRIRAEWQERLARSPQREEFVAHLAPPDAARLHA
FT                   ALADHRRRLCGERPKVATRKASELALEVVNSTIPNMVGGSADLTGSNNTRTKGMRPVTR
FT                   SDFTGNYIHYGVREHGMAAAMNGISLHGGLRPYGGTFLAFSDYCRGAIRLSALMGRPVI
FT                   YVMTHDSIGLGEDGPTHQPVEHLASLRAMPNVYVFRPADAVETAEAWEVALAAAKTPSV
FT                   LCLSRQDLPTLRTEHGDENMTARGAYLLRDPGEHRDLTIIATGSEVAIAVEAADELSAD
FT                   GLAVAVVSAPCWELFAAQEAGYRAAVLGEGPRVGVEAGVALGWAEWLGPNSIFIGMTGF
FT                   GASGPAADLYNHFGITAERVAAEGWRLARKPGEEHE"
FT   gene            448309..449316
FT                   /gene="cbbG"
FT                   /gene_synonym="epd"
FT                   /gene_synonym="gapB"
FT                   /locus_tag="BBta_0448"
FT   CDS_pept        448309..449316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbG"
FT                   /gene_synonym="epd"
FT                   /gene_synonym="gapB"
FT                   /locus_tag="BBta_0448"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /function="Pyridoxine (vitamin B6); Gluconeogenesis;
FT                   Cytoplasm"
FT                   /EC_number="1.2.1.12"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32734"
FT                   /db_xref="GOA:A5E990"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5E990"
FT                   /protein_id="ABQ32734.1"
FT                   /translation="MTVRVAINGFGRIGRNVLRAIYESGRGDIEVVAINDLGSVDINAH
FT                   LLRYDSVHGTFPGAVKVNGASIDIGRGSPIRVTAERDPKTLPWKDVDIALECTGIFTAR
FT                   EKASLHLENGSKRVLVSAPAAGADKTIVFGVNHNSLSPGDNVVSCASCTTNCLAPVAAV
FT                   LHRTIGIDKGFMTTIHSYTGDQPTLDTLHKDPYRARAAAMSMIPTSTGAAKAVGLVLPE
FT                   LNGKLDGVAIRVPTPNVSVVDFKFIASRETTAEEINSVVRTAAGADLEGILGFTDEPLV
FT                   SVDFTHDPRSSIVHMDQTKVIDGRLCRVMSWYDNEWGFSNRMADTAVAMGRLIG"
FT   gene            449313..450515
FT                   /gene="cbbK"
FT                   /gene_synonym="pgk"
FT                   /locus_tag="BBta_0449"
FT   CDS_pept        449313..450515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbK"
FT                   /gene_synonym="pgk"
FT                   /locus_tag="BBta_0449"
FT                   /product="phosphoglycerate kinase"
FT                   /function="Galactose degradation; Glycolysis;
FT                   Gluconeogenesis; Cytoplasm"
FT                   /EC_number="2.7.2.3"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32735"
FT                   /db_xref="GOA:A5E991"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:A5E991"
FT                   /protein_id="ABQ32735.1"
FT                   /translation="MTLKSVHDVDISSRRLLIRADLNVPMNNGGVADATRIERFVAGLK
FT                   PLLARGARAVVLSHLGRPDGQRRPELSLEPVAAALGRVLGKDVAFSEAISGPVAARSAA
FT                   ALGPGDVLVCENLRFDQREEANDASLAEELAELGDLYVNDAFSCAHRAHASTVAIAERL
FT                   PAVAGPLMMAEISALTQALEAPQRPAVALVGGAKVSSKIDVLFNLIGKLDTVIVGGGMA
FT                   NTFLAANGLPIGKSPHESAKFETVRKILSRAQSCGCQIVLPVDIVWADRFERGAEAHIA
FT                   ELDCCPQHGMILDAGPRSIERIWDVLAEAKTILWNGPLGAFEIEPFDHATEAVAAEAAR
FT                   LTRVGKVKSIAGGGDTVAALNAAGVTEDFTYVSTAGGAFLEWLEGKELPGVSVLRTPQL
FT                   A"
FT   gene            450512..451612
FT                   /gene="cbbA"
FT                   /locus_tag="BBta_0450"
FT   CDS_pept        450512..451612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbA"
FT                   /locus_tag="BBta_0450"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /function="Energy metabolism (carbon)"
FT                   /EC_number="4.1.2.13"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32736"
FT                   /db_xref="GOA:A5E992"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5E992"
FT                   /protein_id="ABQ32736.1"
FT                   /translation="MIGKETTMALITLRQLLDHAAEQGYGVPAFNINNMEQGLAILEAA
FT                   REMDAPVIIQASRGARSYAGDVMLQKVIEALVEMFPDIPVCLHQDHGNNVNTCLSAIQN
FT                   GFSSVMMDGSLKEDAKTPADYDYNVKVTRQVTELAHMVGVSVEGELGCLGSLETGHGEA
FT                   EDGHGFEGKLDKSMLLTDPDEAMRFVAETKVDALAVAIGTSHGAYKFTRKPTGEVLAMT
FT                   VIEAIHQKLPNTHIVMHGSSSVPEEWQEVFNAHGGQMRETYGVPVEEIVRGIKHGVRKI
FT                   NIDTDLRLAATAEFRRVANTKKDEFDPRKFLKPAMDAMRKVCAERFEAFGAAGNASKIK
FT                   PIPLSEMAKRYTNGALEPQISAARAA"
FT   gene            451632..453098
FT                   /gene="cbbL"
FT                   /gene_synonym="rbcL"
FT                   /locus_tag="BBta_0451"
FT   CDS_pept        451632..453098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbL"
FT                   /gene_synonym="rbcL"
FT                   /locus_tag="BBta_0451"
FT                   /product="ribulose-1,5-bisphosphate carboxylase/oxygenase
FT                   large subunit"
FT                   /function="Energy metabolism (carbon)"
FT                   /EC_number="4.1.1.39"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32737"
FT                   /db_xref="GOA:A5E993"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020878"
FT                   /db_xref="InterPro:IPR020888"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5E993"
FT                   /protein_id="ABQ32737.1"
FT                   /translation="MNEALKSLTVTGKERYKSGVLEYKRMGYWEPDYEPKDTDVIALFR
FT                   VTPQNGVDPIEASAAVAGESSTATWTVVWTDRLTAAEKYRAKCYRVDPVPNTPGSYFAY
FT                   IAYDLDLFEPGSIANLSASIIGNVFGFKPLKALRLEDMRFPVAYVKTFQGPATGIVVER
FT                   ERLDKFGRPLLGATVKPKLGLSGRNYGRVVYEALKGGLDFTKDDENTNSQPFMHWRDRF
FT                   LYCMEAVNKAQAATGEVKGTYLNVTAATMEDMYERAEFAKELGSVIIMIDLVIGYTAIQ
FT                   SMAKWARRNDMILHLHRAGHGTYTRQKSHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEG
FT                   DPNTTRGYYDICREDHNPMALEYGLFFEQHWASLNKLMPVASGGIHAGQMHQLLNYLGE
FT                   DVVLQFGGGTIGHPLGIQAGATANRVALEAMILARNEGRDYVHEGPEILAKAAATCTPL
FT                   KQALDVWKNVTFNYDSTDTPDFVPTAAVTA"
FT   gene            453109..453528
FT                   /gene="cbbS"
FT                   /gene_synonym="rbcS"
FT                   /locus_tag="BBta_0452"
FT   CDS_pept        453109..453528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbS"
FT                   /gene_synonym="rbcS"
FT                   /locus_tag="BBta_0452"
FT                   /product="ribulose 1,5-bisphosphate carboxylase small
FT                   subunit"
FT                   /function="Energy metabolism (carbon)"
FT                   /EC_number="4.1.1.39"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32738"
FT                   /db_xref="GOA:A5E994"
FT                   /db_xref="InterPro:IPR000894"
FT                   /db_xref="InterPro:IPR036385"
FT                   /db_xref="UniProtKB/TrEMBL:A5E994"
FT                   /protein_id="ABQ32738.1"
FT                   /translation="MRITQGCFSFLPDLTDEQITKQVQYCLEKGWSVNIEFTDDPHPRN
FT                   TYWEMWGLPMFDLRDAAGVMMELAKCRRVYADRYIRLSAFDSSHGWESVRLSFIVNRPK
FT                   EEPGFRLDRQEVAGRRIRYSTHAYVTDRPEGQRYG"
FT   gene            453619..454623
FT                   /locus_tag="BBta_0453"
FT   CDS_pept        453619..454623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0453"
FT                   /product="putative CbbX-like protein, containing AAA-ATPase
FT                   domain"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32739"
FT                   /db_xref="GOA:A5E995"
FT                   /db_xref="InterPro:IPR000470"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E995"
FT                   /protein_id="ABQ32739.1"
FT                   /translation="MSASTDSRLDTHTGDTARLTVPVDKDIQPTAEIDLRREFESSGVH
FT                   AVLEELDRSLIGLKPVKRRIRETAALLLVDRARKSFGLAHETPTLHMSFTGNPGTGKTT
FT                   VALKMADLLHRLGYIRRGHLVTVTRDDLVGQYIGHTAPKTKEVLKKAMGGVLFIDEAYY
FT                   LYRPENERDYGQESIEILLQVMENNRDDLVVILAGYADRMDRFFNSNPGFRSRIAHHIE
FT                   FPDYTDEELLHIATLMLDAQNYRFTDGARAAMAEYIALRRAQPHFANARSIRNAIDRMR
FT                   LRQANRLFESVDGPVGIEAVSTIEESDVRASRVFRGGLDSDVAREDGGKEDDR"
FT   gene            454620..455351
FT                   /gene="rpe"
FT                   /gene_synonym="dod"
FT                   /gene_synonym="yhfD"
FT                   /locus_tag="BBta_0454"
FT   CDS_pept        454620..455351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /gene_synonym="dod"
FT                   /gene_synonym="yhfD"
FT                   /locus_tag="BBta_0454"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /function="Carbohydrates/Carbon compounds; Pentose
FT                   phosphate shunt, oxidative branch"
FT                   /EC_number="5.1.3.1"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; PUBMED: 1429456"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32740"
FT                   /db_xref="GOA:A5E996"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A5E996"
FT                   /protein_id="ABQ32740.1"
FT                   /translation="MTFDRSIKIAPSILSADFAAFGAECRAIEAQGCDWVHVDVMDGHF
FT                   VPNITFGPQLCRAIRPHVKTVMDVHLMITPVDPYIHAFAEAGADVITAHVEAGPHLDRT
FT                   LQAIRAAGAKAGVSLNPSTPAEAIEFVLDRIDLVLVMTVNPGFGGQSFIEAMVPKIRRL
FT                   REMVGDRPIHIEVDGGVTPATAPLVAAAGADVLVAGSAVFKGGSAADPAPYGRNILAIR
FT                   EAATAAQRKVAEADGTRGHWT"
FT   gene            455342..456580
FT                   /locus_tag="BBta_0455"
FT   CDS_pept        455342..456580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0455"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /function="Carbohydrates/Carbon compounds"
FT                   /EC_number="4.1.2.13"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32741"
FT                   /db_xref="GOA:A5E997"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5E997"
FT                   /protein_id="ABQ32741.1"
FT                   /translation="MDMSDLLRHAHCERYAIGAYDVVDTAFLEAVLDGAEGCRAPVIAS
FT                   LAESHFDHFDFECLMPVVVDAARRARVPVAIHLDHGHSLATVERAIRLGCNNVMVDASL
FT                   SSLEDNIKATREVVRLARRCGVRVEGELGYVPGVEGEDAEKHPRAMQLTSLADAERYIA
FT                   ETPVDCLAISIGTVHGRLRGAPRLDFERLSAFSSALHIPLVIHGGTGLSDDQYGMLAAN
FT                   GVAKINYFTGLADAAARSIVEEAESKDSPADTALIHGVRGAVRAEVERTCRLFGAAGRA
FT                   GAASAACRRWREVEHVVVYNLRDGGQNVDWSAFAAQGVEALGAIPGVRNVLAGRALRTD
FT                   APYLLCWLIRFASPEVVASYRDHPDHVGYADKVFRPTAPDRVTIDFELVDVSGEEEKSS
FT                   LSTQPPTSSGTKR"
FT   gene            456727..457239
FT                   /gene="cbbZ"
FT                   /locus_tag="BBta_0456"
FT   CDS_pept        456727..457239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbZ"
FT                   /locus_tag="BBta_0456"
FT                   /product="Phosphoglycolate phosphatase"
FT                   /function="DNA repair"
FT                   /EC_number="3.1.3.18"
FT                   /note="fragment; Evidence: Function of strongly homologous
FT                   gene; Localization: 2 : Cytoplasmic; PUBMED: 9006018"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32742"
FT                   /db_xref="GOA:A5E998"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5E998"
FT                   /protein_id="ABQ32742.1"
FT                   /translation="MVARCLDATGGPADDFDSALARFRKHYARAPAQLTRPYAGVEPTL
FT                   ERLAASGVALGICTNKPPEFAVTILKELGLMRFVGALVGEGTVPQLKPDPAPLLHCLDR
FT                   LGADETSALYVGDSEIDAETAFRAKVPFALFSGGYLRESVDAFEPVYVFDHFDDLSDYV
FT                   LQGVGRR"
FT   gene            457236..457946
FT                   /locus_tag="BBta_0457"
FT   CDS_pept        457236..457946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0457"
FT                   /product="putative haloacid dehalogenase-like hydrolase
FT                   cbbY-like protein"
FT                   /EC_number="3.1.3.18"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic; PUBMED: 9425311"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32743"
FT                   /db_xref="GOA:A5E999"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5E999"
FT                   /protein_id="ABQ32743.1"
FT                   /translation="MKTAAFIFDVDGTLAETEEAHRQAFNATFAAAGLDWHWDAPLYGE
FT                   LLKVTGGKERIRAFLERAYPGVVMSDESIVGLHRQKTKAYGDIIVGGGVPLRPGVRELI
FT                   QFAKLQGIKTAVATTTNLPNVDALCVAFWGEPAGAVFDVIAAGDEAPRKKPAPDIYTIA
FT                   LDRLGLEPKDCIAFEDSRNGLLSAKSAGLRVVVTPSQYSTGEDFTEADLCLPDLTGFDV
FT                   AHFTRAPAEGLENP"
FT   gene            458042..459493
FT                   /locus_tag="BBta_0458"
FT   CDS_pept        458042..459493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0458"
FT                   /product="Two-component response regulator protein"
FT                   /function="Two-component regulatory systems (external
FT                   signal)"
FT                   /note="putative HupR-like transcriptional regulation of
FT                   hydrogenase genes; Evidence: Function of strongly
FT                   homologous gene"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32744"
FT                   /db_xref="GOA:A5E9A0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9A0"
FT                   /protein_id="ABQ32744.1"
FT                   /translation="MEHSGTVLIVARRGGDWTDCLDVLSERYAYRVVLVGSVAEALTTM
FT                   SGIHVDLAVAEDRKDESIGLDFLTRLRVSHPEIMRVYVATGGSPLSYGTLTKAAIYQFL
FT                   LTPLDATQLGLVVERALEARELARRHRILSREFKISGDVLRLGERRDLLFRPESHQFEK
FT                   LVYASEKMAELCDLAKQAATTELPILIQGETGTGKELLARAIHYNSPRRTSPLLIQNCG
FT                   GMPDDLLQSELFGHKRGAFTGAISDRLGLFRAADGGTVFLDEISEVSPSFQVSLLRFLQ
FT                   EGEVKPLGSDKVEHCSVRIIAASNRSLKDMVARREFRQDLYFRLKGFELEVPPLRERRD
FT                   DIAPLSEFFAAKHADGMGRKILGITASTIEKLSACDFPGNVRELENEIRRMVALAKDGE
FT                   YITTRNMSASLLASAAARSRSDGPRGFVPEGATLKDRVESLEKQIVGSALLRNHWNQSR
FT                   TAAELGLSRVGLSNKIKRYNLEQQG"
FT   gene            459991..460905
FT                   /gene="hupU"
FT                   /gene_synonym="hupS"
FT                   /locus_tag="BBta_0460"
FT   CDS_pept        459991..460905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupU"
FT                   /gene_synonym="hupS"
FT                   /locus_tag="BBta_0460"
FT                   /product="uptake hydrogenase accessory protein hupU"
FT                   /function="Metabolism of other compounds"
FT                   /EC_number="1.12.99.6"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 9 : Periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32745"
FT                   /db_xref="GOA:A5E9A1"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9A1"
FT                   /protein_id="ABQ32745.1"
FT                   /translation="MSFLNAEEPSVCDLVTDFGINVLWHPSLGLELGENLQKMLRALTS
FT                   GQLPLDIFVFEGTVVNAPNGTGEWNRFAGRPMRDWVHDLSKVANFVVAIGDCATWGGIP
FT                   ATAPNPSESQGLQFLKRSQGGFLGKDYKSKAGLPVINVPGCPAHPDWITQIVVAVATGR
FT                   AGDLALDEFQRPKTFFTSFTQTGCTRNMHFAYKVSATEFGQRKGCLFYDLGCRGPMTHS
FT                   PCNRILWNRQSSKTRSGMPCLGCTEPEFPFFDLAPGTVFKTQTVMGVPKDMPAGVDKTG
FT                   YIKLTAAAKAASPRWAEEDIFVV"
FT   gene            460952..462550
FT                   /gene="hupL"
FT                   /locus_tag="BBta_0461"
FT   CDS_pept        460952..462550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupL"
FT                   /locus_tag="BBta_0461"
FT                   /product="Uptake hydrogenase large subunit"
FT                   /function="Metabolism of other compounds"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 9 : Periplasmic; PUBMED: 15528652"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32746"
FT                   /db_xref="GOA:A5E9A2"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9A2"
FT                   /protein_id="ABQ32746.1"
FT                   /translation="MSAAVQTLDISPVGRVEGDLDVRVDIQNGVVVNAWTQAELFRGFE
FT                   VILRDKDPQAGLVVTPRACGICGASHLTCAAWALDTAWKTEVPRNAILARNLGQIAESL
FT                   QSLPRHHYGLFMIDYTHKNYSRSKYYEEAVRRWSPYTGTNYELGVTISGRPVEIYALLG
FT                   GQWPHSSFMVPGGVMCAPTLTDVTRAWSILEHFRRNWMEPVWLGCSFERYEEIKSYDDF
FT                   MAWLDERPEHANSDLGMFWRMSQDIGVDKYGKGHGKYVSWGYLPHEDKYNRPTIEGRNA
FT                   AVIMKSGVYDGASDTHKLMDQIHTREDLMHAWYDEQSGKHPFDRVTKPVGKNPVDHTKQ
FT                   YSWATAVRHDQNGRLEAGPLARQLIAGGPHGERWQHHDPLVLDMYRKLGGASVMLRHFA
FT                   RMHEGVKLYRQAEHALREFRLNDPWYVKPTEKDGRGWGATEAIRGALCHWIEVQGGKIK
FT                   NYQIITPTTWNVGPRSDRDELGPIEQALIGTPVADVNDPVEVGHVCRSYDSCLVCTVHA
FT                   HHASTGKELARFRTA"
FT   gene            462630..462944
FT                   /locus_tag="BBta_0462"
FT   CDS_pept        462630..462944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0462"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32747"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9A3"
FT                   /protein_id="ABQ32747.1"
FT                   /translation="MNSEQQRALLLQMADLMEAGLKTQTEPVPETEREFAGILDELRKL
FT                   DPNDIKAKLVISGFVDHPYGPDKQRCMECMYYLVHREWCDLPELAVPVKADWWCRLWRI
FT                   "
FT   gene            462985..463314
FT                   /locus_tag="BBta_0463"
FT   CDS_pept        462985..463314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0463"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32748"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9A4"
FT                   /protein_id="ABQ32748.1"
FT                   /translation="MTTDSKELADVSGREEVRGLLAGGLTTEVQPRADTHEEVTQIVAR
FT                   LRAAGGDLKAKLVIAGFTLEPIEHSGIEEACETCMYYVVHRRFCELPELNLPVEPQWSC
FT                   RLWRI"
FT   gene            463527..463805
FT                   /locus_tag="BBta_0464"
FT   CDS_pept        463527..463805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0464"
FT                   /product="Hydrogenase maturation protease HyaD"
FT                   /function="Metabolism of other compounds"
FT                   /note="fragment; Evidence: Function of strongly homologous
FT                   gene"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32749"
FT                   /db_xref="GOA:A5E9A5"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9A5"
FT                   /protein_id="ABQ32749.1"
FT                   /translation="MEAGAIYEVPGAELERPYKHGLNLHDFRWDAALHAGRQIFRDAFP
FT                   SDVTVFLIEAAELGFGVGLTPAVSRAADKVACRIEALIEKRRSKDVT"
FT   gene            463937..464110
FT                   /locus_tag="BBta_0465"
FT   CDS_pept        463937..464110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32750"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9A6"
FT                   /protein_id="ABQ32750.1"
FT                   /translation="MRHAAAGGYLLKQRNSRGDRVVSAPEFFRACGFDDDAEVVLEAHW
FT                   DDHAAALIASGL"
FT   gene            464217..465242
FT                   /locus_tag="BBta_0466"
FT   CDS_pept        464217..465242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0466"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32751"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9A7"
FT                   /protein_id="ABQ32751.1"
FT                   /translation="MVKIDRTDDDVRAALVAAEDETATLAERAEMLMEIALGLQQRPKD
FT                   VGQLYSAIDLYARALDICPEDERLLAARIRARQGTALLALPGEGVEPLEVARTGFEAAI
FT                   SVLRDFGRPEELAEAEMNLGLAIQNLAGRNRARITDAIAAYQRALRTFDKHRFPKEFAI
FT                   LQNNLATAFLSMPFTDSRAKMREALAVQAFEEGLRIVNLTDHPTEYAMLQNNLGNALQY
FT                   SSSSHMIENNLRALDAYDEALKVRTRATMPIEYANTLANKANCLRNLPDAPQHPENGNR
FT                   ANLMAAREYYLESREIFIRAGEVAKARIVAEACEQIDRELLSAPPARSRGPADSRSQHL
FT                   N"
FT   gene            465297..465476
FT                   /locus_tag="BBta_0467"
FT   CDS_pept        465297..465476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0467"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32752"
FT                   /db_xref="GOA:A5E9A8"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9A8"
FT                   /protein_id="ABQ32752.1"
FT                   /translation="MAALIVGLVASGIGGAGGGVLTGGKAIGNQLAALMGSFYGPVGVI
FT                   PGLIVGLIALAFLK"
FT   gene            465486..465710
FT                   /locus_tag="BBta_0468"
FT   CDS_pept        465486..465710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0468"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32753"
FT                   /db_xref="GOA:A5E9A9"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9A9"
FT                   /protein_id="ABQ32753.1"
FT                   /translation="MLEMVKSSIVLFFRGKLFADPAKVYRQTATGALATAVILFGLTKL
FT                   GLPIIASAAIAGLIGGAAQPYLFKDLRYR"
FT   gene            465724..466593
FT                   /locus_tag="BBta_0469"
FT   CDS_pept        465724..466593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0469"
FT                   /product="putative nitrogen-fixing NifU , Rieske (2Fe-2S)
FT                   region"
FT                   /function="Electron carrier; Nitrogen fixation"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PUBMED: 2644218"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32754"
FT                   /db_xref="GOA:A5E9B0"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9B0"
FT                   /protein_id="ABQ32754.1"
FT                   /translation="MNAIDLISTRRETLAGFTGDIERLEAVFADWDETQRSAVDAYRRA
FT                   IEDLQGEAFRRLVRALKSDSAALTAMKQAVSDEIVYAVLRRHDILKPSLSERLETALDS
FT                   VRPILASHGGDVELIAVRPPAIEVRFTGACDGCPASALTFHAGVKKAVEEACPEITDIL
FT                   QVKGASGSQHDSVRFVSPFALGAVNGWHLVCRLDEIPQGGVITRIVGEQNVILSRQGAV
FT                   VSCFQNACAHLGMEIDGGAVENGIITCPWHGFQYDLATGECLTAPEVQLQSHAVKVVGN
FT                   RVEVRLAT"
FT   gene            466674..467789
FT                   /locus_tag="BBta_0470"
FT   CDS_pept        466674..467789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0470"
FT                   /product="hypothetical protein"
FT                   /note="NHL repeat; Evidence: Similar to previously reported
FT                   genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32755"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9B1"
FT                   /protein_id="ABQ32755.1"
FT                   /translation="MGARIVLGDHLAADGLPAPLLPSRATLFGPRGVAFASRQGPFFIA
FT                   DTGHHRLLVWRTVPNTDNSPADLLIGQPDFNVEGRNAGGNVGPATLNMPSGIATDGRVL
FT                   AVADAWNHRILIWCSLPEVNNQPADIVLGQADFSGGLANRGSSNAGPHTLNWCYGVTIA
FT                   DGRLFVADTGNRRVLIWNTLPGENGQPADMVLGQAGMTIHDDNAGAEASAVGMRWPHAI
FT                   VVANGRIFVADAGNSRIMVWNGFPNADGAPASFVIGQAGFEAVDHNRAAYEPSAHALQM
FT                   PYGITVHDDMLVCADTGNSRLVGFPLPGLAMDAAATTLTGQRRFSDKGDNRWRFAARDS
FT                   LCWPFAVTVCDGLVAVADTGNNRVLLWEAAV"
FT   gene            467771..470245
FT                   /gene="hypF"
FT                   /gene_synonym="hydA"
FT                   /locus_tag="BBta_0471"
FT   CDS_pept        467771..470245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypF"
FT                   /gene_synonym="hydA"
FT                   /locus_tag="BBta_0471"
FT                   /product="carbamoyl phosphate phosphatase, (NiFe)
FT                   Hydrogenase maturation protein"
FT                   /function="Anaerobic respiration; Chaperoning, folding;
FT                   Cytoplasm; Metabolism of other compounds"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32756"
FT                   /db_xref="GOA:A5E9B2"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9B2"
FT                   /protein_id="ABQ32756.1"
FT                   /translation="MGGGSMSTQPAIANAAALESVQIRVRGRVQGVGFRPTVWRHAREV
FT                   GLDGEVLNDGEGVLIRARGQGKDIETLVRRLRDEAPLLAAIEAIEVEPFTGRLAPGFRI
FT                   IESNRSEARTEISPDAAICPACAAEVLDPFERRFRYAFTNCTHCGPRFTIIRSIPYDRS
FT                   ATTMAAFPVCAECAAEYGDPANRRFHAEPIACHACGPKAQLVRFDGRALTYEQHSMFDD
FT                   VDAAMSLIQKGEIVAVKALGGYQLACDATRLDTVERLRLLKRREVKPFALMARDLDVIR
FT                   RFCAVSPDEEEALCSPAAPIVLLDAAGPERLPEAVAPGMRMLGFMLPSTPLHVLMFRRM
FT                   PRPVIMTSGNLSDEPQAIGDAEAARKLGTITPYALVHDREIANRVDDSVMRVMDGRMRL
FT                   LRRARGYAPASISLPKGFEDSPDILAYGPEMKATFCLVKEGRAVLSQHQGDLQDAATWD
FT                   DYRKNLALFRDLFAHDPQALACDMHPEYLSAKLARKRASEDSLALIEVQHHHAHIAACL
FT                   TENARALDAPRVLGIALDGLGYGTDDTIWGGEFLLCDYRGFQRVGTFRPVAMVGGAAAS
FT                   REPWRNLYAHLTAQMGWAAFAMNFRQLPLFERLAAKPRAVLDTMIHDHINSPLASSCGR
FT                   LFDAVAAALDVCFERQAYEGEAAARLEAIACPKTLAEEDDSLCYPMPIPVLKGSGLPYI
FT                   EPLAMWNAILGDLILGTPQPIIAARFHKALARSIVTMAIQLARRDDEDAQPRFDTVALS
FT                   GGCFQNRILLEQTVRRLEEKKFKVLTHAKVPANDGGVALGQATIAAAHLIDAERTRRKG
FT                   GTSCALEFPDGS"
FT   gene            470341..470496
FT                   /locus_tag="BBta_0472"
FT   CDS_pept        470341..470496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0472"
FT                   /product="Hydrogenase expression/formation protein HypC"
FT                   /function="Electron carrier; Metabolism of other compounds"
FT                   /note="fragment; Evidence: Function of strongly homologous
FT                   gene"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32757"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9B3"
FT                   /protein_id="ABQ32757.1"
FT                   /translation="MESCVGDWVLVHVGFAMSRISEEQAAETLKILTELGEAQAEIEAM
FT                   RETAVP"
FT   gene            470606..471205
FT                   /gene="lpcA"
FT                   /gene_synonym="gmhA"
FT                   /gene_synonym="isn"
FT                   /gene_synonym="tfrA"
FT                   /gene_synonym="yafI"
FT                   /locus_tag="BBta_0473"
FT   CDS_pept        470606..471205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpcA"
FT                   /gene_synonym="gmhA"
FT                   /gene_synonym="isn"
FT                   /gene_synonym="tfrA"
FT                   /gene_synonym="yafI"
FT                   /locus_tag="BBta_0473"
FT                   /product="phosphoheptose isomerase"
FT                   /function="Core region; Surface antigens (ECA, O antigen of
FT                   LPS); Cytoplasm"
FT                   /EC_number="5.3.1.-"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32758"
FT                   /db_xref="GOA:A5E9B4"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9B4"
FT                   /protein_id="ABQ32758.1"
FT                   /translation="MAGKARDSRETNERFFGDQSEVLVAAAGTLANVYRRNGKLFSMGN
FT                   GGSSCDASHVAVEFVHPITAGRPALAATNLVADLAMISAVGNDLGFDHVFVRQLVAHAR
FT                   KGDALIGISTSGNSQNLIAAFVKAKELGVATIGLTGGDGGKMKSSGAVDHCLVVPSTSI
FT                   HRIQECHVAAYHILWDLVHTLLADERGSAANREAMQ"
FT   gene            471202..472350
FT                   /gene="hypD"
FT                   /locus_tag="BBta_0474"
FT   CDS_pept        471202..472350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypD"
FT                   /locus_tag="BBta_0474"
FT                   /product="Hydrogenase expression/formation"
FT                   /function="Posttranslational modification; Metabolism of
FT                   other compounds"
FT                   /note="fragment; Evidence: Function of homologous gene
FT                   experimentally demonstrated in an other organism;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32759"
FT                   /db_xref="GOA:A5E9B5"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9B5"
FT                   /protein_id="ABQ32759.1"
FT                   /translation="MKFADEFRDRDKARTLVREIETLADQIETTKTRPLQLMEVCGGHT
FT                   HSIFRYGLEGMLPSSIELVHGPGCPVCVLPMGRVDDCVAIAERPGVIFTTFGDAMRVPG
FT                   SKKSLMQAKADGADVRMVYSPMDALALARKHPDREVVFFGLGFETTMPSTALTVLQAEA
FT                   DGIENFSVFCNHITIVPTIKAILDSPDLHLDGFLGPGHVSMVIGAAPYAFIAEFYKRPM
FT                   VIAGFEPLDILQSIWMLLKQIREGRAEIENQYTRIVPEAGNHPALAAVAEVYELREFFE
FT                   WRGLGSIDHSGVKVRDQYARFDAERKFAIPNVKIADPKSCQCGEVLKGVLKPWQCKVFG
FT                   TLCTPETPLGALMVSPEGACSAYYQYGGIKRSNTPEKEAVVS"
FT   gene            472347..473417
FT                   /gene="hypE"
FT                   /locus_tag="BBta_0475"
FT   CDS_pept        472347..473417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypE"
FT                   /locus_tag="BBta_0475"
FT                   /product="hydrogenase maturation"
FT                   /function="Chaperoning, folding"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32760"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9B6"
FT                   /protein_id="ABQ32760.1"
FT                   /translation="MNLLDLPPRRSLGRVHVPAVTLAHGGGGKAMKDLIDDVFVSAFCN
FT                   AKAPDVLEDQARLDLAALARYGDRLAFTTDSFVVDPLFFPGGDIGKLAVCGTINDLAVG
FT                   GAKPLYLSCAVVIEEGMPLDALRGIANSMAEAARMAGVRIVTGDTKVVQRGACDKLFIT
FT                   TTGIGVIPPQIDLGIHQIKPGDGILVNGLLGDHGAAILAARGDLALETEVASDCAALHG
FT                   LIEALLRAAPGTRCIRDATRGGLATVLNEMAEASALSIEIDESATPLREEVRGFCEILG
FT                   LDPLYLANEGKVVIAVPPAEIEAALAAMRAHPLGAGAALIGHASGGIPARVTMQTVFGG
FT                   KRIVDMLIGEQLPRIC"
FT   gene            473430..473768
FT                   /gene="hypA"
FT                   /locus_tag="BBta_0476"
FT   CDS_pept        473430..473768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypA"
FT                   /locus_tag="BBta_0476"
FT                   /product="hydrogenase formation/expression"
FT                   /note="Evidence: Function of strongly homologous gene"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32761"
FT                   /db_xref="GOA:A5E9B7"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="InterPro:IPR020538"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9B7"
FT                   /protein_id="ABQ32761.1"
FT                   /translation="MHELGITRNIVKIVEEAAKGRRVKRVTLDVGQFSGVMPDAILFCF
FT                   DIVAKGTLLDGALLDIQKIAGLARCRSCGEAFKTTSLYQACACGSRAIDRLAGEELKIR
FT                   EMEIEEAA"
FT   gene            complement(473675..474055)
FT                   /locus_tag="BBta_0477"
FT   CDS_pept        complement(473675..474055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0477"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32762"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9B8"
FT                   /protein_id="ABQ32762.1"
FT                   /translation="MGVIVMVVMLMRMLRTMIVPVLMAMNMIMDMAVRMFMIMDMAVAM
FT                   VVPVVMTMPMHHVIAMRMHVRALIVESGLLTCLQVEESGFGLGAAATGSAHQAASSISI
FT                   SRIFSSSPASRSMAREPQAQAW"
FT   gene            474068..474781
FT                   /gene="hypB"
FT                   /locus_tag="BBta_0478"
FT   CDS_pept        474068..474781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypB"
FT                   /locus_tag="BBta_0478"
FT                   /product="Hydrogenase nickel incorporation"
FT                   /function="Chaperoning, folding"
FT                   /note="Evidence: Function of strongly homologous gene"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32763"
FT                   /db_xref="GOA:A5E9B9"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9B9"
FT                   /protein_id="ABQ32763.1"
FT                   /translation="MHGHDHPHDHDHPHSHGHSSVIELETRILAKNDALAARNRGWFAG
FT                   REILALNLVSSPGSGKTTLLERTIRDLKDKIPIAVIEGDQATTNDGERIRAAGAAAVQV
FT                   NTGAGCHLEADMVAKGLAELKPAFGSVVIIENVGNLVCPAMFDLGEHAKVVILSVTEGD
FT                   DKPLKYPHMFRAAEIMVINKIDLLPHVDFDVDIANANARQVNPEIVTFSVSARTGEGLG
FT                   GWYDWLGTQASQAWL"
FT   gene            474970..475470
FT                   /gene="hupE"
FT                   /locus_tag="BBta_0479"
FT   CDS_pept        474970..475470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupE"
FT                   /locus_tag="BBta_0479"
FT                   /product="Hydrogenase/urease accessory protein"
FT                   /note="Evidence: Function of strongly homologous gene;
FT                   Localization: 6 : Inner membrane-associated; PUBMED:
FT                   1597428"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32764"
FT                   /db_xref="GOA:A5E9C0"
FT                   /db_xref="InterPro:IPR007038"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9C0"
FT                   /protein_id="ABQ32764.1"
FT                   /translation="MHGFGHPVSGIDHILATVAVGMFAAYLGGRALWLVPTTFVLMMGV
FT                   GGVLGITGVPLLYVELGIAVSVIVLGLAVAMQWSLPTIAAMGLVGFFAIFHGHAHGAEM
FT                   PVDASGFEYAMGFMLATALLHVVGIGIALGIGRIGARTSRVALRTSGSIIALAGIGILT
FT                   SYL"
FT   gene            475793..476311
FT                   /locus_tag="BBta_0480"
FT   CDS_pept        475793..476311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0480"
FT                   /product="putative transposase"
FT                   /function="transposases"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32765"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9C1"
FT                   /protein_id="ABQ32765.1"
FT                   /translation="MDLSEFWLSEEQFERLRPLLPSKVRGVARVDDRRVISGIIHVVTS
FT                   GGRWVDAPACYEPRKTLYNRFVRWAAKGVWQELFVTLAAAGGPPAEVLIDSTHMKAHRS
FT                   AGGGKGGARPGDRDQPGRPQQQAPRPHRRRRPAAPLPADRRPGRRLPCGRCPVERSCGR
FT                   DHRARRQGL"
FT   gene            476262..476549
FT                   /locus_tag="BBta_0481"
FT   CDS_pept        476262..476549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0481"
FT                   /product="putative transposase"
FT                   /note="fragment; Evidence: Function proposed based on
FT                   presence of conserved amino acid motif, structural feature
FT                   or limited homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32766"
FT                   /db_xref="GOA:A5E9C2"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9C2"
FT                   /protein_id="ABQ32766.1"
FT                   /translation="MNDLAAGTIVLGDKAYDSNAIRDLIERQGAVPNIPSKANRRWKSC
FT                   FSKTLYKGRNAVERMFGRLKDYRRIATRYDKLATNFLGAIYLAAAVTWWL"
FT   gene            complement(476620..476715)
FT                   /locus_tag="BBta_0482"
FT   CDS_pept        complement(476620..476715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0482"
FT                   /product="putative transposase"
FT                   /note="fragment; Evidence: Function proposed based on
FT                   presence of conserved amino acid motif, structural feature
FT                   or limited homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32767"
FT                   /db_xref="GOA:A5E9C3"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9C3"
FT                   /protein_id="ABQ32767.1"
FT                   /translation="MVDFTYAHTRAGFVYVAFVIDAFAGGFWGGR"
FT   gene            476945..477688
FT                   /locus_tag="BBta_0483"
FT   CDS_pept        476945..477688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0483"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32768"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9C4"
FT                   /protein_id="ABQ32768.1"
FT                   /translation="MNQPSDPVALDKLKARIQALRAKTTANGCTEDEALSAAAKVAELL
FT                   DRHDLSLSDVELQTSLCERRVYETHRKKRIPLDDCIGAVAQFCDCRVWREKNAAGEASY
FT                   VFFGLSADVEVAHYLAELIDGAVRAELGRFKTSADYARFRHQERHLANASFALGMVTSI
FT                   ADRLVAMKKSRDQVNERTGRGLVVLKTSVVDAEFDKLDMKLRTQRATSRMVSTAAYEAG
FT                   GAAGATLPINPGLDGAPPKRSARQG"
FT   gene            complement(477712..478320)
FT                   /locus_tag="BBta_0484"
FT   CDS_pept        complement(477712..478320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0484"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32769"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9C5"
FT                   /protein_id="ABQ32769.1"
FT                   /translation="MSTQSSMHVYLNWAKERLHEMDAALDSFDATAAKAEAASKVKAAE
FT                   IIADLKKRRGELEAMLKTQSEAGEAALAGAKTELDRQWAEFETQMKAYFENAGKQVDQQ
FT                   QATFKQIAAAQAKAWQETTNRFREAAAKVTMAGTTDIDAVLKQLRSDASEAGAHLEKLK
FT                   QTGSESWSVLSAALSDSRKAFDQANQAAWNALKGSAPKG"
FT   gene            478558..478893
FT                   /locus_tag="BBta_0485"
FT   CDS_pept        478558..478893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0485"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32770"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9C6"
FT                   /protein_id="ABQ32770.1"
FT                   /translation="MTGDEFSALALSFEGTTAAPHFDRTAFKRHRTFATLAADGTSANV
FT                   LLTPDEQDHYAGLQPGIFSRVPNKWGDQGWTMVTLMQADVGLLRAALESAWRAAHRPQR
FT                   SRSGKRR"
FT   gene            complement(478932..479825)
FT                   /locus_tag="BBta_0486"
FT   CDS_pept        complement(478932..479825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0486"
FT                   /product="2-keto-myo-inositol dehydratase"
FT                   /function="Nitrogen metabolism; Carbon compound
FT                   utilization; Nodulation"
FT                   /EC_number="4.2.1.44"
FT                   /note="putative rhizopine catabolism protein mocC;
FT                   Evidence: Function proposed based on presence of conserved
FT                   amino acid motif, structural feature or limited homology;
FT                   Localization: 2 : Cytoplasmic; PUBMED: 7845353"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32771"
FT                   /db_xref="GOA:A5E9C7"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR030823"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9C7"
FT                   /protein_id="ABQ32771.1"
FT                   /translation="MILYGTNPIAWSNDDDWSIGDHLSLDDCLRDCREIGFDGIEKGHK
FT                   MPDEGSALKAKLGEYGLRFAAGWHSTNLLVNDIETEMKALQSFIDMVKAAGGDHINACE
FT                   CSNTVHGNDDVAVNDRPIMTDAEWDRFSRGYEALSHYAHEQGVKMGYHHHMGTIIETPE
FT                   DIDRFMAQAGPYTRLLFDTGHARFGGGDPVAILAKYVDRVSHIHCKNVRPPVMRDVRDN
FT                   GLSFLEGVRRGAFTVPGDPDGCIDFAPVLKIAADSGYSGWIVIEAEQDSLRYEPLSYQG
FT                   LGYRTLRELAARVGLR"
FT   gene            complement(479835..481667)
FT                   /locus_tag="BBta_0487"
FT   CDS_pept        complement(479835..481667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0487"
FT                   /product="3D-(3,5/4)-trihydroxycyclohexane-1,2-dione
FT                   hydrolase"
FT                   /EC_number="3.7.1.-"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32772"
FT                   /db_xref="GOA:A5E9C8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9C8"
FT                   /protein_id="ABQ32772.1"
FT                   /translation="MTGTIRLTASQAMVRWLSVQLTEQGDRFIEGVWAIFGHGNVAGLG
FT                   QALHGIGAELPTWRGQNEQTMAHTAIAYAKTMKRRKTMAVTSSIGPGATNMVTAAALAH
FT                   VNRLPVLFIPGDVFANRRPDPVLQQIEDFDDGTVSANDAFRPVVRYFDRIARPEHILSA
FT                   LPRALAVMTDPANCGPVCLAFCQDVQAEAYDYPDSFFAPKVWRIRRPLPDPDEVSAVAA
FT                   LIRAAQKPLLISGGGVIYSGAEAALAAFARKHDIAYLETQAGKGGNAWTDPLNFGAPGV
FT                   TGSDCGNALAAQADLIIGVGTRFQDFTTASWTLFRNPARKLVSINLHGYDASKRGATGV
FT                   VGDAQATLAQLSAALGDHKAAAPDAALRRAWHAKVTAVTAAPDESANGLPSDAQVIGAV
FT                   QRVATDSSIVMCAAGTMPGALQVLWQAAAGGYHMEYGYSCMGYEIAGALGVALAAPGKE
FT                   VICFVGDGSYMMANSELATAVMRRVPFTVVLTDNRGYGCINRLQIATGGAEFNNLYKDC
FT                   AVADGPEIDFVAHARAMGAHAEKASGLADLAARIVAARGRTRPTVIVIETDPVPGTGAG
FT                   GAWWDVAVPETGSAQLETLREIYEANTTQQRAFD"
FT   gene            complement(481688..482692)
FT                   /gene="idhA"
FT                   /locus_tag="BBta_0488"
FT   CDS_pept        complement(481688..482692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idhA"
FT                   /locus_tag="BBta_0488"
FT                   /product="myo-inositol 2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32773"
FT                   /db_xref="GOA:A5E9C9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR030827"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9C9"
FT                   /protein_id="ABQ32773.1"
FT                   /translation="MLNVGLLGAGRIGAVHARTIATHPGSRLAAISDAITESAAALAAK
FT                   MGAEPRSTEAILADTSIDAVLIATPTNTHSDLIEAATRAGKAVLCEKPVDLSLARARAC
FT                   QAAAAATGRPVMIGFNRRFDPNFAALKGAAERGEIGKPELLSITSFDPAPPPVSYVKVS
FT                   GGLFRDMMIHDFDVALWIMGAIPSRVMAVGAAIVDPEIGAAGDVDTAIVTLAFAHGAMA
FT                   VIKNSRRAVYGYDQRIELLGSEGLLSAGNVLENTVSKATTAGISSAKPEHFFLERYGRA
FT                   YAAEWAAFVAAVESGGPMPVTLADGVKALALAEAATRSAQTGAVVDPASLLQG"
FT   gene            complement(483206..484282)
FT                   /locus_tag="BBta_0489"
FT   CDS_pept        complement(483206..484282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0489"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32774"
FT                   /db_xref="GOA:A5E9D0"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9D0"
FT                   /protein_id="ABQ32774.1"
FT                   /translation="MADESVVASIIPWQQPKTAKPRPKRPKVVKPRPRPKSDRPEKTKA
FT                   AALDDEMLASETLIMPDFLELVNEPAKTPVAGEPGRTEAAASAAAAVTAGQAAPAPQAL
FT                   RETNAAVAGEVVPASAPLAAPEAERSPAKAEHPSARPERRRISASSILLQLAALALAAV
FT                   GMAMNGWFAHSLGSNNTAGYMFLAVGVTADLVALVMPTCAARLWQARHRASALTGWTVW
FT                   LMTFVFAVTAGIGFASTNISDVTLARASRVTPAVQAAQTALADAMTARDRECKGGVGKF
FT                   CREREAAVAERRQALDVAMSAVSQTADPQTEAAIKLVAWVSRGVVKPSADDFVMLRLIL
FT                   LALLPQIGGILLMVGRRA"
FT   gene            484785..485282
FT                   /locus_tag="BBta_0490"
FT   CDS_pept        484785..485282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0490"
FT                   /product="putative SEC-C motif domain protein"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32775"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9D1"
FT                   /protein_id="ABQ32775.1"
FT                   /translation="MSCPCGSDLPLDRCCGPYLSGDATPPTAEALMRSRYTAYTRGDIG
FT                   YIAATLAADKRAAFDAAAARQWASRATWLGLRIVSTARGQIDDSDGVVSFVASYREAGK
FT                   TIEHHEVSQFRRDDDGAWRFVAGDTRAVIVEPKRTAGAAKVGRNDPCPCGSGKKSKFCC
FT                   GR"
FT   gene            485574..487082
FT                   /locus_tag="BBta_0492"
FT   CDS_pept        485574..487082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0492"
FT                   /product="hypothetical protein"
FT                   /note="glycosyl transferase, family 2 and
FT                   Dolichyl-phosphate beta-D-mannosyltransferase domains;
FT                   Evidence: Similar to previously reported genes of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32776"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9D2"
FT                   /protein_id="ABQ32776.1"
FT                   /translation="MTELDGQVLQDEHARPQAAAIAAPAPKALSPRKQAILDHANSHAD
FT                   ARAGWRDKAAFFHAEDECYLRFLIPPGSRVLEIGCGIGDTLAALAPSYGVGIDFSDRQI
FT                   AIARTRHPNLTFIAGDAEDPATLAAVTGPFDVILVLDTIGSLDDCQQFIAQLHPLCTRE
FT                   TRLVIGYFSHLWYPLLKAAEAIGLRMPQPEQNVLSPADLRNLAHLADFDPVKSEQRVLS
FT                   PLRLYGLGRFANRFLSVLPGLRALSLRHYLVSRSMRCVTDDVRSATVVIPARNERGNIA
FT                   PAVQRIAAFCPDIEIIFIEGHSQDGTYEEMERVRAAYPQHDIKLMRQPGKGKADAVFTA
FT                   FDAARGDVLMILDADLTMPPEQLPKFFEALRSGKGEFINGSRLVYPMDEGAMRFLNLIA
FT                   NKTFSYLFSWLLNQRYTDTLCGTKVLRRSDYQRLKAGKAYFGDFDPFGDFDLIFGASKL
FT                   NLKSIDLPIRYAARSYGETQISRFRHGWMLLKMVVFAFFKIKAI"
FT   gene            487372..489024
FT                   /locus_tag="BBta_0493"
FT   CDS_pept        487372..489024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0493"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32777"
FT                   /db_xref="GOA:A5E9D3"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9D3"
FT                   /protein_id="ABQ32777.1"
FT                   /translation="MTRIDRLGPGAGADCKTATDASARDALDRLTPFGWRGGVAVTLLL
FT                   SLASFLIVGYFTVYWRNADMDFMVIYSALAMNDGGAQVFFDHPAYLTILSVKAWFALLH
FT                   RIGLLDVWTLSTMPSAADRAAFDASMISAVRAGRIAALLTAGGVILAFAVLARRLVSDW
FT                   RIAMLAVVAFAWSGGVQMHLRILRSEMIAASFCVLALIILILAARRASVSRPLAIGLAA
FT                   LLCTLGLENKVHAILLIAAIPVLVMPFGTATSGSVAFWRTPQAWMAALLAVVLALAGAF
FT                   IVWPLVAAGIDPANAAAAGLKPLLFGRFGAYQFALIGGIAIGMIVFARLWQVSAAETLA
FT                   AMAAASAGASLGLLALDLSYDINNVVVVLNPLEKMITYVDAPEAAGSLSGAIGLLLSGV
FT                   LGVIRRYTFILQSSARPTVFLTWLILPGIVLAWRRGERQVALQAALLMLAAIGIDTLGV
FT                   RRGLKVEYLVFTDPLIIIAGMILLDRLVDLRLARFAYPIGVTLLVLHVGISQAEPVKMA
FT                   LKRRGPEEVCTWNGYYMPRLALPWCVPRNLPRT"
FT   gene            complement(489044..489781)
FT                   /locus_tag="BBta_0494"
FT   CDS_pept        complement(489044..489781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0494"
FT                   /product="transcriptional regulator, GntR family"
FT                   /function="Transcriptional level"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32778"
FT                   /db_xref="GOA:A5E9D4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9D4"
FT                   /protein_id="ABQ32778.1"
FT                   /translation="MRVQRIGKANPAEDEAVYQAILRALLEGKLKAGTKLAETPLAAIF
FT                   GVSRERIRKVLHRLGAERRLEMIPNRGARVPRPTLDDIRRVYEAHRVLEAGVLSQLVLR
FT                   VDEVLLAQLDTHLEEERAAARRGDRAASVRLSGAFHVHLVEALGNPELSRILADLLSRS
FT                   SVMVSVYEPAAQSICAVDEHGAIVAALRDRDLMRAIAVSREHFLHVEGRLRLDEAAASE
FT                   SEDLAAIFTPVKPLRRKPRSAQS"
FT   gene            489984..491018
FT                   /locus_tag="BBta_0495"
FT   CDS_pept        489984..491018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0495"
FT                   /product="putative spermidine/putrescine ABC transporter
FT                   (Substrate binding protein)"
FT                   /function="periplasmic binding component; Amines; Polyamine
FT                   biosynthesis; Periplasmic space; putrescine/spermidine"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 9 : Periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32779"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9D5"
FT                   /protein_id="ABQ32779.1"
FT                   /translation="MHPFSRRSLLKTGAAFAATFAAPSLVRAAPKEIVIGGPAGAAKYF
FT                   NADLFPVLEKKLDCKVLYEGTNSLTNLQKMQADKASPKISVVIMDDPVMLPAAAEGLIT
FT                   KMSSSAIPNLGKLVDDAVHQDGMWANYQKPWVGIAYSTKRMKTAPVSWAELWDAKYDSK
FT                   IVVPSLSNTEGFWTLLAAAHLETGKPYKEAQYEIDAGFKKIKSLKANLLNVYTNAPQAI
FT                   NLLEQGEAWMIGGQFSAYTLIRKADGSPVDLAIPKDGGFSMPSGIAKVAGAPAGDLADA
FT                   VIDFYLSPEAQTILAKTAFIAPTSKATPLPAGYPDPASLFAPDWAFIAKNRAGWVDRWS
FT                   KEMT"
FT   gene            491015..492094
FT                   /locus_tag="BBta_0496"
FT   CDS_pept        491015..492094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0496"
FT                   /product="putative spermidine/putrescine ABC transporter,
FT                   (ATP-binding protein)"
FT                   /function="Amines; Polyamine biosynthesis; ATP binding
FT                   component; Cytoplasm; putrescine/spermidine"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32780"
FT                   /db_xref="GOA:A5E9D6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9D6"
FT                   /protein_id="ABQ32780.1"
FT                   /translation="MSEPAPHLVISAVSKRFGAATVLDRVDLTIRRGELVTLLGPSGCG
FT                   KTTLLRAIAGLSPPDTGTIALAGRDVTHVPPHRRNVGVVFQSYALFPHLTVAGNVAFGL
FT                   KVRGAPKAEIDRAVQRALALVKLGHLGGRRISALSGGQQQRVALARAIAVEPDVLLFDE
FT                   ALSALDRKLREEMQIELRRLLQDVKATAIFVTHDQDEALTMSDRVAVMNKGRIEQLAAP
FT                   RELYARPASLFALNFVGLSTRIAGQVVGGQDGMVDVVTPVGRLSARGAFQLGASVIVAT
FT                   RPEQLRLGADHEANSASGRVRSVVFQGSRTLVDVDAGAGASLLAELSGREAEVPRVHDE
FT                   VRFAWPAAETFAFAAEASP"
FT   gene            492091..492957
FT                   /locus_tag="BBta_0497"
FT   CDS_pept        492091..492957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0497"
FT                   /product="Putative spermidine/putrescine ABC transporter
FT                   (permease protein)"
FT                   /function="Amines; Polyamine biosynthesis; membrane
FT                   component; Membrane; Inner membrane; putrescine/spermidine"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 5 : Inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32781"
FT                   /db_xref="GOA:A5E9D7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9D7"
FT                   /protein_id="ABQ32781.1"
FT                   /translation="MTDAVLSAPVATPAPDRERLAAFGFVAPSLLITALVFVLPLALLL
FT                   GVSVLDPKGGGTSAHYARLLGTPYYLGVIWNSLRLGLLTTLIAFLISYPAAFALARARG
FT                   PLRSILLATLFLPLAASVIVKAFAWTILLRSDGLINTVLIAAGIIEDPIRMIFTQTALI
FT                   VGAVNIFLPFMVLPIYAVVAQLDSRYAEAAATLGASPLVVFFRVILPLTLPGIVAGVAL
FT                   VFSLSVSAYVVPTLLIGEKYPTLATTIAKAYLLAREPGFGAAAGVVLLAIAIIVVALSA
FT                   LLSREPK"
FT   gene            492957..493754
FT                   /locus_tag="BBta_0498"
FT   CDS_pept        492957..493754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0498"
FT                   /product="putative sperimidine/putrescine ABC transporter
FT                   (permease protein)"
FT                   /function="Amines; Polyamine biosynthesis; membrane
FT                   component; Inner membrane; putrescine/spermidine"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 5 : Inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32782"
FT                   /db_xref="GOA:A5E9D8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9D8"
FT                   /protein_id="ABQ32782.1"
FT                   /translation="MTRHAIIFCWVLAIGLALFLLLPLVVIAAASFSPTPVFDLPLSGA
FT                   SLRWYGRIGRLDGFWPSLSLSLQIAVLSTALSLVAGTLAAIAIARGRLPGATALGTLLV
FT                   SPLMMPGLVLGIALLQYFRMIGLTATWSALLVAHLVVTLPYVARTMIAGLSRFDFTLIE
FT                   AARTLGCTYAGSVIRVMVPALAPSFLISGLFSLLASFDNYPVSIFLTDVRSKTLPIRML
FT                   QYIEEAPDPTLAALSTLILAGTLVLLLISDRLVGLHRMAGTAD"
FT   gene            493759..494661
FT                   /locus_tag="BBta_0499"
FT   CDS_pept        493759..494661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0499"
FT                   /product="putative polysaccharide deacetylase family
FT                   protein"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32783"
FT                   /db_xref="GOA:A5E9D9"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9D9"
FT                   /protein_id="ABQ32783.1"
FT                   /translation="MSSQPVFRRDFVGYGGRPPHPRWPGDARVAVSVVVNFEEGSEFSV
FT                   ADGDTANEAIYEVVHRLEGPDPCIDSHFEYGTRAAWWRIMDLFDSYGVKVTVSACGRAV
FT                   ERSPDLARDAVARGHEISAHGWRWQSHAGMAEPEERRLIARTVDTIQHVTGKPPLGWHT
FT                   RSAASPNTRRLLVEQGGFLYDSDAYNDDLPYYVDVAGRPHLVLPYAFDSNDMQYFNGSR
FT                   FRGGDFADYVIDAFDWLAREGATAPKMLSIGLHLRMIGRPGRIGALDRILAHVTGSGAA
FT                   WIAPRADIARHWLATVPPV"
FT   gene            complement(494668..494817)
FT                   /locus_tag="BBta_0500"
FT   CDS_pept        complement(494668..494817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0500"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32784"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9E0"
FT                   /protein_id="ABQ32784.1"
FT                   /translation="MTPRNGHDRGLWPLEEAEDDPAEDERDLATGEGGTIELPLTPDDL
FT                   DEDD"
FT   gene            494816..495742
FT                   /locus_tag="BBta_0501"
FT   CDS_pept        494816..495742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0501"
FT                   /product="putative Sir2-family regulator protein"
FT                   /function="Regulation"
FT                   /note="NAD-dependent protein deacetylase; Evidence:
FT                   Function proposed based on presence of conserved amino acid
FT                   motif, structural feature or limited homology;
FT                   Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32785"
FT                   /db_xref="GOA:A5E9E1"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026587"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9E1"
FT                   /protein_id="ABQ32785.1"
FT                   /translation="MACPPVRDKTGRAHWFTPADPRCAGLAQATLAAYICAMVDPTALQ
FT                   SFLQSHSRIVVLTGAGCSTNSGIPDYRDSDGQWKRTPPVTYKAFMGTEETRRRYWARSM
FT                   VGWRRFGRAVPNGAHHALARLEAQGRSSLLVTQNVDRLHQAAGASNVIDLHGRLDRVRC
FT                   MGCGATLSRASFQDELASANPHWGDLDAADAPDGDADLDGVDFTAFTVPACHICGGILK
FT                   PDVVFFGETVPREIVSTARDHVDQADAMLVVGTSLMVYSGFRFVRAAAERGIPIAVVNL
FT                   GRTRADDLLSLKVEAPCDEALAFLLEG"
FT   gene            complement(495857..496030)
FT                   /locus_tag="BBta_0502"
FT   CDS_pept        complement(495857..496030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0502"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32786"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9E2"
FT                   /protein_id="ABQ32786.1"
FT                   /translation="MADNVNPDQKQPGENHEGKFHYNPGNQAGKTVEVGKPDSEQVNNK
FT                   DRIENRETPRSR"
FT   gene            496206..496454
FT                   /locus_tag="BBta_0503"
FT   CDS_pept        496206..496454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0503"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32787"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9E3"
FT                   /protein_id="ABQ32787.1"
FT                   /translation="MTSSLRLLAAAAIVASTGLLASASTSPAEAGWDWLGNKDYVRCLQ
FT                   LFYTGDFLMPANATPAQRAAKHEAGRRYCNRQYYGHD"
FT   gene            complement(496501..497805)
FT                   /locus_tag="BBta_0504"
FT   CDS_pept        complement(496501..497805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0504"
FT                   /product="L-sorbosone dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32788"
FT                   /db_xref="GOA:A5E9E4"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9E4"
FT                   /protein_id="ABQ32788.1"
FT                   /translation="MTTLSSIVARGVALVGNAALQWRKLQGETPQPAWGTQPQIPVAKP
FT                   QGLLPTLKMPTARGWRDGERPVAAPGLKANAFATGLDHPRWIYVMPDKSVLIAEATQIP
FT                   SPVRNMFGYAMQATMRRAAALGVSANRITRLVDADGDGTAERRNAFMENLSQPFGMALV
FT                   GDTFYVGNTDGIVAFPYAAGAERITAQGKRLTTFKPGGHWTRSLLVSPDGTKLYAGVGS
FT                   LSNIAEQGFEVEKGRACIYELDIASGQSRIFAGGLRNAVGLAFEPTTRVLWTVVNERDG
FT                   LGDETPPDYLTSVREGGFYGWPYCYWGKTVDDRVPQDPALVATALTPDYALGGHTASLG
FT                   LCWLPAGTLPGFPDGMVIGQHGSWNRSKLSGYKVVFIPFENGKPSGPARDILSGFLAPD
FT                   ESFSYGRPVGVTLGPDGSLLVADDVGNCIWRVTGA"
FT   gene            complement(497944..498381)
FT                   /locus_tag="BBta_0505"
FT   CDS_pept        complement(497944..498381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0505"
FT                   /product="putative plasmid stability protein"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32789"
FT                   /db_xref="GOA:A5E9E5"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9E5"
FT                   /protein_id="ABQ32789.1"
FT                   /translation="MNFLLDTNVLSEVRRPVPDRRVIGWLDTVDEDRVFISTASLAELQ
FT                   RGIELLDAGRRRTALAAWLSHDLPSRFAGRILAIDQAVALRWGDVMAAGHRRGIALSVM
FT                   DGFFAATALVHGLTLVTRNVKDFAATGTPLFNPWTDDDDVG"
FT   gene            complement(498378..498659)
FT                   /locus_tag="BBta_0506"
FT   CDS_pept        complement(498378..498659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0506"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32790"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9E6"
FT                   /protein_id="ABQ32790.1"
FT                   /translation="MKTPKSSKADSREGAWTLAGAKARLSELVDRAQAGPQVITRNGKP
FT                   AAVVVSAEEWSRKTARKGTLAEFLLASPLRGTDLDLPRSTDKPRDIDL"
FT   gene            499464..500792
FT                   /locus_tag="BBta_0509"
FT   CDS_pept        499464..500792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0509"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32791"
FT                   /db_xref="GOA:A5E9E7"
FT                   /db_xref="InterPro:IPR021830"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9E7"
FT                   /protein_id="ABQ32791.1"
FT                   /translation="MTAAFDLSAFTPHALRDSVLNEVHARPFTPLTQPVLVIRFAFMAR
FT                   GDSAAADRASLAAFCAQHGAPPPEPGVKHHQVDLGPVRLRFEQHSEFATLTWIWTPPAG
FT                   AGPRRFGAIAPELRALIAALPQAGELLVAVKLEVENAADPVARAEEIFNKTSLAIVTIK
FT                   GSAGAVASDFRLDEDGFTRILVCADGPTQERLGALVQRALELETYRTLALLGLPAALEL
FT                   APQVDRIERRLGEVLVEMQGAETLKINNHLLDELTELAASLERGATGSLFRFGASRAYW
FT                   ELVQARLTVIEGEPITPYSSWSSFLSRRIAPAMRTLTTLERRQDNLSRKLARAADLLRT
FT                   RVDVELEEQNRDLLRSMNERTKLQLRLQSTVEGLSVAAIGYYVVSLFGYLAKGAHDIGL
FT                   PVEPTFATAAFVPVAIALIWFTTHQIRKRHLKEDHEAEKTAGE"
FT   gene            500863..501555
FT                   /locus_tag="BBta_0510"
FT   CDS_pept        500863..501555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0510"
FT                   /product="hypothetical protein"
FT                   /note="alcohol dehydrogenase class III domain; Evidence:
FT                   Similar to previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32792"
FT                   /db_xref="GOA:A5E9E8"
FT                   /db_xref="InterPro:IPR021269"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9E8"
FT                   /protein_id="ABQ32792.1"
FT                   /translation="MSGMTIDVLVHAGGTATRQQVTVNRLVIAGWTGRDPVARDKHIAE
FT                   LEALGIPRPATTPIYYEVAARRLTTSDAIEVSGADSSGEVEFVLVKAGGRLLLGVGSDH
FT                   TDRKVETYNITVSKQICDKPVAPELWLVDDVLAHWDQLVLRAYATIGGERVLYQEGALS
FT                   GMLAPADLIARRYGEAGLPEGTAMFGGTFAAKGGIRPADRFAYELVDPVLNRSIRHGYA
FT                   IEQRVIAG"
FT   gene            501674..501925
FT                   /locus_tag="BBta_0511"
FT   CDS_pept        501674..501925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0511"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32793"
FT                   /db_xref="GOA:A5E9E9"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9E9"
FT                   /protein_id="ABQ32793.1"
FT                   /translation="MSIATMEMEMTYILDAALAAALLFFLFLPITDRRTVMMKLGMIAL
FT                   LAVSFSLSLSISRTAAPDGRAAATLVSSNQVPPAAPAR"
FT   gene            502005..503642
FT                   /gene="ipdC"
FT                   /locus_tag="BBta_0512"
FT   CDS_pept        502005..503642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipdC"
FT                   /locus_tag="BBta_0512"
FT                   /product="phenylpyruvate decarboxylase"
FT                   /EC_number="4.1.1.43"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32794"
FT                   /db_xref="GOA:A5E9F0"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR017765"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9F0"
FT                   /protein_id="ABQ32794.1"
FT                   /translation="MPALAHVLLAALRDHGAREIFGIPGDFVLPLFKVIEESRILPAVT
FT                   LSHEPAVGFAADAAARYHGGLGVAVVTYGAGAFNLVNSVAGAYAERSPVVVIAGAPGAR
FT                   ERVSGFLLHHQARTVDTQLAVFKEITCDQAVLSDPATAPAQIARVLRSAKEMSLPVYLE
FT                   FPRDMVDVEAEPVVPLPPRRADQDALGECVEEILGRIARAERPVIVVDVEIRRYGVEAR
FT                   IAALARKLGLPLVTTFMGRGLLDQADDVVAGTYLGAAGNPAITALVEDADLVLMLGVIL
FT                   SDTNFALSNRAPDPRRMILAASCEVQIGHHVYRDMPLGDLIDALDDRATPRAAPADRVR
FT                   QRSAYPRGLVADSNPIAPSDIATAINDMFDRHGRMPMTADIGDCLFTAMEIDNTALAAP
FT                   GYYAGMGFGVPAGIGVAATGLRPLILVGDGAFQMTGWELGNCRRYGLDPIVVLFNNCSW
FT                   EMLRVFQPESRFNDLDDWHYADIAKSIGGVGERVTTRAELVAALERAVERRGQFSLVEV
FT                   MLPRGKTSDTLARFVAGFKSARERMAGG"
FT   gene            complement(503678..504826)
FT                   /locus_tag="BBta_0513"
FT   CDS_pept        complement(503678..504826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0513"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32795"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9F1"
FT                   /protein_id="ABQ32795.1"
FT                   /translation="MGPVDRIWEFLQRLSPLTRSCLLSELERLELSGVDMPGSADIQAR
FT                   LRAEIRKDGVGGHRTANPSRYFFMPVEQLLIDGSPEHANEGRIARGSLTPIWEWISRDL
FT                   LPTMARDYNAQMRDLIAADKQREIRQVASAFQTKVTKSLEGTLARADGIEQVRSKLKAY
FT                   TASPSVFDDVVKLMKALRARDELAKFADSLPDRIAEFDDPQVKKMALLLDGLRKKEPEA
FT                   VPFALTLVAKRLKEPWQVMRLATKAARTKNVADVVAAPYAMTIPMVLDQLEDKRLALRM
FT                   ALKNNRVVTAKEILTSIYEIEYAIQVRIDRIEESDWGARLEAIMTSTDRMVQAEIKRFP
FT                   DEVGHVLGSNRLRGHRSLSGRLTYLAWKGRDAIKTALRSTTG"
FT   gene            505135..505755
FT                   /locus_tag="BBta_0514"
FT   CDS_pept        505135..505755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0514"
FT                   /product="putative Transcriptional regulatory protein, luxR
FT                   family"
FT                   /function="Transcriptional level"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32796"
FT                   /db_xref="GOA:A5E9F2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9F2"
FT                   /protein_id="ABQ32796.1"
FT                   /translation="MAQLRHRLPDDRGVALSSAPKVNDGGLAPPRAEALGAPVTAQAEP
FT                   SDGLVALTGQLNGSLTALMLYMGEIKQRSDDIARTPGDRRHVQMIVDNALMQTERICTL
FT                   VSQMAGAQPQCGSAPRSLPGQDSVVIGTATTSRHPGRTNKSLTPREREVLELISAGHSN
FT                   KEGALRMGISPRTFESHRAEAMRKLGARNTAELVRAALLNQIG"
FT   gene            complement(505937..506182)
FT                   /locus_tag="BBta_0515"
FT   CDS_pept        complement(505937..506182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0515"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32797"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9F3"
FT                   /protein_id="ABQ32797.1"
FT                   /translation="MFTFETADQKEVRRFRIAQFNGRTATVKSGGATITGHVRSVMEKE
FT                   ASVPPRWTITLVPAPAKAQAPLRPASRVRPFAEDYF"
FT   gene            complement(506422..508974)
FT                   /locus_tag="BBta_0516"
FT   CDS_pept        complement(506422..508974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0516"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /function="Complex regulation"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32798"
FT                   /db_xref="GOA:A5E9F4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9F4"
FT                   /protein_id="ABQ32798.1"
FT                   /translation="MDKKKRVLGAPAAIALILICIIAGSNLFFLTNLRENALLHAEEDL
FT                   SRHSLTLAENADRSVKSVDLVLSSVRDYLVRGGAIDAATYGKVAADYQTHLLLKEKIAG
FT                   LPQIDAVTLIDAQGRLLNFSRYWPIPDVNISDRDYFKALKGDSALRSYVSTPVQNRGDG
FT                   TWNIYFARRLDDGKGEFMGLLLGAMSVPYLENFFGSTALGLDASVSLIREDGILLAHFP
FT                   PTSEIGKSTSGFGQRALAAGGVLRELSGRTGEMRLRAAKMLPSYPAMIVVSVPEQHVLK
FT                   AWRAMATLLVIMSLVSATAVLAAAVLISRLWERHEHLIDAAEAANAAKSTFVAMMSHEI
FT                   RTPMNAVLGLATTLLETNLDPEQRRSVVAIHNAGDNLLEILNDILDFSKLESGQLSLED
FT                   IAFSAEALVHNTLSIIGPRASAKDLKLRSVNDPAVPPALVGDAGRIRQILLNLVSNAVK
FT                   FTAAGEVVITTRCLAKDDAKATVEWTVTDTGIGIAADKIGSLFANFVQADNSISRRFGG
FT                   SGLGLAICKRLTEQMGGEIDVTSTLGRGSTFSFRLTLPIAEAVAVPEQNDDSIYAALQS
FT                   RIAAYGRPLRVLVVDDNPTNRLVATKMLKDFDIQTDTACDGAEAVTAASRFNYDLILMD
FT                   VRMPEMDGFQATRTIRARGERRSNVPIIAFTANAFMEDIRACREAGMNDFVVKPARKKA
FT                   LVEAILRVLPARTLAIETIASDAPPLAPVEQDDMPAEFSAEAEIPAEPALDREAFAELV
FT                   GEIGDDAAQEIRNVFFSETDARLKLFRKLSLDSERIKIGREAHSLKSAAGTFGYRRLAT
FT                   YALALEKSAPRLSPREYSELLDNIDAAYEAARAQELQY"
FT   gene            complement(508974..509393)
FT                   /locus_tag="BBta_0517"
FT   CDS_pept        complement(508974..509393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0517"
FT                   /product="putative response regulator receiver (CheY-like
FT                   protein)"
FT                   /function="Regulation level unknown"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32799"
FT                   /db_xref="GOA:A5E9F5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9F5"
FT                   /protein_id="ABQ32799.1"
FT                   /translation="MRNELLVIEDADVHLSILRKIATQAGFNTTGVSSVDAASTILRTR
FT                   HFDCVTLDLSLGERSGTEVLQRLAELKYRGPVLIISASENDRLDASVRIGNFLELNVCP
FT                   PFSKPINLPLLRQTLKQIASETDRQKLVRRQAGRG"
FT   gene            complement(509637..510026)
FT                   /locus_tag="BBta_0518"
FT   CDS_pept        complement(509637..510026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0518"
FT                   /product="putative response regulator receiver (CheY-like
FT                   protein)"
FT                   /function="Regulation level unknown"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32800"
FT                   /db_xref="GOA:A5E9F6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9F6"
FT                   /protein_id="ABQ32800.1"
FT                   /translation="MAFDLSMPILVVDDYATMIRIIRNLLKQLGFENVDDATDGSAALA
FT                   KMQAKKYGLVISDWNMEPMTGYDLLREVRASPELSKTPFIMITAESKTENVIAAKKAGV
FT                   SNYIVKPFNAATLKTKMEAVFGPAE"
FT   gene            complement(510256..510972)
FT                   /locus_tag="BBta_0519"
FT   CDS_pept        complement(510256..510972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0519"
FT                   /product="Putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /function="Regulation level unknown"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32801"
FT                   /db_xref="GOA:A5E9F7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9F7"
FT                   /protein_id="ABQ32801.1"
FT                   /translation="MDLGLRSPNGFLSSLSDEDFELIRPYLRTVDLVQDSVLAEVGEKL
FT                   SRIYFPHRGVISLVVNLARGERVQVAMIGRDSFFGSMSLLGGAESLVLNTAAVLVPGAA
FT                   SVVDIERVRNAAEQSGTFRAQMLRHALAVYLQSQQTAGCNAAHTVESRLARCLLQTHDL
FT                   SGGNKLYITQESLAQMIGARRNSVSLVASTLQQADFIHYSRGHIEIIDLEGLKKTACEC
FT                   YGTVKSQYDRLMRCHP"
FT   gene            511651..512391
FT                   /locus_tag="BBta_0521"
FT   CDS_pept        511651..512391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0521"
FT                   /product="hypothetical protein"
FT                   /note="His Kinase A domain; Evidence: Similar to previously
FT                   reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32802"
FT                   /db_xref="GOA:A5E9F8"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9F8"
FT                   /protein_id="ABQ32802.1"
FT                   /translation="MALPTQQQAGHHNEDANAAKPVTIEPNPGLAIVGQVAGGLLHDFN
FT                   NILTVITGTIDILAEAVEDRPELAAVARLIDEAATRGARMTAQLLSFARGRPPRPCAVE
FT                   LSELLIDVGRLLRPTLGTDVEVTTSIEPAVPAVFADPGQLMAALLCLAIMARPTIDNGG
FT                   KLDILAKAIAAAEGDDSDGASSNVLITVTATATAAAIIPAERMFPDIRMVTDFVMRSNG
FT                   QLALKASDGSAASVEIVLPCAVQD"
FT   gene            512671..514239
FT                   /locus_tag="BBta_0522"
FT   CDS_pept        512671..514239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0522"
FT                   /product="hypothetical protein"
FT                   /note="flagellin domain (C-ter); Evidence: Similar to
FT                   previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32803"
FT                   /db_xref="GOA:A5E9F9"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9F9"
FT                   /protein_id="ABQ32803.1"
FT                   /translation="MFIQKGMTMSGIVLSASVRQNLLSLQSTAQLLATTQNNLSTGKKV
FT                   NSALDNPTNFFTAQGLDNRASDISNLLDGIGNGVQVLQAANTGITSLQKLVDSAKSIAN
FT                   QVLQSAVGYSTKSTVTSAALTGATATSLIGASTTAVTGSAVLNDNTSTAVAITGSTKLS
FT                   GTPGTSSNDLASSITTGDTLVVNGTTFTFIAGTSSSGTNIGVGDTVTNLLSTIQSATGV
FT                   TSSITAGAITLTPPAAGLTLSGTSLAKLGLSAVGNSLSGQTLTIAATGGGTATSVTFGL
FT                   GTGQVNSLNDLNAKLAANNLQATVASATGKISITTTNDAASSTIGAIGGTAAASSQSFN
FT                   GLTAAAPVADATAQSQRASLVAQYNNVLAQINTTAADASFNGINLLNGDTLKLTFNETG
FT                   KSTLSITGVTFNTGGLGLSTLTSGTDFLDNNSANKVIKVLNTASSTLRDEASTLGSNLS
FT                   VVQVRQDFNKNLINVLQTGSSNLTLADTNEEAANSQALSTRQSIAVSALSLANQSQASV
FT                   LQLLR"
FT   gene            514442..514837
FT                   /locus_tag="BBta_0523"
FT   CDS_pept        514442..514837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0523"
FT                   /product="putative Flagellin synthesis repressor protein
FT                   FlbT"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32804"
FT                   /db_xref="GOA:A5E9G0"
FT                   /db_xref="InterPro:IPR009967"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9G0"
FT                   /protein_id="ABQ32804.1"
FT                   /translation="MPLRVELKPFERIVIGDSVIINSNTRARFIVEGDVPILRERDTVS
FT                   AETADTPAKRLYHCVQTMYLKNDAIRYRASYLACMNELRESVPDAAALAATVDRHVAEG
FT                   ALYKALKAIRMLIQCESPAIAPVEVSP"
FT   gene            515093..517876
FT                   /gene="cheA"
FT                   /locus_tag="BBta_0524"
FT   CDS_pept        515093..517876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="BBta_0524"
FT                   /product="Chemotaxis protein cheA"
FT                   /function="Motility (incl. chemotaxis, energytaxis,
FT                   aerotaxis, redoxtaxis)"
FT                   /EC_number="2.7.3.-"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32805"
FT                   /db_xref="GOA:A5E9G1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9G1"
FT                   /protein_id="ABQ32805.1"
FT                   /translation="MDDLLREFLTETSESLDTVDNQLVRFEQEPNNAKILDNIFRLVHT
FT                   IKGTCGFLGLPRLEALAHAAETLMGKFRDGMPVTGEAVTLILTTIDRIKDLLAQLEANE
FT                   SEPEGEDRDLISELEAMVERGMAAMAAGAAPPPLVPAAPAAPPAAPAVTQGSLIDQTLE
FT                   RPLRPGEVSLDELERAFRETAIETPPAHEKAPEPKAAAPAPKAEPAKVEAKAEPKAEAP
FT                   KKAARAKANADGEVHESDKVANQSIRVNVDTLEHLMTMVSELVLTRNQLLEIARRNEDT
FT                   EFKVPLQRLSNVTAELQEGVMKTRMQPIGNAWQKLPRIVRDLATELGKQIELEMHGADT
FT                   ELDRQVLDLIKDPLTHMVRNSADHGLETPAERAASGKAEQGTIRLSAYHEGGHIIICIA
FT                   DNGRGLNTERIKAKAVANGLVTEAELEKMTEAQIHKFIFEPGFSTAAAVTSVSGRGVGM
FT                   DVVRTNIDQIGGTIDIKSVAGEGSSVTIKIPLTLAIVSALIVEAGGDRFAIPQLAVVEL
FT                   VRARANSEHRIERIKDTAVLRLRNKLLPLMHLKKLLKIDDGSSTDPENGFIVVTQVGNQ
FT                   TFGIVVDCVFHTEEIVVKPMSTKLRHIDMFSGNTILGDGAVIMIIDPNGIAKALGAAGS
FT                   ASQAVADEHAAHHAVGGEQLTSLLVFRAGTAQPKAVPLALVTRLEEIAADKIEISNGRY
FT                   MVQYRDQLMPLVQMEGVSVQTTGSQPILVFADETRAMGLVVDEIIDIVEERLHIQVSGA
FT                   KDGILGSAVIKGQATEVIDVGHFLPMAFADWFIRKEMATEAQTQSVLLVDDSPFFRNML
FT                   APVLKSAGYKVRTAASAIEGLATLRSGHTFDIVVTDIEMPEMNGFEFAEAIRSDQNLNQ
FT                   LPVIAVSSLVSPAAIERGRQAGLYDYIAKFDRPGLIAALKEQIEERARAEANRRAA"
FT   gene            517902..518375
FT                   /gene="cheW"
FT                   /locus_tag="BBta_0525"
FT   CDS_pept        517902..518375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="BBta_0525"
FT                   /product="CheW protein"
FT                   /function="Motility (incl. chemotaxis, energytaxis,
FT                   aerotaxis, redoxtaxis)"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32806"
FT                   /db_xref="GOA:A5E9G2"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9G2"
FT                   /protein_id="ABQ32806.1"
FT                   /translation="MSSKIEATDGAASEFVTAVIGGQLFGLPISRVQDVFMPERVTRVP
FT                   LSSAEIAGVLNLRGRIVTVIDMRARLGLARADDGKPPMAVGVDLRGESYGLLIDQIGEV
FT                   LRLPEASREENPVNLDPRMAKFAGGVHRLDGQLMVVLDVDRVLELLPKAAIAA"
FT   gene            518406..518795
FT                   /gene="cheY"
FT                   /locus_tag="BBta_0526"
FT   CDS_pept        518406..518795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="BBta_0526"
FT                   /product="Chemotaxis protein cheY"
FT                   /function="Motility (incl. chemotaxis, energytaxis,
FT                   aerotaxis, redoxtaxis)"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32807"
FT                   /db_xref="GOA:A5E9G3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9G3"
FT                   /protein_id="ABQ32807.1"
FT                   /translation="MKSCLVVDDSSVVRKIARRILEELGFSVVEAEDGEQALELCTKSL
FT                   PEAILLDWNMPVMDGYDFLGRLRRLPGGEGPKVVFCTTENDIDHISRALNAGANEYIMK
FT                   PFDKEIVAAKFQEVGLIQAMSAESA"
FT   gene            518825..519694
FT                   /gene="cheR"
FT                   /gene_synonym="cheX"
FT                   /locus_tag="BBta_0527"
FT   CDS_pept        518825..519694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /gene_synonym="cheX"
FT                   /locus_tag="BBta_0527"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /function="Motility (incl. chemotaxis, energytaxis,
FT                   aerotaxis, redoxtaxis)"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32808"
FT                   /db_xref="GOA:A5E9G4"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9G4"
FT                   /protein_id="ABQ32808.1"
FT                   /translation="MNQPDYEFLRKLLRDKSGLDLSADKQYLIESRLLPLARKAGLASI
FT                   SDLVQKLKDGSSALISQVVEAMTTNETFFFRDKVPFDHFRDVIMPELLKARAGRKSIRI
FT                   WCAACSTGQEPYSLAMSLKEMSAALNGWRVEILATDLSQEVLEKSKAGLYSQFEVQRGL
FT                   PIQLLVKYFKQAGELWQINSDVRGMVQHRQLNLLHDFSQLGTFDVVFCRNVLIYFDQDT
FT                   KINIFNRLAKQMEPDGFLVLGAAETVVGLTDVFKPLADRRGLYRPSGAASSAKPPAPGM
FT                   PRVAAAGN"
FT   gene            519728..520051
FT                   /locus_tag="BBta_0528"
FT   CDS_pept        519728..520051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0528"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32809"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9G5"
FT                   /protein_id="ABQ32809.1"
FT                   /translation="MSDENKGTERVTFSRGYDVCIMGIDGTWRRDCQLNAISDNDAVLT
FT                   VEGSIQGLNLKEFFLLLSSTGLAYRRCELVRVNGAEMDIQFIKGKNKKKRSGASSGQEA
FT                   TVS"
FT   gene            520244..520753
FT                   /locus_tag="BBta_0529"
FT   CDS_pept        520244..520753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0529"
FT                   /product="putative response regulator receiver protein"
FT                   /function="Two-component regulatory systems (external
FT                   signal)"
FT                   /note="CheY-like; Evidence: Function proposed based on
FT                   presence of conserved amino acid motif, structural feature
FT                   or limited homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32810"
FT                   /db_xref="GOA:A5E9G6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9G6"
FT                   /protein_id="ABQ32810.1"
FT                   /translation="MSVMSSELASRRPDAAEEGDRRALQLLVVDDDASQRTLISLAAKQ
FT                   AGHAVTVVASCAEAIREIGHKRFDCVTLDLMLEDGDGTEVLKAIADSRFAGSVIVISGM
FT                   DAARRIAARLYARSLGIDLQSLPKPVDLAALRIFLANLGKTALGLPVVHTWGGVAAESV
FT                   AAKHRS"
FT   gene            521251..521886
FT                   /locus_tag="BBta_0530"
FT   CDS_pept        521251..521886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0530"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /function="Transcriptional level"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32811"
FT                   /db_xref="GOA:A5E9G7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9G7"
FT                   /protein_id="ABQ32811.1"
FT                   /translation="MAEQANSRGEIFVVDDDPAVRDTLSMVLSAGGYEVICFADGAALL
FT                   AVARSRTPACILLDVHIPGKSGLDILRELHGEDYPAPIFMISGQGDIPMAVNAIKYGAL
FT                   DFIEKPFRGSEIVARLNEAIGAFARRQKENASPKIGSLHFPGREPLTRREREVLEQFTA
FT                   GASNKEAGRTLGISPRTIEDHRANIMKKLGARNAADLIRIVMTASRTN"
FT   gene            complement(522024..525605)
FT                   /locus_tag="BBta_0531"
FT   CDS_pept        complement(522024..525605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0531"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /function="Two-component regulatory systems (external
FT                   signal)"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence: Function of strongly homologous gene"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32812"
FT                   /db_xref="GOA:A5E9G8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9G8"
FT                   /protein_id="ABQ32812.1"
FT                   /translation="MGQQPGRAGSPDGREALGLGRRLTLTTRLAIAMILLVAMAVFAVG
FT                   WLGYRSLESALLPRALDRIEAHSRLMATELENYVGGARNDLNGYRASPNLATLIRTLKT
FT                   GGPDPREGLSAQSWRERVAMRYFAELQAKTTYAMVRLVGIENNYRELIRVDRLGPGGTV
FT                   RIVPENELITRGDRKYITETLQLAPGGIRVSPIILDGNTTDPKTGVPMLCVGTPVFSPD
FT                   GKPFAILMLDLDMRPIFAHLRSAARPGAQLYVVNARGDYLFHPESDREFASKRGGSTRW
FT                   QDDFPSLASATGSTQGFARILHDDAKRPGGVAFAPAMLAGQEWVAVIETIPNTAFMAPA
FT                   LAIRKTAIEVGLIAMLCAAALAFVVARSLTRPINQLTQAVESVGRGESVKIPLEAVGET
FT                   GVLARAFARVLEEVRAKTAELEREVQEHYLTEAARDHFAARERLYSAAVESSNDAIVTL
FT                   ALDGTITAWNPAAETMLGYAAEEAVGRQADFVVPADRMAEAQDILLRVARGERIQHFET
FT                   VRIRKDGEHILVSLSVSPIKSPTGQIIGASKIARDITESRKTEQALRQQTEERRRIFET
FT                   SQDLILITDRSGILVQVSPSVEAILGYTPAEMIGRNGADFIHPDDLQKARDELRASRHG
FT                   LSPRNSDGRYVHKDGRVVTLSWTSNWSEPVQRHFFIGRDMTESRLAQETLRESEQLARN
FT                   IIETALDAFVQVDAKGAILNWNSQAEKIFGWPRAEILGKDVFDLITIDDEGEELRSALG
FT                   RIVLTGEASALGIGRRREVIVRRRDGRDFKAEVSVTALKTRNGFVFNGFFRDLTDKIAA
FT                   EERIRQSEKMEAIGQLTGGIAHDFNNILTVITGTIEILAAAVAKEPQLAAITRMIDEAA
FT                   ARGADLTQHLLAFARRQPLQPREVDVNMLVIDTAKLLRPTLGEQIEIESVFQDETCAAH
FT                   VDPNQLATAIINLALNARDAMPSGGKLILETGWADLDENYASLYDDVRPGRYAMIAVSD
FT                   SGSGIPAAIIDKVFNPFFTSKGPGKGTGLGLSMVYGFVKQSSGHVRIYSEEGHGTTIRM
FT                   YLPPGREGVAIPAASAAPAIEGGHETILVVEDDRLVRGYVLAQLHALGYATLEAANAAE
FT                   ALAIANGGERFDLLFTDIIMPGTMNGRQLASEIQRLRPGQRVLFTSGYTENAIVHHGRL
FT                   DEGLLLLPKPYRKSELAKMIRTALTSD"
FT   gene            complement(525613..526047)
FT                   /locus_tag="BBta_0532"
FT   CDS_pept        complement(525613..526047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0532"
FT                   /product="Putative response regulator receiver (CheY-like
FT                   protein)"
FT                   /function="Two-component regulatory systems (external
FT                   signal)"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32813"
FT                   /db_xref="GOA:A5E9G9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9G9"
FT                   /protein_id="ABQ32813.1"
FT                   /translation="MAKILVVDDDPVMQMTIQRLLQQAGHAVTVADDGQKAIARFQGES
FT                   FDLVVMDIFMPGMDGLEAMRLILKHAPSTPILMTSGRPNTPNSISEPDYLTMATKLGAV
FT                   SALPKPFKPAALLAMVSDCLERGGTNAAPSRPGPDAVPNA"
FT   gene            526378..528516
FT                   /locus_tag="BBta_0533"
FT   CDS_pept        526378..528516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0533"
FT                   /product="Methyl-accepting chemotaxis protein (MCP)"
FT                   /function="Motility (incl. chemotaxis, energytaxis,
FT                   aerotaxis, redoxtaxis)"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 6 : Inner
FT                   membrane-associated"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32814"
FT                   /db_xref="GOA:A5E9H0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9H0"
FT                   /protein_id="ABQ32814.1"
FT                   /translation="MGTFSTTCYLGRGEMMFGKIKIGARLSLGFGVLVAVGLATAAFAY
FT                   RELDFILAKVVRMADQSQNAIGVVRIAGELHAASRALLRYQMDRDQASYGEAETRLASA
FT                   ATTLEATIRRTVSQERLAAYRVLQPEIASLNEKRLALGRVLQAYFAGRDALFEDGDRLA
FT                   ADLRKLVEAAQASREAAAIAALETSIVAARIAVWRHLATSDVKPREAFQAELTRSRAQF
FT                   AELEKRDLAPALAPLVATVKADLTKYAGSFETASSGLLRGHEILVGEIGPLTKSAIDRI
FT                   EKVESGIRSAYSATIEETSGLIATSSQVQLTTALIAALVGALCAVLITRSIVGPVRVLA
FT                   DEAGRLSAGDTSVEFLGARRGDEIGQLAGAVAKFRDNVLAQQQAAKEVSAAAEQRDAAN
FT                   RNMEQAVEEFRQAAEGLLGRVGENAGRMKQTAGALTEIATHATQQADAAADASERTAAN
FT                   VQTVAAAAEELAGSIQEIARQIDRSNSTVRSANTTTARSESEIEGLAQAAQSISSVVDL
FT                   IQAIAAQTNLLALNATIEAARAGEAGRGFAVVAQEVKSLAEQTAKATQEIAQHVQGIQT
FT                   STGNAVASVKQVGVAMREIDEVTGAIASAVEQQGAATREISQNVQMAASGSHTLASNIA
FT                   TVSEAIRKTNRSADQVSDSSGQVSEAAERLAEEVRSFFVKLRTGPLDRRKEDDAAYRGP
FT                   ERRQNYIASLSGRRKSAA"
FT   gene            528571..530772
FT                   /locus_tag="BBta_0534"
FT   CDS_pept        528571..530772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0534"
FT                   /product="Methyl-accepting chemotaxis protein (MCP)"
FT                   /function="Motility (incl. chemotaxis, energytaxis,
FT                   aerotaxis, redoxtaxis)"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 6 : Inner
FT                   membrane-associated"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32815"
FT                   /db_xref="GOA:A5E9H1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9H1"
FT                   /protein_id="ABQ32815.1"
FT                   /translation="MFGYISKLRIQSRLLAGFGLLCVLLACSVGYSAYAVSDLSAKFSK
FT                   VVTLRSPVAITSTQLVADLHATLSALRGYLLTGDPEMKQRRAALWAEFDTSVQQFDRLA
FT                   DKFALPENRALWAEVKPLVAEFRTAQDKAESVAFTAEAYPATKLLGAEASPLIATMFAE
FT                   VTRMIDEENSLEATPERKRLLKTMADLRGNLAAAGSQLRLYVASGDVSDRDKFAAPYTN
FT                   YKNAVAAIRSQTDLLTSTQKAAFDKVSKASEALAPLPDRIFAIRQSPQWNAAVYLLATE
FT                   ATPRANKLLDLLDGKKRPDGTFGGGLKTNQQDLLVKESTDVAALIDRLLFTEWTLLGVG
FT                   LLLGLGIAILVARSITRPIQELVADAVLLSEGDTTVEFRTAELADEVGDVSKAVAIFRD
FT                   TAIAQQQASSNYVREAEAREAMNRNMEEAVEAFRAKSTELLSEVDDNVGVMRSTAESLT
FT                   GIAGHATEQAASAAGASEKTAVNVQTVAAAAEQLASSIVEIGRQIELSNTTVRNANATT
FT                   ARSEAEIESLAQAAQSISTVVDLIQAIAAQTNLLALNATIEAARAGEAGRGFAVVAQEV
FT                   KSLAEQTAKATQEIGQHVQGIQNSTSNAVASVKEVSTAMRQMADVTTAIASAVEQQGAA
FT                   TREITENVQMAASGSKMLASNISTVSGAIEETSQSAASVRDASNNVSRVAEDLAAEVQD
FT                   FFIRLRSGPLDRRVDDDPNYQGPERRANSGAGRRRGQAA"
FT   gene            complement(530797..531510)
FT                   /locus_tag="BBta_0535"
FT   CDS_pept        complement(530797..531510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0535"
FT                   /product="transcriptional regulator, GntR family"
FT                   /function="Transcriptional level"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32816"
FT                   /db_xref="GOA:A5E9H2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9H2"
FT                   /protein_id="ABQ32816.1"
FT                   /translation="MASLPAPHSASGFQDRLDPSRRAAPQVFERLRDQIIALVLPPGAP
FT                   LSRVTLQAEFGLSSTPIRDALMRLAEEGLVEVFPQHATLVSRIDVGRAQQAQFLRQALE
FT                   LEIVRLLALQPAIAPVDELNGLIAQQRRFAKDGDFASFTVVDNAFHERLYTAADKQELW
FT                   LLVRSRSGHIDRLRRLHLPSPGKAQTILRHHKQIVDAIAAGQPDAAQAHLREHLTGTLS
FT                   DLATIRGRWPDYLSG"
FT   gene            531638..532666
FT                   /locus_tag="BBta_0536"
FT   CDS_pept        531638..532666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0536"
FT                   /product="putative ABC transporter (substrate-binding
FT                   protein)"
FT                   /function="periplasmic binding component"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 9 : Periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32817"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9H3"
FT                   /protein_id="ABQ32817.1"
FT                   /translation="MLMSFGRSATRAAGLLAALAATTWSVAAAAQQKTEVSLSRQPGIF
FT                   YMPSHIIEKQKLIEKHAAALGLAGVTTKWLTFSGGGAQTDALLSGSVDILNTGTGNLLL
FT                   LWDRTRGGVKGIVATSAQPMTLISRDPHIKSIKDFGPTDKIAVPTVKVSTQAIVLQIAA
FT                   AEAFGADQWNKLDANTVQLGHPDAYTALSNPQHEVHNHFSIPPYTFLEMKNVPGAHVVL
FT                   NSPDVMGGPLSQAQFFTTTKFADANPKIIQAVRDATKEAQDLIRSDTKAAVEIYKEITG
FT                   DKTSTEDLLAWLKEPGMMEWNLEPQGTMKFATHLAKIGTIKTQPKAWTDYYLPVAHDLK
FT                   GN"
FT   gene            532666..533430
FT                   /locus_tag="BBta_0537"
FT   CDS_pept        532666..533430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0537"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /function="ATP binding component"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32818"
FT                   /db_xref="GOA:A5E9H4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9H4"
FT                   /protein_id="ABQ32818.1"
FT                   /translation="MSALLDVDGVTLRYKTSSAVITATERVGFSVDRSDRFVLLGPSGC
FT                   GKSTLLKAVGGYIKPSEGRMKINGREITGPGADRMMIFQEFDQLLPWKTVLANVMFPLL
FT                   TARRMPRKEAESRARAYIEKVGLTRVVDAYPHTLSGGMKQRVAIARGMAMEPDILLMDE
FT                   PFAALDALTRRTCQDELLQLWSETKFTVLFVTHSIAEAIKIGNRILLLSPHPGRVKAEV
FT                   IDVDKVSAEDGSAARLEKQIHDLLFSEPATAH"
FT   gene            533442..534305
FT                   /locus_tag="BBta_0538"
FT   CDS_pept        533442..534305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0538"
FT                   /product="putative ABC transporter (permease protein)"
FT                   /function="membrane component"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32819"
FT                   /db_xref="GOA:A5E9H5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9H5"
FT                   /protein_id="ABQ32819.1"
FT                   /translation="MADAKIILRDTSTPSAASAADVARKLSVFELLWNDGFVRKSLIIV
FT                   VLAAIWQAYGSYLDNPLLFPTFSDTIAALWEKVRDGTIPMRAWTSLKVLFMGYAAGIAL
FT                   AAILTVLAISTRIGTDFLETVTAMFNPLPAIALLPLALIWFGLGSGSLVFVLIHSVLWP
FT                   VALNTHSGFKSVSNTLRMVGRNYGLTGFSYVIRILIPAGFGAILTGLKIGWAFAWRTLI
FT                   AAELVFGVSSGQGGLGWFIFENRNLLEIPAVFAGLLTVILIGLVVENLIFRTIERKTVL
FT                   TWGTQS"
FT   gene            534302..536038
FT                   /locus_tag="BBta_0539"
FT   CDS_pept        534302..536038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0539"
FT                   /product="dihydroxyacid dehydratase"
FT                   /function="Isoleucine/valine"
FT                   /EC_number="4.2.1.9"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32820"
FT                   /db_xref="GOA:A5E9H6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9H6"
FT                   /protein_id="ABQ32820.1"
FT                   /translation="MTKQKQPDQLRSARWFAPDDLRSFGHRSRVMQMGYAQEEWKGRPV
FT                   IAIVNTWSDAQPCHMHFKQRVDDVKRGVLMAGGFPIELPALSLSESLLKPTTMLYRNML
FT                   AMDVEELLRSHPVDGVVLMGGCDKTTPALLLGATSMNLPAIYLPAGPMLRGNWKGKTLG
FT                   SGSDAWKYWDERRAGKLSDADWSAMEAGIARSHGTCMTMGTASTMTAIAEAIGMTLPGA
FT                   SSIPAADAEHIRMSSECGRRIVEMVWEDLTPAKIQSRQAFENAIAVAMAMGCSTNAIIH
FT                   VIAQARRAGADIGLDDFEAASRKVPVLANVRPSGDTYLMEDFYYAGGLPGLMSRMKEHL
FT                   HLGCLTVNGRTLGDNIADAGVYNDDVIRPQSNPIYREGALAVLKGNLAPDGCVIKPSAC
FT                   DPRFLKHTGPALVFDDYPSMKKAIDDPDLDVTADHVLILRNAGPQGGPGMPEWGMLPIP
FT                   TKLVKQGVRDMVRLSDARMSGTSYGACILHVAPEAYVGGPLALVRNGDLITLDVAARTI
FT                   DLDVPEDELARRRAEWQPPAPRFERGYGWMFARHIKQANDGCDFDFLETSFGAPIGEPA
FT                   IY"
FT   gene            536258..536977
FT                   /locus_tag="BBta_0540"
FT   CDS_pept        536258..536977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0540"
FT                   /product="hypothetical protein"
FT                   /function="Menaquinone (MK), ubiquinone (Q)"
FT                   /note="demethylmenaquinone methyltransferase domain;
FT                   Evidence: Similar to previously reported genes of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32821"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9H7"
FT                   /protein_id="ABQ32821.1"
FT                   /translation="MTKLSTATRNKLKTVSTATVATALFKRGLRIQCIQNVHPLSPQQP
FT                   TMVGEAFTLRYIPAREDLNTIEVFKDRGHPQRKAVEECPPGAVLVMDSRKDARAASAGA
FT                   ILVSRLQQRGVAGVVTDGGFRDSAEIAKLGIPAFHQRPSAPTNLTLHHAIEINGPIACG
FT                   DAPVFPGDVILGDSDGVIVIPAGIADEIADETFEMTAFEDFVADQVAQGRSILGLYPPT
FT                   DPQTPQDFAAWRARNGR"
FT   gene            537219..539282
FT                   /locus_tag="BBta_0541"
FT   CDS_pept        537219..539282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0541"
FT                   /product="Methyl-accepting chemotaxis protein (MCP)"
FT                   /function="Motility (incl. chemotaxis, energytaxis,
FT                   aerotaxis, redoxtaxis)"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 6 : Inner
FT                   membrane-associated"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32822"
FT                   /db_xref="GOA:A5E9H8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9H8"
FT                   /protein_id="ABQ32822.1"
FT                   /translation="MSYNSAQVPNNQSTGVSGMKIKTRLYGGFGVLVALGLLMAGFGLW
FT                   QSSATSERVERLSTQAENAIGVVKISSELQAIRRALLRYQFDNDEASFAEAERRLGATA
FT                   TMLEQSAKEAGSDLQRDSARQLQKSIAAIQEARMALGGAVKVYSTGRTALFSEGDKMTA
FT                   DVQKFLDAMQASDFADAARALESRVLLVRVANWRFLATRDPKGRDTFKSNLGKAMAQVA
FT                   ELEKRELAPAQAKLLDEVKQGLGRYAEAFDKTSASMLRGDEVYYKDVAPLTAAAIEIID
FT                   RAEKDIRASFAATLAETHERISSATAMQQTLAVLAGLLGIAIAILIARSISTPLTSLVR
FT                   DADRLSGGDTNVEFLDARRGDEIGDVAKSVARFRDNVIAQQKTAKEVAEAAELREATSR
FT                   NMEAAVAQFRAASEQLLGTVGDNAGKMTHTAKTLTGVAGQATEQASAAAAASEQTASNV
FT                   QTVASAAEELASSIQEIGRQIERANTTVRAAGSVTARSESEIEGLAQAAQSISSVVDLI
FT                   QAIAAQTNLLALNATIEAARAGDAGRGFAVVAQEVKSLAEQTARATQEIAQHIQGIQTS
FT                   TGNAVASVKEVGLAMREIDEVTSAIATAVEQQGAATREISQNVQMAAAGTQKLASNITT
FT                   VGDAIRETNRSADHVLGASGSVSSAADALAAEVQAFFARLRDASVNRGRNAA"
FT   gene            complement(539298..541409)
FT                   /locus_tag="BBta_0542"
FT   CDS_pept        complement(539298..541409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0542"
FT                   /product="oligopeptidase B, Serine peptidase, MEROPS family
FT                   S09A"
FT                   /function="Proteins/peptides/glycopeptides"
FT                   /EC_number="3.4.21.83"
FT                   /note="putative Protease II; Evidence: Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32823"
FT                   /db_xref="GOA:A5E9H9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9H9"
FT                   /protein_id="ABQ32823.1"
FT                   /translation="MTQPINATIAAPVAPRRSHSFTRHGITVHDDYAWLKDARWQEVLH
FT                   DPSLLDADIRAYLEAENAYAEGVLGHTAPLQKKLVAEMRGRIKEDDSSVPSPDGPYAYF
FT                   RKYREGGQHELFCRMPRHGGAETIGLDGDALAKGHDYFKFGGSRHSHDHRLVAWSADTK
FT                   GSEYFTLRVRDWDSGHDLDDLVEESDGGVVWSRDCKSFFYVKLDDNHRPMQVWRHRLGT
FT                   QQSDDVLVYEEKDTGWFTHVHESTSGRFCVIAGGDHETSEQRLIDLDAPEAPPRLVAAR
FT                   EDGVQYAIADRGDELFILTNADGAIDFKIVTAPLATPERANWRDLIPHRAGIYVLDHDL
FT                   YAGHLVRLERANALPSIVIRDLASGEEHAIAFDEGAYSLDAMGSYEFDTTNLRFSYSSM
FT                   TTPSEVYDYDMVTRARTLRKRQEIPSGHNPADYVTTRIMARADDGAEVPVSLLHRRDFK
FT                   ADGSAPLLLYGYGSYGMAMPASFSANRLSLVDRGFVYAIAHIRGGTDKGWGWYLDGKRE
FT                   KKTNSFDDFAACARALIAANYTSARRIVGHGGSAGGMLMGAVANRSGELFAGIVAEVPF
FT                   VDVLNTMLDDTLPLTPPEWPEWGNPIASEKDFRTILSYSPYDNVAARPYPAILAMAGLT
FT                   DPRVTYWEPAKWIARLRATMTGGGPVLLRTNMGAGHGGASGRFNRLDEVAIVYAFALWA
FT                   VGLTEKAAA"
FT   gene            541654..543171
FT                   /locus_tag="BBta_0543"
FT   CDS_pept        541654..543171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0543"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32824"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9I0"
FT                   /protein_id="ABQ32824.1"
FT                   /translation="MIMIPFRAGALLARLTVAIAAIAVLPCAGTAASRAASNSTAITSA
FT                   ASGGAGTLTTTPAPVGAIPQVAPWDPDDFGDFHKNALATKTPYGPRGGLHDLTPPPAGA
FT                   IPVFTQLLARHGARAATSDDDFAVVLQVLDAAKAAGTLTEKGATLARRTAALQKVNDAV
FT                   GLGQLSTRGRSEQKQLAERLAQRLPGLFADAARQGRTITVINSGKDRAIDSSEIFALSL
FT                   GQSVPWAAKLIKAPVSDPTTLYFFKQPENAAYQAYKKRDPDLLAAEKAVRLALKTAAAA
FT                   RELLTPLVGVQIVAALDAGMVTVKPNAEDGPATPNSVDVALAVYGVFQQAPALNADGSG
FT                   PITLTPFLSPDEADQFARVSDTDDFYEKGPGFAGRTITFAMAKPLVDDFVAAMDRIAAG
FT                   DLHEAARLRFAHAETVIPFAALLKLPHSATQQPLGVMFDDHNGWTGRDVASFSANIQWD
FT                   AFRTTDGRLLVRMLYDEKEIAFKQGCFPVKDDSPYYAWNELKRCYGF"
FT   gene            complement(543203..544390)
FT                   /locus_tag="BBta_0544"
FT   CDS_pept        complement(543203..544390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0544"
FT                   /product="Putative Aminotransferase, class V"
FT                   /EC_number="2.6.1.45"
FT                   /note="putative Serine--glyoxylate aminotransferase;
FT                   Evidence: Function proposed based on presence of conserved
FT                   amino acid motif, structural feature or limited homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32825"
FT                   /db_xref="GOA:A5E9I1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9I1"
FT                   /protein_id="ABQ32825.1"
FT                   /translation="MTVRAGREFLAIPGPTTMPDEVLQAMHRPALDIYSKQMVELTDGL
FT                   MADLGRLFATKGKTYIYIANGHGAWEAVLSNVLSRGDKLLVLESGRFAIGWGQAARAMG
FT                   AEIEVLRGDWRRAVRPAEVEARLRADREHTIKAIVVAQIDTASGVVNDVEAIGRAIKAS
FT                   GHPALYMVDTVASLGCMPFEMDAWGIDVAMSGSQKGLMTPPGLGFVAANARALEVHKRA
FT                   NMRTPYWDWSEREGAEHYRKYGGTAPVHLLFALRQAIDMLFAEGLPHAFRRHQLLGEAV
FT                   RRAVAKWGEGQVIGFNIADAAERSNTVTTVLVGGGYDPAVLQSYCKEQCGVVLGTGIGD
FT                   LSGKAFRIAHMGHVNAPMVLGTLGVIEMALVALKIPHGRGGLDAAIQWLGESVSA"
FT   gene            complement(544551..545276)
FT                   /locus_tag="BBta_0545"
FT   CDS_pept        complement(544551..545276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0545"
FT                   /product="putative nuclease-like protein"
FT                   /note="SNase-like; Evidence: Function proposed based on
FT                   presence of conserved amino acid motif, structural feature
FT                   or limited homology; Localization: 10 : Secreted"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32826"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9I2"
FT                   /protein_id="ABQ32826.1"
FT                   /translation="MPMKTVSLALLLLLPSLAHAAEITGIPKIREADGITIGTTRIRLG
FT                   GIDAPSVDQLCLNKDGERWTCGVAARDELIKHADGKSWVCHPRAIDRRGRQVARCDVDG
FT                   EDIQKWLVRNGWALAYRTVSHDYEPEEAEARTAKAGMWQGAFIAPWDWRVRNKKTTILG
FT                   ATKPPESARNILLASASGPVAPSPDCTIKGNVNSAGECIYHTPQSRWYAQIKMHVSKGT
FT                   RWFCSVEEAEAAGCRETRR"
FT   gene            complement(545457..547181)
FT                   /locus_tag="BBta_0546"
FT   CDS_pept        complement(545457..547181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0546"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32827"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9I3"
FT                   /protein_id="ABQ32827.1"
FT                   /translation="MSFQYFAGAACRALTARKDGPSLYEVCDPILRQPGRGDPHLAKFY
FT                   RTALGNPALRALLRRAGLPELKEPARLAALREALVLARDNPTPDWGAVGRPIAELVDSI
FT                   ALRHPAPPRRTTAVTMPPSSEIDRVIRACGADLLGSYARNGFIPTYAAFNLIGDPDLGG
FT                   REVLMALKGLDARGYKNSTLLFNLARVFIARSPAAAVIHPPWRGIAEPMWEPVQIRHRS
FT                   AYYDAFFTEALLSYVETGLASPDQTLAARGAIGDMVAFCLATSREEVRGADGKSYNVVT
FT                   ALAPPPHPRFSRFFTQIKQDLGFGVYVPDCDTTACSFSAATQAGSDDPILAQPLVDFYA
FT                   GYQVRAGSNEPRVTVPINDNIDYEGGIATWIDSLAGERPYGNDLDPTLNLDVLEVSFRN
FT                   LSRWQILETEGRLDVVRRIVGFQQRLVISGAFADPRSHIYYLPELYCAYFGRCYHAFMA
FT                   LPPAARQAIDPDGAFELIRLRVLAYVEDELIGREMNPFDAALALIALGHLGGAAASFAP
FT                   AVHCIVAAFGEGGRRHPYRAYEWNKMKTPTRILVGGPEVTSAFVLMGLALARRVVAR"
FT   gene            547609..548472
FT                   /locus_tag="BBta_0548"
FT   CDS_pept        547609..548472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0548"
FT                   /product="putative Peptidase"
FT                   /function="Proteins/peptides/glycopeptides"
FT                   /note="Caspase-like protein; Evidence: Function proposed
FT                   based on presence of conserved amino acid motif, structural
FT                   feature or limited homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32828"
FT                   /db_xref="GOA:A5E9I4"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9I4"
FT                   /protein_id="ABQ32828.1"
FT                   /translation="MMTARQPSFSRRSAVIAAALLCTVSLAIGANAALNKRSLEAPKSA
FT                   AAEQGVASTGNGARLALVIGNGHYPDANAPLAQPINDARALTGALRRGGFDVDVVEDAS
FT                   KDDLARAVERLTARIKPDSVVMLFFGGYAIQAGRDSYMIPTDAKIWKEADVRREGTSIE
FT                   RVLDAVSEKGARAKLVVIDASRRNPFERRFRAYSHGLAPINAPANALIMSSATPGKVLD
FT                   DPQQANSVLVSELLNQLGKSPSAETVFNKTRNAIARSSDGEQVPTVSSSLVEDIRLSAD
FT                   VANAGS"
FT   gene            complement(548674..549564)
FT                   /locus_tag="BBta_0549"
FT   CDS_pept        complement(548674..549564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0549"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32829"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9I5"
FT                   /protein_id="ABQ32829.1"
FT                   /translation="MRHAAIAATSRRMPMLTALGLLALGAAASPAMAAEDTAPRGAAVS
FT                   VLKAAKACFDNTVEVSGMVLARDETAVRPDRPGLKVAEVLVDAGDTVTAGQNLARLTPP
FT                   EGGTIMVQAPVAGTILTSTATIGAFASGRGEALFSIIARNEYDLVGLVPSAQINRLAVN
FT                   QTARIRIVGAGEVDGKIRRIAPTVEPNSQLGQAFIAITGNARLLVNAFGRAVIKTGQSC
FT                   GVALPLTAILYDPDGTVVQVVRNQRVETKRVEIGLMAGGQVEIRDGLNEGEVVVARAGA
FT                   LLREGDPVRPVLASN"
FT   gene            complement(549752..550204)
FT                   /locus_tag="BBta_0551"
FT   CDS_pept        complement(549752..550204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0551"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32830"
FT                   /db_xref="InterPro:IPR019627"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9I6"
FT                   /protein_id="ABQ32830.1"
FT                   /translation="MDGASKVVGIVGSRHFPSRALVESFVTSLPCDTCVVSGGAQGVDT
FT                   WAIEAARSLGLPTLIIQADWKRHGRKAGPLRNAELVRRVDEIAAFWDGRSRGTLNTVML
FT                   ALRAGLPVRIFGENGEILATDFVVKEAERRGVVAAMKAPGAGEGDP"
FT   gene            complement(551007..551837)
FT                   /locus_tag="BBta_0553"
FT   CDS_pept        complement(551007..551837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0553"
FT                   /product="Putative Zn-dependent hydrolase"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32831"
FT                   /db_xref="GOA:A5E9I7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9I7"
FT                   /protein_id="ABQ32831.1"
FT                   /translation="MAINETGIMGNAAEIYALRYATMSPRMPSMNFLQPDPHEAVAQDL
FT                   DYFVWLIRSAGRDILVDTGFNAAEAQARNRKLTRNPVDALELFGVNAADIRDIIVTHLH
FT                   YDHAGNLDRFPHARFHLQEREMAYATGRCMCNGLLRHPFSVEHVTTMARHVYGERVTFH
FT                   SGDGEIAPGVTVHRVGGHSDGLQVVRVDTARGPVVLASDAAHYYANLQRRSPFPIVYNV
FT                   GDMALGWEIIERLAGHPDRFIPGHDPLVTELYPRVNEAADAYALHVAPSRSFAR"
FT   gene            552110..553666
FT                   /locus_tag="BBta_0554"
FT   CDS_pept        552110..553666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0554"
FT                   /product="putative Peptidase, Caspase-like domain and TPR
FT                   repeats"
FT                   /function="Proteins/peptides/glycopeptides"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32832"
FT                   /db_xref="GOA:A5E9I8"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9I8"
FT                   /protein_id="ABQ32832.1"
FT                   /translation="MLDRWTAIVMTARLLLLLGLMFAVAFSGPALAAGDRIALVIGNAK
FT                   YPDAEAPLKEPINDARDLTDELKRDGFTVETLENATGEAMRRGLERLYGSIKPGSVALV
FT                   FFSGFGIQSNRTSYMIPVDAQIWQEADVRRDGISLEQVLQEINSRGAGVKIALLDASRR
FT                   NPYERRFRTASSGLAPVIAPSGTLVMYSAALSAVVSDTGRDRSLFVQELLKEIRVPDLT
FT                   AEETLNRTRVGVTRASRSEQVPWISSSLAEDFSFVPGAGGVRPTPPVESSTAPVAAPTP
FT                   TPTPTQVVVAPPLPPPPPPPPPPVQKADAPPAPPVVPPPPVPTPSPVIATTAPTTTAPA
FT                   TNVTAAPPVQDPFAEDPTIKSLTAKIAANPEDAGALYRRGQVYASKGAYAQAIRDFDDT
FT                   IRLNPKDVEALNNRCWARTVVGELQAALRDCNEALRLRPNFVDALDSRGLVNLKSGATK
FT                   NAIADFDAALKINPRLTSSLYGRGLAKQRNGAAQEGALDIANAKAIDPNIVREFESYGV
FT                   R"
FT   gene            553848..554486
FT                   /locus_tag="BBta_0555"
FT   CDS_pept        553848..554486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0555"
FT                   /product="hypothetical protein"
FT                   /note="OmpA-like transmembrane domain; Evidence: Similar to
FT                   previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32833"
FT                   /db_xref="GOA:A5E9I9"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9I9"
FT                   /protein_id="ABQ32833.1"
FT                   /translation="MTGLFVAVTLSAAAALSVTAAKAAEDVTEDQIVRALAGPKKPLTR
FT                   GLSLSPPSEAAPAAAPEQDKFLQSIRGRSTRSLSTAEREEIAAVAKSKPNIDLEITFDY
FT                   NSANISQKSLASVQALGRALTSPDLKGSTFVVAGHTDAAGGDAYNQDLSERRADSIKRY
FT                   LVEKFGIAGADLVTVGYGKSKLKDPSQPLAEVNRRVQVVNMQSKTAAAK"
FT   gene            554659..555585
FT                   /locus_tag="BBta_0556"
FT   CDS_pept        554659..555585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0556"
FT                   /product="putative HlyD family Secretion protein"
FT                   /function="Transporters of Unknown Classification"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32834"
FT                   /db_xref="GOA:A5E9J0"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9J0"
FT                   /protein_id="ABQ32834.1"
FT                   /translation="MKLPKSLKTVAGAIIFVALFAGYYTYEHRSHPAAEEPPMQAQVLV
FT                   TKAVKACFSDLVRVTGFVVPRREAVVGADQEGSRVTDVLVKEGDTVTENQELARLTPPP
FT                   PQPGAPAAAANRPVSLRAPAAGVVTEVRTIAGAPASPQAGPMFRIAVNNELELDAEVPS
FT                   VHLLKLSPGLPARITRDNLPDIIGRLRVVAPQVDRSTQLGHARITLTSSATLKPGMFAR
FT                   ANIDARRSCGVAVPNTAIDHLTIQVVKGNTIETRRVRVGLVSDTSTEILEGLAEGEIVV
FT                   ADAGSSLHDGDQIKTMFAEDIDRTRVR"
FT   gene            555585..558725
FT                   /locus_tag="BBta_0557"
FT   CDS_pept        555585..558725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0557"
FT                   /product="Putative multidrug efflux
FT                   transporter,AcrB/AcrD/AcrF family"
FT                   /function="The Drug/Metabolite Transporter (DMT)
FT                   Superfamily"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32835"
FT                   /db_xref="GOA:A5E9J1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9J1"
FT                   /protein_id="ABQ32835.1"
FT                   /translation="MALNISAWSIRNPLPSILFSLILLILGWMSFSKLAVTRLPNADIP
FT                   VISVAVAQFGAAPSELESQVTKIIEDGVSGVEGARHIQSLITDGLSVTTITFALETNTD
FT                   RAINDVKDAVTRVRSDLPQNVTEPLISRVDKIGLPIVTYAAISPGKTPEQLSFFVDDVV
FT                   KRELQGVRGVSQVERIGGVEREILVSLDPDRLQAMGLTAVNVSQSLRGTNVDVAGGRAE
FT                   IGKNDQAIRTLAGAKTLNELSNTMIPLFGGGEVRLADLGTVTDTIADRRTFARFNGEPV
FT                   VALGIKRAKGASDVVVAAAVQKRIDEVKAAHPDVDLRLIDTSVEFTKGNYEAAISTLFE
FT                   GAILAVIIVLLFLRDFRATVIAAISLPLSIFPAFWAMDILGFSLNMVSFLAITLSTGIL
FT                   VDDAIVEIENIVRHMRMGKSPYRAALDAADEIGLAVIAISLTIIAIFAPASFMSGIAGQ
FT                   FFKQFGITVSVQVFFSLLAARFVTPMLAAYFMKHHDHEDPPPGFILRAYQRIVTWSVQH
FT                   YFVTVLLGIGIFAASIWSTTLLSQGFLPAQDAARSLLAIELPPGAQLAYTEKVTEEIVA
FT                   RLRKRPEVRSVFVDGGRLQGAMEVRRAGMIVNYTPKTERKITQKELELAITKDLETIPD
FT                   IRFWFTDENGLRPIKLVLTGSDPKLVDNVASELASQMKRIPIISNVVSDTSLDRPELRV
FT                   QPRADLAARLGVSTESLSQTIRVATIGDVGPALAKYDAGGRLVPIRVQLEDAARGDVKI
FT                   LEQLRVPLGQYGEKGGVPLAVVADIKLDQGPTSISRYDRGRQATVSADLVGLAALGDAT
FT                   KQIDDLPVRKSMPASVKLIPSDDAESLNELASGFITAITAGLMIVYAVLVLLFGTFLQP
FT                   ITILFSLPLSIGGAIGALMLTGKQLTIPVYIGMMMLMGIVTKNAIMLVEFAVEAIHAGT
FT                   RRDEAIIDAGMKRARPIVMTTIAMVAGMMPSALAVGAGGEFRSPMALAVIGGLVFSTVL
FT                   SLLFVPAMFLVMDDLSTLFGRLGRRLIVSDGTDEPGHDAEGGHAQRPRPSVVSPAAE"
FT   gene            complement(558747..560381)
FT                   /locus_tag="BBta_0558"
FT   CDS_pept        complement(558747..560381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0558"
FT                   /product="putative membrane protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function; Localization: 11 : Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32836"
FT                   /db_xref="GOA:A5E9J2"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9J2"
FT                   /protein_id="ABQ32836.1"
FT                   /translation="MSLAWPAIGIETSGSIPRWRRALAIWIDAVEDGWAVPALIAGFVA
FT                   VWMIYFSIAYVGGDLHQDVIETWSLGRSFAWGSSKHPPLMGWAARAWTSAFPLTNWSFN
FT                   LLALTNAAAGLWAVDLITRRFARDDKRLIVLLLLMLLPVYQLHAQRFNANAVLLSSWPL
FT                   ATYCFLRSYETRNVRWAIAAGLAAALAMLGKYYSIFLIASFAIAALCHRERRAYFASSA
FT                   PWVAALSGLAALTPHLIWLGMTGAQPFSHAITHHVGKTGAAALIEGGGFFLAMAGIGGI
FT                   PGLIWLAMTRPRPARVLNDALSLGAGLRLLAMMSIGTVALPALTSVVFGTDMPPLWGLQ
FT                   GVFLFVIVIVCGASYQPSRAATINLAAATIGIAAFAATVAAPLHALYRNYVPLSEGRNF
FT                   YQPAVAELDRLWQSVSSRPLAAVGGDDGLAFAAAFYSPDHPRYEISLVHPYELQTPAAA
FT                   LTAQGWSALCYDTDISCISGMSAVAARARRSVRAEISLRTKLFGWPGASQRFVAIIVPP
FT                   ETSPPSEPAPNVADDVSAQRRQPITAN"
FT   gene            complement(560692..561369)
FT                   /locus_tag="BBta_0559"
FT   CDS_pept        complement(560692..561369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0559"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /function="Activator"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32837"
FT                   /db_xref="GOA:A5E9J3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9J3"
FT                   /protein_id="ABQ32837.1"
FT                   /translation="MMSKQAEFAVILKMNPMFADLGADELQRLSNLCHTQHLSSGEVLF
FT                   QKGDPGNALFGVRRGQIRIETGATDGSRLTLNFMGPGDLFGEVAVLDGQERTADATAGE
FT                   TTELFVLRREDFLSFLEREPKVAIKIIQLLCQRIRWQSERMEESVLQPLPIRLARRLCA
FT                   LAEDFGSEVHISQEQLGIFVGAARESVNRQLQAWRKDKILDLQRGRILLHDLTKLNTIA
FT                   RNE"
FT   gene            561583..563700
FT                   /locus_tag="BBta_0560"
FT   CDS_pept        561583..563700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0560"
FT                   /product="putative AsmA-like protein"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32838"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9J4"
FT                   /protein_id="ABQ32838.1"
FT                   /translation="MKALKIAGGLVGAVAVVLVLALAFGLPASVVTAAIQDRVERDTGY
FT                   RLSIAGSASISLWPSLHATLTDITLLDPKDRDGNNRLTVAKLQADMALSGLWSGRPDIA
FT                   EVIVDKPTLYLPLLRERLRDNAPRNRAPAKSDAAPSIRIERVTIRDGAVILSNPRDRVE
FT                   NRIDGIGATASLGGDGRIKLTGTARASDRPVSFEVNSTAPGMPIDRQTLPVEFKLEMAD
FT                   AFRGVLAGRADLRLNGPLVMINGLSGTLGGGDFNGWASVDVASKPLVKLDLDVRRLDLG
FT                   SPAAPRNAGASGWSTAAIDLRGLNYVDARVKLSATDVGVAGARLGPLEVESSLAGGVLK
FT                   ATVANLGAYDGQASGEVVIDASTGNPAYAMHCDVVGIRALPLLQNLAGFDRLDARLQGK
FT                   LALRSSGASQQAIMSNLSGSAFLLFQDGAIRGINVAQMIRSLTSNPLSGWQDSKELTTD
FT                   LTQLSASFQVERGQAATGDLNLIGPLVKVTGAGTIDLGNRVLAMRVEPKLVMTTEGQGR
FT                   NSDPIGLGIPVVIDGPWSQPRFYPDMAGILDNPDAAYAKLKQMGQGLFGKDNAGLNNLI
FT                   NGLGGLIGNSAPTGTAGANGGPSAAAPSGQAPTTGQSDVLGGQLGAAIGNLIQQGLQQG
FT                   APPQGRSRGRTLNPSESAAPLLQSPRAAQPPATDAGQDAASASGNPPDAAMDGAPDSQP
FT                   MNDVLKRIFNR"
FT   gene            563974..566427
FT                   /locus_tag="BBta_0561"
FT   CDS_pept        563974..566427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0561"
FT                   /product="Putative Adenylate/Guanylate cyclase"
FT                   /function="Nucleotide and nucleoside conversions"
FT                   /EC_number="4.6.1.1"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 6 : Inner membrane-associated"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32839"
FT                   /db_xref="GOA:A5E9J5"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9J5"
FT                   /protein_id="ABQ32839.1"
FT                   /translation="MSGVEERGWSLRQGLFAKYVVSLVGLVVFVLAVNGATETWISYQS
FT                   TKASLTAAMAEKADASARRIDQALSDLQRQISWVTRASANTLELRRADYVQLLSQAPAV
FT                   RQLYQLDGQGREQLRVSRTSIAFSSGNDLSRDLRFTDTVTHGSNFSAVTFKGAQPMMSI
FT                   SVAHSGFNAGVTVADIDLDFLEDFMTEAQVGKVGIAYVVDPRGQVLASSAKGPAVGQDL
FT                   ARLPQVAAVLTPDGQSLNSGTDSDGRAVLSAAAVLPKLGWAVFFEQSTAHALAPIRDQL
FT                   LRGALLIALGLAVATLAGSLLARRMLVPITALRMGARKLGAGDFAQRIEVKTHDELEEL
FT                   ADQFNSMAGQLAESYAVLEAKVEERTRDLARSINELKVLEEVGRAVASSLDLNAVLPTV
FT                   AARALEITQADAVLIYSYEAAERRFRLVEAKGVERAQDGAHTMLDGATSLLADSIRSGE
FT                   PIAIAELESAPDHPLRDVAIAAGFHAVLFTPLVDQQGVLGALVVLRRSAGAFSPNLIGV
FT                   MRTFAHQAVLAMRNARLFTEVDQKGRELALAHDTVQQQAVKLREQTEQLREWNKSLEER
FT                   VEKQLGEIERIRRLERFLAPQVAQIIASSDGHDALLESHRREVTVVFCDLRGFTAFTET
FT                   TEPEEAMNVLREYHAALGKLIFKYEGTLDRYAGDGVMILFNAPIPFDDHTTRAVKMALE
FT                   MRDEIGQLTERWKNRGHSLGFGVGIALGYATLGQVGFEHRLEYAAIGSVTNLASRLCDE
FT                   AKAGQVIVSRRVYGVVDQSVDARPIDDLHLKGFNHPVLAMEILRWRGESTAPVDVPAER
FT                   RRSSS"
FT   gene            complement(566514..567071)
FT                   /locus_tag="BBta_0562"
FT   CDS_pept        complement(566514..567071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0562"
FT                   /product="putative transcriptional regulator, MarR family"
FT                   /function="Transcriptional level"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32840"
FT                   /db_xref="GOA:A5E9J6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9J6"
FT                   /protein_id="ABQ32840.1"
FT                   /translation="MANPADTASRRQPKPVEASRNAAAPHAEERLDLFKFAPFRLNRLA
FT                   AEVSAALASEYRERYGLDIPEWRVLATLGFRREACSAQYVAECTRTHKSTISRAVTALL
FT                   ERRLIERVENAEDRREFRLRLTRKGKTLYEELIPRLQQREREIMACLSADERRAFDRLI
FT                   GKIEASLDLIQTSEEADAKQAY"
FT   gene            567236..568870
FT                   /locus_tag="BBta_0563"
FT   CDS_pept        567236..568870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0563"
FT                   /product="putative FAD-binding Monooxygenase"
FT                   /function="Carbon compound utilization"
FT                   /EC_number="1.14.13.-"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32841"
FT                   /db_xref="GOA:A5E9J7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9J7"
FT                   /protein_id="ABQ32841.1"
FT                   /translation="MVQVNPGQGASHAKVQFGYHRHGDQDRAAPAEHPVVVVGAGPVGL
FT                   SFAIDLAQRGHAVVVLDDADRIGEGSRAICFSKRSLDYWDRLGVGDRMVDKGVVWNVGR
FT                   IFHGPSELYQFNLLPEPGHKRPAFINLQQFYAEAYLVDRVNELPEISLRWRNKVTALEQ
FT                   RNDRAVLTIETPDGPYRLSARYVVACDGARSSLRQMVGAGFSGKVFEDQFLIADVKMTA
FT                   EFPTERWFWFDPPFHAGRSALLHRQPDDVWRIDLQLTPDCDPQVEKKPENVRPRIARML
FT                   GHDEFEFEWISIYKFQCRRMQRFIHGSVIFAGDSAHQVSPFGARGANSGLEDAENLSWK
FT                   LDRVLRGTSPSQLLETYHIERSAAADENIRESTRATDFMAPVSAQEARLRKAVLSLAKE
FT                   TEFGKRMVNGGRLSVPSVYETPLSTADAEEWQGGPCPGTSMLDAPLKATDGRHLHLTDA
FT                   FNVLGRRFTLLAFANGGDVDAPDEVGVVRIDGDDGFADAEGFAGKRYDAKPGTAYLLRP
FT                   DGYVAARFRHPTRAAIAAAVARASGLN"
FT   gene            568879..569109
FT                   /locus_tag="BBta_0564"
FT   CDS_pept        568879..569109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0564"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32842"
FT                   /db_xref="InterPro:IPR021233"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9J8"
FT                   /protein_id="ABQ32842.1"
FT                   /translation="MMALSTASNFAKPDDAFRAVVEAHRGLSEKDSADLDAALVLILAN
FT                   HIGDITVLREAITLAKGRMIDSVQQQQQQQQ"
FT   gene            569133..570089
FT                   /locus_tag="BBta_0565"
FT   CDS_pept        569133..570089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0565"
FT                   /product="Putative Metallo-beta-lactamase family protein"
FT                   /function="Drug resistance/sensitivity; Defense/survival"
FT                   /EC_number="3.5.2.6"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32843"
FT                   /db_xref="GOA:A5E9J9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9J9"
FT                   /protein_id="ABQ32843.1"
FT                   /translation="MAKGFASTTDLAEKKVTFSEIGPDLYAFTAEGDPNSAVIVGDDGC
FT                   IVFDAQATPAMANKVIERVKTVTDKPIKYVVLSHYHAVRVLGASAYHAQGIVASQETHR
FT                   LIVERGQQDWDSEYGRFPRLFQDAQSIPGLTWPTLTFEGEMTIHLGKREVQLIQLGAGH
FT                   TSGDIVAWVPDAEVMFSGDLIEYHSACYCGDAYLREWPSTLNEIRDFNPKAIAPGRGDA
FT                   LKGEATVREAIAMTRDFVTSLYGAAEMSVAKGRSLKESMAATREVMDPKFASFAIYEHC
FT                   LPFNVSRAYDEASGIDDPVIWTAERDREMWARLQGEG"
FT   gene            570086..571435
FT                   /gene="hmgA"
FT                   /locus_tag="BBta_0566"
FT   CDS_pept        570086..571435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmgA"
FT                   /locus_tag="BBta_0566"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /function="Phenylalanine, tyrosine degradation"
FT                   /EC_number="1.13.11.5"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32844"
FT                   /db_xref="GOA:A5E9K0"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR022950"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9K0"
FT                   /protein_id="ABQ32844.1"
FT                   /translation="MMNINTSPDQLSRASAQVTPGYMSGFGNSFETEALPGALPIGRNS
FT                   PQRCAYGLYAEQLSGSPFTAPRGSNERSWLYRIRPSVKHSGRFAKVDAGLWRTAPCHEQ
FT                   EITVQQLRWDPTPVPSGEVTFLQGVQTMTTAGDAATQSGMAAHVYVITKSMVDQHFYNA
FT                   DGELMFVLQQGRLLFVTEFGRIDAAPGEIVMIPRGVKFRVELPAGPARGYLCENYGGAF
FT                   TLPERGPIGANCLANARDFLTPVASYEDKDTPTELYVKWGGALFKTELKHSPIDVVAWH
FT                   GNYAPYKYDLRTFSPVGAIGFDHPDPSIFTVLTSPSETAGTANIDFVIFPERWMVADNT
FT                   FRPPWYHMNIMSEFMGLIYGVYDAKPQGFVPGGMSLHNCMLPHGPDREAFDHASNGELK
FT                   PVKLTGTMAFMFETRFPQRITKHAAESSTLQPDYADCWNGLEKRFDPNRP"
FT   gene            571562..572836
FT                   /gene="fahA"
FT                   /locus_tag="BBta_0567"
FT   CDS_pept        571562..572836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fahA"
FT                   /locus_tag="BBta_0567"
FT                   /product="fumarylacetoacetate hydrolase"
FT                   /function="Phenylalanine, tyrosine degradation"
FT                   /EC_number="3.7.1.2"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32845"
FT                   /db_xref="GOA:A5E9K1"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9K1"
FT                   /protein_id="ABQ32845.1"
FT                   /translation="MTHPNDPSLRSFIPVDPASDFPIQNLPYGVFSAADSPKPRVGVAI
FT                   GDVVLDLAVLEDEGLLDLSPAYEVFAQPSLNAFMALGPAVWTKTRAAISALLRHDNPRL
FT                   RDDKPLRSRALLLQKDVRLHLPFDVAGYTDFYSSKEHATNVGVMFRGKDNALQPNWLHM
FT                   PIGYNGRASTVVVSGTPVRRPRGQLKPPSAEVPSFGPCKRLDFELEMGVVIGQSSALGE
FT                   MLTEAQAEAMIFGFVLLNDWSARDIQQWEYVPLGPFQAKVFATSISPWVVTREALEPFR
FT                   VQGPVQDPMPLPYLQQAHAQNYDLALEVALRASGSNAPQRISQTNFKYMYWSSVQQLMH
FT                   HASSGCAMSVGDLLGSGTISGPEKHQRGSLLEISWNGSEPVELPGGVTRTFLEDGDSLV
FT                   MRGWCQGQGYRVGFGEVEGTIVPAG"
FT   gene            complement(572874..573185)
FT                   /locus_tag="BBta_0568"
FT   CDS_pept        complement(572874..573185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0568"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32846"
FT                   /db_xref="InterPro:IPR010696"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9K2"
FT                   /protein_id="ABQ32846.1"
FT                   /translation="MALQLRPNCESCDKDLPPAATDARICSYECTFCADCVETRLFNVC
FT                   PNCGGGFAPRPIRPAHEWRPGACVTKQLPSDKRVHLKYAAEDVAAFVARVKDVAPDSR"
FT   gene            complement(573275..573754)
FT                   /locus_tag="BBta_0569"
FT   CDS_pept        complement(573275..573754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0569"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /function="Transcriptional level"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32847"
FT                   /db_xref="GOA:A5E9K3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9K3"
FT                   /protein_id="ABQ32847.1"
FT                   /translation="MISVDSFDLRLLAALQDDGRLTNQELAEIAGLSASQCSRRRMRLE
FT                   EDGVIAGYRAQLASQALGFELIAFIQITLATHSPDNAQKFRALVNRVDEIQEAYALTGD
FT                   SDYLLKVVLRDLKSLSDIVNNVLMPHQSVAHVRSSIVLDRIKESAKLPLAALPRS"
FT   gene            573876..574994
FT                   /gene="hpd"
FT                   /locus_tag="BBta_0570"
FT   CDS_pept        573876..574994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpd"
FT                   /locus_tag="BBta_0570"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /function="Phenylalanine, tyrosine degradation"
FT                   /EC_number="1.13.11.27"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32848"
FT                   /db_xref="GOA:A5E9K4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9K4"
FT                   /protein_id="ABQ32848.1"
FT                   /translation="MGPFPHDAPPATLSADNPMGTDGFEFVEYAHPDAAQLHALFKLMG
FT                   FAPVARHKTKAITVYRQGDINYLVNEEPGSHGHDFVAAHGPCAPSMAFRVVDAKKAYAR
FT                   AVALGAEPADLQPSQKALDVPAIKGIGGSVLYLVDRYGAKGSAYDLEFDWLGARDPRPA
FT                   GSGLYYIDHLTHNVRRGRMNVWTGFYERLFNFRQIRFFDIEGRASGLFSRALTSPDGKI
FT                   RIPINEDAGDSGQIEEYLKVYRGEGIQHIACGARDIYATVEGLRASGLPFMPSPPDTYF
FT                   ERIDARLPGHGEDIARLKTNGILIDGEGVVDGGHTKVLLQIFSANAIGPIFFEFIQRKG
FT                   DDGFGEGNFKALFESIEEDQIRRGVLKVEAAE"
FT   gene            complement(575370..576482)
FT                   /locus_tag="BBta_0571"
FT   CDS_pept        complement(575370..576482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0571"
FT                   /product="Putative Alpha-methylacyl-CoA racemase
FT                   (2-methylacyl-CoA racemase) (2-arylpropionyl-CoA
FT                   epimerase)"
FT                   /EC_number="5.1.99.4"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32849"
FT                   /db_xref="GOA:A5E9K5"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9K5"
FT                   /protein_id="ABQ32849.1"
FT                   /translation="MLDKTAPHTGTRATGPLAGFRIVEFAGIGPGPFACMLLADMGAEV
FT                   VTLDRVGARKTMKSVAGRGRKVIELDLKDKAVIADVLDLLAGADALIEGFRPGVMERLG
FT                   LGPEIVLARNPKLVYGRMTGWGQAGPLAQAAGHDINYISITGALAAIGPKERPVPPLNL
FT                   VGDFGGGALYLVVGVLAALLEASKSGKGQVVDTAMCDGAASLLAMFFDLTAMGRWTEGR
FT                   ERNFLDGGAHFYGVYECACGNFISIGSIEPQFYALLRQHAGLSDPAFEAQMDPRAWPAL
FT                   KEKLVAVFKSKTREEWCAIMEGTDICFAPVLTMSEAPKHAHMAARGVFVERHGVTQPAP
FT                   APRFSRTPSNIREPEVTEIGAVVNAWKAGR"
FT   gene            complement(576694..577494)
FT                   /locus_tag="BBta_0572"
FT   CDS_pept        complement(576694..577494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0572"
FT                   /product="Putative carbon monoxide dehydrogenase medium
FT                   subunit, coxM-like protein"
FT                   /function="Energy metabolism (carbon)"
FT                   /EC_number="1.2.99.2"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32850"
FT                   /db_xref="GOA:A5E9K6"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9K6"
FT                   /protein_id="ABQ32850.1"
FT                   /translation="MYQTTYHRASSVDEAAALFAKGSEAKFLAGGHTLLPVMKQRLASP
FT                   SDVIDIGKIKDLIGVQLSGDTLVIKAATTYYDIMTNADVQKAIPAISYLTSVLGDPAVR
FT                   HRGTIGGSIANNDPAADFPAALISLGATVKTNKRAITADDFFKGLFTTALEDGEIITEV
FT                   AFPVPEKAGYAKMRHPASRFALTGVFVTKTKGGDVRVAATGASQSGVMRVPAIEAALKS
FT                   NWSASAIDGVTVSASGLLSDIHGSSDYRANLVKVMAQRAVQAAG"
FT   gene            complement(577514..579859)
FT                   /locus_tag="BBta_0573"
FT   CDS_pept        complement(577514..579859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0573"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /function="Energy metabolism (carbon)"
FT                   /EC_number="1.17.1.4"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32851"
FT                   /db_xref="GOA:A5E9K7"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9K7"
FT                   /protein_id="ABQ32851.1"
FT                   /translation="MGMEGIGASVVRKEDKRFITGKGRYVDDIKLLGMTYAHFIRSPHA
FT                   HAKVKSIDSSAAEAMPGVVAVLTGRQIVDDKVGNLICGWAVTSKDGSPMRMGAWPAMAP
FT                   ETVRFVGQAVAVVIAESKNLARDAAEAVVVEYEELPAVADMPSALKPGAPQLHPEAPGN
FT                   VVYDWHIGDEAAVNAAFSKAANVVSLELTNNRLAPNAMEPRAAIADYDAAEEHFTLYTT
FT                   SQNPHVARLVLSAFYNIAPEHKLRVIAPDVGGGFGSKIFIYPEEMVALWASKKVGRPVK
FT                   WTGDRTEAFLTDAHGRDHISKAEMAFDADNKILGLRVKTHANFGAYMSLFSSSVPTYLY
FT                   ATLLSGQYNIPAIYAEVMGVYTNTTPVDAYRGAGRPEASYLLERLVETAARQLKVDPAE
FT                   LRRKNFITQFPHQTPVIMAYDTGDFNASLDAAMKAIDYAGFPARKAAAKAQGKLRGIGL
FT                   SCYIEACGIAPSKAVGSLGAGVGLWESAEIRVNPVGTIEVLTGSHSHGQGHETTFCQLI
FT                   AERLGVPISQVSIVHGDTDKVQFGMGTYGSRSAAVGLTAILKAMEKVEAKAKKIAAHAL
FT                   EASEGDIIIENGEFKVTGTDKSIALPMVALAAYTAHNLPDGMEPGLKESAFYDPTNFTF
FT                   PAGTYICELEVDQATGKTSFVNFVAADDFGRLINPMIVEGQVHGGLVQGIGQALLEHAV
FT                   YDSNGQPVTASFMDYAMPRADDVPSFKLSHTTTLCPGNPLGVKGCGEAGAIGASAAVIN
FT                   AITDAIGNNKLEMPATPDRVWHAIHGNA"
FT   gene            complement(579973..580458)
FT                   /locus_tag="BBta_0574"
FT   CDS_pept        complement(579973..580458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0574"
FT                   /product="Putative carbon-monoxide dehydrogenase small
FT                   subunit, coxS-like protein"
FT                   /function="Energy metabolism (carbon)"
FT                   /EC_number="1.2.99.2"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32852"
FT                   /db_xref="GOA:A5E9K8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9K8"
FT                   /protein_id="ABQ32852.1"
FT                   /translation="MSTVKLTVNGKAVSVEVEDRTLLVHLLRDHLNLTGTHVGCDTSQC
FT                   GACVVHIDGRSVKSCTVLAAQAAGANVTTIEGIAKGDELHPMQAAFRDNHGLQCGYCTP
FT                   GMIMSAIDIVHRHGGELDEATVREELEGNICRCTGYHNIVKAVLDAAGRMKVAQAAE"
FT   gene            580749..582794
FT                   /locus_tag="BBta_0575"
FT   CDS_pept        580749..582794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0575"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /function="Motility (incl. chemotaxis, energytaxis,
FT                   aerotaxis, redoxtaxis)"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 6 : Inner membrane-associated"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32853"
FT                   /db_xref="GOA:A5E9K9"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9K9"
FT                   /protein_id="ABQ32853.1"
FT                   /translation="MGMSAHLAPQSRRGNFLTLRFRAKIFLGFAVVLAISAASIGFAYL
FT                   GFEKVAAAVASYRASVSEADAARTIDRELISYQALARYFALTGKPEDEAAAMAAQQSLL
FT                   AAIDKSLAAASAAERRAQLGKLQAQFQTFAKIFSEIANLTRDNAKLATDQIGIVGNKIR
FT                   YKFDDLADTAALAGLPTVQTTAKDLTGQYLTASALVGTFIAKPDPKTADGAIARTRFLE
FT                   TSLVTIYANDEKVTQRVTELGDLIKQYRAAFIKFADNSKALAKLVQDMGTAATEILGLS
FT                   NGLRSDLAADQQRIESATNATIAEIERLIAILAVGGLALGAALALMLGNGISKPMITMC
FT                   KAMRELASGNFDVRLPGLGRADEIGEMAAAVEEFKVQAVAKAERDAATQDAQNKAAGAA
FT                   RRAELIRFADEFEAAVGSIVSNVSSSAEQLEHAASTLTRTAETTQSLASRVSGTSDQAA
FT                   GRIHSVASATDELSASVSEIGRQVRESNRIAESAVSQAEETDGRIGKLSRAAQEIGDVV
FT                   KLITAIAEQTNLLALNATIEAARAGDAGRGFAVVASEVKSLAEQTAKATDDISNHISGM
FT                   QAATQESVTAIKQIGGTIRQISTIASSIATAVEQQGGATQEIARNVQSVAAGTQAAASD
FT                   ITEVNRGATQTGEASEEVLRSAKSLSSQSARLREELNRFMANIRAA"
FT   gene            583186..584700
FT                   /locus_tag="BBta_0576"
FT   CDS_pept        583186..584700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0576"
FT                   /product="putative Major Facilitator Superfamily (MFS)
FT                   transporter"
FT                   /function="The Major Facilitator Superfamily (MFS)"
FT                   /note="putative sugar transporter; Evidence: Function
FT                   proposed based on presence of conserved amino acid motif,
FT                   structural feature or limited homology; Localization: 11 :
FT                   Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32854"
FT                   /db_xref="GOA:A5E9L0"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9L0"
FT                   /protein_id="ABQ32854.1"
FT                   /translation="MAPRQAPVPDLRIVTPAPQSAGVARELPEHDRIIETNIPARLDDL
FT                   RWSGFHTRVVLALGITWVLDGLEVTLAGALSGALKQSPVLHFSNLDIGLANSAYLAGAV
FT                   LGALGFGWLTDRIGRRKLFFITLALYLSATAATALSWNVAVYALFRFLTGAGIGGEYTA
FT                   INSTIQELVPARYRGWTDLMINGSFWLGAALGAVGAIVLLDPEVASADMGWRLAYGIGA
FT                   GLGLVVLIMRMWIPESPRWLMIHGHPEQAHDIVAAIERDVTGHDREERAKSLPKIRLRM
FT                   RDHTPLLEVARTLFSVYRQRSLVGLTLMIAQAFFYNAIFFTFALVLTDFYGIQADHVGW
FT                   YILPFAAGNVLGPLLLGRLFDTLGRRAMITFTYGVSGVLLALTGYLFSLGVLSAQTQTA
FT                   AWMVIFFFASPAASAAYLTVSENFPLEVRALAIALFYAIGTGLGGVAGPALFGALLDSG
FT                   ARGAVFAGYLFGAALMVVAALVASRYAVAAERKSLEDVARPLAVME"
FT   gene            584707..585540
FT                   /gene="otsB"
FT                   /locus_tag="BBta_0577"
FT   CDS_pept        584707..585540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsB"
FT                   /locus_tag="BBta_0577"
FT                   /product="trehalose 6-phosphatase"
FT                   /function="Misc. glucose metabolism; Dessication"
FT                   /EC_number="3.1.3.12"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32855"
FT                   /db_xref="GOA:A5E9L1"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9L1"
FT                   /protein_id="ABQ32855.1"
FT                   /translation="MSDVSKLIATQPPAAASAPPEIVPAPASLVPHLGEVAILLDIDGT
FT                   LLDLAPTPREVWVPPGLAETLNSLLQRTAGALALVSGRSLNDIDLIFAPEIYPAVGGHG
FT                   AEMRLGSGNEADAVQAPPMDKELKRRLAAIAKLSPGILLEDKGYSLALHYRLAPQAEAA
FT                   IYEEVSRIRAELPGAPIEVLPGKCVCEIKHAGFTKATGVRELMRRAPFEGRKPFFIGDD
FT                   VTDESVFAIMPDFAGLSFSVGRRALGVDGHFDSPDDVRAFLARLAQREGQSAASR"
FT   gene            585873..587204
FT                   /gene="otsA"
FT                   /locus_tag="BBta_0578"
FT   CDS_pept        585873..587204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsA"
FT                   /locus_tag="BBta_0578"
FT                   /product="trehalose 6-phosphate synthase"
FT                   /function="Misc. glucose metabolism; Dessication"
FT                   /EC_number="2.4.1.15"
FT                   /note="Evidence: Function of homologous gene experimentally
FT                   demonstrated in an other organism; Localization: 2 :
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32856"
FT                   /db_xref="GOA:A5E9L2"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9L2"
FT                   /protein_id="ABQ32856.1"
FT                   /translation="MRDGAQMEPIAQIEQLGQGALALLDLPAAHYAGYYEGFANSALWP
FT                   ALHSRSDLISVSHDDYRSYREVNAFVARALLRFHKPETLFWIQDYHFLSLGVELRTLGV
FT                   KSPIGFFLHTPWPARSVIDSVPNHRDLVTAMLAYDLIGFQTEDDRDNFCACIRADLGLQ
FT                   VRDGVVKSRHGRTRLAVFPIGIDADKFAASAAKAASHPDVSRLRRSLHGEKLAIGVDRL
FT                   DYSKGLVNRITAFDRMWTMHPTLLRAASLLQIATPSRESIEAYGNLQSDVARLVSEVNG
FT                   RHGEADWTPIRYLNKGYGQGVLSGLYRSAQVGVVTPLHDGMNLVAKEYVAAQSPVDPGV
FT                   LVLSKFAGAANELDAALLVNPHDIDGMARTIAMALSMPLNERRMRYEIMMTKLRRHSIQ
FT                   QWFTDFLEALQDSDAPETAEIAPLPTAPAGLLSSRLASSSARYH"
FT   gene            complement(587239..587475)
FT                   /locus_tag="BBta_0579"
FT   CDS_pept        complement(587239..587475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0579"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32857"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9L3"
FT                   /protein_id="ABQ32857.1"
FT                   /translation="MTCDDGRKGIWQGDAILWPDGTKSSLKPHPSVIVGNKASVVVGPG
FT                   VFVGQGKGMVPMDNPSSPNKLRCAVLDGVAYCH"
FT   gene            587810..587899
FT                   /locus_tag="BBta_tRNA6"
FT   tRNA            587810..587899
FT                   /locus_tag="BBta_tRNA6"
FT                   /product="tRNA-Ser"
FT                   /note="Function of homologous gene experimentally
FT                   demonstrated in an other organism"
FT   gene            587976..589292
FT                   /locus_tag="BBta_0580"
FT   CDS_pept        587976..589292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0580"
FT                   /product="putative phage integrase"
FT                   /function="Integration, recombination; Genetic exchange,
FT                   recombination"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32858"
FT                   /db_xref="GOA:A5E9L4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9L4"
FT                   /protein_id="ABQ32858.1"
FT                   /translation="MLLWTRARSFAIIRPPFVVWIVDMARVLGRLTALKVEKLKEAGMY
FT                   ADGGGLYLRVTKDGTKNWVFRFMLNKRPRWMGLGPVALFGLQEARGRALDARRLRHDGV
FT                   DPIETRRASRIQQRLEAAKAISFDECCSAYIKANRAGWRNAKHGAQWESTLATYASPVV
FT                   GALPVQTIDTGLVLKVLEPIWADKPETASRVRQRIERVLDWARVRGYRTGENPARWKGH
FT                   LDKLLPATAKVRRVVHHAALPYGEMPGFLADLRQQEGVAARALEFLVLTAGRTGEVIGA
FT                   RWTEVNRHDKTWQVPGERMKAGREHRVPLSARALAILEETYALRHADDGFLFPGAKHGK
FT                   PLSNMAFLMLLRRMSRDDLTAHGFRSSFRDWVAERTNFPAEVAEIALAHTVSDKTVAAY
FT                   SRTDLFERRRRLMQQWSVFCTAMPQEKRGNVTALSRPQS"
FT   gene            589489..589953
FT                   /locus_tag="BBta_0581"
FT   CDS_pept        589489..589953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0581"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32859"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9L5"
FT                   /protein_id="ABQ32859.1"
FT                   /translation="MAYRLSLWLVLLSGPCADRADLTLVVARAGRWNPRPPRLSRLVGL
FT                   STCLFAVGVHRAERCVMRTPKATTTSSAAISSPVEIDRPITVTVPTACSLSGLGATSVW
FT                   SLISDGTLQSVQVGRRRLVLYESLSRLLTPPGESAAVMSSTRNPSKGGPR"
FT   gene            590088..591260
FT                   /locus_tag="BBta_0583"
FT   CDS_pept        590088..591260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0583"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32860"
FT                   /db_xref="InterPro:IPR025048"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9L6"
FT                   /protein_id="ABQ32860.1"
FT                   /translation="MSTIAPHTEADPVAILIQVLVMFGNVVGRLPHYQVEADQHHLNLF
FT                   CVLVGQSAKGRKGTSGSRARSIMQMADEVWLNERMKGGLSSGEGLIAEVRDEVEQWDPK
FT                   AQELRVVDPGVADKRLMVSEAEFSSALAVMERPGNTLSSIVRKAWDGGKLSTLTRNSPL
FT                   CATDPHISIIGHITEDELRARINRTEAANGFANRFLFVAVRRSKCLPHGGSLDEAETLI
FT                   LAERMKEAVAFAKRVGRVEMTDSARQLWESVYAHLSAEQPGLLGAVTARAEAQTIRLAL
FT                   AYALLDRHDAIDAQHLKAALAVWEYCDASAARVFGRLLGDPVADEILAALRHAGGVGLT
FT                   RTLIRDVLGKHKTADRINAALALLAGKGLVRWSSASTGGRPAETWYINGA"
FT   gene            591264..591746
FT                   /locus_tag="BBta_0584"
FT   CDS_pept        591264..591746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0584"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32861"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9L7"
FT                   /protein_id="ABQ32861.1"
FT                   /translation="MGRYLEILKRAEAEIALRDKSAQRERSLPSGVRGADFGRFRRFGR
FT                   SSSELANALATLERRCPDWVALKDWQQATTDGRRFVAHWGDQALRLKWSVQDLFGLHEA
FT                   PKQPGPNYCRLSRYDQAGLIWLLGGRPVVALTDVAAAIDHGKGVVTIHRKIHKPTV"
FT   gene            592117..592410
FT                   /locus_tag="BBta_0586"
FT   CDS_pept        592117..592410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0586"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32862"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9L8"
FT                   /protein_id="ABQ32862.1"
FT                   /translation="MAGYCCRKCAGDPVYASQCKSTRARRHYEACKLRLRVGGIASLSV
FT                   PFPERPRGMHLRTYERLRSRAEILECGLSTRVRKRPPDYPNLVYYLQHTNSK"
FT   gene            complement(592423..593280)
FT                   /locus_tag="BBta_0587"
FT   CDS_pept        complement(592423..593280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0587"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32863"
FT                   /db_xref="GOA:A5E9L9"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9L9"
FT                   /protein_id="ABQ32863.1"
FT                   /translation="MSLLDYLKPKDKHLVMDLLAEAGVDVAAWKNYKGPPAANPKYCYN
FT                   WSFEQPDELVAVCIWHRGLKLEGSSVVHRSKPRNYGAVGTSPSEVVWNRRAEAFDQSLE
FT                   LAYRQRLPVRVIVVDGEQRDPKATKPSASKVHARLLDPEPWAVTEYNYRTGERLLVRGA
FT                   KPGGSPVESADREMAWFEGSRKQKFVYHRQREGRARREKIRDTLAKSGGRLVCEVENCG
FT                   FDFKERYGPLGEGYAQVHHLAPLSNSPIGGRTVKLRDLAIVCANCHAMIHIGGECRPLK
FT                   GLIA"
FT   gene            complement(593314..593574)
FT                   /locus_tag="BBta_0588"
FT   CDS_pept        complement(593314..593574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0588"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32864"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9M0"
FT                   /protein_id="ABQ32864.1"
FT                   /translation="MAILLLWFGAARAEHWSAVIGKFLCAWGRTHPCEIFAPRASVTMR
FT                   FRTATNPEPIQEIASLRVFLSFSGIDEGMAFAQSGRLGNSR"
FT   gene            593878..597354
FT                   /locus_tag="BBta_0589"
FT   CDS_pept        593878..597354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0589"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9M1"
FT                   /protein_id="ABQ32865.1"
FT                   /translation="MVDLPRHIFDAIWQGRAALIVGQELVGGDTQALIQESAAESLSKA
FT                   LLRPTRDFLDKVSRLRESDPDSVHVEIAQLPWSLVISSALETRLVRALEAAAPAARRVR
FT                   RRFVDDADADSLVRSPTTLEVMHLSLFSSPTSPDGVLPEANRWSRATRLMQPRVLERLK
FT                   DAVGPAHYVIIAGVGSADALDREDLVASLEGIDDAQVVLCEPQVDDTAWLRDSLPGAVI
FT                   LRSSLAQLLHKARVEEPQAVPDILRADDLLVTARSTKNGGRQVATFRAEELRDVRRHLD
FT                   ILGDRPGQVTPATRDERLRAFRKFLRTPRLRADYQTFVGEFCLARQAYQELFEAVILRV
FT                   GRVSGAAARPTGRRSEGPIWLKGLPGSGRTTGLHWLGVRLREEGWPVAHLSSPVDEPDA
FT                   FAIEQIMRLAEQRLKDAGAIDLVVLLVDGVARENVERLEERLVRAGRRSIVVATAVSSS
FT                   PVSDEEEERIGDEITLDYQLNPKELSDLGTILESVGIAIDAEVLQREAGTEGFLGMLDR
FT                   LSVDAREGLGQVLRSDFNRFVPSLAQALRKRPPDVKRGALGEAIIAAFAKAGQPAKLSE
FT                   NQAPLAPDREHIEEARNLMSAIFAFAWLDRVMPLDLLGRRFPQLFAAYEDVRVVAQEHG
FT                   FLTEVTFDADGDIALAIVNPAIARALRTHVVGGTRDVLRELQAFANSIAWPVGPDDNGL
FT                   SHWPAFLHGLLRSVSPRGSFRGEFGSVEDLRQLGDILSDLRQVKGVQSAQMLMLEAIVL
FT                   RERADRGNLPVSETEEILDRSRLLLTNARDQIAKKPRNPSRDQLLASILTSYATTLRRQ
FT                   MQVRIEQGNLLAAQTIATPALAAAQRAQALQDQWHPFDAAALVYYRLAQAWQSERQLPE
FT                   ARQQYLNAVDQLGTLFDLASELSELPQDQQERKSARQREYLYVTGQLEVAKEQALAEAE
FT                   DGDLAALSHVLRMEAIDPVTNQIRSVAAAKSAFDTLARYPAAFENERSVVLLHRLWVGV
FT                   HLGLRTLDKGPLLIGASDEEWRNLQRIEQRRLELGREFDPAIGFWLSLALLQLGNLVEA
FT                   RRILQSLTSFIGRPRKRQFEPLILISTSDAIPRSFRALVRRRGEREDYTVYIRELDVET
FT                   TLWRRYLEAGEAIDLKQGDLVEVYVALNYRGPMAIGPRWTARALRSPAPLT"
FT   gene            597364..598761
FT                   /locus_tag="BBta_0592"
FT   CDS_pept        597364..598761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0592"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32866"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9M2"
FT                   /protein_id="ABQ32866.1"
FT                   /translation="MTGDLVIGAIASMLEGAGDSVSFAFGKERVICGSGELRETLTRIE
FT                   ARLSEIAAGSKDALRVALLSDDDDERRMIASAIVGLGAELGLQIKLSNDSWGIWARDAR
FT                   NARDSGKIIHVLTEVPPLPKAQQGFASILGSLILLWPPQFAGSEVTPDRIEAVILAPFS
FT                   ERPLEKAAHVVDAVWATLNSIEEGDERQAAIDLFARLDVNALFGTCIDVTKLTTSSLAR
FT                   EAGNRLASSLRVQSALRPGEALSAAEIYRALSPQPDRLAPHLRRLWVEGSTDAAMIRLA
FT                   ERLAAADAPGLLDGIHIEAIGGVAQVEAALQRCNRSPSLELFMFDADADGKMGESKVRD
FT                   QGFPALVLDRSNAMGACDDEWVIEDLLTVSCLDRFYSAHRNLRPAREEIAHQPPEGRRL
FT                   VLRGEDKGTLVEWLEREATLGDLYGVLQQIKAIRRRFALRDWADSTTRPPDASIGLRPR
FT                   PWWFIGT"
FT   gene            599108..599467
FT                   /locus_tag="BBta_0593"
FT   CDS_pept        599108..599467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0593"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32867"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9M3"
FT                   /protein_id="ABQ32867.1"
FT                   /translation="MHIHQAGWLALAAIAVSGCGPTLSERNWADAQRQCQLRTSKEQQQ
FT                   ESFDDCVRNNYRAYDILSRYTPPTVPSVPSSGPATTVVSPSSLDNQAPAPNIIPPTVRC
FT                   QSVGAGLGTVQTVCH"
FT   gene            599693..600007
FT                   /locus_tag="BBta_0595"
FT   CDS_pept        599693..600007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0595"
FT                   /product="putative transposase"
FT                   /function="transposases"
FT                   /note="fragment; Evidence: Function proposed based on
FT                   presence of conserved amino acid motif, structural feature
FT                   or limited homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32868"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9M4"
FT                   /protein_id="ABQ32868.1"
FT                   /translation="MLPNKPRGVGRVDDRRVLNGIFYVLRTGSPWRDLPERYGPYTTVY
FT                   NRFNRWAKAGVWVQIFEVLAARSPQSMALIDSSIVRAHQHAAGGKKGARITPLAVLVED
FT                   "
FT   gene            600058..600408
FT                   /locus_tag="BBta_0596"
FT   CDS_pept        600058..600408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0596"
FT                   /product="hypothetical protein"
FT                   /note="transposase domain; Evidence: Similar to previously
FT                   reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32869"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9M5"
FT                   /protein_id="ABQ32869.1"
FT                   /translation="MLTPGQAHDLRAAPFLLQGLKCRDVVADRGYDADALLHMIRARGA
FT                   RAHIPSTSQRVVQRSVSRRIYRKRNLVERFFCKLKHFRRIATRFDKLARNFLAAVALGS
FT                   TRLWTRVYESTP"
FT   gene            600438..600851
FT                   /locus_tag="BBta_0597"
FT   CDS_pept        600438..600851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0597"
FT                   /product="Helicase"
FT                   /note="Methyltransferase; fragment; Evidence: Gene remnant"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32870"
FT                   /db_xref="GOA:A5E9M6"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9M6"
FT                   /protein_id="ABQ32870.1"
FT                   /translation="MQLKAGSSAELASIPAFTTSTIYLVTGLLLLIWKRIPQKSTRVYR
FT                   LQTDAGERIIGRKVPLSWVTAMSAERPALAAEDAFAALLRDGDPTRTAPPPREQRFEPS
FT                   PFHIAQPKSCYLIKASRDSDALNRNSAYADTPN"
FT   gene            complement(600904..601998)
FT                   /locus_tag="BBta_0598"
FT   CDS_pept        complement(600904..601998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0598"
FT                   /product="putative exported protein of unknown function"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32871"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9M7"
FT                   /protein_id="ABQ32871.1"
FT                   /translation="MERAAMTSPESLNSGSRLFSRRPTAVVAVTVVALLSPQAARADES
FT                   GISYWLPGLYGSMSATPTTPGWSIAAIYYHANAGASGAAAASREVQIGRLSTAVAVDLN
FT                   VVLRGQADLMLIAPTYTFATPVLGGQLSATLASIYARNSASIAGTLTTAVGPISITRNG
FT                   LLEEAVTSYGDLYPTAKLKWNTGVHNFIVYGTGNIPIGDYSPNRLANIGLGHGAVDVGG
FT                   GYTYFNPATGLELSGVGGLTYNFKNRDTQYQSGVDFHFDWGASQFLSKQVFVGLVGYVY
FT                   QQITDDFGQPAVLGSFRSRVFGIGPQIGYAFQIGSNQAFLGVKGYGEFAAQNRPSGWNT
FT                   WLTFSISEAVPASIATPTKHPMHK"
FT   gene            complement(602089..604377)
FT                   /locus_tag="BBta_0599"
FT   CDS_pept        complement(602089..604377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0599"
FT                   /product="Putative Arylsulfatase"
FT                   /EC_number="3.1.6.1"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32872"
FT                   /db_xref="GOA:A5E9M8"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9M8"
FT                   /protein_id="ABQ32872.1"
FT                   /translation="MLDVRNAGAPPPRFEIKAPSQAPNVLIVLIDDMGFGQSSAFGGPI
FT                   HMPTVEQLASGGLRYNQFHTTALCSPTRAALLSGRNHHVNNFGSIAETGTSFPGQTGQR
FT                   PNNVASVAEMLRLNGYSTAHFGKNHETAAWEVSASGPTDRWPTRQGFDKFYGFMGGETN
FT                   QWAPLIYDGTTQVELPKDPNYHFMTDMTDKAIAWMKSQKSLTPDKPFFMYFAPGATHAP
FT                   HHVPKQWIAKYKGKFDQGWDALREETLARQIKLGVVPAGTKLAPKPDAIADWAKLSGDE
FT                   KKLFTRQMEVFAGFAEYTDTEIGRLVDAIKATGQLDNTLIFYIVGDNGASAEGGMSGMF
FT                   NEMTYFNGVQETVQDVLKHYDELGGPNTYSHYAAGWAVAGDTPFTWTKQVASSYGGTRN
FT                   GMVVYWPKVIRAKNEVRTQWHHVVDIAPTILEAASLPEPKSVNGTIQVPIEGTSMVYSF
FT                   DAPKAESTHKTQYFEIFGNRAIYHDGWLAGTIHRAAWETKPRRPLDQDVWELYDTRSDF
FT                   SLANDLAAKDPDKLKEMQDLFMKEAEANSVLPLDDRTLERANAALAGRPDLMAGRTSLT
FT                   VHEGMAGMSENVFINIKNRSHTITAEVDIPKGGANGVILAQAGRFGGWSLYLKDGKPTY
FT                   TYNFLGLERFTVSAKQAVPAGRATIRFEFAYDGGGVGKGGLGTIIVNGRSVATGRIERT
FT                   EFGVFSADEGADVGADEGTPVTESYKVPFKFTGKIAKVTIDLLDMKKADIEDAKRARKA
FT                   ALVKKGLSD"
FT   gene            604427..604594
FT                   /locus_tag="BBta_0600"
FT   CDS_pept        604427..604594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0600"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32873"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9M9"
FT                   /protein_id="ABQ32873.1"
FT                   /translation="MGSTTPGGTTDCAKDCAKAGATIAGAMSIKATIARITPTRPVKRT
FT                   LVLSRFGDSN"
FT   gene            604613..605290
FT                   /locus_tag="BBta_0601"
FT   CDS_pept        604613..605290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0601"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32874"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9N0"
FT                   /protein_id="ABQ32874.1"
FT                   /translation="MTRSWLNENDNWIAYSVKTLLILCAASRYAAVRGVWVGKRRTYPD
FT                   DLQHDDPDWADALGNEQQKPDQTKVNLQGATENSSRLRAIELLNASVDCHGRRQMQQNA
FT                   EYLNLFGLAGQPNTEPVQRRPTRLTGPPRFIGVPARTPIPGAPTPGRTTARATGRGRRT
FT                   TPGRTMHPTGYSMYWQYTTAPAFSVLAATKPATNPLVSKIASALDRFIVASSSFLSMTK
FT                   LAQ"
FT   gene            605458..607911
FT                   /locus_tag="BBta_0602"
FT   CDS_pept        605458..607911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0602"
FT                   /product="hypothetical protein"
FT                   /note="tetratricopeptide repeat; Evidence: Similar to
FT                   previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32875"
FT                   /db_xref="GOA:A5E9N1"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9N1"
FT                   /protein_id="ABQ32875.1"
FT                   /translation="MARRRRKSTHQPVANFPARSPEASLREPEPRRWNSGFSGLFWAAS
FT                   LMATTAILAWIAFLSLENKASPAPEIATYVGSNACAGCHQTEARLWMASQHKGAMQHAT
FT                   DGTVLGNFNDVRFDYFGVQSRFFRKNGQFFVETDGPDGALAVYEVKYTFGVDPLQQYLV
FT                   PFPDGRLQVLPIAWDSRPSDRGGQRWFHLSANEAIRHDDVLHWTRLNQTWNFMCAECHS
FT                   TGVRKNYDAEKDRFATTWTEISVGCEACHGQGSRHVSWAHEQQSWLPFGRRQDSSKGLL
FT                   VHLDERNGITWSIEPQTGNVQRSSEPAALRKEVETCGLCHARRAAFHEGWIPGHSLSET
FT                   HAVEALSRNTFDVDGQIRDVEEPYNYTPFRQSKMYAAGVSCSDCHEPHSGGLRLSGEGT
FT                   CLQCHASNKYADVKHRQHAGVDPAPTCISCHMPTRTYMSIDARHDHAFRVPRPDQSVAL
FT                   GTANACNDCHRDQSAQWAAAAIERWYGADRKGFQSYGPIFHAARINRTDAAALLSELAS
FT                   DRRAPAVARASALGELASRMTRADISTARAALGDPDPMVRLGALDMLENVPAAEIWSFV
FT                   SPLLSDPSRGVRIRAVALLANMPVRSQQPADRARFDLAAAEFIAAQRSNAERPEARTAL
FT                   GNFLLQRDRPQEAEAEYRAALRLSPHYATAAINLADLYRQRGQDGEGEAVLRTALVASP
FT                   RDAALFYSLGLTLTRLRRPDDALNALARAAELEPERQRYVYVYGIALHSSGRREAAVSV
FT                   LKDALRAHPNDSQILQALISFSRMSGDATSALRYAEQLAAIAPSDKELAALIQELRRIA
FT                   SPPAR"
FT   gene            complement(608114..608596)
FT                   /locus_tag="BBta_0603"
FT   CDS_pept        complement(608114..608596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0603"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32876"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9N2"
FT                   /protein_id="ABQ32876.1"
FT                   /translation="MSTLSGIATPDGIEVEYFKLGTAGAPVSISASAGPGFIPAATTAV
FT                   NAPEQRKSRFVHIGEFSVGEPLLINRLWRDHIDITQSRGSLAGRRRMVFPASADKLAGY
FT                   QFGLGCDAEEPAVAIIPEVQIEPHIASDESRRRRQVQELRASKELFLEPSRVSLIA"
FT   gene            608589..609962
FT                   /locus_tag="BBta_0604"
FT   CDS_pept        608589..609962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0604"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32877"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9N3"
FT                   /protein_id="ABQ32877.1"
FT                   /translation="MDTRLGRLNFFGGFPDQASVDRLYDNLDFQRAVQAYLLALPVVNQ
FT                   VGNRDGILAVGPANTTVPIWETMVDARTVELTANNNTPYTWFWLDLRGGPLVVEAPPNV
FT                   LGLANDMWYRWVGDIGLVGPDKGKGGKYLVLPPGYKGRVPSGYFVLRPGSYLTWIAWRS
FT                   FLVGDDPKPGVDLVKKHTKIYRLGETNPPKLNFVDMSGKPFNMVAPADYPYWALLNKVV
FT                   QEEPTDDVDATTLGFWASVGIMKGKPFAPDERMQKILAEAAIVGDATARAIMYRWRGAD
FT                   GYWYSDRNWRLGFVGGYKFEENGARLLNAYSGFFFYATGVTPAMDSRSVGEGSQYLAMF
FT                   VDAKKTVLDGGKNYRLHLPPNIPIKNFWSVIVYDNQTRSMLQTDQRFPSVSSQNKKLKI
FT                   NPDGSVDIYFGPKAPAGLEDNWAQTVPGASWNILLRLYGPLQAFFDKTWRPGDIELQS"
FT   gene            complement(610193..610606)
FT                   /locus_tag="BBta_0606"
FT   CDS_pept        complement(610193..610606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0606"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32878"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9N4"
FT                   /protein_id="ABQ32878.1"
FT                   /translation="MLFNAIKRLHSLGLSGPFQALQSLGLSYSYGLISSFLSPLVVGGT
FT                   VVLPPRGDITDLSQAIETGRLAVALMTPALIEHLVNTGSPTQLAVLGEIRRLGIGGDAC
FT                   PPTSHCVDRHRIDDRSAGIAGVRISGGAAQRSR"
FT   gene            610265..610357
FT                   /locus_tag="BBta_0607"
FT   CDS_pept        610265..610357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32879"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9N5"
FT                   /protein_id="ABQ32879.1"
FT                   /translation="MPINAMTGRRAGVTTDPETPDLAEHSELRR"
FT   gene            complement(610663..610908)
FT                   /locus_tag="BBta_0608"
FT   CDS_pept        complement(610663..610908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0608"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32880"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9N6"
FT                   /protein_id="ABQ32880.1"
FT                   /translation="MHLGGREDADFYAATALATPEPDLGCFAFLQYARRLGMERFSRKC
FT                   RTHLATHSLEERQRTKMDLGTLRRRERIVARPMISF"
FT   gene            complement(610994..612577)
FT                   /locus_tag="BBta_0609"
FT   CDS_pept        complement(610994..612577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0609"
FT                   /product="transposase"
FT                   /function="transposases"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32881"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9N7"
FT                   /protein_id="ABQ32881.1"
FT                   /translation="MSSDPLPADLAAAHAMILAQREQLTLAKSEVTVGRLEIERLKLML
FT                   AKARREQFGQSSERGRLLVEQLELAIEDLEETQAEQETRAEIAAPEAAKQKRAQNPRPP
FT                   RRPLPDNLPVERIVEPAPCACGKCGSERLHKLGEVVSKTLECEPRRWKIIEHVREKFSC
FT                   RDCEAITEAPAPSHPIPRGFAGPSLLAMVLVNKFLLHQPLNRQSQTYAREGIEIDVSTL
FT                   ADRIGACVVALAPIIEAIRTHVMSAERIHADDTTVPVLAKLKTVTGRIWTYVRDDRPFG
FT                   GRDPPAAVFHYSRSRAGEHPQGHLAGYVGLMQADAFDGYNQLYMAQRKPAPIVEAACWS
FT                   HGRRKFVDLVKQGEAPVASEAVRRIDMLFEIERSINGKTPEQRLLVRRERSRPLVAELE
FT                   IWMRQQQALLSTKNDTAKAINYLFNGWAAFTRFLDDGRVCLTNNAAERALRGVAVGRRN
FT                   WTFAGSDVGGHRAAAVYTLIETCKMNDVDPQAWLADVLARLPDHPANKVNELLPWNWKA
FT                   NQRSKAAVAA"
FT   gene            complement(612654..613001)
FT                   /locus_tag="BBta_0610"
FT   CDS_pept        complement(612654..613001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0610"
FT                   /product="hypothetical protein"
FT                   /function="Transposon related"
FT                   /note="IS66 Orf2 like domain; Evidence: Similar to
FT                   previously reported genes of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32882"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9N8"
FT                   /protein_id="ABQ32882.1"
FT                   /translation="MIAIPGNVRVWLATGHTDMRRGFPSLARLVQESLKRDPHVGDLYV
FT                   FRGRRGDLIKIIWHDGQGACLFTKRLERGRFLWPSVADGVVTISVAQLSYLLSGIDWRM
FT                   PQATWRPQASG"
FT   gene            complement(612998..613399)
FT                   /locus_tag="BBta_0611"
FT   CDS_pept        complement(612998..613399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0611"
FT                   /product="putative transposase"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32883"
FT                   /db_xref="GOA:A5E9N9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9N9"
FT                   /protein_id="ABQ32883.1"
FT                   /translation="MRVEVLGGLERRRRWSQDDKARIVEETLVPGAKVTDVARRNGVAA
FT                   SVVFTWRRQARTVVNDGPCFAPVQIAAAVAPSAEEAKPLSKDDRRLQPMPTARSGLIEI
FT                   DLGNRRRIRVDAQVDPEALARVLDVLERR"
FT   gene            614338..614778
FT                   /locus_tag="BBta_0612"
FT   CDS_pept        614338..614778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0612"
FT                   /product="putative Acyltransferase"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32884"
FT                   /db_xref="GOA:A5E9P0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9P0"
FT                   /protein_id="ABQ32884.1"
FT                   /translation="MRQARPDDAEKLTRIAQAAYGKYVPRMVKAPAPMSYDYLAWIREG
FT                   NTYVLEHSGEVAAMITLLPKDDHLMMRNLAVLPAFQGRRLGHALIDFAEAEARRRNLPE
FT                   LRLYTNEKFPETMPFYKSRGFSETHRAQVDGYSFIYLSRTLT"
FT   gene            complement(615323..616024)
FT                   /locus_tag="BBta_0613"
FT   CDS_pept        complement(615323..616024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0613"
FT                   /product="putative Glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="Evidence: Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Localization: 2 : Cytoplasmic; PUBMED: 7798255,
FT                   2185038, 9680481"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32885"
FT                   /db_xref="GOA:A5E9P1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9P1"
FT                   /protein_id="ABQ32885.1"
FT                   /translation="MEALSYQHANQRISSVSHLVLYFWPGACSIAAHIVLEETGLTFEA
FT                   IKVDFAAGKQREPDYLAINPRGRVPALATPWGILTETPAILRYLTAAGTHPTPASRLWP
FT                   TESRADARCAEWCSWLASTVHVTYAHISRAERYADSPEGKAEVVRKGVESCRPLWQEIN
FT                   DRLSASPWALGDTYSVVDPYLQVFWNWGRGQRLRYDMATDFPAWTDHARRLAERPAVRR
FT                   AFAREGLALPE"
FT   gene            616311..616940
FT                   /locus_tag="BBta_0614"
FT   CDS_pept        616311..616940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0614"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32886"
FT                   /db_xref="GOA:A5E9P2"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9P2"
FT                   /protein_id="ABQ32886.1"
FT                   /translation="MTLRRLGTIVPQYDGRVSFDVTYRPGYDDAPYSQSMNALGAHTEA
FT                   PGFMPPPKYLALYCHRQARCGNGQTLLADGIRFYDEALSPDLRRWSQNNEVEFVSSATP
FT                   GDETRSSLRAPIRATVAGEPVLRFSYNLFRYGNVNPDAIEVRRVGDDPSDPLGQIAEEG
FT                   EAFFSRNLIPVLIPDGCMLVWNNHRLMHGRGRYADQARHLTRYWLS"
FT   gene            617057..617542
FT                   /locus_tag="BBta_0615"
FT   CDS_pept        617057..617542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0615"
FT                   /product="hypothetical protein"
FT                   /note="Evidence: No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32887"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A5E9P3"
FT                   /protein_id="ABQ32887.1"
FT                   /translation="MKSRTTEPVAWSWSRTAAELETRVGAEIRGISLVALSTAASDATG
FT                   EVVPGISFAVQSLPVDGQTPRHSHAWWHVFVVQSGSGIVGFGDGREAIRMMRNDVVLIP
FT                   AWCVHELRNDGAEPFVTLNLSNMPQQADLANFRTADGRQSSPCTDPIGKGRTHATGL"
FT   gene            617475..618932
FT                   /locus_tag="BBta_0616"
FT   CDS_pept        617475..618932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBta_0616"
FT                   /product="L-lysine 2,3-aminomutase"
FT                   /EC_number="5.4.3.2"
FT                   /note="Evidence: Similar to previously reported genes of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BBta_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ32888"
FT                   /db_xref="GO