(data stored in ACNUC22857 zone)

EMBL: CP000500

ID   CP000500; SV 1; linear; genomic DNA; STD; FUN; 1724953 BP.
XX
AC   CP000500;
XX
PR   Project:PRJNA16843;
XX
DT   27-FEB-2007 (Rel. 90, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Scheffersomyces stipitis CBS 6054 chromosome 6, complete sequence.
XX
KW   .
XX
OS   Scheffersomyces stipitis CBS 6054
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Debaryomycetaceae; Scheffersomyces.
XX
RN   [1]
RP   1-1724953
RX   DOI; 10.1038/nbt1290.
RX   PUBMED; 17334359.
RA   Jeffries T.W., Grigoriev I.V., Grimwood J., Laplaza J.M., Aerts A.,
RA   Salamov A., Schmutz J., Lindquist E., Dehal P., Shapiro H., Jin Y.S.,
RA   Passoth V., Richardson P.M.;
RT   "Genome sequence of the lignocellulose-bioconverting and xylose-fermenting
RT   yeast Pichia stipitis";
RL   Nat. Biotechnol. 25(3):319-326(2007).
XX
RN   [2]
RP   1-1724953
RG   US DOE Joint Genome Institute
RA   Grigoriev I., Grimwood J., Aerts A., Salamov A., Zhou K., Lou Y.,
RA   Pitluck S., Schmutz J., Myers R.M., Lucas S., Detter J.C.,
RA   Glavina del Rio T., Jin Y.-S., Passoth V., Laplaza J.M., Jeffries T.W.,
RA   Richardson P.;
RT   ;
RL   Submitted (12-DEC-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 916084316b35e575d41e9648a5f61d89.
DR   BioSample; SAMN02746101.
DR   CABRI; CBS 6054.
DR   EnsemblGenomes-Gn; ENSRNA049610438.
DR   EnsemblGenomes-Gn; ENSRNA049610462.
DR   EnsemblGenomes-Gn; ENSRNA049610536.
DR   EnsemblGenomes-Gn; ENSRNA049610586.
DR   EnsemblGenomes-Gn; ENSRNA049610633.
DR   EnsemblGenomes-Gn; ENSRNA049610680.
DR   EnsemblGenomes-Gn; ENSRNA049610760.
DR   EnsemblGenomes-Gn; ENSRNA049610828.
DR   EnsemblGenomes-Gn; ENSRNA049610871.
DR   EnsemblGenomes-Gn; ENSRNA049610920.
DR   EnsemblGenomes-Gn; ENSRNA049610967.
DR   EnsemblGenomes-Gn; ENSRNA049611039.
DR   EnsemblGenomes-Gn; ENSRNA049611100.
DR   EnsemblGenomes-Gn; ENSRNA049611131.
DR   EnsemblGenomes-Gn; ENSRNA049611173.
DR   EnsemblGenomes-Gn; ENSRNA049611235.
DR   EnsemblGenomes-Gn; ENSRNA049611272.
DR   EnsemblGenomes-Gn; ENSRNA049611305.
DR   EnsemblGenomes-Gn; ENSRNA049611359.
DR   EnsemblGenomes-Gn; ENSRNA049611408.
DR   EnsemblGenomes-Gn; ENSRNA049611470.
DR   EnsemblGenomes-Gn; ENSRNA049611537.
DR   EnsemblGenomes-Gn; ENSRNA049611617.
DR   EnsemblGenomes-Gn; ENSRNA049611677.
DR   EnsemblGenomes-Gn; ENSRNA049672579.
DR   EnsemblGenomes-Gn; ENSRNA049672656.
DR   EnsemblGenomes-Gn; ENSRNA049672698.
DR   EnsemblGenomes-Tr; EFT00001981005.
DR   EnsemblGenomes-Tr; EFT00001981006.
DR   EnsemblGenomes-Tr; EFT00001981007.
DR   EnsemblGenomes-Tr; EFT00001981008.
DR   EnsemblGenomes-Tr; EFT00001981009.
DR   EnsemblGenomes-Tr; EFT00001981010.
DR   EnsemblGenomes-Tr; EFT00001981011.
DR   EnsemblGenomes-Tr; EFT00001981012.
DR   EnsemblGenomes-Tr; EFT00001981013.
DR   EnsemblGenomes-Tr; EFT00001981014.
DR   EnsemblGenomes-Tr; EFT00001981015.
DR   EnsemblGenomes-Tr; EFT00001981016.
DR   EnsemblGenomes-Tr; EFT00001981017.
DR   EnsemblGenomes-Tr; EFT00001981018.
DR   EnsemblGenomes-Tr; EFT00001981019.
DR   EnsemblGenomes-Tr; EFT00001981020.
DR   EnsemblGenomes-Tr; EFT00001981021.
DR   EnsemblGenomes-Tr; EFT00001981022.
DR   EnsemblGenomes-Tr; EFT00001981023.
DR   EnsemblGenomes-Tr; EFT00001981024.
DR   EnsemblGenomes-Tr; EFT00001981025.
DR   EnsemblGenomes-Tr; EFT00001981026.
DR   EnsemblGenomes-Tr; EFT00001981027.
DR   EnsemblGenomes-Tr; EFT00001981028.
DR   EnsemblGenomes-Tr; EFT00001981029.
DR   EnsemblGenomes-Tr; EFT00001981030.
DR   EnsemblGenomes-Tr; EFT00001981031.
DR   EnsemblGenomes-Tr; EFT00001981032.
DR   EnsemblGenomes-Tr; EFT00001981033.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00030; RNase_MRP.
DR   RFAM; RF00472; snosnR55.
DR   RFAM; RF00474; snosnR57.
DR   RFAM; RF00476; snosnR61.
DR   RFAM; RF01177; snR67.
DR   RFAM; RF01247; snR32.
DR   StrainInfo; 362616; 0.
XX
CC   URL -- http://www.jgi.doe.gov/pichia
CC   JGI Project ID: 3634480
CC   Source DNA was provided by Jose Laplaza and Thomas Jeffries
CC   (twjeffri@wisc.edu)
CC   Stock culture is available from Cletus P Kurtzman
CC   (kurtsman@ncaur.usda.gov)
CC   Contacts: Thomas Jeffries (twjeffri@wisc.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Annotation done by JGI-PGF
CC   Manual curation done by the P. stipitis User Community
CC   Finishing done by JGI-Stanford Human Genome Center
CC   (www-shgc.stanford.edu)
CC   The finished chromosome has no gaps. The sequence has less than one
CC   error in 100,000 bp.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1724953
FT                   /organism="Scheffersomyces stipitis CBS 6054"
FT                   /chromosome="6"
FT                   /strain="CBS 6054"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:322104"
FT   gene            complement(<1198..>3875)
FT                   /gene="DUR3.2"
FT                   /locus_tag="PICST_32520"
FT   mRNA            complement(join(<1198..1250,1952..>3875))
FT                   /gene="DUR3.2"
FT                   /locus_tag="PICST_32520"
FT                   /product="Urea active transport protein"
FT   CDS_pept        complement(join(1198..1250,1952..3875))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="DUR3.2"
FT                   /locus_tag="PICST_32520"
FT                   /product="Urea active transport protein"
FT                   /note="go_component membrane; go_function transporter
FT                   activity; go_process transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32520"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67657"
FT                   /db_xref="GOA:A3LWM2"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR031155"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWM2"
FT                   /protein_id="ABN67657.2"
FT                   /translation="MAESLLNEGYGYGFVLGLGAAFALIMSIITKVLSKYGGQVQNSER
FT                   FSTASRNVNSGLIASSTVSAWTWPATLLSAGTWSYSHGIMGGFMYGIGGTIQITLFVFL
FT                   AIQIKLRAPSAHTVSECFSIRYGKAGHCVFLCYCIATNILVSSLLLLGGSQAFSATTGM
FT                   HAVAASFLLPLGVMVYTALGGLKATFMSDWIHTVVIYVILMVSCFTIYCSSSLIGSPSR
FT                   MYDLLREVQEQFPSETGTSYLSFRDKEMMLLTWTVMLGGLSSVFGDPGYSQRAIASDAK
FT                   SVFQGYIMGGICWWIIPAALGSSAGLACRALLTNPASVTYPRALSTSEVDSALPVIYGL
FT                   TAIFGRSGAAAGLVMVFMSVTSATSAELIAFSSVTTYDVYRTYINPSATGVQLVRVGHI
FT                   AVIGFSLFMAVLSTIFNYVGVTSGWLLSFVGIVLSPEVSAVLLTLFWNKMTKTALIIGA
FT                   PLGTISGIACWIGATYSFANGVVDKNSVMMSEATFVGNIVALASTPIYIFLISFLYPEK
FT                   SFDLASYNRIELGDDLDEEEKMALIVDTSDKRTLRIQSWWCLGINVFILFGCYIIIPCA
FT                   LYGSGHDLSKKSFTALIVVLLIWLVLAASYIIIFPLWQGREAIRLIIKSMLEQDEYQTE
FT                   SLDGLDVVPKQQRIAVGESSTRT"
FT   gene            <4350..>5975
FT                   /gene="AMD2"
FT                   /locus_tag="PICST_47832"
FT   mRNA            <4350..>5975
FT                   /gene="AMD2"
FT                   /locus_tag="PICST_47832"
FT                   /product="Acetamidase"
FT   CDS_pept        4350..5975
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="AMD2"
FT                   /locus_tag="PICST_47832"
FT                   /product="Acetamidase"
FT                   /note="go_function amidase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_47832"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67307"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWM3"
FT                   /protein_id="ABN67307.2"
FT                   /translation="MIAQEVNDWKLAAELKKQSLISSIPEKWRIADIKTQMKNAGYVNP
FT                   HLFLDSILPKDEVIITNKHLHELRVLIKKGTLSAYSVTEAFCHRSALAHQLLNCCIEIF
FT                   YVEALEKAQKLDDYFAVTGDVKGPLHGIPISLKDQVDLPGKDSSIGYVGLLGQPAGQIA
FT                   LMAKVLEDMGAVFYVKTAVPMAMMLPETYSNLHGYTFNGVNINLSPGGSSGGEGSLIGA
FT                   GGSCMGFGTDIGGSIRIPSAFQGLYSLKPSVGRFSYSGVTNSYSGQEVVPSVIGPMSTS
FT                   LKDIQIITELIVASETWNNDPKVMPIPWRDMSHLKDTPLTIGIWRFDGAVMPHPPIQRA
FT                   LRQVEAHLKEKGHKIVELTFPLQSQILSTISRVFGADAAYDVESICAISGEPIVPTVKE
FT                   MIQCDDINEPITVNEWWNLADEVYGLKKQFYEYWKDNSLDAILAPVWPSTASLPYGQPT
FT                   INYTAPFNLCDCCSVVVPITNVDRLIDEIDTSYVPINPADNHMYQSYDPDLFDKMPVCL
FT                   QVVTKKLEEEKALVVASIIDEIHN"
FT   gene            complement(<6080..>8092)
FT                   /locus_tag="PICST_36494"
FT   mRNA            complement(join(<6080..6235,6308..7855,7907..>8092))
FT                   /locus_tag="PICST_36494"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(6080..6235,6308..7855,7907..8092))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_36494"
FT                   /product="zinc finger protein"
FT                   /note="go_component nucleus; go_function transcription
FT                   factor activity; zinc ion binding; DNA binding; go_process
FT                   regulation of transcription, DNA-dependent; transcription"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36494"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67658"
FT                   /db_xref="GOA:A3LWM4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWM4"
FT                   /protein_id="ABN67658.2"
FT                   /translation="MSATPFKIRHTRILKACDNCRQRKIKCSGESVCSYCKKYGDPCIY
FT                   REKTRQSKKVVDRGNIDCGQEVLDMPTFLSVRKSSVNSSTMEYFGPASNFSFVNQLNDY
FT                   LRLLGKNTTPIDEDQGLRRFGMNLMVLSNPAEDFDCTLSTISVETVNQLITAFLETWHI
FT                   PCPIFTGEDLFDLSVTTWKQGSAPKHRKALLYLVLSIGAAASYFESTHCSASSTLPLAR
FT                   GFFELSIRTVPEIFTEVSFDAVRIIFLMSLSACNLGDTAQSYLYSGYSVRIAIALGLHK
FT                   LTKFESQHQCRVWTCAWQWENYWSFCVGRPSCSREDMSIPMVPEDAFTASGYGNKDRFA
FT                   IHHQHMELRVYFGANCSRIHSQLYDSESDLLAVLKSVEKLSTDIDNKYLGCSDPLLKES
FT                   QVSDLLLQNTDANACREWFWIRIYYLYLKMVIYRPFMIFYAYLNNSKTEASEKITLLLK
FT                   SKSNLCVQVAIDISRFIIDLNRKIKMRQPIFFICTYLESASTILLFFIISNRDNIPDTL
FT                   AESIWEVLQDTCAFLSGSSGPYVGSIKIIANDALKSLHDILLSNNSEIAERTYFGKVLQ
FT                   GVPNHSPDSNVLTEPSSDATSRFNAEKDAQLGDMSTYGLEDFWQQTLDWISIT"
FT   gene            <11203..13155
FT                   /gene="NAG4"
FT                   /locus_tag="PICST_84561"
FT   mRNA            join(<11203..11384,11406..13155)
FT                   /gene="NAG4"
FT                   /locus_tag="PICST_84561"
FT                   /product="Synaptic vesicle transporter SVOP"
FT   CDS_pept        join(11203..11384,11406..13038)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="NAG4"
FT                   /locus_tag="PICST_84561"
FT                   /product="Synaptic vesicle transporter SVOP"
FT                   /note="related to MDR family transporters (MDR15)"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_84561"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67308"
FT                   /db_xref="GOA:A3LWM5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWM5"
FT                   /protein_id="ABN67308.1"
FT                   /translation="MDPNHTISASEDDDSNTIDNASLDSEKVQSYGDALNTEQEHQNLT
FT                   PHRSISRILHSINSREEELKKLISNNKGVERIISELEEGTGRLGPLEQPYDLKRITTQA
FT                   DPNSDFNEADPWKYPLDSESGLRIVEFVPNDEKNPKNLSITTKWVYTGVLGFMCFVVAL
FT                   GSAIVTGDLERPAEYFGVSQEVIILASVTVFVIGFGVGPLLFAPMSEEVGRKPIYATTL
FT                   AIAVVFIVPCGAAKNIGTLLVCRLIDGIAFSAPMTLIGGSLADIWEGKDRGTAMAIFSA
FT                   APFLGPVTGPIFGGLLADHAPTWRWIYWTFLIIAGFVYVLFISIVPETHAGTLLKKRAK
FT                   QLRKETGDSRYRSFNELKIRSFSEVAKSSLLRPFVLLNELIVFLMTLYMSVVYGLLYMF
FT                   FFAYPMVFQEGKGFSASLTGVMFIPIGAGVGLATLAAPFFNKDYNKRAQVYRDRGELPP
FT                   AELRLIPMMVSCWFVPAGLFAFAWSSYPTISWAGPCFSGLGVGFGFCCLYNPANNYIVD
FT                   SYQHYAASALAAKTFVRSIWGACVPLFTIQMYHRLGLEWASTLMAFISLACCAIPFLFF
FT                   IYGARIRTFSKYAYSPNMDTKKDEENQK"
FT   gene            complement(<13338..>14600)
FT                   /gene="NAG2"
FT                   /locus_tag="PICST_48829"
FT   mRNA            complement(<13338..>14600)
FT                   /gene="NAG2"
FT                   /locus_tag="PICST_48829"
FT                   /product="N-acetyl-glucosamine-6-phosphate deacetylase"
FT   CDS_pept        complement(13338..14600)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="NAG2"
FT                   /locus_tag="PICST_48829"
FT                   /product="N-acetyl-glucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="go_function hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48829"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67659"
FT                   /db_xref="GOA:A3LWM6"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWM6"
FT                   /protein_id="ABN67659.2"
FT                   /translation="MASFTRFTNCHLIDNGQLYEYTDLYVNNKTNKISHPPADSSLITI
FT                   TVDVHGNILAPGFLDIQNNGIYGLNFSNLNANSTPQDVAAFDKFYKDAMTKYLSTGVTA
FT                   TCPTVTSNFPEVYEKVLPFYKKSRLSTQTDSLGAHIEGPFINLKKKGCHPVETFVDAKE
FT                   GEAKLYHIYGESNLIDNVCILTAAPEIPGVLDLIPLVKSKNIVFSLGHTMADYKTGIRA
FT                   VECGASMITHLYNAMPQPHHRDAGVVGLINSPELGEENTPYFGLIVDGVHVDPSMVNLA
FT                   YRSNPDKCVLVTDAMHLIGLPDGTYKWDDQYIVKTGDRLYLKGTKTLAGAATTLPQCVR
FT                   NLIKWSNITLPEAVKTVTNNAAVSVGLEHQKGFLNVGCDADLVVLDRDGYIQKVYKLGR
FT                   EIQSSDINLSNEKNPKVMAVL"
FT   gene            <15375..>16133
FT                   /gene="NAG1"
FT                   /locus_tag="PICST_62706"
FT   mRNA            <15375..>16133
FT                   /gene="NAG1"
FT                   /locus_tag="PICST_62706"
FT                   /product="Glucosamine-6-phosphate isomerase
FT                   (Glucosamine-6-phosphate deaminase) (GNPDA) (GlcN6P
FT                   deaminase)"
FT                   /note="Has EST support"
FT   CDS_pept        15375..16133
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="NAG1"
FT                   /locus_tag="PICST_62706"
FT                   /product="Glucosamine-6-phosphate isomerase
FT                   (Glucosamine-6-phosphate deaminase) (GNPDA) (GlcN6P
FT                   deaminase)"
FT                   /EC_number="3.5.99.6"
FT                   /note="go_process carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62706"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67309"
FT                   /db_xref="GOA:A3LWM7"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWM7"
FT                   /protein_id="ABN67309.2"
FT                   /translation="MKQATFSSPDDASTYLAEYIINKINSFKPTASKPFVLGLPTGSSP
FT                   EGIYARLISAYKDGRISFRNVITFNMDEYLGLPPTNDQSYHYFMYNKLFNHIDIPRENI
FT                   HILNGLAKDIKKECVDYEKAIKSYGRIHLFLGGLGPEGHLAFNEAGSTRDSKTREVFLV
FT                   ESTIKANSRFFDNDLNKVPKSALSVGISTILDNSDEIVLIVLGENKKFALDKTINGTKN
FT                   DARFPSSYLQDHSSVLVVCDNAAAGLKSKL"
FT   gene            complement(<16507..>18159)
FT                   /gene="NAG5"
FT                   /locus_tag="PICST_32526"
FT   mRNA            complement(<16507..>18159)
FT                   /gene="NAG5"
FT                   /locus_tag="PICST_32526"
FT                   /product="hexokinase I"
FT   CDS_pept        complement(16507..18159)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="NAG5"
FT                   /locus_tag="PICST_32526"
FT                   /product="hexokinase I"
FT                   /EC_number="2.7.1.1"
FT                   /note="hexokinase I (HXK1); go_function hexokinase
FT                   activity; ATP binding; go_process glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32526"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67660"
FT                   /db_xref="GOA:A3LWM8"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWM8"
FT                   /protein_id="ABN67660.2"
FT                   /translation="MAMIHNSSKVASPTEESIILPMKGLHGDVTISPTPILINQSEESD
FT                   FIDELSSSTSTSSEPSPNSSISTDSSCLLSSVVNDFVYDLTSQNFLEQTEFLVADLNES
FT                   LSRNSKITMLPNYNISPTGQESGEFLVIDLGGSTLRIAVIKIDQASDSDDEDRSKRIHI
FT                   LMEKNWTIDNSFKTLDLNFFKFIGSKIHEILCHQDLIDIRNNIKTGITWSFPLKTTSYN
FT                   NGKIVHVSKGYTIHPEIYNQDLKSILESVLLNEFDLHIDVKSILNDSLAVYSAGAFIDK
FT                   YTKLALVLGTGFNMCCSLSTSDKMHSDKTLESCDKILFNTELSLFGEHLIKSIATKYDS
FT                   LIDERFKTFDFHFKPFMSTDPNTHSIFQPNELMTSGRYLPELTRLVLVDLVEAKEIFVN
FT                   ISQKEELLSSAYDGFSGELMCFINESTNVDAITEKLCAQYGWSASEVTIGDVLTLKKIV
FT                   QSIVERAAFIVSVSIVSFIKLLQQHNDDHFDSSIINIGYVGSVLKHFNVYRDLVKQYVN
FT                   DNDDIKRLGVQVDFKLIENSSIIGAAIGAAYYS"
FT   gene            complement(19840..22425)
FT                   /locus_tag="PICST_84922"
FT   mRNA            complement(19840..22425)
FT                   /locus_tag="PICST_84922"
FT                   /product="predicted protein"
FT   CDS_pept        complement(19899..22382)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_84922"
FT                   /product="putative stress-related vesicular transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_84922"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67661"
FT                   /db_xref="GOA:A3LWM9"
FT                   /db_xref="InterPro:IPR008803"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030386"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LWM9"
FT                   /protein_id="ABN67661.2"
FT                   /translation="MSQSSPSNAETDEDLSTTSSSSSFVPIEQHQIQDAIQVIDENKEF
FT                   NKNILPYVVKTTPISSVGNNYHIISVFGSQSTGKSTLLNRLFNTNFDVMDESRRQQTTK
FT                   GIWMAHSPQVSTTKQMDTHQENIFVMDVEGTDGRERGEDQDFERKAALFALATSEILIV
FT                   NIWETQIGLYQGANMGLLKTVFEVNLTLFGKSKLEKNDHKVLLLIVIRDHVGLTPKENL
FT                   SSTITQDLLKIWESLNKPAELAHLQFEDFFDTDFHTLRHKVLQPKEFLEDVNELGDRLV
FT                   VKKDLFRPNYHHNIPIDGWTMYAENCWQQIDSNKDLDLPTQQILVAKFKCDEISASVYE
FT                   EFHQKFKAISSANTPGISTLDYQDLGLLLVDLRSDTLENYDLSASRYTKSVYEQRKDLL
FT                   KEKLNEKFREFFDAHIKHLSEKSVKEFETNIVGLKGKNFDKEATRLTRETTDYFINSAI
FT                   LLSLENELDYDVHVSNLQDQLTKLIQQQQLVELKNIVNKSIKKLSSGLTKAVSFELADP
FT                   TETSWNNILSKFKEFVLDFLSKNELEEEAGTYDFGLGTNRAQNKEAVETFKFKSWNAFY
FT                   EIIHKIISKDNLLTLLKDRFDDKFRYDENGLPRMYQNTVELETNFGISKSFALRIVPLL
FT                   TIAKLNDNSEILPDYDIFDSKLRAKYLGLVENEHDSEDEEDEEDRCFAEIISESEKAEV
FT                   LNKFKKETDARFIETKRSIVQHVTQIPYYIYLVIMVLGWNEFMAIVRNPLFFSLVLVFG
FT                   AGLYILYSMNLLKPAMVVVQRLIDEIIAMAKEKMREFLIDDHPTQAHNLQKISASNREK
FT                   VEEEKVVETIEMQDL"
FT   gene            complement(<23043..>24041)
FT                   /gene="ETF1"
FT                   /locus_tag="PICST_32528"
FT   mRNA            complement(<23043..>24041)
FT                   /gene="ETF1"
FT                   /locus_tag="PICST_32528"
FT                   /product="Electron transfer flavoprotein alpha-subunit"
FT   CDS_pept        complement(23043..24041)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ETF1"
FT                   /locus_tag="PICST_32528"
FT                   /product="Electron transfer flavoprotein alpha-subunit"
FT                   /note="electron transfer flavoprotein alpha-subunit,
FT                   mitochondrial precursor (Alpha-ETF) (Yong-Su Jin[2006-01-06
FT                   11:32:10]); go_function electron transporter activity;
FT                   go_process electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32528"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67662"
FT                   /db_xref="GOA:A3LWN0"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWN0"
FT                   /protein_id="ABN67662.1"
FT                   /translation="MLRSCISKRLFSTTRARLDTLAFVEAAGGKISPASLSAITAAQQI
FT                   GKPITALIVGEQGEAVSSEVGKIAGVSKALFAKGEQYNHYLAEELSPLIKDILSSSSDY
FT                   THFVTAASAVGKSVLPRLGALVDAQPISDIIKVESENTFVRPIYAGNALATVKSNDKLI
FT                   LVSVRASAFAPAELSGDGSVSVEEFATVFKSDNRTEFVSEDLVTSERPELGSASKVVAG
FT                   GRGLKNKETFEQLIEPLASKLSAAVGASRAAVDSGFCDNSLQVGQTGKIVAPELYIAVG
FT                   ISGAIQHLAGMKDSKTIVAINKDPEAPIFNVADIGLVADLNEALPELTQKL"
FT   gene            <26659..>28221
FT                   /gene="SUC1.4"
FT                   /locus_tag="PICST_3849"
FT   mRNA            join(<26659..26874,26977..>28221)
FT                   /gene="SUC1.4"
FT                   /locus_tag="PICST_3849"
FT                   /product="Probable sucrose utilization protein"
FT   CDS_pept        join(<26659..26874,26977..>28221)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SUC1.4"
FT                   /locus_tag="PICST_3849"
FT                   /product="Probable sucrose utilization protein"
FT                   /note="Fungal specific transcription factor; possible
FT                   sucrose or maltose fermentation regulatory protein (MAL33);
FT                   go_function DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_3849"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67310"
FT                   /db_xref="GOA:A3LWN1"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWN1"
FT                   /protein_id="ABN67310.2"
FT                   /translation="RSKYSRPCDACAHRKVRCTDNRPCSRCIDYGISCTNTRIRKRSGP
FT                   KPKIISELPFSNNISTSPKGTSQYLTIFIPIDDLYPFLQFFQTWYYGLWPVLSVGSLIT
FT                   NLTTITDRRSLNKQTSPYYSLGLALCAAISGQFAFLSKSSDLPHMTTTVSASQLARAAL
FT                   NVRETFDHRMKPTEETLLTSFFLYNYYINVKNGTEAAIMYLREAISMVHILGLHDPQAY
FT                   LQMSSESSHRLKKTYYLLLASERFMCIEDNVPVILDSSVPYPLVEDDEYPELLAGFVEV
FT                   VKIFAIPDRNFFEKMSIANRRTENVKDYEIFQNFFHLSATSLSEAWVREVDKKIKGITI
FT                   VDSMSDISKVNLLLSKDWMRSLIWRIAYQNALTSALREKDDCLSLNYPMTIAYQFLSST
FT                   SNLPAFAFECNGAGVVVKLLDIANGLGDSMNDLSSMERTYDLSLFENALTSVFCLISKF
FT                   KTKVTLPVRMYRKIENMVSRWSIPRQFSS"
FT   gene            complement(<28472..>30943)
FT                   /gene="YIC1"
FT                   /locus_tag="PICST_32530"
FT   mRNA            complement(<28472..>30943)
FT                   /gene="YIC1"
FT                   /locus_tag="PICST_32530"
FT                   /product="Alpha-glucosidase II; Alpha-xylosidase"
FT   CDS_pept        complement(28472..30943)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="YIC1"
FT                   /locus_tag="PICST_32530"
FT                   /product="Alpha-glucosidase II; Alpha-xylosidase"
FT                   /note="Glucosidase II catalytic (alpha) subunit and related
FT                   enzymes, glycosyl hydrolase family 31 Carbohydrate
FT                   transport and metabolism; go_function hydrolase activity,
FT                   acting on glycosyl bonds; hydrolase activity, hydrolyzing
FT                   O-glycosyl compounds; alpha-glucosidase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32530"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67663"
FT                   /db_xref="GOA:A3LWN2"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWN2"
FT                   /protein_id="ABN67663.2"
FT                   /translation="MSNHQNMEYYSLDRSIDSDTRFTRGMWELKHGINLRWALENVKTV
FT                   VKDPSSIQTVSATQRISQRGDTLNNPTITSTISSPSEGIVKFEAYHHLSGYNNHSEPRF
FT                   GLNEKDSPDVTTSVSDDFSSLETEGDISVNVSNKPATFEFLGTKGKLLTKLGYKSLGWV
FT                   KDARVPHSSTPRGYTTYTTAQLHLSVGERLFGLGERFGPFVKNGQRVEIWNEDGGTSSE
FT                   WTYKNIPFYLSDRGYGIFVDSSSNVVFELQSERTTRVNITVPGEGIRFYVIHGPDPKTI
FT                   LKRYTKLTGRPALPPAWTFGLWLTTSFTTEYDLNTVSSFIQGMKDRDIPLTTFHFDCFW
FT                   MKGFQWCDFEFDPQYFPDAKLMLKELKSRFNVKVCVWINPYIAQESMLFREADEKRYLI
FT                   RYNSNVNNGASYQTDLWQAGMGIVDFTNPDAVKWYQSKLEHLIDLGVDSFKTDFGERIP
FT                   VKDIVYHSGEDSVAMHNYYALLYNKTVFELLERKLGKDNACVFARSATVGGQQYPVHWG
FT                   GDCESTFEAMAESLRGGLSLTLSGFGFWSHDIGGFEGDPRPEVYKRWCAFGLLSSHSRL
FT                   HGSNSYRVPWNFDDEASEVLAKFTKLKISLMPYIYKHAIESHETGVPVMRAMMLEFPDD
FT                   KTAVSVDSQFTLGDSLLVSPVFSGDEGEVSYYLPKGSWYGLLDGKIRSSVGEWMNEVHG
FT                   YTSLPILVRPNSVIVTSGPDAENEHPVYTWNERFMLNVFDVDKTWNNSTNIPNSKKLGK
FT                   IDTTIDVSKGDNLLTIKVSGDFKTPYFVSFLGKNAGVEVVKGKSKPSGSGTIGNLIFEC
FT                   NSGVLQFKILN"
FT   gene            <31705..>33234
FT                   /gene="MAL5"
FT                   /locus_tag="PICST_32531"
FT   mRNA            <31705..>33234
FT                   /gene="MAL5"
FT                   /locus_tag="PICST_32531"
FT                   /product="maltose permease"
FT   CDS_pept        31705..33234
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MAL5"
FT                   /locus_tag="PICST_32531"
FT                   /product="maltose permease"
FT                   /note="go_component integral to membrane; go_function
FT                   transporter activity; go_process transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32531"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67311"
FT                   /db_xref="GOA:A3LWN3"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWN3"
FT                   /protein_id="ABN67311.2"
FT                   /translation="MTLSEAWKDHKPAMLWSIVLGATIIMEGYDCILTSSFYAYPQFKK
FT                   VFGDQIVAKDGSISYELATRWQIGLGCASTVGTMIGVFFNGYLAERFGHRMVILVSLTF
FT                   MAGFLFIVFFAKTIEVLLVGQILCGIPWGIFATMGISYASEILPLQLRGYLTSIINLYW
FT                   ATGQFVAAGALQALVNNDTKWSYKIPYGLQWMWIPPLFIMTLLAPDSPWYLIRKGKIEQ
FT                   AEKSIKRLGSKRIADKSKTTLALMIHTNKLEKEQQLANLESTSGWKGYIQCFQGVNLRR
FT                   TEIVCIAFAGQVLSGSTFAYSPSYFFSQAGLNSSETYKLNLGTTAIAFSGTVCSWFLLA
FT                   RFGRRTIYVTGFAFLVLFLFLIGVLAKPAESNGTVKWVQCGLTMLWVSTYALTIGPLAF
FT                   TISAEMSATRIRSQSVCLARNSYNLVNLISYIVEPYLINPGSANLRGKTAFVWFATALP
FT                   TFIWSYYRLPETRNRTYEELDLLFEKRVPARQFASYDLYSGDTSEIEKFEE"
FT   gene            complement(<34361..>36106)
FT                   /gene="MAL3"
FT                   /locus_tag="PICST_47584"
FT   mRNA            complement(<34361..>36106)
FT                   /gene="MAL3"
FT                   /locus_tag="PICST_47584"
FT                   /product="maltose permease"
FT   CDS_pept        complement(34361..36106)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MAL3"
FT                   /locus_tag="PICST_47584"
FT                   /product="maltose permease"
FT                   /note="maltose permease slight similarity to Candida
FT                   intermedia GXS1; go_component integral to membrane;
FT                   go_function transporter activity; go_process transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_47584"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67664"
FT                   /db_xref="GOA:A3LWN4"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWN4"
FT                   /protein_id="ABN67664.1"
FT                   /translation="MSSVFVEDIKNPEKVVIVNSVAKKASDDSSLNSVDDYVSRFLDMS
FT                   NEARDNDHNEKRMPLREGLKTFPKAVMWSIILSTALVMEGYDTYLLNSLFGFQAFNKKF
FT                   GHFDKRLNKYIIEAKWQTGLNMGYNSGCVIGLAISGFVADIYGYRKTLMTALASSIALI
FT                   FLQFFSPNKEVLLLAYVLLGINWGSYQTLTVTYASEVAPTTLRVYLTTYVNMCWVFGQL
FT                   LGSGVLKAVSSMSETPNSYRIPFAVQWVWPIPLIIGVYLAPESPWFLVKRGRDQDAKNS
FT                   LKRLLSENPLMPDKDVLSQAMLTKIQMTVREEDAKDVGNFSDCFKGTNWRRTRIAGLTW
FT                   FFQCFCGSSLMGYSTVFYQQAGLPVSMSFTFSIIQYCLGIVGTVSSWFLSQKVGRRKIY
FT                   LTGLSTMSLLMLLVGGLGTSSSKSAKWGVGTLLLLFTFVYDLSVGPMCYCIVAEMPSSK
FT                   LRTKTVMLARNTYNVAHIVAGVVTPYMLSPTAWNWKAKTGFFWAGTAFVGSVWVFFELP
FT                   ETKNRTYAELDILFQDGVSSRKFNSTDVEVFDAGKLMEKYGATGIKQIIEHVDKTNYDI
FT                   LEQNR"
FT   gene            <37412..>39130
FT                   /gene="AGL1"
FT                   /locus_tag="PICST_62666"
FT   mRNA            <37412..>39130
FT                   /gene="AGL1"
FT                   /locus_tag="PICST_62666"
FT                   /product="alpha-glucosidase maltase"
FT   CDS_pept        37412..39130
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="AGL1"
FT                   /locus_tag="PICST_62666"
FT                   /product="alpha-glucosidase maltase"
FT                   /note="alpha-glucosidase maltase (MAL2) [EC:3.2.1.20]
FT                   [KO:K01187]; go_function alpha-amylase activity; go_process
FT                   carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62666"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67312"
FT                   /db_xref="GOA:A3LWN5"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWN5"
FT                   /protein_id="ABN67312.1"
FT                   /translation="MTITRNWWKTSTVYQIWPASYKDSNGDGIGDIKGIISTLDYLRDL
FT                   GVDVIWCSPMYDSPQDDMGYDVRDYEKVYPKYGTNDDMQLLIDECHSRGMKLILDLVIN
FT                   HTSSEHVWFKESRSSKTNPKRDWYIWKPPKYDEEGNRRPPNNWASYFSGSAWEYDERTD
FT                   EYYLRLFASSQPDLNWENEETRNAIYESAVKFWLDKGVDGFRIDTAGLYSKVQTFPDTP
FT                   IIFPEEEFQSSKLYSQNGPRIHEFHKEMYSKVTSKYDAMTVGEVGHCSREDALKYVSAK
FT                   EHEMNMMFLFNKVWVGCDRNDRWKFDGWKLTDFKKAVEIDCDFIAGTDAWSTVFIENHD
FT                   LPRCVTRFGDKKHRSQAAKLLSILGTTLTGTLFIYQGQEIAMENLPRDWSIDEYKDINT
FT                   INRYKEFKDKYGNDPDFKEKEEKLMDIINLLARDNSRSPVQWDASPNAGFTTGIPWTRV
FT                   NENYTTINVESQIRDPNSVLNFYKKSIQIRKSYQDLLIFGDMKILDYENQKTFTYLKLN
FT                   ENALSPKAYIVLNFSNEEVNFEKLINGDFELVLSNVDVINEQKLSPFEARLYIVD"
FT   gene            complement(<41455..>43002)
FT                   /gene="SUC1.2"
FT                   /locus_tag="PICST_62249"
FT   mRNA            complement(join(<41455..42683,42786..>43002))
FT                   /gene="SUC1.2"
FT                   /locus_tag="PICST_62249"
FT                   /product="Fungal transcriptional regulatory protein"
FT   CDS_pept        complement(join(<41455..42683,42786..>43002))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SUC1.2"
FT                   /locus_tag="PICST_62249"
FT                   /product="Fungal transcriptional regulatory protein"
FT                   /note="Fungal transcriptional regulatory protein (MAL33)
FT                   (MAL63); go_component nucleus; go_function transcription
FT                   factor activity; zinc ion binding; DNA binding; go_process
FT                   regulation of transcription, DNA-dependent; transcription"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62249"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67665"
FT                   /db_xref="GOA:A3LWN6"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWN6"
FT                   /protein_id="ABN67665.2"
FT                   /translation="ISPCDGCSVRKVKCSGSRPCTRCVKKGIPCTNNRIKKKSGPKSKK
FT                   NEDQTYFRTVHLDLFSETGTHTNKPPPELIPMSILLPYLQVYQTWYYSLWPVLSVTHLV
FT                   TKLTILEPGEVLDQEGSVSYALCLAVCAAISRKIAFISEDPNIIHLPTGVRGRDYVLAA
FT                   LRIRNEYEHLLHPTSETLLTSFFLYVYYFHNEGGINAAITYLREAISMAQIMNLQDPDT
FT                   YLNKSPTEVHRLRKIYYILLVTERYMCIEKGMPVILDSTIQFPMSQDEEYSNLLTGFTE
FT                   LIKIFSIPDRSFFEKMRMLHNTGSNYDNLRNFFHFPINNITEGWVIDVDNKIKGISIKN
FT                   SAADIQKANFLLSKHWMRSLVWHVAFQNGLVTYNREDADCLSVKYPVTIAYEFLASTSN
FT                   LPMYAFESNGPQVVVKLLEIANGMADTMNDLAFLKDGYDTFACSNALNSIFWFISRFKI
FT                   DVSLPMQLYHKIESIVNASPIPKM"
FT   gene            <45623..>48268
FT                   /gene="SUL4"
FT                   /locus_tag="PICST_32535"
FT   mRNA            join(<45623..45761,45798..47485,47552..>48268)
FT                   /gene="SUL4"
FT                   /locus_tag="PICST_32535"
FT                   /product="Putative sulfate transporter"
FT   CDS_pept        join(45623..45761,45798..47485,47552..48268)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SUL4"
FT                   /locus_tag="PICST_32535"
FT                   /product="Putative sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32535"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67313"
FT                   /db_xref="GOA:A3LWN7"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWN7"
FT                   /protein_id="ABN67313.2"
FT                   /translation="MTSPNPSIRHISSKRVNAVSFDRQSLLDRESPQQDYSGITNSLSP
FT                   RSFSSPPTKNIAPALHRHLVDTADVESVVYRSTPTVHHSSSLHYVNPPPPGSDSTSPSG
FT                   DYNEGYSDYMPATTRHLENLEWNDILPYYLPCMSWIKEYNFRYFVGDLIGGLTLVFFQL
FT                   PLSLSYATTLAKVPVLSGLLSLGVTPLIYAVFGSVPQMVVGPEGPISLIVGQAVEPLLH
FT                   HSNKKHLDPLEFVVAITFVSGASLLGFGLGRFGFLDNVLSASLLKGFISGVGIVMVINA
FT                   SIVVCGLEKLLQEIADDPNEMDIHSPFDKVRFFIHHYQETNPLTFKISMTGFVIIMALR
FT                   IFKKYADKRPDKRFRNAAYIPEILLVVSISTYLCSKLRWDLDGISIIGKIKNDGSVKLY
FT                   NPFSKKILPLYKTLSTSGFLCAMLGFFESTTASKSLGSTYDLPISSNRELVALGFINIV
FT                   ASSFGGLPSFGGYGRSKINAMSAKTTMSGAIMGICTLFTVFFLLDYLYFVPECMLSVIT
FT                   AVIGISLIEEAPYELYFHWQSGGYNELITFAVTVMTTLFFSMEGGIAVGLVYSLIRVIR
FT                   HSAESRIQILGRYPGSNTFLDADIPDASLLHLQLLNSQLNVFADGNFTHLNTHVLEEIE
FT                   GCLIIKIPEPLTFTNSSDLRTRLQRVEMYGSTKAHPASKRSRSPAMTKYIIFDLHGMTD
FT                   IDSSAAKILTELLTSYKRRNIHSFFVRVNKNARLRIRLRKTGIVQMLLDDLEDVKYFEA
FT                   QKRSVFSRMRGRRSFSEISAEYNEEEIANIPVDLDDTAEIYDLIESNEEPYFNHISDAL
FT                   KVIDFYEVNECTRTSEYLEVDQMERRSSLPEDILV"
FT   gene            <48690..>49883
FT                   /gene="HAT2"
FT                   /locus_tag="PICST_61538"
FT   mRNA            <48690..>49883
FT                   /gene="HAT2"
FT                   /locus_tag="PICST_61538"
FT                   /product="histone acetyltransferase subunit"
FT   CDS_pept        48690..49883
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="HAT2"
FT                   /locus_tag="PICST_61538"
FT                   /product="histone acetyltransferase subunit"
FT                   /EC_number="2.3.1.-"
FT                   /note="histone acetyltransferase type B subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61538"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67314"
FT                   /db_xref="GOA:A3LWN8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWN8"
FT                   /protein_id="ABN67314.1"
FT                   /translation="MDENVQRELTIKEEYQLWRKNCRYMYEFVSETALTWPSLTIQWLP
FT                   QHTEEDGVIQSKLLLGTHTSGEDTNYLKVASTELPSSQPTESAKKATSRIKISKKLTND
FT                   YEINRARYMPQDPDTVATINGEGNIDIYGLKSEEKNSLLHITPHDRNGYGLSWNSHRKG
FT                   YLLSSSDDKSIVLTDINREALTSNQIFKNNSHSDIVNDVKWHTLDENMFASVSDDKHAY
FT                   IFDLRTPNRPVSLFYNEVSDGINSVAFSPFSKYLLAVGNTNSNINVLDLRKFSNNVKSK
FT                   DGLLHTMMGHSDSITSLEFSPHRDGIIASGAQDRRLIVWDLFKIGEEQQQEDAEDGCPE
FT                   LFMMHAGHTGSVTDLSWCPYKDWTIGSVADDNIVHLWEVGKSLLEDGVGEIKETDLE"
FT   gene            complement(<51795..>52745)
FT                   /gene="AKR3"
FT                   /locus_tag="PICST_32538"
FT   mRNA            complement(<51795..>52745)
FT                   /gene="AKR3"
FT                   /locus_tag="PICST_32538"
FT                   /product="aldose reductase"
FT   CDS_pept        complement(51795..52745)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="AKR3"
FT                   /locus_tag="PICST_32538"
FT                   /product="aldose reductase"
FT                   /note="aldose reductase (PKR3)"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32538"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67666"
FT                   /db_xref="GOA:A3LWN9"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWN9"
FT                   /protein_id="ABN67666.1"
FT                   /translation="MTVELTPNFKTKSGTSITIGAGSGTAWKSVKRSDPDNQVNLDRIV
FT                   DKLSYSIKKGYNHLDTAEVYTTHPEVGRAIKKSGTPREDLWITTKYNPSSRVAEKKDHS
FT                   PVELVESALKELNTDYIDLLLIHHPFFKPEQTKYNYDLVSLWQDVIKVKKSGAVRYIGV
FT                   SNFTVDHLKTIIPVSETEGKEFLPVVNQIEFHPYLQNKEIVQFSQKNGILVEAYGPLTP
FT                   LFRIVDEKSNKEVADHPLAKLLPQLSEKYGKTQAQILLRYALEKNVLPITTSSKEERID
FT                   QALNIYDFDLSKQDVDLIDSEGSKFPYRAFFKTYF"
FT   gene            complement(<53227..>54198)
FT                   /gene="AKR5"
FT                   /locus_tag="PICST_48294"
FT   mRNA            complement(<53227..>54198)
FT                   /gene="AKR5"
FT                   /locus_tag="PICST_48294"
FT                   /product="Aldo/keto reductase"
FT   CDS_pept        complement(53227..54198)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="AKR5"
FT                   /locus_tag="PICST_48294"
FT                   /product="Aldo/keto reductase"
FT                   /note="Aldo/keto reductase (PKR2)"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48294"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67667"
FT                   /db_xref="GOA:A3LWP0"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWP0"
FT                   /protein_id="ABN67667.2"
FT                   /translation="MTKSASKPVELTHNFTTKSGKPITLGTGTGTKWQWLKKGRPEEEQ
FT                   NTLTTELVDSILLALENGYNHIDTAEVYTTHPEVAAAVKKSGIAREDLFITTKYTPGFR
FT                   TFPAISSGPTEFIDRALKELETDYVDLFLIHSPFFEEKVSRGQTLESAWAEVIDAKKAG
FT                   KVRHIGVSNFSKEHLERTFKVAGNPDFYPKVNQIEFHPYLQNQSPGIIKFAQENDILIE
FT                   AYGPLSTLFRIKQNGVDVEDHPLKELIPKLAEKYGKTDAQILLRYTLQKKILPITTSSK
FT                   LDRIRQSLEVYNFEISDEDVAEIDKTGSSYHFRQFFVEEYDH"
FT   gene            complement(54680..56361)
FT                   /gene="GDI1"
FT                   /locus_tag="PICST_90444"
FT   mRNA            complement(54680..56361)
FT                   /gene="GDI1"
FT                   /locus_tag="PICST_90444"
FT                   /product="Secretory pathway GDP dissociation inhibitor"
FT   CDS_pept        complement(54735..56099)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="GDI1"
FT                   /locus_tag="PICST_90444"
FT                   /product="Secretory pathway GDP dissociation inhibitor"
FT                   /note="Regulates vesicle traffic in secretory pathway by
FT                   regulating dissociation of GDP from Sec4/Ypt/rab family of
FT                   GTP-binding proteins; go_process regulation of GTPase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90444"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67668"
FT                   /db_xref="GOA:A3LWP1"
FT                   /db_xref="InterPro:IPR000806"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWP1"
FT                   /protein_id="ABN67668.2"
FT                   /translation="MDENYDVIVLGTGLTECILSGILSVEGKKVLHIDRQDFYGGESAS
FT                   LNLSQLYTKFRPSAQRPELKGRDRDWCVDLIPKFLMANGELTNILVHTDVTRYIDFKQI
FT                   AGSYVYRNGRIAKVPANEVEALRSNLMGLFEKRRMKRFLEFIQNYDEDTPSTHQGFNLD
FT                   TNTMNEIYTHFGLENGTKDFIGHAMALWHTDDYLNDVARPTYERIILYVQSVAKHGKSP
FT                   YLYPLYGLGELPQGFARLSAIYGGTFMLDTPIDEVLYDETDGVKKFAGVVTKEGTAKAP
FT                   IVIADPTYFPEKVKKTGARVIRAMCILEHPVPNTGDTDSVQIIIPQNQVGRKHDIYIAV
FT                   VSDVHCVVPKGYYLAIVSTIIETDAPHIELEPAFKLLGPRIDTLMGITEIYEPINDGTA
FT                   DGIYISKSYDSSSHFESTTDDVKDLYFRITGKPLVLKKRSTTEEESQDEATIGGL"
FT   gene            complement(<56712..>58139)
FT                   /locus_tag="PICST_62767"
FT   mRNA            complement(<56712..>58139)
FT                   /locus_tag="PICST_62767"
FT                   /product="X-Pro dipeptidase"
FT   CDS_pept        complement(56712..58139)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62767"
FT                   /product="X-Pro dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /note="go_function metalloexopeptidase activity; peptidase
FT                   activity; go_process proteolysis and peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62767"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67669"
FT                   /db_xref="GOA:A3LWP2"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWP2"
FT                   /protein_id="ABN67669.2"
FT                   /translation="MSGPPSLVGKKYPAKQHARTVYSHLVHKNEVSAKGSAFFVSGEDL
FT                   ELYLYCDQTKPVRQNRYFFYLTGCDIPGSHVLYNTVKDHLTLYLPDIDYEDVMWSGLPL
FT                   SLEAAAEKFDADEIKYASALHADLEEFHNDKVTIFTTDINKFNTKYEGFLQPGNKDFFY
FT                   ALDESRLIKDWYEIELMKHAAKITDNCHFAVMSATPIETNETHIHAEFLYHALRQGSKY
FT                   QSYDPICCAGETCSTLHWVKNDEEITPDKKSVLIDAGAEWSCYASDVTRCFPINGDWTK
FT                   EHLEIYNAVLKMQSVTKEMIKPGASWDVLHLTAHRIMIEEFLKLGIFKKEYTVDELFES
FT                   KVSARFFPHGLGHLLGMDTHDVGGYPNYSDPDPLLQYLRLRRDLQAGMVLTDEPGIYFS
FT                   PFLLEDTLKDPTKVKYINKDVLDKYWYIGGVRIEDDILVTEDGYENFTGITSDPEEISK
FT                   IVRAGLAKGKEGFHNVV"
FT   gene            <58544..>59482
FT                   /gene="RPN11"
FT                   /locus_tag="PICST_32542"
FT   mRNA            <58544..>59482
FT                   /gene="RPN11"
FT                   /locus_tag="PICST_32542"
FT                   /product="multicatalytic endopeptidase"
FT   CDS_pept        58544..59482
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RPN11"
FT                   /locus_tag="PICST_32542"
FT                   /product="multicatalytic endopeptidase"
FT                   /note="26S proteasome regulatory subunit RPN11"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32542"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67315"
FT                   /db_xref="GOA:A3LWP3"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR024969"
FT                   /db_xref="InterPro:IPR035299"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWP3"
FT                   /protein_id="ABN67315.2"
FT                   /translation="MERLQRLLGSGAGLGGAAPPQSDGPAIDNAETVYISSLALLKMLK
FT                   HGRAGVPMEVMGLMLGEYVDEFTIHVIDVFAMPQSGTGVSVEAVDDVFQSNMMDMLRQT
FT                   GRDQLVVGWYHSHPGFGCWLSSVDVNTQQSFEQLNKRAVAVVIDPIQSVKGKVVIDAFR
FT                   TIDTTTMMMGQEPRQTTSNVGHLNKPSIQALIHGLNRHYYSLNIDYHKTSYETNMLLNL
FT                   HKKNWQSGLKLVDYNHKEHENLENTEKMVKIAELYNQRVSEEKELSEEQLKTRYVGKQD
FT                   PKKHLSDTAEKLIEENVTTLLTSNINALAIQ"
FT   gene            <59777..>61246
FT                   /gene="USP39"
FT                   /locus_tag="PICST_61453"
FT   mRNA            <59777..>61246
FT                   /gene="USP39"
FT                   /locus_tag="PICST_61453"
FT                   /product="ubiquitin specific protease"
FT   CDS_pept        59777..61246
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="USP39"
FT                   /locus_tag="PICST_61453"
FT                   /product="ubiquitin specific protease"
FT                   /note="cysteine-type endopeptidase activity; go_function
FT                   cysteine-type endopeptidase activity; ubiquitin
FT                   thiolesterase activity; go_process ubiquitin-dependent
FT                   protein catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61453"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67316"
FT                   /db_xref="GOA:A3LWP4"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR033809"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWP4"
FT                   /protein_id="ABN67316.2"
FT                   /translation="MNGNDSTPLLKKQKVAAHEDSQSDAEFDFPEYMTSNVNHSAQQDT
FT                   LYLDTIHRPLLDFDFEKVCSVTLSNTNVYCCLVCGKYFSGRSRTSPSYTHSLENNHHVF
FT                   INLHNEKYYVLPENYEITSYSALKSLRDINNFLNPKYTKSDIENLPVTARDLDHKSYDV
FT                   GYVGLNNISANDYSNVVIQALSHIVPIRNWYLSLSHRQDLNARLESMSPLNYNFGILVR
FT                   KLWSKYLYRNHVSPHEFLQYLSSTTKNQFSITRQSTPKKLLVWLLNNLHLQLSKSIKKS
FT                   STVLSDNLRGRIKVTSMEVHTKEVNDKVEFETDENSAKESVSSFWVLTLDLISSPLFMD
FT                   VTKIQEVALTKLLQKYDGKQTSQVSSSELRTYKLIAPLPRYLIFHIDRGLEKDGSTRGN
FT                   PTVVQFSTTIDMAPYTEGADQSLNYKLLSTIKRQSTEGVKLDHSDDKNNWAISLRRTDD
FT                   SWVCIKDLEFNACEGGLLFLEENYLQIWERC"
FT   gene            complement(<61492..>62252)
FT                   /locus_tag="PICST_32544"
FT   mRNA            complement(join(<61492..61514,61556..>62252))
FT                   /locus_tag="PICST_32544"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(61492..61514,61556..62252))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32544"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32544"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67670"
FT                   /db_xref="InterPro:IPR021211"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWP5"
FT                   /protein_id="ABN67670.2"
FT                   /translation="MFDIPESVKKLFDTFPLTTYPAIPKTTSGNDEFIEEKKFYFENEK
FT                   QSQISTNASFSLGVHNVVEFKGQDGKRKYIPSDPVSLGQALILCHKNKLKLPTTSSTNR
FT                   SCNSIMKVSFHASPDKQLPILIEDDKQSRTIRTISSIIETVAKSNFQKHPYLDAELLVL
FT                   NDFIDLKLFDLWILCLLNENIDRFDEIFDIDSKLDLSFVAKSLVINNIYSEVEHWRAFR
FT                   TRNPNLFDYMELLLSTN"
FT   gene            complement(<62736..>63422)
FT                   /gene="SNA1"
FT                   /locus_tag="PICST_62543"
FT   mRNA            complement(<62736..>63422)
FT                   /gene="SNA1"
FT                   /locus_tag="PICST_62543"
FT                   /product="aries arylalkylamine N-acetyltransferase"
FT   CDS_pept        complement(62736..63422)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SNA1"
FT                   /locus_tag="PICST_62543"
FT                   /product="aries arylalkylamine N-acetyltransferase"
FT                   /EC_number="2.3.1.87"
FT                   /note="aries arylalkylamine N-acetyltransferase (SNAT);
FT                   go_function N-acetyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62543"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67671"
FT                   /db_xref="GOA:A3LWP6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWP6"
FT                   /protein_id="ABN67671.2"
FT                   /translation="MSDFPPNLSIRPLTIEDIDKCVVLENKGFSEFERCTPEKFKYRLR
FT                   VCPELCSGLFIRDYEYKYNAINLPEVADALSKENSSNDDSNTETNDDDLNELPAKSSVT
FT                   KETLVGHIIATKIHSSVITGSAMELPSAEDPTAGHFEGSRTVGIHSVVIDPEWQGKNLG
FT                   TLLLHDYIQKLSNQDLGDKVVIIAHKELIPFYEKIGFNNLGESDCKFGGDTWYDMAIDL
FT                   IAEDDI"
FT   gene            complement(<64304..>64522)
FT                   /locus_tag="PICST_23784"
FT   mRNA            complement(<64304..>64522)
FT                   /locus_tag="PICST_23784"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<64304..>64522)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_23784"
FT                   /product="predicted protein"
FT                   /note="go_component nucleus; small nucleolar
FT                   ribonucleoprotein complex"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_23784"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67672"
FT                   /db_xref="GOA:A3LWP7"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR033871"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWP7"
FT                   /protein_id="ABN67672.1"
FT                   /translation="TVLPLEIIDKSIGHEIRVLMTNDKEFTGKLVGFDDFVNMVLEDVR
FT                   EIDSDVKSDKVIKKMLLNGGQVAMIIPA"
FT   gene            complement(<64842..>67091)
FT                   /locus_tag="PICST_32546"
FT   mRNA            complement(<64842..>67091)
FT                   /locus_tag="PICST_32546"
FT                   /product="predicted protein"
FT   CDS_pept        complement(64842..67091)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32546"
FT                   /product="predicted protein"
FT                   /note="go_function two-component response regulator
FT                   activity; DNA binding; go_process two-component signal
FT                   transduction system (phosphorelay); regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32546"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67673"
FT                   /db_xref="GOA:A3LWP8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWP8"
FT                   /protein_id="ABN67673.2"
FT                   /translation="MNSYGSKIASSESSGPRVSSNTSTPSKKSSKVTTQSHHSTNAGLN
FT                   NQYSNASAHSNINSANSSQYSPSAGRRVWVKRPNGTPTTLKVHINDIVDDLKLMVMNKF
FT                   PNSLARVFDPADLALHLESGSKQPNSTSMGKRVLNLSMSPDNLKNSPTSMNTSHSKNTT
FT                   NTVTLEPDQNVFSILDLYFPNGMGMSDSFVIVAPQVSGTEFTTVIPQVSSELMGGNSIN
FT                   AYGIHSNNNSGGNSARGSFSTTNYYRNNSNTQLSAMYNTAMSNSNNNPQNQQIQVQQPS
FT                   PPIISTHSHLQEKVSTPVSSSSGHYHAPKPQYLYQATSFSTPGLPKDRSVSPATINSPV
FT                   HASHRRSHSNPPQSPVSASNGTNSQAVLLLPKNFSLAGGGSSSSNNLKKRYSVDEGMLS
FT                   RKGNSLKAIQTNNLTNIGVGITSPDNGSSSDAFSLRDKVGNNLKLKQEPIEELVEPRSN
FT                   GKHNVHNSDLPQREAFSMSPSPPGEVQRLNSPTRDTPNSSTQSETNNEVLKPKDAKDHE
FT                   KNTSTKSKAKNLKSSKSTTDKVLPSISVLVVEDNAINQAILGAFLRKHKIHYQIAKNGQ
FT                   EAIDKWRKGGFHLVLMDIQLPVKSGIEATKEIRHLEKINRIGVFAENELVTDFENPDQL
FT                   KEAEKLDLGIFRSPVIIVALTASSNSSVDKKNALMAGCNDYLTKPVNLVWLQNKITEWG
FT                   CMQALIDFDGWNSRVLTKSDSDKENNRPVKKNPVKKEKKLEKIMLTTKAKPVSLK"
FT   gene            complement(<67809..>68828)
FT                   /locus_tag="PICST_47663"
FT   mRNA            complement(<67809..>68828)
FT                   /locus_tag="PICST_47663"
FT                   /product="predicted protein"
FT   CDS_pept        complement(67809..68828)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_47663"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_47663"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67674"
FT                   /db_xref="InterPro:IPR005607"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWP9"
FT                   /protein_id="ABN67674.2"
FT                   /translation="MEFADPAVAEEEVTKDTSVQNAFSEEHDNKTEETVQKLESEINNM
FT                   YNALESKFSDLWSNASKNASDLQAKYKLDERKEQLLGQLNSARESLKNNNTLNVTENLA
FT                   SIEEQIKKVQLPAVKVDIKNLSEQANTALDVLDSKLEIVENQAGKYVSSFASFLSNMIS
FT                   VTPEAPVNEKETLFASSSGINTHENYGTSRYETDFYKLHTTESYYLTEELDDKAEAEKY
FT                   SADSKTKEISELLEQYPQTLTKLMNEIVPVKVSYNLFWYRYFKNEDKLKESEKKRKELL
FT                   EKKGSQASANDDDEEFTWDDDEEDEETVNLSKNLKESEDEATKPAKEDPKDEEDDDWE"
FT   gene            <69396..>71021
FT                   /locus_tag="PICST_49011"
FT   mRNA            <69396..>71021
FT                   /locus_tag="PICST_49011"
FT                   /product="predicted protein"
FT   CDS_pept        69396..71021
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49011"
FT                   /product="predicted protein"
FT                   /note="go_component membrane; go_function ATP binding;
FT                   go_process transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49011"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67317"
FT                   /db_xref="GOA:A3LWQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWQ0"
FT                   /protein_id="ABN67317.2"
FT                   /translation="MKPSRVSLNSNCLLRIKDAIFRIDNSSNSSLIFSKPVSHFEIYKP
FT                   NQANKPSFWSVSGPEKSRFLSIVAGRYIPSPPLSRSYPFLSETFEYSKIQFLDFRDSSG
FT                   LDKVHLSARYETYSYRGEVEMSDDVNSVRNYITGANNYNKDTSEITSDYVDKLINLFNL
FT                   DHLSHKWINSLSNGQMRRARIAKSLVSKPSLLIIDDPFLGLDPGATEMVSDSLNRVSQL
FT                   LGASVVLGLRVQDDIPNWINSIAYVDETGLKVSGPKEETLQQLHEETSQLDITHADHEK
FT                   RHTKHQNPVEISNEELFEGSTIPAHIEFNNASVSYRGLKILDNFKWKIPRRSKWRILGD
FT                   NGTGKTTLLSFITADHPQSWRSVLTIDGVVRKTGNGVTFFEVNNKIGLSSPELHALVPQ
FT                   HTRTMRDIILNGIVKDVGNSNFLFRGKEENLTNFARGILALFADRLEANGNKKFTDLSM
FT                   TDQKLTLFLRAIIKNPDLLILDEAFSTMDDEDVMIRCHDVIENHLPNTTVLAIGHIDWE
FT                   VPRCDYLLKLIGDEERNYKVYKYT"
FT   gene            71748..73849
FT                   /gene="LCB2"
FT                   /locus_tag="PICST_84331"
FT   mRNA            71748..73849
FT                   /gene="LCB2"
FT                   /locus_tag="PICST_84331"
FT                   /product="palmitoyl transferase"
FT                   /note="Has EST support"
FT   CDS_pept        72020..73720
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="LCB2"
FT                   /locus_tag="PICST_84331"
FT                   /product="palmitoyl transferase"
FT                   /EC_number="2.3.1.50"
FT                   /note="go_function transaminase activity; go_process
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_84331"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67318"
FT                   /db_xref="GOA:A3LWQ1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWQ1"
FT                   /protein_id="ABN67318.1"
FT                   /translation="MARKERVLTANIPNAAPDDRPQEVLDELEYGKLSTKRYLYVSKHP
FT                   VGEPLPTPIDDEPPYIIYLATYISYLILIIIGHIRDFFGKFFKPKEYADLIEKDGYAPW
FT                   YDGFESFYVRRLKIRIDDCFARPIHGAPGRYVKCFNRIRHGKTGYLYDGTSNECLNLSS
FT                   YNYLGFAQSNGVCTDYALGCVDDYGTSACSPRAISGTTDLHQKCERVIADFVGKEDAII
FT                   VSQGYGTNANLFSSIADSKTLVISDELNHASIRFGIRLSGASVKVFKHNDTKDLEKLIR
FT                   NQIAQGQPKTHRPWKKIIIAVEGLYSMEGNMCNLPEIVEIKDKYKCYLFVDEAHSIGAL
FT                   GPGGRGICDYFSVDPARVDLLMGTFTKSFGATGGYIAGDKYLIEKMRTNYITQVYSESV
FT                   PPAVMGQIISSLSVIEGTLNPGEGQERLQRIAFNSRYLRLGLKKLGFIVYGADDSPVIP
FT                   VLLFLPAKMPAVSRMLYDMKIAVVIVSYPATPLISGRARLCVSAALTKEDLDYVLQKFN
FT                   EVGDQIFLKFSSGIAGGSKVEGEPPRWAIEDVLATNVEDCKKPKLGYFN"
FT   gene            <74021..>74668
FT                   /locus_tag="PICST_61589"
FT   mRNA            <74021..>74668
FT                   /locus_tag="PICST_61589"
FT                   /product="predicted protein"
FT   CDS_pept        74021..74668
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61589"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61589"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67319"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWQ2"
FT                   /protein_id="ABN67319.1"
FT                   /translation="MSYDIPDPFVPPLRFNTVQKNLYRGAYPREINLTFLKTLQLKVII
FT                   SLTPNPITKETDPILYEFATANNIGLIHVECAQSGKGKKRGVPMGYTTVLQALNFMIHN
FT                   EFAPVYIHCLNGGQVTSLVIACLRKLQFWSSISIFNEFINFTANITVNDRSFVEGFKGE
FT                   LNINSEDKVDWLWVGMSKGVVGSHPRIRVNETTSSTTSSSPVQESKMQLMDC"
FT   gene            complement(<74694..>77384)
FT                   /locus_tag="PICST_62413"
FT   mRNA            complement(join(<74694..76293,76381..76942,77000..>77384))
FT                   /locus_tag="PICST_62413"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(74694..76293,76381..76942,77000..77384))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62413"
FT                   /product="predicted protein"
FT                   /note="go_function cysteine-type endopeptidase activity;
FT                   ubiquitin thiolesterase activity; go_process
FT                   ubiquitin-dependent protein catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62413"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67675"
FT                   /db_xref="GOA:A3LWQ3"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWQ3"
FT                   /protein_id="ABN67675.2"
FT                   /translation="MTEEPVSFRSIADLNSLSKSLLRDLITGSSGISKLIKHQVSLLEL
FT                   YSHESKKLERIGYCDYELAYVCYTLALSLYTNSEKLLSEKTVDFVRSIKQNLVIRKDSY
FT                   ETIRSFLDSNENETNVDPSNLGSYVSVGHVKANLKSSMDNFKYREVIFVEELHNIISST
FT                   SSSKVLLIDYRASKDFNYNHIKHSEIINIEPSHINAIFSQNKDVTDQDLEERLKLHLSQ
FT                   DQFHKFQNRYKYDLIVIYNLKYGTHMSHMDRFAYLKEVLLNEDSSALPTRNPFNNLVEL
FT                   IMFKNKYISSKLKRHPCYLAGGVFHWHSVYGDDSFYTGTSYGNSSSIARTSSPYLKNFG
FT                   EYLSTAKSTDDTPISNAFVPIIPSASMSKYNPSSAIKSSTSSSTITTTNVSPPIQQPPT
FT                   VKRTLSVTIPNNSSSSSTTTSITEKPTIASVAGITTNNTPSKFLDSYVTGLVNLGNSCY
FT                   MNCILQCLGATPPLTKFFFPGISNSLPSSSQVQSYRQHINVNNKLGSKGIMTTNFFGLL
FT                   ANMFNSNGKSYSPTNFKKVMGSLSPGGQFATFDQQDCLEFLTFLLDGLHEDLNQMVISN
FT                   PEEKKAISELTPEQEKTREILPVRLASTIEWERYLKLNFSIIVDYFQGQYLSQLKCLEC
FT                   GMTSTTYNAFSVLSLPIPEKLGYSTNQRVSLDDCLKEFTTTELLDDNNKWHCPRCKRFT
FT                   KSTKKITITRLPQILIIHFKRFKMTPNGYFNKLDTFVNFPVKDTLDLTSYWPDVGTSVN
FT                   SNLKDSEIMSKEKEEQILSTLPSRNQQKPFRYKLYGVANHFGNLTTGHYTSYIHKEGES
FT                   KKTRGWIYFDDAKLTYNCKESDVMNKNAYCLFYQRI"
FT   gene            complement(<77768..>79288)
FT                   /gene="EXG3"
FT                   /locus_tag="PICST_61452"
FT   mRNA            complement(<77768..>79288)
FT                   /gene="EXG3"
FT                   /locus_tag="PICST_61452"
FT                   /product="glucan 1,3-beta-glucosidase"
FT   CDS_pept        complement(77768..79288)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="EXG3"
FT                   /locus_tag="PICST_61452"
FT                   /product="glucan 1,3-beta-glucosidase"
FT                   /EC_number="3.2.1.58"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61452"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67676"
FT                   /db_xref="GOA:A3LWQ4"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWQ4"
FT                   /protein_id="ABN67676.2"
FT                   /translation="MFDKVKLRSKGSNPVAAVPAATPGQPPSTRQIYQSRKNFGVNIGA
FT                   CFVSEKWIFHELFGENVPEFELAAVEAMVRAKGLDGAKSTFENFWSNFMNDNDWRWLQD
FT                   NQVTSVRIPIGYWDVAGGRFTKGTQFEKYGSSVYSGAWNIFKEKFVKPAGKHNISVLVD
FT                   LHGLPGGANSSDHSGEKSGGSAAFWSNEKFQLQVAEMLTFIARDLQQFENISGIQVVNE
FT                   AEFAQEPASKQTTYYVAALNSIREADSGIPVIISDGWWTDQWVRFIQKHQQNNNSLGLI
FT                   IDHHVYRCFSKEDKDKSPMRIIEDLNNDVLTNLTDNGKGVDIMVGEFSCVLDQQSWNKD
FT                   GAQGRRDELVIQYGNRQCDLINERAGMGFYFWTYKFQSGNGGEWDLKQMVEKGAIRNPF
FT                   SVNGKRLPDRSMFEQAYNQAMQGHVGYWSGTDPGGRYEHERYGEGFTTAWADAEEFAKF
FT                   NGSVLGRVEAWRIARLSEHIRARGASGYLWEWEQGFYEGLKQFHSNVR"
FT   gene            <79942..>83475
FT                   /locus_tag="PICST_62134"
FT   mRNA            <79942..>83475
FT                   /locus_tag="PICST_62134"
FT                   /product="predicted protein"
FT   CDS_pept        79942..>83475
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62134"
FT                   /product="predicted protein"
FT                   /note="go_function nucleic acid binding; helicase activity;
FT                   ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62134"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67320"
FT                   /db_xref="GOA:A3LWQ5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWQ5"
FT                   /protein_id="ABN67320.2"
FT                   /translation="MPPKKANINTSKWPPSFQRLYRLFVQINTHLTFLSSHSRTTIPTF
FT                   ELLQKLNPDINTLDLTLMKGLLPDKHVAYKYVDENQLMLSMAEKVEYSRSHGYKQGNAS
FT                   SMDDAFEQVANNHGLSGSNQLLVFDFQDTRMHGIGGVVKGGRAKRRKVEQNDTNNDFFL
FT                   SSSDLAFSPLTQIQLTRMINSRSDNFKEILKAYLDGFSEEEVSQDIPMQKLVAKYEPLI
FT                   PQPPVLNDPVEQLEHSHKVVDRKSKPTLDEMLIVLKQEPFYKGQIEQVCTLTPAQKAMK
FT                   VPLGDFEGHIYNIHPELRDALYNYKGIDIYKDLYSHQADALKTLLQPNSFGRHVIVSTA
FT                   TASGKSLIYQIPVLNEILWDITNGKKSRSTTAFFIFPTKALAQDQKRHLEEFISYLPTN
FT                   EKRKIIVQTYDGDTASRDRNFVRSFADIVFTNPDTIHASVLPNHLGYSDSSGWIPFLRS
FT                   LKFIVVDELHVYKGTFGIQVSYVMTRLLRITEKLKNGVNDITFVSCSATISNPVAHFRA
FT                   VCAIPKCDQVVHVANDGSPCSERKLVVWNPPALMNKKGQIQSTLKSSMTIESTVSNTLI
FT                   PRVGIVAESARLLVHLLSNLSEIKVIVFCPIRVVCELLMNEVRHLLRSSDHTERALLNE
FT                   HDIMSYRGGYSKEDRRVIEQKMFTGQLRAIVATNALELGIDLSDLDIVITCGFPISKSH
FT                   MHQQFGRAGRARDSKGSLAIFVAGPTPIDQYYLSNYKDILDKNSYEDLCVDGLLDLGSY
FT                   HLTLEQHMQCAAFEDPLDIVEDLKWFAPDGSTGKANAFVKICQERLLKDNTGKYRTSPN
FT                   FLPWPSDLVTIRAIEESSFAVVDITNGRNIVIEEVESSRTNFTLYEGGIFLHQGFPYLV
FT                   REFNADQKFAKVERVNVDWTTSQRDFTDMDPMEAQYVKQLYPPNSAVPSDIPVFLGLVK
FT                   TTIKVFGFFKLNRRNEILEAVDVKNSPVIIINKGFWVDIGSEVIDIINKKQLSPAAGIH
FT                   AASHAIINILPVFINGTVDTSSKSYYSGVGEAELVTECKAPEKEFARRESNRKRPARLI
FT                   FNDSKGGELGSGMSAKAFEYFDEILQTTFDKVRNCECEWGCPLCIAPKFCKERSIVMSK
FT                   PAALLILASLLGYDLNEFQEQVQDGPEQNMPAITIETIESGPSTVKFSKDVEIISVRKA
FT                   RHPLNPKVEVKE"
FT   gene            complement(83590..85760)
FT                   /locus_tag="PICST_84899"
FT   mRNA            complement(83590..85760)
FT                   /locus_tag="PICST_84899"
FT                   /product="predicted protein"
FT   CDS_pept        complement(83645..85738)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_84899"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_84899"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67677"
FT                   /db_xref="GOA:A3LWQ6"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWQ6"
FT                   /protein_id="ABN67677.2"
FT                   /translation="MSDGKLFAKSNSVELRAELEQAMKKSKSHSRIKIVLRKVIANIIL
FT                   NNNELAAMMPDVIDLFKIDDLEIRKMCFQYLSNYAHVNPRDASEALPYLEQFLNDSSPI
FT                   VRALAIRTLASVANKDYIERTVGAVRTGLGDVDPYVRKTAAYAVSRLYQHDPTRTEKHN
FT                   LISELNELLYDKNQVVVSNALASLSYVTDHSRTLTLAIDKAHSMALITHLGNANEWCQI
FT                   YILNSLMSYVPQNSEEALDLIEATIPSLQHENSSVVLNAIKVIVYYSHYVKNPGLIFPT
FT                   LPKRLGTSLISLLSKPAEIQFLVLRNVILLLLGSKDLVSFEVEMFFCHNEDPIYIKDTK
FT                   LEIIYLLANEQNVHVVLRELEEYATEVDVSMARKAIRALGNLAVKLPNAADACVEVIQN
FT                   LFNEGISYIVQESAVVLKNIMRKYPNKFQQETLELVKFYKLIDEPDAKASMIWIIGQAC
FT                   QFIDSVETIFEVIISNFKDDPIEVQYATLTAATKLYLMLPEKGEKTVLNVLKWATEESD
FT                   NPDIRERGYIYWRLISSEYASGKSGNFQEVTKEIILNPNPIISPENDSIDPKILEELEL
FT                   NIGTLASIYLKPVSHVFRLAKVKSLPNSPVLQKRAQGPVTSDVTVATKNAQSTSGRKVS
FT                   VISSPVADTSFPARNLTPRSTSSKQTYDSTGSSNEDISSKDSFAKRLTRKATQLAARKG
FT                   SRD"
FT   gene            complement(<86124..>87161)
FT                   /locus_tag="PICST_36516"
FT   mRNA            complement(<86124..>87161)
FT                   /locus_tag="PICST_36516"
FT                   /product="predicted protein"
FT   CDS_pept        complement(86124..87161)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_36516"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36516"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67678"
FT                   /db_xref="GOA:A3LWQ7"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWQ7"
FT                   /protein_id="ABN67678.2"
FT                   /translation="MSYIRPATHAGSWYSNNPTKLGLQLEAYFHKAESHSGEDSRHIIP
FT                   GARILIGPHAGFAYSGERLAETFTVWDTSKVKRIFMLGPSHHVYFKNSVMVSQFEWYET
FT                   PFGNIPVDTETIEKLLHTKPQSHGHSLTHAKDSVFKYMSEEMDEDEHSFEMHAPFIYQK
FT                   THDLPQGIPKIIPILISGMDEKLNDEVVSALLPYLENEENHFIISSDFCHWGSRFGYTK
FT                   YVPQKVDSLQLLTENLSSLGHSLRTKPNELPIYKSIEVLDKAAMEIASSGSYSDWKTYI
FT                   SQTGNTICGQKPIAVVLKLIQKYRLAAGDTDKAAIFKWIGYSQSNQARRASDSSVSYAS
FT                   GYVTI"
FT   gene            complement(<88151..>88552)
FT                   /locus_tag="PICST_48488"
FT   mRNA            complement(<88151..>88552)
FT                   /locus_tag="PICST_48488"
FT                   /product="predicted protein"
FT   CDS_pept        complement(88151..88552)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_48488"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48488"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67679"
FT                   /db_xref="GOA:A3LWQ8"
FT                   /db_xref="InterPro:IPR000406"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR024792"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWQ8"
FT                   /protein_id="ABN67679.1"
FT                   /translation="MLPTHPDLEVIKFVTNVVGRDPIETPVSGAETIDVKIPESSKFVM
FT                   TIHFKVKNRALKNFKYKQVVKKAGITIRNQEFLIGDYEPSDEVYTKDFPEDTTPGGFLM
FT                   RGVYPSHSLYFDEVEQLLDVKWDLEITKK"
FT   gene            complement(<89131..>90264)
FT                   /locus_tag="PICST_62189"
FT   mRNA            complement(join(<89131..89954,90018..>90264))
FT                   /locus_tag="PICST_62189"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(89131..89954,90018..>90264))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62189"
FT                   /product="predicted protein"
FT                   /note="go_function protein kinase activity; ATP binding;
FT                   go_process protein amino acid phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62189"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67680"
FT                   /db_xref="GOA:A3LWQ9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008350"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWQ9"
FT                   /protein_id="ABN67680.2"
FT                   /translation="TTFCENGCYFSIDSRYELEKVLGKGSYGTVCSAIDTRKSHPDAEY
FT                   SRIAIKKVSNIFNKDILLKRAVRELKFMRHFKGHRNVNLDIVFTKPYDGLYCYQELADL
FT                   DLARVLYSNIQFSEFHIQSFIYQILTGLKYIHSADVIHRDLKPGNILVTTQGTLKICDF
FT                   GLARGVNPRYFKHRSSQITNYVATRWYRAPELMLSEKRYTKAVDLWAVGCILAELYGRK
FT                   PLFPGKNQMDQIHCIVRVLGTPLPAVINRNNWKFLLPPRPQYRVSEWSQLYPFASKDGQ
FT                   ELIESLLQWDPEKRLSVHQAISHRFIEPVRDSNSEALCEVFDFSFENRATTLGELRELL
FT                   EREVEMFKAERKSAEM"
FT   gene            complement(90693..93481)
FT                   /locus_tag="PICST_90468"
FT   mRNA            complement(90693..93481)
FT                   /locus_tag="PICST_90468"
FT                   /product="predicted protein"
FT   CDS_pept        complement(91853..93424)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_90468"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90468"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67681"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR008615"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWR0"
FT                   /protein_id="ABN67681.2"
FT                   /translation="MQLKELRESPDDIVTVLELSEINSLLTDKVLSNIRFDHLNICIEY
FT                   NDEFENNLRGFAEFIEQNPAKISSMGDIGYHIHFAPGKKWKDYKEYEIKEYNRFLDVLN
FT                   KVAGDKVVHCSVINKYDMDTVYITERNELAKLGQEIQGDIEYWKHLKVLDYGESSIRFL
FT                   PGVQLPDSLQVLNIGGGYALETLTGFKMPPKLKTLLAGQGAVHSIDNIVFPATLESLGL
FT                   EDNKIYLLNYVEFPATLKHLDISQNRIESLRGVNFPEDLISLNLGFNPIDSIKGVKFPE
FT                   TLRYLEVSNIPNESMTGVKFPDNLEVLNLQSSMTTTRGLKLPSNVKTLILTGNGVNSIN
FT                   PLKLPNSVEILYLNDNNIKTLNKVQFPTALKELYLGDNMITTLKNVTLPPTLEILDLQN
FT                   DPDAEEHEKYITTLKDVVFPPNLKVLKLGYHSIKIIESIDFPYSLTSLYLSYNDLKLIR
FT                   GVRFGNYLKLLDLSGNPELTNIDNLVLPESLAELRVPVELIPNLPAYIIDRANKKQLLI
FT                   KKGFSP"
FT   gene            complement(<94711..>96249)
FT                   /gene="MCH2.1"
FT                   /locus_tag="PICST_32560"
FT   mRNA            complement(<94711..>96249)
FT                   /gene="MCH2.1"
FT                   /locus_tag="PICST_32560"
FT                   /product="Monocarboxylate transporter"
FT   CDS_pept        complement(94711..96249)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MCH2.1"
FT                   /locus_tag="PICST_32560"
FT                   /product="Monocarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32560"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67682"
FT                   /db_xref="GOA:A3LWR1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWR1"
FT                   /protein_id="ABN67682.2"
FT                   /translation="MQRDSSSSHTEASDKSIGNPKEELEKIHDKIHTKLSTNGDSHLVE
FT                   EIRDTPGGDLTKITTTDIEKQSSPQPQDSELNVDGGYAWVICFACFLLNFSTWGMNSGF
FT                   AIYFANYLNNNTFAGATKMDYAYIGGIAFGVGLFCSPAINFIQGKIGTRPTIIVGNCLQ
FT                   FTGLMLASWSRKLWQLYLTQGLIQSFGLAFISIPATTVLPQYFKKKRILSGGLSSAGSG
FT                   VGGICFNLGMQHVVESKGVFWALRVQSIIGFGLTWIAISLIRSRSKAHKIQFTAFDSAV
FT                   VSSAAFWILSFFVITCMFGYVIVLYTLAQFTTSMGYSEYQGSIVSAMVQLGSCCGRPII
FT                   GLLADKFGGATVSVVAYTVVGTLCLAMWVPARNYATIVAFAIIQGALMGSIYGMIAGVV
FT                   ARTFGLRKMNVAFSMIWTIMGAAGLFSPVIGIKLTKGNGAILDPGSYINCSIFAGVSFL
FT                   ACAGSLLLLRGYIKARDHLQVDQHTDSDQGDYTGINVPFKSVITSCFKTSHEKT"
FT   gene            <97690..100346
FT                   /gene="MEF2"
FT                   /locus_tag="PICST_67982"
FT   mRNA            <97690..100346
FT                   /gene="MEF2"
FT                   /locus_tag="PICST_67982"
FT                   /product="mitochondrial elongation factor G-like protein"
FT   CDS_pept        97690..100227
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MEF2"
FT                   /locus_tag="PICST_67982"
FT                   /product="mitochondrial elongation factor G-like protein"
FT                   /note="go_function GTP binding; translation elongation
FT                   factor activity; go_process protein biosynthesis;
FT                   translational elongation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_67982"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67321"
FT                   /db_xref="GOA:A3LWR2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030851"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LWR2"
FT                   /protein_id="ABN67321.2"
FT                   /translation="MIIATSLRSQTFCTWRAWRAVHSTAVRLESKLNEVPIDRTRNIGI
FT                   IAHIDAGKTTTTERMLYYSGKTKRIGNVDEGDTVTDYLPSERQRGITIQSAAISIPWNN
FT                   HKINIIDTPGHADFTFEVTRSLRVLDGAVTILDGVAGVEAQTEKVWKQATSLNIPKIAY
FT                   VNKMDRPGAGFSRTVMEIIEKLQTRVVLCNVPYFENSKDNDPVFCGVADILHVKLLKWN
FT                   PEIDPHGKNITVIDIEAERDTYPEVYETVVKSRESMVETLGEFDEAIIDSFLESNEDYM
FT                   NIPINVLNEAIRKATLENYLTPVYCGSSFRNIGVQPLMDGVVKYLPSPLQISVPEITSS
FT                   ATKNVKIKHVKAKQAVKQDMEVTTKMNNRTGLVVNANPNLTLALAFKVMTHATRGVMTF
FT                   FRVYSGKLVSNSIITNTTTGKKLHVKKLFMMHGDEPEEVKHISSGNIGVITGHEDDIQT
FT                   GDTLVSHSHLKKGFSEMESNLKLLPIEIPPPLFNSAIEPQTAGDEAYMKECVRILTRED
FT                   PSLKVSVDEEMGQTIISGMGELHLDIVKERLVRDMKAKVTLRDVAVSYKETLLNPGSSY
FT                   KQTSESGSVSIEIEMDSFEGAAEESSFFEENGAMIIAEDNNIIIIEPSAISQNMLKALE
FT                   ERRWKSTYSLEDLQEIVIQGCLTALQMGGPIFGLSLHSTVIRVKSWDFPVADSSVASTV
FT                   LLDVSRSAVTSYIATNRDWFGILEPIMETRVYIDSDIMGEVSHDLTQRCQAVIKSIEDE
FT                   STQDVDALAWAKDEAEKTFLPPDYTMKAGKDAISYKNKKIIIAETPLREMIGYLSRLRS
FT                   ITQGRGTFDMTYIGMRRAIKSRFDAISKEFNFM"
FT   gene            <100574..>101458
FT                   /locus_tag="PICST_32562"
FT   mRNA            <100574..>101458
FT                   /locus_tag="PICST_32562"
FT                   /product="predicted protein"
FT   CDS_pept        100574..101458
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32562"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32562"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67322"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWR3"
FT                   /protein_id="ABN67322.2"
FT                   /translation="MSNLPDNSGVGSLALDRERVTCLLLINTQLMKKAINIYHNILCNQ
FT                   QTLQQMPQQTRQSAIDSYQNCTRRLHCNLTVLNYIHEKYHADPSQVSQQQNKASFPIIL
FT                   SAPQDTPELIQLYTKLQELYPEALQYLKMKLQQMRKSQFQNQPNQNQQPQQSRPSSFSQ
FT                   QQLPQRGQQMPQRQLSQQQINNLQQQQQQQQQQNPMMASNSPMLGNVNTINPQSTSGQP
FT                   DFLQQQQHYNNGFNGQNQKFGGNIPQQQGQPSAISPQQILQQMNNGPLGGSGNMNSNLA
FT                   AGNGNNNNMMDFF"
FT   gene            complement(<101707..>104892)
FT                   /gene="PUT3"
FT                   /locus_tag="PICST_32563"
FT   mRNA            complement(<101707..>104892)
FT                   /gene="PUT3"
FT                   /locus_tag="PICST_32563"
FT                   /product="transcription activator involved in proline
FT                   utilization potential fungal Zn(2)-Cys(6) binuclear cluster
FT                   domain"
FT   CDS_pept        complement(101707..104892)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PUT3"
FT                   /locus_tag="PICST_32563"
FT                   /product="transcription activator involved in proline
FT                   utilization potential fungal Zn(2)-Cys(6) binuclear cluster
FT                   domain"
FT                   /note="go_component nucleus; go_function transcription
FT                   factor activity; zinc ion binding; DNA binding; go_process
FT                   regulation of transcription, DNA-dependent; transcription"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32563"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67683"
FT                   /db_xref="GOA:A3LWR4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWR4"
FT                   /protein_id="ABN67683.2"
FT                   /translation="MTDCAAGDEHRPAVSLSASVKDEEVADSMIAGGVLELHPANSPAS
FT                   GQTTNITSTLTDISSNSPSSSSNASSHASSNLSNITSSHQSNKQKRTALACIRCRARHI
FT                   RCPGGDPCKKCQIAKTKCEYVEADKKIVVSMKYLSKLHDDIARLKKDNAVLRNNLKEEE
FT                   TKRIRANPVLSASTLQQQNNFTNNIKYSMPSVSQSVQQPQQPASTTGVTANSNFSSTEV
FT                   IQPSLDKHGRLIQSRTGEKVYVGSSSMTLFGLEIQNMVPSFVSSSLLPNNSTDTSPTAS
FT                   PNSVGGSTPQSNQSGEPGSFKRNKRETEILEKEGNAYRITLAKTNTRPGLSINFTLPSY
FT                   SYAMLLVDTFINYNDGCFYFFNEGLVKKFLMNLYSGKAAENKRILKRNITEAKGGPDED
FT                   ENAIKKDTDDDTILETIWFCKILLIFAIGEMYLGTESNSHIIKSKEKLESKKARNRTKE
FT                   RKEKDTLPGSGFFYEASELFTGLFASGAIDNITKDGGIEVMLLYAFYLQVADCTIASYF
FT                   YFGLALRSTLILGWHVDADKENLNRFELEHRRRIWWTVYMYERMLSSKAGLPLSFADDS
FT                   VSTELPVDFNIDLTDFRKDENDVRGYYIFPPADYINNCVTITQINAIILSSLYTKQPTV
FT                   NILPVVSDLVHKLMTWKNLLPDFLKIDFSEENLRITRLIVNLMTEYFQGLNLAVRPLLF
FT                   HFATKKLKELQAKNTVNKYVDLSKYSKNVLFLLNASFQASINTIKSIWALLPENMVALF
FT                   GWMDREYLFTSASTLILFNASFGVHEATKEHLDHALIIFTKMKKLGNYPAALRRAQLLK
FT                   LIKVLDFNGVMKDLLLKHDDDLKEINISNTNLSSEEIQNHIVEVNQISNSKINSDHLNV
FT                   LDTELSESIAVAAVAPDKQAPPSEPYLEFPDRQTPIHPYIHTTSYPLGTMSGDTFSYTI
FT                   PTPMNGNNTGGDVYTNSDLAGIEGLTYLDEEQKLWNEITNDAGWLNVAGGNPNQQHGSS
FT                   GDLFLRNHAVESHSATESSTPHNTAGHIPTNYGPGSDSRGDIYGHPSFGTSMASGGYSD
FT                   IINSEFHDIMDQS"
FT   gene            <105795..>107873
FT                   /locus_tag="PICST_32564"
FT   mRNA            <105795..>107873
FT                   /locus_tag="PICST_32564"
FT                   /product="predicted protein"
FT   CDS_pept        105795..107873
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32564"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32564"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67323"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWR5"
FT                   /protein_id="ABN67323.2"
FT                   /translation="MESDIIDYTSPSISDLPPEIISYIFSYLSPDLVYEKFIELCPWTN
FT                   HSIQNIAYASIFTRKLIVRSVPLRKTGYDASRVFYSPADLQTAFVIIGFQRAYNVLRNL
FT                   IHYNLMNNTSIFPREMGFLFRFKNEAGNVSEMPSQWLHSEVDYFAKLIEILSLDNYYKD
FT                   AIPRVCFQLSYNITLSPALIAKSNKIMQRIESLENKTVKVLIQSSYTSKNSVQNIRLLH
FT                   TNSLDSLEELYLWRYNISNYHVKNYLRRSSETLRVLDLTANEITSLQGLTLPPNLEKLL
FT                   LSANNITSLDGPNYDEATKLKILDASINAIHDLDYNLVLPSSLTSLKITYNSIPQIHQA
FT                   QIPQNLNILGLSKNSLTHLEDIILPPSLCELHLNGNSIKTLPENLFISTPNLTILDLSE
FT                   NQIDDLDDLGELPDSLSELMLDNNEIDHSDLHNILTTNLTKLSLRSTGLITFSHVQLPK
FT                   GLKELDISKNEIGEIELVNFGDELTKLNLSNNILSTFNLDTSVHLPRTIRKLDLSRNKF
FT                   MRGLDSIGIPSHLTSLHLNDIGLGLLTNDTISKLPVSLETLFLDNTCWTPKVNSSGTIT
FT                   KYKSIELSLDFRSILPNLTTLSLERNCIGSIDDITYPCGLQWLSYQHNDLGHINFQNIP
FT                   TNIKCLQLNNNKIHEEILWESIRNVPYFPEIEYFGICGDQTELMRSGIYFGGMEPTS"
FT   gene            complement(107879..109172)
FT                   /locus_tag="PICST_79035"
FT   mRNA            complement(107879..109172)
FT                   /locus_tag="PICST_79035"
FT                   /product="predicted protein"
FT   CDS_pept        complement(108104..108850)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_79035"
FT                   /product="predicted protein"
FT                   /note="go_component extracellular region"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_79035"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67684"
FT                   /db_xref="GOA:A3LWR6"
FT                   /db_xref="InterPro:IPR001283"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR018244"
FT                   /db_xref="InterPro:IPR034120"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWR6"
FT                   /protein_id="ABN67684.2"
FT                   /translation="MRFFTFALFSLLSVVFADIVYVTQTHIVTVLDGVTTIFINGQTPA
FT                   ATTSSVSTKAQARVIVTTVVDGNDATTAPAPAPAPTTSATAAAAPAPAPSPASSAAPAN
FT                   DFGSADKDFAQSILDAHNQKRADHGVSALTWSDDLYQYAQNYANGYSCSGSLVHSGGKY
FT                   GENLAVGYSSGVTAFDAWYVEGDDYNYNAATQWDHFTQVVWKGTTQLGCAYKDCSAENW
FT                   GKYVICSYNPPGNVIGQIKENVLPLV"
FT   gene            complement(<110683..>112974)
FT                   /locus_tag="PICST_61353"
FT   mRNA            complement(join(<110683..110978,110997..111996,
FT                   112066..112644,112699..>112974))
FT                   /locus_tag="PICST_61353"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(110683..110978,110997..111996,
FT                   112066..112644,112699..112974))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61353"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61353"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67685"
FT                   /db_xref="GOA:A3LWR7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004483"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWR7"
FT                   /protein_id="ABN67685.2"
FT                   /translation="MSENSRQAQLVESFKNAINIEQKSDVLVTNSYLTSYPPKQLARLG
FT                   LAVVNLIVNNVRTGLGGKTIIELGVDPALKKDSSDEIQVGTLRVGDIKALANSSKKKEN
FT                   VKTDLTDESLDAVVIKMNQTSIAVSVEEDSTDEKVLNLYNNSSNDNTRMWLVKLSNSIT
FT                   YKRLISTMNKLGEMGDSEKNYITRLLLGESVYSPLVKVTKMADDLFFNNQLNQSQKDAI
FT                   SFAVNDSPITIIHGPPGTGKTYTLIELIKQLVFNHGEKVLVCGPSNISVDTILERLSPV
FT                   FRGGLIRIGHPARLLAGNLQHSLDILSKTNYGGGESSGNKEILRDIEKDIGETLGKIKK
FT                   SKRYAERRALWADLKVLKKELRVREKKIVSDLLLHADVILSTLHGAGAYELTSLYKEES
FT                   QNFGADNPFFDTIIIDEVSQSLEPQCWIPLVNHLGFKRLVIAGDNMQLPPTVKSKDEIE
FT                   SLISSMSLEQSKVANLEHTLFDRLVQDHNGDAFKKLLDTQYRMNENIMKFPSRELYEEK
FT                   LRAHESVRDISLLDLKGVADSDETRAMCIWYDTQGGDFPEKSSDEDAKSLADSTGSKFN
FT                   EMEALVVTQHIKKLLESGVAPEHIGVISPYNAQVSVLKKIIQKGGSRIEISTVDGFQGR
FT                   EKEVIIISLVRSNDNREIGFLKDKRRLNVAMTRPKRQLCVIGDLELMSTCGVKFLHNWC
FT                   QFVEGSGDQTEFEIIYPDLGDF"
FT   gene            complement(<113543..>113845)
FT                   /locus_tag="PICST_48525"
FT   mRNA            complement(<113543..>113845)
FT                   /locus_tag="PICST_48525"
FT                   /product="predicted protein"
FT   CDS_pept        complement(113543..>113845)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_48525"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48525"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67686"
FT                   /db_xref="InterPro:IPR013726"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWR8"
FT                   /protein_id="ABN67686.1"
FT                   /translation="IGKLAHYSFDLVLISIILAGIHRNTGLVFDTSSFSSVDFRRWFGN
FT                   YLAFGEKCYDSTVSFLKMTGYFKQRNLVYDYVQREAGKVLKEQTGRDINDLQKNQ"
FT   gene            complement(<114081..>119129)
FT                   /locus_tag="PICST_32567"
FT   mRNA            complement(<114081..>119129)
FT                   /locus_tag="PICST_32567"
FT                   /product="predicted protein"
FT   CDS_pept        complement(114081..119129)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32567"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32567"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67687"
FT                   /db_xref="InterPro:IPR021714"
FT                   /db_xref="InterPro:IPR032436"
FT                   /db_xref="InterPro:IPR039844"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWR9"
FT                   /protein_id="ABN67687.2"
FT                   /translation="MKDSSRKIYPSGGTANVDTSFLEKISTILEKNDIPQLLSLIETSS
FT                   LTKLLSNWSYFASINNHNQFIDLSVKLSKITSLFLQQSFSLVRPQIIEFYKDILNNHLK
FT                   VIYRALNNSKPSLTNPNLRILTNIVQYDGSCAHEFLNTFDLTLNVLPNLLVPTKTELEN
FT                   KSTKEHLSIRYNFIRFWLTLASSVPHYHRNDLFANHHKIVNNLWKFLYIDSVATTKYVV
FT                   EFLDSKILQEVNFKRASKCKILNENFMYKIQSVFAKLEQEKWYLDFVYRLATDSKLGLV
FT                   YPHDSLFTSSTTGVPVHINNKTFKINNKLLYTLLTTLKPSESHAELAFVTKILEVNPEL
FT                   VAPYMNWMVQHGGGYLDPSLTSWWMAHTLLYSNILQLSINPTLFDNQHSSKVNVRLIQE
FT                   NVSLAPISKSSLVKCLESSNNPLIIQFALQLIMFTVQKLESFIEIMESNNQELLDLVFF
FT                   NLPDLPTIIQVYNKFETGDSKLIKLTSSIIIQKYESLYPRQVNSGSSKLASAGISSIIN
FT                   QDISKCSGYDITLLHTYLSIQANQQQEQELKWWNKTNGSNSLFTSLVRLSSDGSIGDSK
FT                   AKIYDLLEKLTQDKSLFNKELIVSPLYALINSFSSDIQVDDKVWNLLDEVVSRTVRTPY
FT                   KYLDLSHSKYGDCSLFIVAVFEQFKFILMQADISLSTNWLFNFLQLMIVIGQSKKSILQ
FT                   LLQDFLLEDEAFAMFVEENDLMSLLEFRNFKQTSEDSFFNFTVGTPSKDLMSKLNSFEK
FT                   RLPTSDLDFAALLTRVRLTIEETSGNYENLLIEIISKVGNYLLSTKSKHLLDYISSGHF
FT                   WNPLLMNSVAENLSDTKFLFGGLFSEVLEQISDTVSLQLHELQKYLFDLFCNQESISVR
FT                   NQIYISRFAWILSDAQLLQIVEGETSEIPVSNEHLVSVLAQECLNRKLRIAVGLFKRLC
FT                   QCSLSSKTILIPQIVESGLVHFDDKELVNMLDDIIASKSDHYLLKSFSTSTGWQSQLVI
FT                   QYLIEHSDVKNDYLQCFIAYSLTMSDWHPDDDQYQEFFKKVTPRALSVLQNGNFEQYIQ
FT                   WRELLCIFARGVDYIDPDAKNVLVDTIFKYVEANGYKNSFIAEFASLVFALAKSTVDIN
FT                   KQIGDWVHKSMLYITKKFAESSQLSFNFNNFLKEMQKVIIRLPDLSLSVWKLAPIAIMN
FT                   TQLEVLFRHSQWIKEDSYVEYANIVIMTASKNIIDYEKLLQIFINNESSCLTGLPTAEN
FT                   ARVRYLSALVLHNLFFFDSATNSTLVLLEKVMLLYLGSIQAADLLLKDILVKIESHISK
FT                   SWMVKVANWDFVEEMTSNDIELVGEERLILKDKSDFVVSLNKNYVKNTILYRRDFATIP
FT                   NTGNISAAAKWDKYVEFYNKVDVNVEGSFQSTVYDPEFLMMLIINNDELVSFQKTEETA
FT                   DVALVGAKLNIKRLIDSSLLQFIVVQLGNPQVRNISQILLAGVLKSLEQTENFKDKNIF
FT                   KVYVANILNTVRKQESRLPSLNWYIYSSFVPILVNPGHILYEKVFRYVLSNPSLKRSDI
FT                   PLYISIVTSKADDSDAENDESYYKQITWLLEKLIEGTGTKEDLDLIKFRSVVEWIMNLT
FT                   NSPYITMKIKSMILKFLFVVQGIDQGSDMLITRFGILTNLEQLMANNVSAANELLEFQL
FT                   KLNIDQLVVRFGISVGSSKRIKEWTGDDLPAYVKRVCSEPVISK"
FT   gene            <121896..>123662
FT                   /locus_tag="PICST_16565"
FT   mRNA            join(<121896..122874,122908..123417,123508..>123662)
FT                   /locus_tag="PICST_16565"
FT                   /product="predicted protein"
FT   CDS_pept        join(<121896..122874,122908..123417,123508..>123662)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_16565"
FT                   /product="predicted protein"
FT                   /note="go_function protein kinase activity; ATP binding;
FT                   go_process protein amino acid phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_16565"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67324"
FT                   /db_xref="GOA:A3LWS0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWS0"
FT                   /protein_id="ABN67324.2"
FT                   /translation="YPDLPSHYRLISVLGEGAFSTVYKAVDTKQNDLTVAIKVINKANL
FT                   SAKQYHNIKNEILIMKRASAQPHPNIIKLLHSVNTHDHCFLVLEYCNGGEIFNKIIEYT
FT                   YFSEPLSRHVFKQLVSAIDHLHKNDIVHRDIKPENLLFLKIPYFARSTEEFKSVLRKSD
FT                   DGSKVDEGEFQPSVGGGTIGIIKLADFGLAKQLMPRVNSSTNLKTPCGTAGYTAPEVIT
FT                   CNSSDGGKKKLFFNNASKKNYYSKSVDIWSLGCLLYTILCGFPPFYDDDSNQLTTKIIN
FT                   GDFVFLKPWWDEISNEAKDLITRMLNTDPEERITVEEIWQHPWVRVEEEDVPQHYFEAV
FT                   EQKYEVMHIENNESDKSDPDHLTFKLPNQPLQSPRAQAIRKVFDNHAIMESLEQDEEDS
FT                   KNIQYFAYDEEDEEEEPEFIENVLSKGEKHKVYPKSPNPISLNFKDVFSIKKSAFSHGL
FT                   EYSDDEDDDADDDNDEDSELEDQVTSLNPTEFSGLKRKKDEFSSANSSSENDLDYQTRS
FT                   SSIISGINGEFKFTLSLNDSNLITRRRSSTI"
FT   gene            complement(<124121..>124525)
FT                   /locus_tag="PICST_48859"
FT   mRNA            complement(<124121..>124525)
FT                   /locus_tag="PICST_48859"
FT                   /product="predicted protein"
FT   CDS_pept        complement(124121..>124525)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_48859"
FT                   /product="predicted protein"
FT                   /note="go_function electron transporter activity;
FT                   go_process electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48859"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67688"
FT                   /db_xref="GOA:A3LWS1"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWS1"
FT                   /protein_id="ABN67688.1"
FT                   /translation="QSRFISTEIKDAIDKAVASSPVVLFMKGTPEFPQCGFSRATIQML
FT                   GQQGVDPEKFAAYNVLEDPELRDGIKEYSSWPTIPQLYVNKEFVGGCDIVMSMAQSGEL
FT                   AELLEANDALVPEDVEEEPQAANVKPSERS"
FT   gene            <125572..>125886
FT                   /locus_tag="PICST_48210"
FT   mRNA            <125572..>125886
FT                   /locus_tag="PICST_48210"
FT                   /product="predicted protein"
FT   CDS_pept        <125572..125886
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_48210"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48210"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67325"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWS2"
FT                   /protein_id="ABN67325.1"
FT                   /translation="PVYAVACATNTTLQMTLQDTILRDSNNRIGSIVSGHQFQFDGPVP
FT                   QHGAIYAAGWYITEHAQLALGNSTEFYQCASGDFYNLYHEPIGLQCNPVVLDVVELIEC
FT                   "
FT   gene            complement(<125939..>129805)
FT                   /gene="CDR6"
FT                   /locus_tag="PICST_32571"
FT   mRNA            complement(join(<125939..127723,127829..>129805))
FT                   /gene="CDR6"
FT                   /locus_tag="PICST_32571"
FT                   /product="ABC transporter family protein"
FT                   /note="Has EST support"
FT   CDS_pept        complement(join(125939..127723,127829..129805))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="CDR6"
FT                   /locus_tag="PICST_32571"
FT                   /product="ABC transporter family protein"
FT                   /note="Pleiotropic drug resistance proteins (PDR1-15), ABC
FT                   superfamily; go_component membrane; go_function ATP
FT                   binding; go_process transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32571"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67689"
FT                   /db_xref="GOA:A3LWS3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWS3"
FT                   /protein_id="ABN67689.2"
FT                   /translation="MNAEVLAIEPHHRVSISVRNLVVSVKEKKKKTRQNSNEKELESSA
FT                   ANPKILDNVSFDIQAGEMMAIVGGSGSGKTTLLNTLSTRLNVENHSLDFSGYVEFSTPN
FT                   GDKRIKNSYLQQSDVFLPGLTAFETLRFQADLRLPPSVSQNEKIALIESLLDTLEISHL
FT                   RNTRVVSFTQRINLSGGEQRRLSLAVQLLNKPSVLFLDEPTTGLDASNALKLVQVLKKL
FT                   SSPEFGVTVVMSIHQPRLEITKLFDKICLITSGGRMVYYGDLAESASYFNRISFLSKNT
FT                   ISSHKSSNFIDYIMDIAVKDSTTKANEELTSKRIDRLVEYWNEYSPFNSTDIFDGDGSL
FT                   KDLMKVFERPKQDRISFFKEVYILTRRTFLLTYRDKLSLLALDGGSLVTAVTLGWMFYR
FT                   PVHDLSGIRSLISSLYIMMEIIGFAPVFIELERLWGPDGRNFFREYKENYSSIPGFVIS
FT                   RRLGKVLLEDFPLAAIFAIITYFMWGLREGVGHFFVYFALTVLTSFIGMSTGMAFFAIG
FT                   SDFAISSMYLNVFYQLQNNASGYFVNAATMPVYVKWTKYIAYFWYTFGALNANQLTDWE
FT                   GVCTSNDQAECVEYSGNYQLSVLGYPRHWVAEPIGILIAWLAGFYVITIIGLYFKNYEM
FT                   EMSKTRTNTIGEEETEEDEEEDDENISIFLDQIKLNVITSKWIHKVKVSKTILNEVTSE
FT                   FRASSINAIMGPSGSGKTSLLNFLSNRLSHSSKFEYGGEISLNGGDKIARKELASISAY
FT                   VTQHDNSLIGTLTVRETLYFQAQFRLPHEEHPRIPAIINKLIRVTGLIDCADTVIGSDM
FT                   VKGISGGEKRRVSIAIQLLSRPKILFLDEPTSGLDSATALSILSLLKELSELSKTTVIL
FT                   TIHQPNEDMIAKFDNVLLMAGGGRVVYTGGSEGIDEYFRSINYPIPDGVNKGNYLLDLV
FT                   SRGLDEESSESENRIATLVSAWANTEGSRQVLSKDLKRSSLDLTQYHRKKLPFSTTLMA
FT                   LIRRSLLNSIRSPDILFARVFQVILLAIIQTLYFAPLRNNRDGISNRLGLVQEVLNLYF
FT                   VGLVNNISVYPIERNIFYQEYKDGIYGVCEFSASYLLNELPTEILPVVFFAVLIVFAIG
FT                   LPRNAAMFFTMFVASFIPLNIGESLGIIVNSIFNHLGLATNLLAITISFAIFMGGTMSL
FT                   QMPILFRAVNWINPLKFAVGITAKLGFKDQTFDCGLETCTLDTGDAVLYYYGLDHNLGV
FT                   FFGALVACLVVYRAIAILALYTRVKYFN"
FT   gene            complement(<130408..>131724)
FT                   /locus_tag="PICST_61648"
FT   mRNA            complement(<130408..>131724)
FT                   /locus_tag="PICST_61648"
FT                   /product="predicted protein"
FT   CDS_pept        complement(130408..>131724)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61648"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61648"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67690"
FT                   /db_xref="GOA:A3LWS4"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWS4"
FT                   /protein_id="ABN67690.2"
FT                   /translation="YQFFVRLTTSVLNHRTLLAYFKKITLNSSLILVWVFLTALLNYIP
FT                   RPSHICSRGLLWLERYLFDIHTHQSIGAVTFLLCIASASWLLARHYRITPVYEPEYTSK
FT                   RTFLHPEPIYPIAPILPISSCTSSGNTLNSPTSSFQLSRTTSPILEPHDFSSSTSDLTI
FT                   AELDDAFVIESHFSEKGSCRPVNCWNLAPPVLLAMSWFIINILHSFSISLSKVLNIVAW
FT                   VFYVVLHFTIPPFIGAWLYFFHPPGALKLYALSIGAQNILVVLTHFVIPTAPPLFIKLY
FT                   GEHKVPSFEMTYTDGITRQDMKFGSSMYRYVYYAIPNKFASCPSIHACTSSLVFFFVCY
FT                   YSRTSIFKLMAMVYLFGQWWAALYLDHHWRFDIFAGLIYSIFVWTVIKTWKNGLNRIDS
FT                   RFVSARSNADLINGTTMGMRIFKHTRIQNLFDPLASISK"
FT   gene            complement(<134098..134794)
FT                   /gene="ATP7"
FT                   /locus_tag="PICST_79036"
FT   mRNA            complement(<134098..134794)
FT                   /gene="ATP7"
FT                   /locus_tag="PICST_79036"
FT                   /product="ATP synthase d subunit"
FT                   /note="Has EST support"
FT   CDS_pept        complement(134267..134794)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ATP7"
FT                   /locus_tag="PICST_79036"
FT                   /product="ATP synthase d subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_79036"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67691"
FT                   /db_xref="GOA:A3LWS5"
FT                   /db_xref="InterPro:IPR008689"
FT                   /db_xref="InterPro:IPR036228"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWS5"
FT                   /protein_id="ABN67691.1"
FT                   /translation="MSSVAKTAATKLNWTKVISSLGLTGSTAASLTAFKKRHDEAKKDQ
FT                   LTLAQQPTTVDFAYYRSVLKNTKVIDEIEKAVNAYKPVTIDVSKNLKNIEIFEQKAIEN
FT                   AKLTEKSVLEEIAQLQTTLKDIEGARPFDQLTVDDVAKARPDLDEKVKYMVKNGKWDVP
FT                   GYKEKFGDLTVM"
FT   gene            <135370..>138315
FT                   /locus_tag="PICST_32574"
FT   mRNA            <135370..>138315
FT                   /locus_tag="PICST_32574"
FT                   /product="predicted protein"
FT   CDS_pept        135370..138315
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32574"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32574"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67326"
FT                   /db_xref="GOA:A3LWS6"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017104"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWS6"
FT                   /protein_id="ABN67326.2"
FT                   /translation="MKGLNQFIVDIRNSKDIEEEKKRINLELNNIQSKFNSNINSYQKK
FT                   KYVCKLIYIYLSGYADSVDFGLKESFQLVCSSSHSEKQLGYLALSVLINNDKSTQSTRD
FT                   FLDSLLDQVHSYLIKDLQSSNEDTNCLAVQFIASNFNLPESTTVRVNEADESAPKWLEL
FT                   IDIVYSFVTSPIHKSVIKKKAAIALYSLLKLYPQVLISNNNWIPRLLSLADDKDYGVSI
FT                   ASIPLIQFVVKSKPQFVKAIIPAISLKLYNIIIENKCPEEYYYYKSPAPWLVVKLLQLI
FT                   EYFFFLSDTNDYAVLSIADLDEQTLNNLRSVVAQSIQNASQPIKGLPNRNSQSSTLFQA
FT                   VSLAVFLDASSDAINGAINALMMLLTSNETNTRYLALDALIKLTARSTSNNLSASPSID
FT                   EKYTKIFKLLYDRDISVRRKSLDLLYTITNASSYSMVITKLLDYFPLCDFTLKPELAIK
FT                   IAVLAEKFATDSTWYVTTMLKLLSISGGVNSNGTNYIGNEVWERIVQIIVNNEDLQKKT
FT                   SKLIINLLKKPFSSTDNTPIALSENLIKVAAFVLGEYGDQVTYMSELSTKLQFHLLYDA
FT                   YFKVSLTTRAMLLTTFLKFFVKYPDEDFIPEIMDLFEIEELSLDLEIQTRAHEYLTLAT
FT                   HKYSQQLFKEVLKPMPIFVKKESHLMDRIGSVSHIVGVNRSKSLVLAKNISSNKSKAAR
FT                   GIDSSPILDENSDGSNPFEEESKPVVLSPNWYSGYHRMLHYDAGIFYEDQLIKITYRVI
FT                   KEGCALTLKLTIINNSAKTAGTDITGLTVLNLESLTDDHDPNYVLNLKQLPESTFHDKA
FT                   NMEISVKIRNVVENHESPILSITFMCGGSFNTLNLKFPVLLLKTLTSTALNGLDEFNRR
FT                   WAQIGELLGPQGESSQAVNLTHRYNSSNIVRLLSRLGFAVVHATSDETDNTILVMGAGI
FT                   LHTQKTNYGVLATLKSTDQVGKEFEVAIRCSGGGVAEVVAITMKEILEGKF"
FT   gene            <139910..>140335
FT                   /locus_tag="PICST_47641"
FT   mRNA            <139910..>140335
FT                   /locus_tag="PICST_47641"
FT                   /product="predicted protein"
FT   CDS_pept        <139910..140335
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_47641"
FT                   /product="the plant PR-1 class of pathogen related
FT                   protein-like protein"
FT                   /note="go_component extracellular region"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_47641"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67327"
FT                   /db_xref="GOA:A3LWS7"
FT                   /db_xref="InterPro:IPR001283"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR018244"
FT                   /db_xref="InterPro:IPR034120"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWS7"
FT                   /protein_id="ABN67327.1"
FT                   /translation="VDQTFAKQILDRHNEYRKIHQVAPLSWEVSAYNYAKNNADNYDCS
FT                   GVLTHTHGPFGENLAAGFSDGPSAVDAWYVEGETYSYSNANTYDHFTQVVWKDSTKVGC
FT                   AYKDCRAENWGLYIICSYDPAGNVIGENKDNVFPATS"
FT   gene            <140595..>141896
FT                   /gene="RIB6"
FT                   /locus_tag="PICST_61490"
FT   mRNA            join(<140595..140930,140955..>141896)
FT                   /gene="RIB6"
FT                   /locus_tag="PICST_61490"
FT                   /product="DRAP deaminase and pseudouridylate synthase"
FT                   /note="Has EST support; involved in riboflavin synthesis"
FT   CDS_pept        join(140595..140930,140955..141896)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RIB6"
FT                   /locus_tag="PICST_61490"
FT                   /product="DRAP deaminase and pseudouridylate synthase"
FT                   /EC_number="4.2.1.70"
FT                   /note="involved in riboflavin synthesis; go_function RNA
FT                   binding; pseudouridine synthase activity; go_process RNA
FT                   processing; go_function RNA binding; pseudouridine synthase
FT                   activity; go_process RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61490"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67328"
FT                   /db_xref="GOA:A3LWS8"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWS8"
FT                   /protein_id="ABN67328.2"
FT                   /translation="MQSSVYVFENGLRKVRPYYLQFNTHPKPRWIGRTVVDVFSSEFGE
FT                   AKDILRLDIDNELMYIRTGFGRKGGETVLKGWDSIGDRILDKFDVICNSKHMHEPSVPE
FT                   CPLQLHEDTRLKIVFENEDMLVVDKPSGIPTHPTGNYYYNTMTEILKHDLNMKNVWPFH
FT                   RLDKVTSGILIFGKSKTACDTYSSIFQNEKDNISKQYLARIEGEFPTTEVMVNCPIFSV
FT                   NSTGGYIKPLNADMLPINSTTVFKRLRYSKELNQSIVICRPLTGRMHQIRIHLRNIGHP
FT                   IVNDYLYNPTNDELHNQEINKINGSIEVEIYNRLFEKYPSFGKVQPVDVTIAKTDECID
FT                   LFEIASIKDDNRLQSKLQELQKLRQESLARLKSKNNTTCTECNRQLFDTNKDMTDSQIW
FT                   LHAYKYQYIGDLKFSFQTEEPSWCSI"
FT   gene            complement(<142039..>142587)
FT                   /locus_tag="PICST_21007"
FT   mRNA            complement(<142039..>142587)
FT                   /locus_tag="PICST_21007"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<142039..>142587)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_21007"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_21007"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67692"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWS9"
FT                   /protein_id="ABN67692.2"
FT                   /translation="LPHFPEDIKGVDENAYSLLYKNKVQKPMPVLMSNEFFSLIFFPSD
FT                   HFVSSYRKSNISYTFTNYGPSKLNSQVLEKAINSYKGKYRSTTFFQENLQPFTTAVGRS
FT                   NNRKLMKRCLFNALCDQVKTQDQLVSVSGIFRFRFLSVPVTDKDKSKVQRDISNSVNRI
FT                   LEDRMYRSLLSSGTKKSNQA"
FT   gene            complement(<142973..>144076)
FT                   /gene="SWD2"
FT                   /locus_tag="PICST_62019"
FT   mRNA            complement(<142973..>144076)
FT                   /gene="SWD2"
FT                   /locus_tag="PICST_62019"
FT                   /product="member of Set1p complex, histone methyl
FT                   transferase"
FT   CDS_pept        complement(142973..144076)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SWD2"
FT                   /locus_tag="PICST_62019"
FT                   /product="member of Set1p complex, histone methyl
FT                   transferase"
FT                   /note="go_function copper ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62019"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67693"
FT                   /db_xref="GOA:A3LWT0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWT0"
FT                   /protein_id="ABN67693.2"
FT                   /translation="MFSRPSSSSSSSTTTPITDKVIASFRPAKTFNYHREATITSLDFD
FT                   DSGQYLISAGIDKSIQLYDIHKGVHHKDIQSQKYGAHVSRFAHHELNCLYASTPTPSLE
FT                   VDNGIRYLSLGDNKYIRYFKGHKEQVTSIEVNPVQNIFLSASMDYSVKLWDFKSTNPVG
FT                   NLDVGQKSVIAFDPQGIIFAVGKSPSASDPYAMGNVGFYDIKNMDAGPFLSVDIPSNEG
FT                   KVWSKLEFSNNGKSLLVSTDSYEHYIIDSFSGQLLTTLSLKNHDKPTDYWMSFKYPFTA
FT                   SSTFSPCGKFVLAGSPNGSVSVFDLNSLRTTDGNTHMVTSEDNPIFKKRQFVLPSGQGI
FT                   PKIIAFNPKLLTFATADNTVTLWSPNT"
FT   gene            <147010..>147729
FT                   /locus_tag="PICST_62444"
FT   mRNA            join(<147010..147243,147268..>147729)
FT                   /locus_tag="PICST_62444"
FT                   /product="predicted protein"
FT   CDS_pept        join(<147010..147243,147268..147729)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62444"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62444"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67329"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWT1"
FT                   /protein_id="ABN67329.2"
FT                   /translation="WWLKNGLPESIAGRSGTDFIFESDSNKIRRRGNRTIEYRDYYILF
FT                   YDLSQLVFEIQFESEDPRSTVKLINSYAKPIPVYHKLYGQQIVSYAAQFLGTKIQDEIV
FT                   SHSLQVSGAEIISPIGNKSFGVTIYKNLNNTNVSKIDEIKPGDVLWVKNGKYVSHKGLM
FT                   GAKSVTLEGPDNVYTAIIYEYDPKKEKFKVIESDSTGHVKKESFKIGEFKSGRIRVFRP
FT                   VGRDYVEWD"
FT   gene            <150108..152822
FT                   /locus_tag="PICST_72886"
FT   mRNA            <150108..152822
FT                   /locus_tag="PICST_72886"
FT                   /product="predicted protein"
FT   CDS_pept        150108..152771
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_72886"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_72886"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67330"
FT                   /db_xref="GOA:A3LWT2"
FT                   /db_xref="InterPro:IPR007632"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWT2"
FT                   /protein_id="ABN67330.2"
FT                   /translation="MSPPISELNPDYVLAVQYPLESPSSGLPTTQAKKNLTLLVEKLHS
FT                   NGFSTQIRPGTSTPSTLLVFIKLTSYKYAEEAEKDLIQNYEFGVTAKIETVADHSRIVY
FT                   RYLTAPESVGGLGVNPGAGPWSFVNSVFPITEAFDNSKTITEHVKTHLSASELTTSNIK
FT                   DKYGVQVALYFEFLKYYTTWLVFLVVVGITSYLKSGKIFSLSYSFINLVWGVFFIGFWE
FT                   RRQRYLANCWGVQNSHLVDEHNAELAQINKSFESKSSYSHKDNSDAYRFIRQMLFIPVA
FT                   AIFAAVLVSYQLLCFTIEIFLTDVYDGPGKSFLTLIPTILISVFVPILTIVYNIVSDAA
FT                   ISWENHDSVYSRDRSQLIKTFVLNFLTSYMPLLITSFVYLPYAHLVQPHLGDIKDAISA
FT                   NVAESRFFYKYLIKLKKQEDFKMNQERLNAQFFYFIVTNQVIQLILKYVLPLIITKASK
FT                   LVKDVLNKGKEEYEIVDNEEEKVFLEDVRHVLDLPVYNVNDDFRSLVVQYGYLVMFGPV
FT                   WTIAPLICLIFNIIVFKLDTIRLAKGTYFKPPVPSRVDSIHPWNYALFLLTWVGSIVSP
FT                   LITAFYRHGTKPPKTLGQFAFDKASVNVSSTARLMFILFVSEHGFFILNYFINKFNSFF
FT                   KSEVEWKNDFVDNDIKLRHDYYSDKVKPHYVPDDHSAWATFSAEESIESASKLPLKKVI
FT                   HTEASPATTAPSHSGPTPIPETKSEAYSTAAKTNITEVQQRGKNTAKSVAENVTATVSE
FT                   TERVALEKVKDFDDTIIKSKNTLGEEHLATIDNNKHIPVENVTHLSEDAKAAIHSTTSE
FT                   ATKAVDKLSDSVADVEESVGDAVDDVDDADVTVDSTIDSTAESNDYQNFINETKKNVEE
FT                   KATKKRSLKKLFKNKK"
FT   gene            complement(<152982..>153734)
FT                   /locus_tag="PICST_48387"
FT   mRNA            complement(<152982..>153734)
FT                   /locus_tag="PICST_48387"
FT                   /product="predicted protein"
FT   CDS_pept        complement(152982..153734)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_48387"
FT                   /product="predicted protein"
FT                   /note="go_function alanine racemase activity; pyridoxal
FT                   phosphate binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48387"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67694"
FT                   /db_xref="GOA:A3LWT3"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWT3"
FT                   /protein_id="ABN67694.1"
FT                   /translation="MSSAFLQVSAKRQRELVANYNTVLEQVQSLAKKHSNVPVRLVAVS
FT                   KLKPSGDIMALYNAGVRHFGENYVQELIGKSKELPKDIKWHFIGGMQSGKAKDLAKGVE
FT                   SLFAVETIDALKKCKQLDNTRSRLDGAPIEVYLQINTSEEDQKSGYSLSNLTELYETID
FT                   YILSDECKKLKLGGLMTIGSFAESHTDGEENEDFSKLVNLKKIVDEKYKLNLQLSMGMS
FT                   SDFEQAIKQGSTSVRVGTSIFGARPPRI"
FT   gene            154404..155541
FT                   /locus_tag="PICST_78927"
FT   mRNA            154404..155541
FT                   /locus_tag="PICST_78927"
FT                   /product="predicted protein"
FT   CDS_pept        154428..155348
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_78927"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_78927"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67331"
FT                   /db_xref="GOA:A3LWT4"
FT                   /db_xref="InterPro:IPR002344"
FT                   /db_xref="InterPro:IPR006630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWT4"
FT                   /protein_id="ABN67331.2"
FT                   /translation="MSDSIYKGEDFEEKVRKQVEFYFSDSNLQTDKFLWKIYEANDGWV
FT                   ELKTILTFGRMRQYRPEEKVIAALKESEKLVLSANEESIRRKDPVKDFNEVKNTRKRNT
FT                   VHIEGFPTEAEQEDLENWFNTKIAPNLPKESGFNSLRRIKSRVKKEFFGVVDIELKSQE
FT                   DAEFILNKLEITYPQGIVKADDEGVDKKTLLKKMSLLTFQEMRESGKRFGVNDVTKRRN
FT                   SFNDNHRGNKKFKKNFKAKRDDKKENGKPESTEAIPETTETPETKQVSETATPAPAEPA
FT                   STTEAAPAPEPVSAAPAASTEEVAK"
FT   gene            <156192..158295
FT                   /gene="POL12"
FT                   /locus_tag="PICST_90280"
FT   mRNA            <156192..158295
FT                   /gene="POL12"
FT                   /locus_tag="PICST_90280"
FT                   /product="DNA polymerase alpha-primase complex B subunit"
FT   CDS_pept        156192..158249
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="POL12"
FT                   /locus_tag="PICST_90280"
FT                   /product="DNA polymerase alpha-primase complex B subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="DNA polymerase alpha-primase complex B subunit
FT                   Required for DNA synthesis and correct progression through
FT                   S phase plays an essential role at early stage of
FT                   chromosomal DNA replication, before the
FT                   hydroxyurea-sensitive step; go_component nucleus;
FT                   go_process DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90280"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67332"
FT                   /db_xref="GOA:A3LWT5"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR013627"
FT                   /db_xref="InterPro:IPR016722"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWT5"
FT                   /protein_id="ABN67332.2"
FT                   /translation="MSTQVEIDAIRKELVSSFGSSDLLTEDVCKELGTLMSLYQLSSDD
FT                   LYIKWESFNVAEVQENLDLTIENIDRFQKYLQSSLSTSRATPTAKRARDIQGSNIKKKP
FT                   IIRSNADFNSSSPVIPSTPNLKKRKVIEEATPAFKTPRADFNASSPADFNTANNTFQSP
FT                   STPNVSKKQESNTIIETLNPEIDVLPGFVQLDEDPATSLKPYKLMYNFDASKFKYRTMS
FT                   MKLLESADVLDDQIDSFTQLYIDNHKEDGNLFGNPCISSQFDINCCGRIVPDSPNYDKT
FT                   ASVQLNSTSLYLETSRINGIGQRIPLDLSQLKGYSFFPGQIVLLRGRNPTGRSFTIKEV
FT                   LEIPELGAAVSSRQDLEEFEEMTAENGLKIMVAAGPFSNHHSLNYSKLEKLTEIINNSM
FT                   KPHVVVLNGPFIDITNSMVASGDIEIPDDKSPPRNLDELFKKLISPILRKIDSRIQVIL
FT                   IPSVNDTAIKHCSYPQDSFERKKFGLPKNVRIVPNPSSVSVNEVLIANSNLDVFKDLKD
FT                   VHQENPEGKSFSNRFERIANHIFEQRRFYPVFPGSIKRVTPFQTATPPELHEGIMGKEL
FT                   SFTSVGGPSLEVPYLGLTELGDSLPDILISPSDLKSFVKVISGVVVINPGYYIKLNKDP
FT                   TREDGTYAVINITPPQLNAGGDNNVQPVSEDSELYFHNIHKRTRVDIYST"
FT   gene            <159766..>160956
FT                   /gene="CHT2"
FT                   /locus_tag="PICST_48142"
FT   mRNA            <159766..>160956
FT                   /gene="CHT2"
FT                   /locus_tag="PICST_48142"
FT                   /product="chitinase 2 precursor"
FT                   /note="Has EST support"
FT   CDS_pept        159766..>160956
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="CHT2"
FT                   /locus_tag="PICST_48142"
FT                   /product="chitinase 2 precursor"
FT                   /EC_number="3.2.1.14"
FT                   /note="go_function hydrolase activity; go_process
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48142"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67333"
FT                   /db_xref="GOA:A3LWT6"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025928"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWT6"
FT                   /protein_id="ABN67333.2"
FT                   /translation="MLPIKSLISAAVLLASGAYSLDLSSTNNVALYWGQNGFGGQESLA
FT                   TYCQETDLDVVNLAFLNDFPDPLNLNLANACGTTFPSGLLHCPPIGEDIKTCQSLGKKV
FT                   LLSLGGQYGNYGFQSTDDATSFATTLWNKFGAGTDDERPFDDAVVDGFDFDVENGNNVG
FT                   YVELATELKTLFASDASKTYYLSAAPQCVFPDAGANDLLSSGLLDFAFIQFYNNPCGLD
FT                   GDFNYDTWSQFAQSISANLKLFVGLPASPDAANYVDPATIKTVLDQIVCDPTFAGVSLW
FT                   DASGAWANVDAAGNNFVVQVKDVLNALSCPAPSSSSEVASSSVATSSVVESSAVYENST
FT                   IASVTSEAAGATVTDIHTTVITITSCDENKCVASPVTTGYVVVTDLYTSYTTYCPLT"
FT   gene            162117..163365
FT                   /locus_tag="PICST_90137"
FT   mRNA            162117..163365
FT                   /locus_tag="PICST_90137"
FT                   /product="predicted protein"
FT   CDS_pept        162155..163309
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_90137"
FT                   /product="predicted protein"
FT                   /note="go_function legumain activity; cysteine-type
FT                   endopeptidase activity; go_process proteolysis and
FT                   peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90137"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67334"
FT                   /db_xref="GOA:A3LWT7"
FT                   /db_xref="InterPro:IPR001096"
FT                   /db_xref="InterPro:IPR028361"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWT7"
FT                   /protein_id="ABN67334.1"
FT                   /translation="MLLARCLVWAIALLASFAAADPQVITTDEAESVISKSSHTNNWAV
FT                   LVSTSRFWFNYRHMANVLSLYRTVKRLGIPDSQIILMLSDDIACNPRNAFPGTVFNNKD
FT                   QAIDLYGDAIEVDYRGYEVTVENFVRLLTDRWDEDQPRSKRLLTDENSNIFIYMTGHGG
FT                   EEFLKFQDAEEIGSYDIADAFAQMHEKKRYNEIFFMIDTCQANTMYERFYSPNILAVGS
FT                   SRIEESSYSHHSDMEIGVAVIDRFTYYTLAFLENINRDSRVTMNKLFDEFTYDNVHSNP
FT                   GIRTDLFKRNVSEVLITDFLGNVQNIVLDNVEKDILFNSNHNKQEATDNNETRPVHSYS
FT                   KIDISIDTEDSNELTKIAPEVQRAMGVGIAGLVIALWVIAKDLA"
FT   gene            163621..168146
FT                   /locus_tag="PICST_78610"
FT   mRNA            join(163621..164504,164685..165641,165690..166862,
FT                   167106..168146)
FT                   /locus_tag="PICST_78610"
FT                   /product="predicted protein"
FT   CDS_pept        join(163739..164504,164685..165641,165690..166862,
FT                   167106..168106)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_78610"
FT                   /product="putative mitotic spindle protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_78610"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67335"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024395"
FT                   /db_xref="InterPro:IPR034085"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWT8"
FT                   /protein_id="ABN67335.2"
FT                   /translation="MSSHHKVYANELFQIMASRDVDQTRKLELVLKLKTNIKKDAVDIA
FT                   QVPTYFEALSIGVDIPDLGISVASFSTLAHLIKRVSMQDKTGMVLKNQSFLVLPIIINR
FT                   LANSNTSTLSSARKALEAYWFSSPREVESAILDIALKHRNTDITLEAVHWLHHIISNVN
FT                   QHFNLTRFVPQLAKLLATYPSSHSTQLQNSIKSLLCDYYNFKQNRLYKFDLARELELKN
FT                   VPDTIKESIMQNIAGINPESTSVTKPDSNFVIAVQDHQSIPSEAETLLPEIRDIISKYN
FT                   YELDTSIRSVSFEGSEQMLSTFNDLLPPFNSKETEFNWGQREKNIVQMRSILRGNAPSL
FT                   YRRDLIVGLKDSAEAICKAVSSLRTTLSSHGCQLVKECAIFLKTDIDSLVDLFMPSLVR
FT                   LCAATKHIASTNANMSIVAICANASYSPRLLQRIVNATNEKNVQPRSYSGIWLQITVSR
FT                   FFNSHSFLSSHGSTPNTGVDLAMKALAKLLKDPNPTVRQIAKDSYWCLWRKLPTQSELL
FT                   LSKLEPKIIKIVERSRPKDVSHEEVSAPTLNMQRSRPSLKETIIERNKDLRLKQRELNQ
FT                   SHREELHIKRVATRTNSTNGFRQNSIERNLSNSHKPDLRPPSKEGVSPKDIEQESVQQE
FT                   TTRTKQTDTAPASKEVAFDVQADPILKFLSSYQTDLIKEGINLLKYAIMGEEELSPEIT
FT                   SLLKSISLRQPKLLEPLLLSNDNLFKRSFQFFSAEDFLRICSIVINPIEGRTIELLISM
FT                   MTVDELYESIIKLLSYSINTANILGDDELTMQVIKYKSSIIQLIVVFLQSSLEKIPIRD
FT                   SYFSKVTSNFLELVSILKSTDIYPEFSKLLAKLYSINIALFVSELDLVDINTKEEVEYI
FT                   VGIDHTLSMKNIPNTMPNSLFELTEVQKTHSYDGFSPVKTNQDFTMIWPERKDNDDYNF
FT                   IPKSANDSQKNIAAQFQGFNHHESKSEDPVKEYSDNLAQVQICEQPPSLIDQNVQLQTF
FT                   LDKVDPLKSISNRNKPIAIYEDSKGSPQKLKEHRYSEFNWFNFQVARLQLESDDDEVED
FT                   NETTEDDYSELLMDVCESLKSLELDSKTLTTALDLLQNMHRFGFEFVKYYENEGAKLME
FT                   ESLWQFFHDCNKVSITNKVRGLVLLKQLLIIHSKLDLANLWTTLINVACLPDSENEIAF
FT                   ALRDISSEILSGLYRSDELLDVLFSSFTSDHLSRASTFILGTLSKVLDSTSIPELLSDS
FT                   ILQQIDRVLRNFVNSRNAECRRYAILCYGKLVKSSRVSFAGKSPDNTILDGIIQRFSPS
FT                   QRRLVEYYSQDPKS"
FT   gene            complement(<168264..>170033)
FT                   /locus_tag="PICST_84653"
FT   mRNA            complement(<168264..>170033)
FT                   /locus_tag="PICST_84653"
FT                   /product="predicted protein"
FT   CDS_pept        complement(168264..170033)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_84653"
FT                   /product="STE-like transcription factor"
FT                   /note="go_component nucleus; go_function transcription
FT                   factor activity; go_process regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_84653"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67695"
FT                   /db_xref="GOA:A3LWT9"
FT                   /db_xref="InterPro:IPR003120"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWT9"
FT                   /protein_id="ABN67695.2"
FT                   /translation="MSLVKQESQTSSRDGIKDDNSKPQEDDITESLRLIEDLKFFLATA
FT                   PANWQENQVIRRYYLNHDEGFVSCVFWNNLYFVTGTDIVRCIVYKFEHFGRTIIDRKKF
FT                   EEGIFSDLRNLKCGTDAILEPPRSDFLEFLFKNSCLRTQKKQKVFFWFNVPHDKLMADA
FT                   LERDLKKEKAGQNPTTVAQREPAKSFKYDESANLYTQLAEHMEKQKVNNQEIYDHNPPV
FT                   TTNENDNSSPEYTTSTNVVLPNVEKSNGENYEFLDHETPAQFKANSDYEDDFPLDYFDP
FT                   NYEDSYITLDPNYQLGGYSSMVDENYDSIVDPSVFIYPTNTSSAPPATTPSFNQVAYNA
FT                   EYLIEQTQPLKTPLPQMPSAVTLQPKSANFVGFPSATDEFFPTYLPPLSAKYQTGFPRS
FT                   TPTQIVYPNITQATPEVAYETLPPNHSQSEIYFQQEPEYWPPQSAAYGGSYEVPMHYNQ
FT                   QYVILNEHDYAPNAMYQVVNPSSMPIPPPSAGAYLTHFGFSPQHGAPSFRQQQISANMM
FT                   KKRSAMAQGKTQGISKPSGARTTKTAHFTVEEIANSKLTRLLNQDNHESARPANDGMMP
FT                   TPVSSANPSDDKK"
FT   gene            <171315..>172454
FT                   /gene="GAT2.1"
FT                   /locus_tag="PICST_32587"
FT   mRNA            <171315..>172454
FT                   /gene="GAT2.1"
FT                   /locus_tag="PICST_32587"
FT                   /product="GATA-family of DNA binding protein-like protein"
FT   CDS_pept        171315..172454
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="GAT2.1"
FT                   /locus_tag="PICST_32587"
FT                   /product="GATA-family of DNA binding protein-like protein"
FT                   /note="go_component nucleus; go_function transcription
FT                   factor activity; go_process regulation of transcription,
FT                   DNA-dependent; go_component nucleus; go_function
FT                   transcription factor activity; go_process regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32587"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67336"
FT                   /db_xref="GOA:A3LWU0"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWU0"
FT                   /protein_id="ABN67336.2"
FT                   /translation="MAPPSEILNNEIMAARILVNAKFANKNLQPLNTTFVSINTPMVQQ
FT                   EVSLQRSTVRCLPPPTPSPTPPYTTDPKAYTAPQLNKNRTCYYHSQANFHIMNPYCANC
FT                   IYCGHEYKNQIVRLANEVSNNANNYASTLWNYKSTLNRIVAANAQDSAESEELYNNFNN
FT                   LSYQVKGHLSTIAATSSSITNIESSVNKLREISSDKESNNPITPPLEEQTQIVIHEPNA
FT                   QKESAQIQTFHYSEPQENLVQKKQIVQLSMPVPTQSPQTLQTETKTKESLKPKKGRPIL
FT                   LKKRAKEPRKSKINVKVSKCSHCQSHSTPEWRRGPGGVRSLCNACGLFYSKLVKKFGTT
FT                   DANTIFLSRKESDKLIDRTIPTTLQSNAILQKQLRLIRK"
FT   gene            complement(172453..175480)
FT                   /gene="KSP2"
FT                   /locus_tag="PICST_90237"
FT   mRNA            complement(172453..175480)
FT                   /gene="KSP2"
FT                   /locus_tag="PICST_90237"
FT                   /product="serine/threonine protein kinase"
FT                   /note="Has EST support. strong"
FT   CDS_pept        complement(172529..174979)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="KSP2"
FT                   /locus_tag="PICST_90237"
FT                   /product="serine/threonine protein kinase"
FT                   /note="go_function protein kinase activity; ATP binding;
FT                   go_process protein amino acid phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90237"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67696"
FT                   /db_xref="GOA:A3LWU1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWU1"
FT                   /protein_id="ABN67696.2"
FT                   /translation="MMEEYKQYDRGGLLRERYHKVNDISEGSYGLVSVAKDTKNNNKLV
FT                   AVKFIYPIDFKKDAKDEKTSRPSSSPAKLRSPNPVSASKPSRNSILTGLYEEAQKEIRI
FT                   HKILGSHPNVSSLYDHFDSYLILEYCSRGDLYEAIHGGNGPSTSQDIKDVFSQVLGALE
FT                   YCHSHQVYHRDLKPENILIAEDWTIKICDWGLATTTKIITNKDEFDIGSERYMAPELFD
FT                   PALESYDASKIDLWSVGVILLTLVFHKNPFQVANYSDKRFLQFVNNREALFDIFSTMSG
FT                   DMFSITRFCLNIDPSNRDLASIKSELETLRYFTIDEEYWGSEEEEDLEEDYEFEMDSDF
FT                   YKKDATPSPEKISPIVVTVESQDDKNSGDKHISESLSTTESESIHSKSSQYRVGFQEDR
FT                   IPHNHRADALLSSNTELKPIPIGGKFIRNTRKPFNVASYNQSHSNARSLNNKFNREDFF
FT                   TPKSIYNHYMDKYGEQRFGNIQNGQNGQNGQNGSKSFHGHHNHHSADWKKNKRPPRSWK
FT                   KPNKRKPRTRSNRNRYGVENNHHQNSNSTDLSSQQASQKKKTRSASTSKLRRSFIPPSA
FT                   GNSLTNSFHNLAHPMGPQSLGSSATSTGKYVPPYLRSPAYTKSPVIEPLTEEIDRLTLA
FT                   NDYDEVFHLEDDFELEAVDEPETTLAEKTERPTTIDDILFRKPNYRGQGEADPIRNYGI
FT                   IYNHSNGNGMAIQNGMITGRRNSALGSSHKRPASNPILESQVLSTSAGSGSGKYVPPFR
FT                   RGSHSAVASNGKPLKVVDKKDEGYIHGKLLSSPLVEINNYTTNSVPVNGREWFDYKKDW
FT                   SDYD"
FT   gene            176714..>178327
FT                   /locus_tag="PICST_84628"
FT   mRNA            join(176714..177222,177283..>178327)
FT                   /locus_tag="PICST_84628"
FT                   /product="predicted protein"
FT   CDS_pept        join(176762..177222,177283..178327)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_84628"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_84628"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67337"
FT                   /db_xref="GOA:A3LWU2"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR006577"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWU2"
FT                   /protein_id="ABN67337.2"
FT                   /translation="MDDDTIATFLAVAGIDDEDTAKQFLELTNGDLEYAVTLYMESRQH
FT                   GSAGSAPAASNDHSNDEELAQRLQNEAYSSNMEDNVRAADANVHRHETLVDSFGPSFGF
FT                   HPSMHQPTSRPGDIFGRGNVGPFNQRFDRAENEFYLNRFEEIEDGDDDDDEDEDDDIME
FT                   LDEHGDVIPSRPAGRRRRLRSEREEELSSTQRRLANLFRPPFDLMSMVNLDEAKKKGKV
FT                   ENKWILINIQQTSEFKSHMLNRDFWSNSQVKAAVKENFIFLQYQSDSPNGVSYLNFYSS
FT                   DDFPHIAILDPLTGERVYKWKDGEVPKVDEWLREVDEFLHTFSLLPNSDNPVVQHEVKF
FT                   DPDALTEEQQIEFALKQSILENNGKSASDAIAIDDSDDENLPEIEDEEEEAPAPTEPTD
FT                   PFESIAAISHEEPTSSNSTRIQVRFPNGKRLVHKFNLDDKVVTIFSWLKFILAESAQEY
FT                   GLSADDRFGLSNSSQKSFKFIESLDTTIEEANLKNASILLEKE"
FT   gene            complement(<178779..>179921)
FT                   /locus_tag="PICST_48789"
FT   mRNA            complement(<178779..>179921)
FT                   /locus_tag="PICST_48789"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<178779..179921)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_48789"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48789"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67697"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWU3"
FT                   /protein_id="ABN67697.2"
FT                   /translation="MSDEVETQAGEQKKSQFSVQNIVKIPNLSVEELTELEKEISDEFR
FT                   DISKSYLATRLSRIDTLIEKINNSIKITTANDRNWLKIYNFEIETINNIKTNTEDLVLL
FT                   SGGYIHNRADILRSIDEYEEELKEIFKNLQSPLDFDETLGDLENENNNNDENSTKLPFA
FT                   YLFERFFKPHTRSLQTIINEKDYQSRLLQNNSSGNSAIIWKSYYYNLMRRKHELVQQTF
FT                   SELNNLYKEYHSVNDQQQIARGWSNYYRSVISPIDLRRTYDEGNNNKLNHTIYNTTNTH
FT                   DYKTILENNRDSNYSNLDNSYLQKNRIELTNIRKNIFSQQHRFNHTQNRDSQTYLSDTE
FT                   EPAKKRVKLNTCLGLVKDEIDDDLSLLRKEIRKHKQLDEPE"
FT   gene            complement(<180765..>181259)
FT                   /locus_tag="PICST_32591"
FT   mRNA            complement(<180765..>181259)
FT                   /locus_tag="PICST_32591"
FT                   /product="predicted protein"
FT   CDS_pept        complement(180765..181259)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32591"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32591"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67698"
FT                   /db_xref="GOA:A3LWU4"
FT                   /db_xref="InterPro:IPR001232"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR016072"
FT                   /db_xref="InterPro:IPR016073"
FT                   /db_xref="InterPro:IPR016897"
FT                   /db_xref="InterPro:IPR036296"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWU4"
FT                   /protein_id="ABN67698.1"
FT                   /translation="MSAPKVIVISSDDEKFPVDPKVAEKSLLMKNMINDLNPDGLQEDF
FT                   EIPTPNVRANVLAKVLEWCEHHKNTIFPDDDDDDARKSAPVEEWDKNFLKVDQEMLYEI
FT                   MLAANYLNIRPLLDAGCKMVAEMIKGKSPEELRRIFNIVNDFSPEEEAAIRRENEWAED
FT                   R"
FT   gene            complement(181737..183310)
FT                   /gene="PEX3"
FT                   /locus_tag="PICST_84357"
FT   mRNA            complement(join(181737..181916,181962..182112,
FT                   182170..183310))
FT                   /gene="PEX3"
FT                   /locus_tag="PICST_84357"
FT                   /product="Peroxisomal biogenesis factor 3 (Peroxin-3)"
FT                   /note="Has EST support"
FT   CDS_pept        complement(join(181823..181916,181962..182112,
FT                   182170..183235))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PEX3"
FT                   /locus_tag="PICST_84357"
FT                   /product="Peroxisomal biogenesis factor 3 (Peroxin-3)"
FT                   /note="Peroxisomal biogenesis factor 3 (Peroxin-3)
FT                   (Peroxisomal membrane protein PAS2); go_component integral
FT                   to peroxisomal membrane; go_process peroxisome organization
FT                   and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_84357"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67699"
FT                   /db_xref="GOA:A3LWU5"
FT                   /db_xref="InterPro:IPR006966"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWU5"
FT                   /protein_id="ABN67699.2"
FT                   /translation="MAIFSSLASFFNRHKRKIFITSTLTVSIYFLFNHFVIKKFRDYQN
FT                   ALRQELIFKQQIKQRFIQTQQDCYYTLLALLPVLTTPVIDYLPVELITHVLRLKKNNPN
FT                   GQTAAGSVTGGSNSELTTDNLNLLDTNNNPQSKMTVYMNKSKVELWALLKIKTITRTLT
FT                   LIYSISGLLLITRLQLNILARRSYLESAISMAGVKSTNNDINPHDNYLIEQSYLSLSWW
FT                   LLNKGWVNLNSIIEPLVIKKFESITPKSELSIEQFDLILHDIVNDISINHKQTILANLF
FT                   PLNYDDLVETLFSTNPDLLVQLEISDSNLNKLINETNSIMLDSQSGFFDLFNSVVSNML
FT                   NTLANNLSLSMNNGNDIAAESFLSNANKTFKLASFLAQLSVQNFILSDNDNLKLEDQVN
FT                   EEDDIEGNNDLTGNVYINNLYLEELDDFSAGIYSNFE"
FT   gene            <185023..>186012
FT                   /gene="PHO3"
FT                   /locus_tag="PICST_32593"
FT   mRNA            <185023..>186012
FT                   /gene="PHO3"
FT                   /locus_tag="PICST_32593"
FT                   /product="acid phosphatase"
FT   CDS_pept        185023..186012
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PHO3"
FT                   /locus_tag="PICST_32593"
FT                   /product="acid phosphatase"
FT                   /EC_number="3.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32593"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67338"
FT                   /db_xref="GOA:A3LWU6"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWU6"
FT                   /protein_id="ABN67338.1"
FT                   /translation="MQFKTSLALFTIAATALAKTILLSNDDGWASTNIRATYYQLKSAG
FT                   HDVYLVAPVSQRSGWGGEFDEPTSPTLDTDGEFGYVKAGAPSWGHEIDDDHIWYVNGTP
FT                   ASSVAFALKYVFPYYFAEKGENITVDLVVAGPNEGTNMSPGFFTASGTMGATYNAVYRG
FT                   YPAISFSGSNSNNSFFKDSLDLEDKLEPSTIYANLVVEMVNQLFESQGENTRTLPLGVG
FT                   LNVNFPAVGYLNETCNSPQWVYTRLTGEYAGGADMYYNETSNSFVWKPSTMSALSVCYN
FT                   GDCSLPSENLILGYTDCATSVSAFSIDYDVTLGMSNEVTSLLQPLFSS"
FT   gene            <188667..>189653
FT                   /gene="PHO3.2"
FT                   /locus_tag="PICST_47650"
FT   mRNA            <188667..>189653
FT                   /gene="PHO3.2"
FT                   /locus_tag="PICST_47650"
FT                   /product="acid phosphatase"
FT   CDS_pept        188667..189653
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PHO3.2"
FT                   /locus_tag="PICST_47650"
FT                   /product="acid phosphatase"
FT                   /EC_number="3.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_47650"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67339"
FT                   /db_xref="GOA:A3LWU7"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWU7"
FT                   /protein_id="ABN67339.1"
FT                   /translation="MQLNNYIAFLALATACLAKTILLTNDDSWAATNIRATYYQLKDAG
FT                   HDVYLVAPVSQRSGWGGKFDVPSSPTLETDGEFAYVKAGEPSWGHEVDDDHIWYFNGTP
FT                   ASAVAFALNYVFPYYFAEKGNNVTVDLVVSGPNEGTNMSPGMYTLSGTMGATYNSVYRG
FT                   YPAVAFSGSNGNNSFFKDSLDLEDKLDPSTIYANLVVDFVAQLFTAQGDNSRTLPLGVG
FT                   INVNFPPVGYQNESCIAPKWVNTRLTGAYASGADLAYNATSNSFIWQQTSWSGLQVCYN
FT                   GDCSLPSENLIVQYTECSTSVSAFSVDYDAKLSLSQEVTALLEPLFS"
FT   gene            <191228..>193975
FT                   /locus_tag="PICST_48545"
FT   mRNA            join(<191228..191345,191394..191660,191724..191904,
FT                   191974..>193975)
FT                   /locus_tag="PICST_48545"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(<191228..191345,191394..191660,191724..191904,
FT                   191974..193975)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_48545"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48545"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67340"
FT                   /db_xref="GOA:A3LWU8"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR031968"
FT                   /db_xref="InterPro:IPR040147"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWU8"
FT                   /protein_id="ABN67340.2"
FT                   /translation="SDSNGFLSSILNAANNIISSTVTDDNKIEASTTSVTSGRTKEHSF
FT                   SNRLDFLLKPARFGSSKSSFDEEQADILMNTDNAEVKEPSEPKMPSSPLSTVNVQFESI
FT                   RESPLNTLGQGDLSLAAFDKAQPKKTRSRFLASPRESTDNLVDIKRSLSPDIVNRQSSN
FT                   AVNTVSDVKRPRRKSNIVTASSVPTVGDSNSKSRSTDADLDESDAALYSEDESSDRDES
FT                   EVIDYSNLKYASRKRNKEFHSVFKKLPSSDPLIDDFSCALSKDILVQGRMYLSSNYICF
FT                   NSNILGWVTNLVIPLQEVIQVEKKSTAVLFPNGMIIRTLHHRYVFATFLSRDTTFNLIT
FT                   NVWHKVLLETADDSKLAVKRRARGNSRSTGASKSVSRDRYDGTNSLNDEYDISEVDSRR
FT                   DVLSASHDEEDDFDGSFSSLSLHSDKDNDDEEAGSDSGSVKGGDHTPSSANKSMSRDEG
FT                   TNGSTEQGANTFKGFPMVGPMAHAPTDINYTKKASETFISEGVLKAPVGAVFSILFGAD
FT                   TSLFIKILKKQKNFDITESEITPLSPKNKERHYSYIKPLGGPIGPKQTKCIIVEKITEF
FT                   NPENYILVEQVTSTPDVPSGNSFSVKTKMFFSWVESNHTRLYVVTSIEWTGKSWIKGAI
FT                   EKGSIDGQKESMKVIMDSLDEMISTGNEGAGKGKQAKSKKKGTRSRKNTIVKKPSIEKE
FT                   PEVVKELGVGEKFMDFVESLGKLLPIPYLGDLITGFIVLFIGIMISFRLFNAITGGSSK
FT                   RVQFIPEDSYVSKIRIDDNKYIIIPSIDTNFHNKKIVMENEVNLWNWVRERSEDKIKIV
FT                   SDDNSSSGPIGKSDARKDYADQEVYEIVKITQMKLGQLSEKLK"
FT   gene            <194855..>195985
FT                   /locus_tag="PICST_32596"
FT   mRNA            <194855..>195985
FT                   /locus_tag="PICST_32596"
FT                   /product="predicted protein"
FT   CDS_pept        194855..195985
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32596"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32596"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67341"
FT                   /db_xref="GOA:A3LWU9"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWU9"
FT                   /protein_id="ABN67341.2"
FT                   /translation="MIFLSILCSLLTTVVPFVLTIKCFDPVIASQIPYTSYQFLLNYWI
FT                   YFVILQFVNINFVTTHGQFYFDIISQTLKLWFLYGSSNNLALFNRFIVTRVTSSRDFNG
FT                   LYHLEANYINPLLSKYVTSQIRTDSRGKRMGQLQYYLIRLGQKYANDTNVDDMSFILLE
FT                   RILSSARMLVVSLFAPQISPNIKTSPRRNEMVQHYQRHRSSSGGSKSLGTSTRTAPSVY
FT                   NVGSSPRSISGGGSYHEATVLELNRHGDAIGQNYTNAQSMPYPVGTGSNSILNDNLANV
FT                   PLSKFMNKPRSVSERIDAAASKYFGIKPRSSSAGESDTVQRGFGPSAGFRVNPNSINSI
FT                   RSSYQMEQQRENDIPPLVTVSSPSSGRTTPARQLLN"
FT   gene            <197027..>197647
FT                   /locus_tag="PICST_32597"
FT   mRNA            <197027..>197647
FT                   /locus_tag="PICST_32597"
FT                   /product="predicted protein"
FT   CDS_pept        197027..197647
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32597"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32597"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67342"
FT                   /db_xref="InterPro:IPR010760"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWV0"
FT                   /protein_id="ABN67342.2"
FT                   /translation="MLPPITVAGKLSDKDTPLPSPDLIQTPHLHFNSTYVTSSSASNTP
FT                   PSGATIANCTCSTASQNPQPHPTVIDTAILENTPRTTILVNHSGTSSEKSNLGQTQYFP
FT                   SVTPPTISANPEITTVDDDANQSSSLSKDERLDEIKKQCSQLISELDANPNPEEIVRKH
FT                   IIMLNKYNELKDIALGLVTMIADQRHIRTTDILEEVKVEHNPE"
FT   gene            <199177..>202707
FT                   /locus_tag="PICST_47968"
FT   mRNA            <199177..>202707
FT                   /locus_tag="PICST_47968"
FT                   /product="predicted protein"
FT   CDS_pept        199177..202707
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_47968"
FT                   /product="predicted protein"
FT                   /note="go_function protein kinase activity; ATP binding;
FT                   go_process protein amino acid phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_47968"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67343"
FT                   /db_xref="GOA:A3LWV1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR010513"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR018997"
FT                   /db_xref="InterPro:IPR038357"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWV1"
FT                   /protein_id="ABN67343.2"
FT                   /translation="MRKLLFLLSLCMMAYVVLVAASPRLEKVTTRYLPDSLLQNDAAPQ
FT                   TTEPPSKRTTDSSILPLDVRSLKDFKLTDLLLISDVDGNLHAVERKEGALIWTLPSDEP
FT                   LVKIQSNSSTEDSQSNILWFVEPYQDGSLYYFTPKFGLNKLPTSIRQLVMESPFSLSGD
FT                   DKIYTGSRKTALYTVNIFTGEIVSSFGNEEKCPVANTHYKIDNLYSRSDTINIGRTTYE
FT                   LTIHSKLNTNVVWNVSYSQWGPNNIDNDLIMQNSESIDKLYFTPFYNKSILAINKDISA
FT                   PKWLTNLPSFAVSVFDVFSNLKNSDCVLLPHPSKIFNQPQLDDDNDNNSDLVFIDRTSN
FT                   RKEWFAMSFNNYPSLIKTAPISNYQLYLLKLQADFQDLNVNVDYLKNFQLSTSPPEEVK
FT                   TLISGIHRAFQLSADTLYQPSSRFEKSDDIKRIGQNEQTERTEQDERTEQDDQNDNSLK
FT                   TDLEEIKPNIAEGVNFAHETSRSEVLYLPPSNNEVESYRPYKDPETSHEIINNLEPNST
FT                   TAIIRRILEDLVVLLVLFVLVMTFGKSNKFVQGFFNNGSLVGPVSIEKDAVFDNDVVLD
FT                   SNFSVSNDKEKVSITEKDKSSQVVELANQDNKDAKDSNEVFKKVKIVVPNESLEKANDD
FT                   PSKLEENVDDDEEGNGDEITTKKKRKRGSRGGKRGGRRVNKSKENAGDDQEINDESPEE
FT                   EFISIATKSLVKTITTPVKIPSKKLQIENNLVISDKILGYGSHGTIVYQGTFENRPVAV
FT                   KRMLLDFYDVANHEVRLLQESDDHPNVIRYFCSQSSESEKFLYIALELCLCSLEDIIEK
FT                   PKKSPQLSIPKVNDVLYQLASGLHYLHSLKIVHRDLKPQNILVADIKKTSSSKATTKPS
FT                   EEENNVRLLISDFGLCKKLDSDQSSFRATTQHAASGTSGWRAPELLLHHDLLEISPDTI
FT                   SSVGSGSRHSFTESWSTVTNSSSVQASGGKRLTKAIDIFSLGCVYYYILSGGMHPFGDR
FT                   YLREGNIIKGEYDISLLKQCCPNDKYEATDLIASMIHANPSKRRSTSKILIHPLFWSSK
FT                   KRLEFLLKVSDRFEVERRDPPSDLLLKLEDRANAVHGGNWHKQFDDEFMDNLGKYRKYH
FT                   KEKLMDLLRAIRNKYHHFNDMPETLQAQMSPLPGGFYKYFNNKFPNLLMQIYFLIEENL
FT                   AEEHAFKDFY"
FT   gene            complement(<203034..>203498)
FT                   /locus_tag="PICST_61936"
FT   mRNA            complement(join(<203034..203098,203135..>203498))
FT                   /locus_tag="PICST_61936"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<203034..203098,203135..203498))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61936"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61936"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67700"
FT                   /db_xref="GOA:A3LWV2"
FT                   /db_xref="InterPro:IPR007146"
FT                   /db_xref="InterPro:IPR011082"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWV2"
FT                   /protein_id="ABN67700.1"
FT                   /translation="MENIENVKLFVKSLDNSVDQLEDALKPVLKKSLAELVAENSTTPF
FT                   ERIKLYNNSAYTLISVIYSYLKTAGVDTDKHPISQELTRIRAYMKRAKELESSTMSKEQ
FT                   EQKNAEAKAKDFLQKTLANMTSPAISASNFQGKHTKFKE"
FT   gene            <203766..>204605
FT                   /locus_tag="PICST_47649"
FT   mRNA            <203766..>204605
FT                   /locus_tag="PICST_47649"
FT                   /product="predicted protein"
FT   CDS_pept        203766..204605
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_47649"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_47649"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67344"
FT                   /db_xref="GOA:A3LWV3"
FT                   /db_xref="InterPro:IPR019186"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWV3"
FT                   /protein_id="ABN67344.1"
FT                   /translation="MVVRKNREILTGGKKYAQKAAKKHRVEEVVFDKDSRVEYLTGFHK
FT                   RKVQRQKKAQEYIKEQERLSRIEERKQIRAERKKDMEKQLEDFNSTVKKITSYVESDDD
FT                   DWSGFNDKTADNDKNDDGINEEEDDDVDDDGEEDNDGEERSKPPAPKPKGILHHTEVYK
FT                   LDETTELLPESSAIIDDETTVTVDSLDNPAIVSAQQASVEALARMHNVDLGKSEKVLEN
FT                   SIKKAKTHAIMVGVAKPSVGDRIKQKKKKFRYLSKAERRENTRKERSKGYSRGKAKK"
FT   gene            <205831..>207153
FT                   /locus_tag="PICST_47989"
FT   mRNA            <205831..>207153
FT                   /locus_tag="PICST_47989"
FT                   /product="predicted protein"
FT   CDS_pept        205831..207153
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_47989"
FT                   /product="predicted protein"
FT                   /note="go_component integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_47989"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67345"
FT                   /db_xref="GOA:A3LWV4"
FT                   /db_xref="InterPro:IPR004342"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWV4"
FT                   /protein_id="ABN67345.2"
FT                   /translation="MDQNQKKSDEILFDDLVPLPFRILFLVQLGVFFWYYLVYSCYNLR
FT                   KLNILHLIKLSYSAHDYSQLDDHYIPNGEFATTLVPDFNSNLILANGIWANLRPVTIVN
FT                   VIGWAVFKIIQRKVSSNDDVSPAIFIPLSYVIPLALFFHLFYRLFYKSKVQNSMGQYRA
FT                   FTTMKRILLGKINSSTMRTNDILISDSLVSYSKVLNDFGLYLWNYYYARDIPYSVELEF
FT                   ILLCIPTFIRMKQCYSEYRSTANRQHLFNFIKYSTTLGPLFVNSLIKSIITSPGKDLNE
FT                   PAFLDKLQSLNRWWYLLSFVNSTYSFIWDVKMDWGLKMFDFLFESKTYYFKMVLLRPKL
FT                   AFEPVVYFAVILFDFIVRFVWILKVFIVKEGQDQVKWTTLHMLSTFLFGYDAFSFGYTV
FT                   IEFLEILRRWAWCFIKLDSDWATLEQATGNDIELVNTSKLG"
FT   gene            complement(<207436..>207618)
FT                   /locus_tag="PICST_62753"
FT   mRNA            complement(<207436..>207618)
FT                   /locus_tag="PICST_62753"
FT                   /product="predicted protein"
FT   CDS_pept        complement(207436..207618)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62753"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62753"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67701"
FT                   /db_xref="GOA:A3LWV5"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWV5"
FT                   /protein_id="ABN67701.1"
FT                   /translation="MAGHHGPSLSIAAIATMGSVLVIYATLKSPLKYQWASENRLSPKA
FT                   DLAWRNAAQKWLDNQ"
FT   gene            <208234..209412
FT                   /locus_tag="PICST_67997"
FT   mRNA            <208234..209412
FT                   /locus_tag="PICST_67997"
FT                   /product="predicted protein"
FT   CDS_pept        208234..209322
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_67997"
FT                   /product="predicted protein"
FT                   /note="go_function RNA binding; ribonuclease III activity;
FT                   go_process RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_67997"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67346"
FT                   /db_xref="GOA:A3LWV6"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWV6"
FT                   /protein_id="ABN67346.1"
FT                   /translation="MLRRIVRLPRPMLRTLVPTRNYQVARLDTSLKTNYDSLTDYGSYK
FT                   NNIFTHRLPESTAQQSPPLVALHSRLNLPTSYSLSTLSQALNLNKFDDGLANNFGLNTL
FT                   GKNLMSYYVAEYLLIKYPRLPMPIHNAAVDSLMGVETLHEIGKSWGIEVDQSSKLEKYL
FT                   SQESEFLKYGKLRFVSEQRKSQVKEDGVYELSQEEIASLHRNKSFVAKETEAYASAVRS
FT                   IVGGLYTHVGEDATKAFISDHILSRKLPLEQMFQFSQPTRELIRLCDKLSFTEPVEIRL
FT                   IAETGRLSAHPIYVAGAFCGVEKLGEGIGSSLAEAKTRSVVNALLSYYLYSPISADGAD
FT                   VKFPSDIDYKFEGIVGTGDVAI"
FT   gene            210038..212582
FT                   /locus_tag="PICST_78660"
FT   mRNA            210038..212582
FT                   /locus_tag="PICST_78660"
FT                   /product="predicted protein"
FT   CDS_pept        210137..212524
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_78660"
FT                   /product="predicted protein"
FT                   /note="go_function catalytic activity;
FT                   phosphoribosylamine-glycine ligase activity; go_process
FT                   purine base biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_78660"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67347"
FT                   /db_xref="GOA:A3LWV7"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWV7"
FT                   /protein_id="ABN67347.1"
FT                   /translation="MSKQLNILVIGNGGREHAIVWRLAQSASVNKIYVAPGNGGTATDS
FT                   DKIVNVPHLSGSPKDFEALQKFAVDNNINLVVPGPEQPLVDGITTVFTKVGIPVFGPSA
FT                   AAAVMEGSKAHSKIFMDKHNIPTARFQNFKSVEEAKKHIETIDYKIVLKADGIAAGKGV
FT                   LIPETKEEALKGLNEIMVDKNFGAAGDEIVIEEFLEGDELSILTITDGYTFFNLPAAQD
FT                   HKRIGDGDKGLNTGGMGAYAPAPIATPAILKKIDELIIKPTIDGMRQDGTPMNGVLFTG
FT                   IMLSPSKEPKVLEYNVRFGDPETQTVLPLLTEDTDLAQVFLACAEHRLDSVTIKTKPDM
FT                   FSTTVVMAAGGYPESYKKGDEITVKSPLPANTYVFHAGTGEKDGKVVTAGGRVIASTAI
FT                   APTLRESVDRAYVGVDHVSFTGKYNRKDIAHRAFRDAASTSQGITYADAGVSVDNGNLL
FT                   VEQIKAKVKSTARAGADSDIGGFGGLFDLKKAGYNTDDTLLVAATDGVGTKLRIAQIMN
FT                   IHDTVGIDLVAMNVNDLVVQGAEPLIFLDYFATGKLDIEVAAKFVSGVADGCIQAGCAL
FT                   VGGETSEMPGMYDEGHYDTNGTAVGAVTKSKILPKIENMKTGNVLIGVTSDGIHSNGFS
FT                   LVRRIIEVSDYEYTSVAPWSKEGKTIGEEVLVPTKIYVKQFLKSINEGLLLGLAHITGG
FT                   GLVENVPRALPKNLQAKIDMNTWEVPEIFKWFGKQGKVPYNDILKTFNMGIGMVLIVEE
FT                   DNVDKVLSNLKASGETGIVIGSLVDRKEGEEGCVVDNVEGLY"
FT   gene            <213608..>215911
FT                   /gene="GSH1"
FT                   /locus_tag="PICST_62151"
FT   mRNA            join(<213608..215384,215472..>215911)
FT                   /gene="GSH1"
FT                   /locus_tag="PICST_62151"
FT                   /product="Glutamate--cysteine ligase"
FT   CDS_pept        join(213608..215384,215472..215911)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="GSH1"
FT                   /locus_tag="PICST_62151"
FT                   /product="Glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="go_function glutamate-cysteine ligase activity;
FT                   go_process glutathione biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62151"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67348"
FT                   /db_xref="GOA:A3LWV8"
FT                   /db_xref="InterPro:IPR004308"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWV8"
FT                   /protein_id="ABN67348.2"
FT                   /translation="MGLLSLGTPLDWHESKKHNEHVRENGITQLINIFRQHASRSNDKF
FT                   LWGDEVEYMLVDIDSKNKTARLSIDKDYILDDLNDPDKSLHKSVDNNISFHPEYGRFML
FT                   ESTPASPYNGTCLKDYVYVEENMIVRRKISESELPPHIKPLTLTSFPRMGCNNFTSPPA
FT                   KAIGPASQSLFLPDEIINRHVRFPTLTANIRKRRGSKVAINLPMYPDVNTKLIDDSIPR
FT                   DRDLFVSDKEPWLGAAKPGHVYMDSMGFGMGSSCLQITMQAQDISEARYLYDTLAPITP
FT                   IMLSLSAASPIFKGYLVNQDVRWNVISGAVDDRTFVERDVEPYNGYDLFGGMNVDKRQH
FT                   LPSPKQSVNKYGDINNLTTKDGKPIQKIPKSRYDSIDNYLNDQNYSTNYFKDEYNDIYS
FT                   PINEKVYKRLLEQNSDLFDEYTAKHFAHLFIRDPLVLFSERIDQDNSTENDHFENLQST
FT                   NWQTLRFKPPALYSSDTDLSSKPGWRVEFRPMEIQLTDFENAAYSNFISLLSKAIIKFK
FT                   PNLYIPISKIETNMRLAHNVDSVLNEKFWFKSLDQWNLDNSDFVGYDLSWFDRFLNKGN
FT                   DELGYDEVYVNGYSINGRRRTIEAVNDIDDHGIDERYSINEIINGNDKFPGLIRLVVKV
FT                   IATDLLPEGSHHCENSDLAKNLTRIQKYLQLISQRASGKVPTTANWLRNSVLRSDFYKR
FT                   DSKVSEALNYVLVEKAAAITDLRDKDLLIDLLGETTTEYLLNSI"
FT   gene            217080..218804
FT                   /gene="SMI1"
FT                   /locus_tag="PICST_67999"
FT   mRNA            217080..218804
FT                   /gene="SMI1"
FT                   /locus_tag="PICST_67999"
FT                   /product="Protein involved in (1,3)-beta-glucan synthesis"
FT                   /note="Has EST support; possibly involved through
FT                   regulation of cell wall glucan and chitin synthesis
FT                   chromatin binding protein"
FT   CDS_pept        217124..218695
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SMI1"
FT                   /locus_tag="PICST_67999"
FT                   /product="Protein involved in (1,3)-beta-glucan synthesis"
FT                   /note="possibly involved through regulation of cell wall
FT                   glucan and chitin synthesis chromatin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_67999"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67349"
FT                   /db_xref="GOA:A3LWV9"
FT                   /db_xref="InterPro:IPR009203"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWV9"
FT                   /protein_id="ABN67349.2"
FT                   /translation="MGLMDNFKAFVHSITTDDHYATYDSPYKHTGSANGSNVEGGSGAN
FT                   GSSSRLSELNRLNAYQNSSSHSLVDGSRNSSTSNVGYRPGQKSSGTVTEYPLQTLNQSG
FT                   QPPLPTIDSLWDRIESWIDDEYPELEDYLNDGVTTADLNEFENDLGCGSLPVEFRQFYK
FT                   RHDGQFRGGKPTGLIMGLALLDLEGIAEEYAVWSKVAQRLEGQQYIVQQQQQQQQKETS
FT                   SSAATATQRPLSNTFIANQRSIPPNSVQPYYYHKGWVPILKDHIGNQIALDLAPGPQGI
FT                   WGQVIIFGRDYDTKLVVASSFQEFIFNFVNDLEAGNYEIDSAQLHEDLGYLSNSRNDDY
FT                   MIGDEDEDQGELTFYDQGGKEFGKGALKGVSSYVEVIKRRSLKKYGLTENFSTTFTPVR
FT                   VPVKKPAAPSATESGSNTPLRAQSPSLGQSSTAAKSSGSSPLINVESANKSVTLQRETI
FT                   IDDKLETETENKIEDKIIKEEPEIASKTEESDDALVTAEESEQPEDQPLIEGSEGIEEG
FT                   LKDVAL"
FT   gene            <219423..>219890
FT                   /locus_tag="PICST_22479"
FT   mRNA            <219423..>219890
FT                   /locus_tag="PICST_22479"
FT                   /product="predicted protein"
FT   CDS_pept        <219423..>219890
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_22479"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_22479"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67350"
FT                   /db_xref="GOA:A3LWW0"
FT                   /db_xref="InterPro:IPR004939"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR016901"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWW0"
FT                   /protein_id="ABN67350.1"
FT                   /translation="LLDLSPLANWKLSSYKQGYGLPQLRDDSPDTYWQSDGSNGSNQNN
FT                   SAIMNNELCNPHSITIQFSKKVSLERISIFTNYSLDESYTPSKIKILAGSSDGWDLNEV
FT                   CTVNFSKPIGWSHIIFNGIRSDGVLKCFVVKLIVLANHQDGKDSHIRAIRCF"
FT   gene            complement(<220289..>221191)
FT                   /gene="BNA6"
FT                   /locus_tag="PICST_36541"
FT   mRNA            complement(<220289..>221191)
FT                   /gene="BNA6"
FT                   /locus_tag="PICST_36541"
FT                   /product="Nicotinate-nucleotide pyrophosphorylase
FT                   [carboxylating] (Quinolinate phosphoribosyltransferase
FT                   [decarboxylating]) (QAPRTase)"
FT   CDS_pept        complement(220289..221191)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="BNA6"
FT                   /locus_tag="PICST_36541"
FT                   /product="Nicotinate-nucleotide pyrophosphorylase
FT                   [carboxylating] (Quinolinate phosphoribosyltransferase
FT                   [decarboxylating]) (QAPRTase)"
FT                   /EC_number="2.4.2.19"
FT                   /note="Biosynthesis of Nicotinic Acid Nicotinate-nucleotide
FT                   pyrophosphorylase [carboxylating] (Quinolinate
FT                   phosphoribosyltransferase [decarboxylating]) (QAPRTase);
FT                   go_function nicotinate-nucleotide diphosphorylase
FT                   (carboxylating) activity; go_process NAD biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36541"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67702"
FT                   /db_xref="GOA:A3LWW1"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWW1"
FT                   /protein_id="ABN67702.1"
FT                   /translation="MASAYANLLPVNGRWKQQITDYLTEDVPSFDFGAFVVGDKVETAS
FT                   LYMKQAGLICGVPFAAEVFKQTELEVIWHYKEGQYINNDDLKAEGGKIVVATVKGPANK
FT                   ILLAERTALNLLARASGIATQSYITKKLADESGYTGLIAGTRKTTPGLRHLEKYSMLVG
FT                   GVDTHRYDLSSMVMLKDNHITSTGSITKAVKSARSVCGFAVKVEVEVSTEDDAREAIDA
FT                   GADVIMLDNFSGAELQKVAHNLKSYYKDSQKSYLLECSGGLTLHNLSSFLCNDIDIYST
FT                   SSIHQGTGIVDFSLKINAN"
FT   gene            <221505..>222269
FT                   /gene="ECO1"
FT                   /locus_tag="PICST_48237"
FT   mRNA            <221505..>222269
FT                   /gene="ECO1"
FT                   /locus_tag="PICST_48237"
FT                   /product="N-acetyltransferase ECO1 (Establishment of
FT                   cohesion protein 1)"
FT   CDS_pept        <221505..222269
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ECO1"
FT                   /locus_tag="PICST_48237"
FT                   /product="N-acetyltransferase ECO1 (Establishment of
FT                   cohesion protein 1)"
FT                   /note="Protein involved in establishing cohesion between
FT                   sister chromatids during DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48237"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67351"
FT                   /db_xref="GOA:A3LWW2"
FT                   /db_xref="InterPro:IPR028005"
FT                   /db_xref="InterPro:IPR028009"
FT                   /db_xref="InterPro:IPR033257"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWW2"
FT                   /protein_id="ABN67351.1"
FT                   /translation="KKFQSTLNFPNRNNLVSKSTTCPECHMTYYEYISKEKELHMRYHA
FT                   RYNSGIPWPPSLSTKVVREFMLHRVLEPKQKGFKRVKSSTVSIKAEVVSVDKNSKRQIQ
FT                   KAQTILDMVNRELNAPSDSGSWKKVECESSKAFVIVINGYAIAICNTDPITNVDRQARW
FT                   MVHRLQTVVPNQVVKTAKVGISRIWVAPSWRRNHLAQILLEVVLTNSIFGTTLNRNEVA
FT                   FSQPSHSGGLLAKKFNGVTHKSGELLIPVYLE"
FT   gene            complement(<222379..>223566)
FT                   /gene="YFL5"
FT                   /locus_tag="PICST_62279"
FT   mRNA            complement(join(<222379..223052,223077..>223566))
FT                   /gene="YFL5"
FT                   /locus_tag="PICST_62279"
FT                   /product="Mitochondrial tricarboxylate/dicarboxylate
FT                   carrier protein"
FT   CDS_pept        complement(join(222379..223052,223077..223566))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="YFL5"
FT                   /locus_tag="PICST_62279"
FT                   /product="Mitochondrial tricarboxylate/dicarboxylate
FT                   carrier protein"
FT                   /note="Mitochondrial tricarboxylate/dicarboxylate carrier
FT                   proteins; go_component membrane; go_function binding;
FT                   go_process transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62279"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67703"
FT                   /db_xref="GOA:A3LWW3"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWW3"
FT                   /protein_id="ABN67703.2"
FT                   /translation="MATTSPQSGDSLLTALISGCTAAAVSGTLTYPLDFIKTQQQLNNH
FT                   AYMNKWNIPGNYPGSIAQLYRGCSALVIGSVIKNATRLISYNWSSKFMAIDTYDSQGNS
FT                   KTKTSPPRIVIAGAMSAFIETLWLIPFENIKIVMIQNQTLQNEITRSEKAKIPFDITGG
FT                   RIKHHHQRRLSPGNLFTKQYISPHAYFSSELLAQYNGKHHSKFSHSASHNKLDALISKY
FT                   NKNPTLTYLGTIKEMYQMKGVGAFTAGTFITFTRQMAISWVWLSTYNATRQLIDPHNSE
FT                   QSWFGHKHTAIQSIGLHVLSSIAVIGFTQPLDVIKSHIQSKNGKAIYKDSLSTAYRLFV
FT                   EQGPRSLFKGALPRGLKVLVSGGLTAAIYSYVEDIVNVAGGQTVFAS"
FT   gene            <224019..>226130
FT                   /locus_tag="PICST_32611"
FT   mRNA            <224019..>226130
FT                   /locus_tag="PICST_32611"
FT                   /product="hypothetical protein"
FT   CDS_pept        224019..226130
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32611"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67352"
FT                   /db_xref="GOA:A3LWW4"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR035425"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWW4"
FT                   /protein_id="ABN67352.2"
FT                   /translation="MSDMRSVTEPSTPRHRISVVDTSGSNHSLPPINKADLLSSTIPYR
FT                   SLDPPLFNLRNIHLPPNELTEATAKLSSQIQEQGSRPRSRPRSRPSTPGRRISGSHSRI
FT                   LSQNFNDRRTSDLLARRRRSSMIRTNTGAVVYGPHYVGPITIDYLRFICRVTVRQIERD
FT                   KIRKESFQMHKPNSEIEIASLQTNLDSNGDQLNEPKSERDLSPETPQPRNIDFSPPRPN
FT                   IPNEFDQSLPIPNDIEGILKSPIGYNNEQQASPPSRDPTRTNELEDSTYENKENVPNFL
FT                   VEEKEEPRSKPLSYLEKILLANKKKRQSREESRQSSTRFSLSKSLGEETPQSPELFVAE
FT                   DYDEDQHEPRITKDSEIKGDNFIVESEQMNALPEEVDQDEPQENFNMYDPDERFEDFEI
FT                   RNVLKETTESLSSQMDRSTILGVAQLTPVRDMSYLGPSFSSGSQIVTPQQVRVIDFASG
FT                   ESPSGIIQDHFTLDNDEQFTDIFDVPQEIEKENIKEGTATSKQFDEGLPDLAMKKSKAS
FT                   SKNVSKRSIPISTIKSLVKTIQVHDSSSFDDTTTPSKKVKLSYISQDIFNLIQEKSDIF
FT                   LTSMLEDLDAYSRHRANGKISSINLSDVILYLKRTNFTGLGPNKKMEIDKISQIAQKFL
FT                   PLENLIALDNNLSKLDRRSHASIVENYNEELVQNLNESGNDGNESEEDVAYMSDSDISS
FT                   QNYDDTYLP"
FT   gene            complement(<226242..>228311)
FT                   /gene="MTO1"
FT                   /locus_tag="PICST_32612"
FT   mRNA            complement(<226242..>228311)
FT                   /gene="MTO1"
FT                   /locus_tag="PICST_32612"
FT                   /product="Mitochondrial Translation Optimization"
FT   CDS_pept        complement(226242..228311)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MTO1"
FT                   /locus_tag="PICST_32612"
FT                   /product="Mitochondrial Translation Optimization"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32612"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67704"
FT                   /db_xref="GOA:A3LWW5"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWW5"
FT                   /protein_id="ABN67704.2"
FT                   /translation="MLRLTRLQSNRCVPSFQQRRNILINADLRSKIEESPFFPVVVIGG
FT                   GHAGCEAATGSARSGTPTTLITPNVDKIGTASCNPSMGGVGKGTLLREVDALDGVAARI
FT                   TDKAGIHFKILNASKGAAVHGPRAQIDRKIYLEEMQKEILNYPNLSVLEASVEDIIIEP
FT                   TRDQSTDAEGREFGSVKGLVLGDGSIVGCSKVVVTTGTFLGGEIHIGLTAYPSGRIGED
FT                   ATFGLSETFRTAGFKLGRLKTGTPARLSSKTIDYSNLNVQPSDYPPQPISYMNDKVQLQ
FT                   EQLVNCYQTSTTPEFHKLISENLDKSIHIKETVKGPRYCPSIESKIIKFPQKQSHMVWL
FT                   EPEGLDTDLVYPNGISCTMPADIQEQLVRMMPGCNNVKMIQPGYGVEYDYVDPRELKMT
FT                   LESKLVDGLYLAGQINGTTGYEEAASQGCLAGINAGLAYKGAEPLELTRADGYLGVLVD
FT                   DLITKGIEEPYRMFTSRSEFRISIRSDNADRRLTEKGYNAGVVSEERYHHYMKEMVQFH
FT                   SIKDHLTSLSLSGAIWAPALKGLSSDVNRNTLVDGWKLLSYKGMSIADLLPHMSKFTRD
FT                   GIVPPYYENLSARLMNRIDVESDYTPWMPKEKAHLTAYAADENLLLPVNYNYNYEGKLK
FT                   ISHEVCVLLNTIQPKTIGQARRIQGVTPAAIFELFKLVKGNQAQLAIQRQNLEN"
FT   gene            <228463..>229380
FT                   /locus_tag="PICST_47752"
FT   mRNA            <228463..>229380
FT                   /locus_tag="PICST_47752"
FT                   /product="Predicted DEAD-box-containing helicase"
FT   CDS_pept        228463..229380
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_47752"
FT                   /product="Predicted DEAD-box-containing helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_47752"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67353"
FT                   /db_xref="GOA:A3LWW6"
FT                   /db_xref="InterPro:IPR032704"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWW6"
FT                   /protein_id="ABN67353.1"
FT                   /translation="MTKEEVRIEQSIGDDLGDGLDYDVEFSEPESGARNEISGDEYVNV
FT                   NEDDFQEDIKTAKAKTETNEGKKRKAKSTKLQEKKRLKMEMDTDQKKNLSKESSTETIV
FT                   DYINTKIRQKNSDLSALELGELYFNKSDIRSTSDFNVETRNLDNLSKFIVARFKNMLPS
FT                   TGSKKEKKNKKSSSQKKSKEYTDPNEERKFIAIISMSAIRACDIHRATKELAGSSLKVI
FT                   NKNKIEVDLKLLKTTTSRVLCCTPGRLIKVLDNEDQVLKKEEIKIVVVDNSYLDSKQQN
FT                   IWDIKETTDALKSLTKNGSKVYLY"
FT   gene            complement(<229347..232160)
FT                   /locus_tag="PICST_68000"
FT   mRNA            complement(<229347..232160)
FT                   /locus_tag="PICST_68000"
FT                   /product="hypothetical protein"
FT                   /note="Has EST support"
FT   CDS_pept        complement(229434..232160)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_68000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68000"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67705"
FT                   /db_xref="GOA:A3LWW7"
FT                   /db_xref="InterPro:IPR033370"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWW7"
FT                   /protein_id="ABN67705.2"
FT                   /translation="MSVSSMESPFSDAIEVGDPDAASVDDIFRQMSIPQIHKLSREYKS
FT                   KIEKTKSDLHSLVGSKYRDLIKIAEDIDSMYLISSDVDSKLTDLSYQKSNFIPFSNSNS
FT                   HAKFNTIVRANHAREARRSSRILILRDAVNNILEKFDLKLSINENGSPLVHTSNLIYYA
FT                   KVYYTIESLFADLLERYSNLKQKFLRLKENFINYLENELSSYNLFDNAVYGTTNDKIKH
FT                   NQKLKLSDLNNNRTMSSLADAQVFDDLYQEESFDPIEEDPADSFENDEYIKSKHESYNK
FT                   SSPPIVNYLIAYTIANICNAELNSVQKVLLKFIQLRHNYLESLLNKADTTYDATQLNYF
FT                   VIFKFIENTCGYIEKYFENVHSTYHRSLNLAIRPWKASNLLGFRGWFNEEDVNLKEAYN
FT                   YEVFPLQVSASIENLPNVIYNFMKNKIISTKVEVSFENVWRTLLIYHNFFFGLIRLFDY
FT                   ASFNESQSKLITIIENKKEDNILIQLTKAVKKVIQGAFSDHYGELLSKDNSSIITKIQE
FT                   YIHQRDKSEHSEERLELFSSGLTDLMDANLEMYIGEISNISFASSGETISDSLMKWFDK
FT                   FDDFNILLDLHSAQDDNKLSSFNCLKNLNVFLSRPISETKQEIKWGLFDKQWFESEFSS
FT                   LYKELNSSFSFSINSFVSDLQNILESSESNDIVSYYYLLNILITIKERLTSLDTVNLDV
FT                   ISAESSIDELCKKLFSYSIEELPKDKFFASFDDLVHELVSSSQMEDLPTRPSLKLAASI
FT                   YELATSYLSAGVSDTNHTYEKLFSSVNGSIIFVNLKNKWIQHELINERFDKAIEKLLTK
FT                   DQEEEKVDIELRPKQENQVSNAPSKEVQAVNIFANMVFLYQFITSSEEDSQMFAESTFK
FT                   KLNENGTLIDDVTLRIVTKSIVDYFKSSQTLYLPLSI"
FT   gene            <232641..>233549
FT                   /locus_tag="PICST_32615"
FT   mRNA            <232641..>233549
FT                   /locus_tag="PICST_32615"
FT                   /product="hypothetical protein"
FT   CDS_pept        232641..233549
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32615"
FT                   /product="hypothetical protein"
FT                   /note="go_component nucleus; go_function transcription
FT                   factor activity; zinc ion binding; go_process regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32615"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67354"
FT                   /db_xref="GOA:A3LWW8"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWW8"
FT                   /protein_id="ABN67354.2"
FT                   /translation="MDVSRKKLKTTRSRTGCLTCRKRKKKCDELSYPVCQNCECKNLQC
FT                   SWPPIKLDLHKKLEEVKYTDSSSVTSSSVLTSYEKSSVSGEHSSMEPGSINLKELNNTF
FT                   EMDYLATSASRNNIDLVNLSASSEFGSPTGSTTLHTRVIPKIRRPDQSETSGVKFGHSK
FT                   WTSGHLIDKKKSSRSFSGSVRPHGYFLERIAMQQDCVETEDSVKDFDVDPLVEFSDQTQ
FT                   SPQSSTRSFLDPSSYPDYQFDLLSGKAGLVAGIPIITQSTSNLATPTSFSPRSLNPTIS
FT                   IESNCAKLNSKSPTPETSTNR"
FT   gene            <234217..>234921
FT                   /gene="HAP2"
FT                   /locus_tag="PICST_61386"
FT   mRNA            join(<234217..234294,234307..>234921)
FT                   /gene="HAP2"
FT                   /locus_tag="PICST_61386"
FT                   /product="transcriptional activator"
FT   CDS_pept        join(234217..234294,234307..234921)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="HAP2"
FT                   /locus_tag="PICST_61386"
FT                   /product="transcriptional activator"
FT                   /note="CCAAT-binding factor, subunit B (HAP2); go_component
FT                   nucleus; go_function transcription factor activity;
FT                   go_process regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61386"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67355"
FT                   /db_xref="GOA:A3LWW9"
FT                   /db_xref="InterPro:IPR001289"
FT                   /db_xref="InterPro:IPR018362"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWW9"
FT                   /protein_id="ABN67355.2"
FT                   /translation="MASLSESTYYQDQASAPASTFYNSTNQSDPHTLIDGTGSPSSGSS
FT                   HSTPYYDTMNQTSAQSPVHHQISQQAFYEEQPEQASPPADVSAEQPFYVNAKQYHRILK
FT                   RRIARAKLEENLKIARTRKPYLHESRHKHAMRRPRGQGGRFLTAAEIAEKERLEKLKEF
FT                   EDKQNEDSEESTKLETATKVENESIPAPANGVAEISKGNEANTSEKTNSTTTNVEDSIF
FT                   ENLMSNTE"
FT   gene            complement(<235086..>238049)
FT                   /gene="CSE1"
FT                   /locus_tag="PICST_32617"
FT   mRNA            complement(<235086..>238049)
FT                   /gene="CSE1"
FT                   /locus_tag="PICST_32617"
FT                   /product="CAS specific exportin for Srp1p required for
FT                   accurate mitotic chromosome segregation"
FT   CDS_pept        complement(235086..238049)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="CSE1"
FT                   /locus_tag="PICST_32617"
FT                   /product="CAS specific exportin for Srp1p required for
FT                   accurate mitotic chromosome segregation"
FT                   /note="Importin alpha re-exporter (Chromosome segregation
FT                   protein CSE1) (Cellular apoptosis susceptibility protein
FT                   homolog) with sequence similarity to CAS specific exportin
FT                   for Srp1p required for accurate mitotic chromosome
FT                   segregation; go_function importin-alpha export receptor
FT                   activity; protein transporter activity; go_component
FT                   nucleus; cytoplasm; nuclear pore; go_process apoptosis;
FT                   cell proliferation; protein-nucleus import, docking"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32617"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67706"
FT                   /db_xref="GOA:A3LWX0"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR005043"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013713"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWX0"
FT                   /protein_id="ABN67706.2"
FT                   /translation="MAENSLEAISKYLEQSLLPQHAKLAEGQLKSVETQPGFSINLLHV
FT                   IASTNLQPSVRLAGALFFKNLVKRKWLDADGSNYLLPVEDVNKIKSEILDVMIKLPNQL
FT                   QIQIGEAITLIAESDFPHNWPNLIDNLVGKLSSDDFVSNKAILLVSHSIFKKWRPLFRS
FT                   DELFLEIKLVLDKFTDPFLKLFVGLDHLIETNSDNGALLNIYFENLLLLMQIYYDFNSQ
FT                   DIPEFFEDNMNVLMNIVHKYLKYQSTLITKEDEDEEIDILIKVKTSIIELTSLYVTRYA
FT                   DVFEPLIQPFMTSVWELITTYLSKQQKYDLLVVKALHFLTSVVKIPNFQSYFQSESSIN
FT                   EIIEKIILPNIYFREVEEEMFEDEPINFVRSDLEGSDFDSRRKSATDFLRELKELNSEL
FT                   LTNTVMKYVNQFLSLSTNQDWKNKDIAVYLFSSLATKGSVTNIGVTSTNVLVDVVRFFS
FT                   ENIANDLVNPNAHPILKVDSIKYIFTFRNQLTKEQLITTIPLLINHLSSNENPVVYTYS
FT                   AITIEKLLAMTDFHQNHEPVFNKHDIQPFFTELITKLFNLILLNDSSPEKLAENEFLVK
FT                   AIMRILNTAEDSLTQRLPIIDQLLKILKITAKNPSNPKFSHYVFESLGLLIKFDLNEIN
FT                   KFIELIIPALWDILSEDVQEFVPYTFQILAFLLENYPRSNGLPEAYKSLVKPLMAPTVW
FT                   EFRGNIPGITRLLVAILEHDPSVFAVSQESLTPLLGVFQKLIASKLNDAYGFDILQSIL
FT                   LNIPLNALQPFLNQIGILLLTRLKNSRTDKFVKRFTLFISTLNCISLDPELNKFVNSSA
FT                   INGDFVIGFIDSVQPGVFKQLYSNMILPTTSTIINLQEKKIVNLGVSQFLATESFASTY
FT                   QSLAVPTIEKMTQNINSYAGIAKESGTAAGSMGGNGSIALSNAPLSDLDLDSTSFGSQF
FT                   SKIASISIKPFDPVSKIKNNDYNSIKFGVISNIKKVPVTELNQLNPEATTFLKNLGL"
FT   gene            complement(<238705..>239688)
FT                   /gene="VRG4"
FT                   /locus_tag="PICST_48772"
FT   mRNA            complement(<238705..>239688)
FT                   /gene="VRG4"
FT                   /locus_tag="PICST_48772"
FT                   /product="GDP-mannose transporter into the lumen of the
FT                   Golgi"
FT                   /note="Has EST support"
FT   CDS_pept        complement(238705..239688)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="VRG4"
FT                   /locus_tag="PICST_48772"
FT                   /product="GDP-mannose transporter into the lumen of the
FT                   Golgi"
FT                   /note="GDP-mannose transporter into the lumen of the Golgi
FT                   May regulate Golgi function and glycosylation in Golgi"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48772"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67707"
FT                   /db_xref="GOA:A3LWX1"
FT                   /db_xref="InterPro:IPR038736"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LWX1"
FT                   /protein_id="ABN67707.1"
FT                   /translation="MESSLAAIANSGPISIFSYCVSSILMTVTNKYVLSGFSFNMNFLL
FT                   LAVQSIVCIVTIGSLKSFGVITYRQFNKEEARKWSPIAVLLVIMIYTSSKALQYLSIPV
FT                   YTIFKNLTIILIAYGEVLWFGGKVTTMALSSFLLMVFSSVVAWYGDEAVSGSGNESFIA
FT                   LYLGYFWMATNCFASAAFVLIMRKRIKLTNFKDFDTMYYNNLLSIPILLASSIIFEDWS
FT                   AENLAVNFPSDNRTATIAAMVLSGASSVGISYCSAWCVRVTSSTTYSMVGALNKLPIAL
FT                   SGLVFFPAAVNFWSVASIFVGFAAGLVYAVAKQRQQKENVSLPSSK"
FT   gene            complement(241479..243379)
FT                   /gene="ADE4"
FT                   /locus_tag="PICST_78788"
FT   mRNA            complement(241479..243379)
FT                   /gene="ADE4"
FT                   /locus_tag="PICST_78788"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="Has EST support"
FT   CDS_pept        complement(241607..243199)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ADE4"
FT                   /locus_tag="PICST_78788"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="go_process nucleoside metabolism; metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_78788"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67708"
FT                   /db_xref="GOA:A3LWX2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWX2"
FT                   /protein_id="ABN67708.1"
FT                   /translation="MCGILGIVLNDQRKNAAPELLEGAMFLQHRGQDAAGIVTCGTRGR
FT                   FYQCKGNGMARDVFTQSRMANLMGNMGITHLRYPTAGSSAGSEAQPFYVNSPYGITLSH
FT                   NGNLVNSIELRRQLDEEVHRHINTDSDSELLINIFAAELDKFNKSRVNNRDVFAAVAAT
FT                   MNNIRGAYACIAMLAGYGIIGFRDPNGIRPLLFGERTNKDGTKDYMLASESVVLKAHGF
FT                   DNFRDVKPGEAVIIPKDVSGVNKPEAEQVVEPKLFAPDIFEYVYFARPDSVMDGVSVYR
FT                   SRIDMGIKLAAKITKELKELDIDVVIPVPDTARTSAFQCAVSLNIDFREGFVKNRYIGR
FT                   TFIMPDQQERRSSVRRKLNAMESEFKGRNVLLVDDSIVRGTTSKEIVAMAREAGAKKVY
FT                   FASCAPPIRFNHIYGIDLADTKALVGFNRDEDEIARVIGADKVIYQDLQDLIDCCKSET
FT                   IRNFEVGVFTGDYVTGVEDNYLQELEKIRAQNQRLKDRRDRGFSIDTCIDASDMVDVKA
FT                   EVDISIYNRGDYQ"
FT   gene            complement(244211..246454)
FT                   /gene="DHH1"
FT                   /locus_tag="PICST_90571"
FT   mRNA            complement(244211..246454)
FT                   /gene="DHH1"
FT                   /locus_tag="PICST_90571"
FT                   /product="RNA helicase of DEAD box family"
FT                   /note="Has EST support"
FT   CDS_pept        complement(244490..246019)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="DHH1"
FT                   /locus_tag="PICST_90571"
FT                   /product="RNA helicase of DEAD box family"
FT                   /note="ATP-dependent RNA helicase of DEAD box family;
FT                   go_function nucleic acid binding; helicase activity; ATP
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90571"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67709"
FT                   /db_xref="GOA:A3LWX3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LWX3"
FT                   /protein_id="ABN67709.1"
FT                   /translation="MSEQNWKQNLNLPQRDTRPQTEDVLNTKGKSFEDFNLKRELLMGI
FT                   FEAGFEKPSPIQEESIPMALAGRDVLARAKNGTGKTASFIIPSLQQIKPKLNKIQALIL
FT                   VPTRELALQTSQVVRTLGKHLGIQCMVTTGGTSLKDDILRLNDPVHVLVGTPGRVLDLA
FT                   ARSVADLSECPLFVMDEADKMLSREFKGIIEQILEFFPKNRQSLLFSATFPLAVKSFMD
FT                   KHLNKPYEINLMDELTLRGITQYYAFVEEKQKLHCLNTLFSKLQINQSIIFCNSTNRVE
FT                   LLAKKITELGYSCYYSHAKMPQQARNKVFHEFRQGKVRNLVCSDLLTRGIDIQAVNVVI
FT                   NFDFPKTAETYLHRIGRSGRFGHLGLAINLMSWNDRYSLYKIEQELGTEIKPIPATIDR
FT                   KLYVADNEDAIPKPFKIEQLPKGNEKVHTRAGYEYKGQPEVQSGQQHAQQQLQPSQQPQ
FT                   QQLQQPQQPQAAPQGYPPAFNGYPPYQQYPPQAGGYPPPQFNGYQAAPGQQ"
FT   gene            complement(<246943..>247197)
FT                   /locus_tag="PICST_62738"
FT   mRNA            complement(<246943..>247197)
FT                   /locus_tag="PICST_62738"
FT                   /product="predicted protein"
FT   CDS_pept        complement(246943..247197)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62738"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62738"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67710"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWX4"
FT                   /protein_id="ABN67710.1"
FT                   /translation="MKCPLCSTGLKQHLLNPSLSIIACPSESCVYPFNMSISELHDHNL
FT                   ILSVSTADIMHNVHKKMNDNKDIDEKLAEFIARDDPEVS"
FT   gene            <247421..>250528
FT                   /gene="RIA1"
FT                   /locus_tag="PICST_36549"
FT   mRNA            <247421..>250528
FT                   /gene="RIA1"
FT                   /locus_tag="PICST_36549"
FT                   /product="Translation elongation factor 2/ribosome
FT                   biogenesis protein RIA1 and related proteins"
FT   CDS_pept        247421..250528
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RIA1"
FT                   /locus_tag="PICST_36549"
FT                   /product="Translation elongation factor 2/ribosome
FT                   biogenesis protein RIA1 and related proteins"
FT                   /note="go_function GTP binding; translation elongation
FT                   factor activity; go_process protein biosynthesis;
FT                   translational elongation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36549"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67356"
FT                   /db_xref="GOA:A3LWX5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWX5"
FT                   /protein_id="ABN67356.2"
FT                   /translation="MRLSEETVNKLQSNASCIRNICILAHVDHGKTSLSDSLLATNGII
FT                   SQRMAGKVRYLDSREDEQLRGITMESSAISLYFKVMRRKKDSDETEIKEHLINLIDSPG
FT                   HIDFSSEVSTSSRLCDGAVVLVDVVEGVCSQTVNVLRQCWVDKLKPMLVINKIDRLITE
FT                   WKMSPLEAYQHISRVIEQVNSVIGSFFAGDRMEDDMIWRESGAEGEFVEKDDEELYFTP
FT                   EKNNVVFASAVDGWAFNVNTFAKIYSAKLGFSHSVLSKTLWGDFYLDMKNKKIIPGSKL
FT                   KASQGNLKPLFVSLILEQIWAVYENCVIERNQEKLERIIEKLGAKIGPRELRSKDYKNL
FT                   LNLIMSQWIPISHAILGTVIEYLPSPIVAQSQRIEKILDESIYNVVEIETDKTKLVDGN
FT                   FDKSIRTCDSSDPEHHTLAYVSKLLSIPNEDLPRVGTSAELTADEIKERGRIARELAKK
FT                   ASEAAAAAQGSNTDEFTIVKKDPFEWEFEEEDFEEETEEEDLDVQTETLVGFTRIYSGS
FT                   LSKGQKITVIGPKYDASLPKDSESNKEQIAKEVEIKDLYLIMGRELVPMHTVPAGNIVG
FT                   VVGLDEAVLKNATLCSEILDDKPYINLASTSTLIHNKPIMKIAVEPTNPSKLTKLERGL
FT                   DLLSKADPVLEWFFDDDSGELIMCVAGELHLERCLKDLQERFAKGCEVIVKEPVIPFRE
FT                   GLADDRKNTSNIDENDDEDEKNSLGVDLDFSVSPMPNKITQFLIDHESEIQTIQNKKLA
FT                   TEEQVGLFKKKFKSVLDEEKFYAEFENVEDLVNHLIAFGPKRIGPNIFVESKGNSHKFT
FT                   HLFGDNDSLSKFEFENNVLNGVQLAFNEGPLASEPLQGVIITLKRSEQIMDENGEPVRA
FT                   INQGRIIVHTRNLIHKEFLLKSPRLFLAMYTCDIQATSEVLGKVYAVVQRTGGSIISEE
FT                   MKEGTPFFTIEARIPVVEAFGFSEDIRKKTSGAASPQLVFAGYDMLDIDPYWVPHTEEE
FT                   LEDLGEFAERENVARRYMNTIRRRKGLFVDEKVVKNAEKQRTMRKD"
FT   gene            250799..252710
FT                   /locus_tag="PICST_68004"
FT   mRNA            250799..252710
FT                   /locus_tag="PICST_68004"
FT                   /product="predicted protein"
FT   CDS_pept        250842..252665
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_68004"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68004"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67357"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWX6"
FT                   /protein_id="ABN67357.2"
FT                   /translation="MSIPIEGHKKVPGESSQKPQELPSERPTMSQENGTSSPFSYEDVR
FT                   NFKFLGPSGLTNIQRQKPTTTPPAYVHSIKSRIVPSNSKSPISIPSGANGQLDPKKLFE
FT                   LVSKNYESWSQAMYKQFQEDDNFSPFPNEDDYNEPNGKAGNGSESQPIFNYSLLEALEK
FT                   ASSEFSDKINKLEDDTIQSSREPSVVTPPIEESETETTEPATEPTEPATEPATEPATEQ
FT                   VPEPVKKLVSAKTKRPVRKSVKNGQKKLINPSDSLLKEGEIDTIRERLARLTPENFLQY
FT                   TRFDERKKGFSLYDTTDEEGLHEGNTEVFFDEDGMFHNDQDDYDLEEINDDDQYVYDYP
FT                   PTHHIELELNTAPECDEHGMDGCDCPVYEYEDGEQFRGGEFGDEGPSCEFTFEYDHTGK
FT                   LVPTYSNVEEKMRLMEIQARFIKTMQGQNANGSKGINGGQMKLPSINELDIGNHDLSSG
FT                   SSKSKKKNKKKKKKKNNTGIDETQQASHEIHQQQQQHNHPAAPGSGCCLFCEYELIFGS
FT                   KPRQMMKWYDQRIRRDEQRREEIKKKLENAKSKAMKRQREMRERQLHSQNEDVQQPVAS
FT                   DHKHSDIEHIEEESFDGEHHEEDHVPKSTSI"
FT   gene            <254003..>254419
FT                   /locus_tag="PICST_32623"
FT   mRNA            <254003..>254419
FT                   /locus_tag="PICST_32623"
FT                   /product="predicted protein"
FT   CDS_pept        254003..254419
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32623"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32623"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67358"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWX7"
FT                   /protein_id="ABN67358.2"
FT                   /translation="MFSQSGTNTPIPSNVNVVQYHEQLGETVTWVKDWYSPNLTSNSSE
FT                   DGISDSVRLKGWFRTNMNHKNSSSLSYSHQDVLDLNQWRYHKTSIHAVESTNSVSDSTG
FT                   SVDTNEESQAKVSSKELESAIKFSAEEGSISGLG"
FT   gene            complement(<254526..>256463)
FT                   /locus_tag="PICST_61778"
FT   mRNA            complement(<254526..>256463)
FT                   /locus_tag="PICST_61778"
FT                   /product="predicted protein"
FT   CDS_pept        complement(254526..256463)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61778"
FT                   /product="predicted protein"
FT                   /note="go_component intracellular; go_function exonuclease
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61778"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67711"
FT                   /db_xref="GOA:A3LWX8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR034922"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWX8"
FT                   /protein_id="ABN67711.2"
FT                   /translation="MPEVAVDDPLSKRTARMSISTSDLDAESHNAQIRELLSESGIPGR
FT                   RDSAVSLTSLNEDEIQKSDPNASTDAIRPPTSQKRRRSSAQSFSSTTVAQVNKLIKTES
FT                   LTKGRSRKKSYMSAGSPQLSINVTGEKRLPFRSMRDLILKVFNCTSERPPKWFQFEKAS
FT                   GISKVVVCMVPGLPIHISESITTPQDIYDEKLSFLYETFSDFIATSSPGSKDSLYPSLE
FT                   TLINVPLTKKEKKQLLEDSKNTKITLYDLLMTTDQMVSHNYPVKVDVEKDEKWVETKAF
FT                   DHDGSHTFALDCEFCEAKSGKVLTRISLINFQGEVVLDKYVKPDEEIIDYLTKYSGITE
FT                   EKLANITTSLKDIQEELLSIISADDILIGHSLESDLNVMKFKHLKIVDTAVIYEHVRGP
FT                   PSKPALKWLTSNFLDRQIQCGEVTGEGHSSVEDSNACLDLVKLKLQEGLCFGLNVGEVS
FT                   IFKRLATEHKSRGEDFQSLLINYANHKEQESYAEPSDHNVQRIYVSNDDEVLSRYQEES
FT                   VDKNMVVLNLRELDFTSGRYRVPDHYTGPVSCENNSLLEITLERLKLIYNSLPANALFI
FT                   IHSEVGDPREMFRLQSIRKKFQKMDRDGEDLHQLAKEEIWDSDKLQQLIEETIAAKEAV
FT                   TLVKVKTVDT"
FT   gene            complement(<256893..>257783)
FT                   /locus_tag="PICST_32625"
FT   mRNA            complement(<256893..>257783)
FT                   /locus_tag="PICST_32625"
FT                   /product="predicted protein"
FT   CDS_pept        complement(256893..257783)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32625"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32625"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67712"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWX9"
FT                   /protein_id="ABN67712.2"
FT                   /translation="MTFFSELIPKKELRDLIVVFTSDLQSKIQYSESDTKAIYTISNIT
FT                   AFSVYLEKLLVQEFNQIHVIIQFRSYQRTLEIINFLYRLECNRDAIKQTYQNEFNANLN
FT                   SLSKANETGSLLVGLGPGQCDLPVQFRFSIVLDSSVLLGDPLSKRSIALQQHLRYIALK
FT                   HGGSIYVVSNFKQVLSAPADLVLTKREPQPIYEQEVSDCDSSDQIVINQHIPRAWDSWN
FT                   KILLVSKSANAVSEFLFSNEEDIEQFDKDYTSSFSANSVDATSKLFRSQDSVKTDTEIS
FT                   KPETKSYSLSELLSV"
FT   gene            258163..262014
FT                   /locus_tag="PICST_90675"
FT   mRNA            join(258163..260608,260798..262014)
FT                   /locus_tag="PICST_90675"
FT                   /product="predicted protein"
FT   CDS_pept        join(258336..260608,260798..261869)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_90675"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90675"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67359"
FT                   /db_xref="GOA:A3LWY0"
FT                   /db_xref="InterPro:IPR022591"
FT                   /db_xref="InterPro:IPR040240"
FT                   /db_xref="InterPro:IPR041670"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWY0"
FT                   /protein_id="ABN67359.2"
FT                   /translation="MKIPYILPRLSQLTNKETMVERSRKGNSKVEDETAFNQFVESAEV
FT                   PDDTVIEAIFSERKTEHAVDAVDYEDIDELADEEDLPEEEVSTNNLDDVDENDNFEAFL
FT                   DEPQKEEELQNRANEEFDDMFGDGGFEDAGGNNNLFTDLDHNNHLIDDDGLTDLNMGGI
FT                   FDEETTQSQTSIPSIKKRVLSEEQRKIKRQRLENIVKRLENQRVRRNIAYHFPSYSRNK
FT                   PFNFHNFFLPEPKYYRYQKPYIAYKENIKPLVPTKLSLELEVDERKLFKSRKPLSNSKS
FT                   TKGIVSVTQQDIEFIRDLNSKSSSTETLLKQISFLKNDWTNNDKFTNYSKDLILSTTDW
FT                   NDDAIINAGDTKFAVKKVNFESNTVDTSTFDEEDENIFNGQLNTDLLKLDMNDPNLLFV
FT                   PEKKSNKSKSLIPTNEKLLSLKFNISNDKQYEILKSNYNTKVRSQLSNLNIEHSIPALR
FT                   LQSPYYKVKLTKEESRSFHRPKFVIRPGSLISFSKLKLRKKKKDRGKSLQEVFSKTSDL
FT                   STTDTAPLVAMEYSEEYPLILSNFGMGSKMINYYRKEREDDSSRPKAQIGETHVLGVED
FT                   RSPFWNFGEVAPGDFVPTLYNNMVRAPIFKHEVKNTDFLFIKSQGAGSHQRYFLRAINF
FT                   MFSVGNVFPAVEIPAPHSRKVTNTSKNRLKMVVFRVMNSMGVARVSVKDVSRHFPDQND
FT                   MQNRQRLKEFMEYQRQGDDQGFWKIRNSDSVPNENEIRSMITPEDISLLDSMQYGQQTL
FT                   DDTYIPRDPDAEVDMDEELAPWNLSRNFVNANQTKSMLQLNGEGDPTGIGLGYSLLRST
FT                   QKNGFKPLFAPVRENVPKNNTAAYQQKLYEAEVKRIWYSQRSSLVDHGPDFNLQAIYDE
FT                   YKPVNQMKTIKNMVKQEDKNDFENKVLRITRRVRDENGILQRKVETITDPRLITAYIRR
FT                   KKQIEDEMMKNAEVGDILPTNDKELNKIRRKILEEKLASAEKRAKQNKSKKPPKDSIHA
FT                   AAAAGGTIIDANTVMLPDGSYAIGGKGIGKGKSKTRRCASCGAFGHIRTNKTCPLYAIT
FT                   RGGTVPLQKDEQGNPIIPASVIIPPGMIGITARHAPPVPEQAPASDVAQATSASPPAPA
FT                   TAAPTDQ"
FT   gene            263311..265261
FT                   /gene="GAP1.6"
FT                   /locus_tag="PICST_78721"
FT   mRNA            263311..265261
FT                   /gene="GAP1.6"
FT                   /locus_tag="PICST_78721"
FT                   /product="amino acid permease"
FT                   /note="Has EST support"
FT   CDS_pept        263322..265115
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="GAP1.6"
FT                   /locus_tag="PICST_78721"
FT                   /product="amino acid permease"
FT                   /note="go_component membrane; go_process transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_78721"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67360"
FT                   /db_xref="GOA:A3LWY1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWY1"
FT                   /protein_id="ABN67360.2"
FT                   /translation="MSYEKGKNPSSLDEEAHSYRNSPAIQDDDRSSSYSSGSYYSESKG
FT                   GSAFTRFIDSFKPIDLEEDGIDTTNMTPMEKSIIASARHPLARRLKSRHLQMIAIGGSI
FT                   GTGLFIGSGYSLYMGGPAGLLIGYLLVGYSMLCVIYGLGELSVQFPVSGSFNAYFTRFV
FT                   DDSWGFTLGLLYATSWLVSFPSELIACSMTIQYWNTSVNPAVWVAVFYVVIVSINFFGV
FT                   KGYGEAEFYLSIIKVVAVVGFLIVGVCIICGVGEGGYIGGRYWHNPGSFNHGFKGVCSV
FT                   FIGAAFSFGGIELVALAAAETRNPRKSLPKATKQVFWRITIFYILTAIIIGFLVPYNNP
FT                   MLLSGNSSEDIVASPFVIAIQSGGIKVLPHIMNAVILVAVVSVGNSSVYGCSRTLASLA
FT                   VQGLIPSIFGYIDRAGRPMVAIMFTNLVGLLGFLVASENQGTVFTWFFSICSLAAFFTW
FT                   IAICFTHLRWRWALAAQGRSLDEVAFVSPLGTFGSYSGILILSLIVVGEIWISIWPIGE
FT                   PASNITFWQNCLSLPLMLVSIIAHKTWYRSWNRIMVKLEDVDLDTGRRDVDVELLKQEI
FT                   ADERETLRQQPFYLKFYHFWC"
FT   gene            complement(265555..267869)
FT                   /gene="HBR1"
FT                   /locus_tag="PICST_68007"
FT   mRNA            complement(join(265555..266714,266805..267390,
FT                   267469..267869))
FT                   /gene="HBR1"
FT                   /locus_tag="PICST_68007"
FT                   /product="zinc finger transcription factor"
FT   CDS_pept        complement(join(265953..266714,266805..267390,
FT                   267469..267683))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="HBR1"
FT                   /locus_tag="PICST_68007"
FT                   /product="zinc finger transcription factor"
FT                   /note="heme binding fungal transcriptional regulator HBR1;
FT                   go_function heme binding; transcription factor activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68007"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67713"
FT                   /db_xref="GOA:A3LWY2"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LWY2"
FT                   /protein_id="ABN67713.2"
FT                   /translation="MTKRLSPHEKKNRKPASRACVFCHEKHLQCSNERPCKNCVKRGLA
FT                   HECRDVIRKRAKYLNTNSRRGSEAQAHADYPHNPIDGFMSPTIKPEIPSPASNMVVSPQ
FT                   FVGNALLQQEVQHPQQFHPQQQQKLSLHNSMLNTTNDVLNRLLEEQNFKDTDSDNMSAN
FT                   SVNASRPNTAIGTGTFSSNYLNEEYLMLGDIILHSKPTSPSPSNTSVSEYNTNTVSPNF
FT                   SSQINYDDLNQPRRKVLQRLKDSRPFISLGFSNESSQLPNLNSSNIAQSSSIPTEYVSP
FT                   LVTHHLYQSVQDIYTNNIMNFDYPQSYHSLTHFLKKRFSGNNLPAEQKQAKRQSLLVIL
FT                   KLIASYRPTFISAHKSLLKPYDLQFLEMTFQRCLIDYEKLSQLNSSPTIIWRRTGEIVS
FT                   ITDDLLSLLGYNLADLLSHRTFIMELMYDDESITNYFRLFKTVAVGNLHSSIITKIKLT
FT                   KNQNRNVSDQTGTRRLSYELSERDHIEFCSVWTVKRDMFDLPMMIIGQFLPILPAGDGV
FT                   RMY"
FT   gene            271432..273346
FT                   /locus_tag="PICST_78790"
FT   mRNA            join(271432..272196,272419..273346)
FT                   /locus_tag="PICST_78790"
FT                   /product="predicted protein"
FT   CDS_pept        join(271841..272196,272419..273280)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_78790"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_78790"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67361"
FT                   /db_xref="GOA:A3LWY3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWY3"
FT                   /protein_id="ABN67361.1"
FT                   /translation="MSVLFLKYALKPFLFVFQLLNRIFWSGLNGRTVFQLVLNFWLNFS
FT                   PVFIWLLMFKNAGIIPKEIRPKIYVALAMHVDDYMFNFVGHPLISTVALVSLVSGAWLI
FT                   YYVFYRTPTSKKQEHSIEFFKNLSSNAISTQTSETNRRIWRTIKTRGYGPLNCWNLSPP
FT                   ILMALSWFLLNIDYWFKDPINTPKDLLAWTSYVLFHFFVPLFTAIWLYVFHAPGALRLF
FT                   SFGLGMQNIAGVCTHLLFPNAPPWFIHLYDEDAEATYDLPGYAAGLTRVDMAMGTHLNS
FT                   NGFHASPIVFGALPSLHSAMAVMAFFFVSYYSRWTTLKLLAASFVALQWWATIYLDHHW
FT                   RLDLVVGMLYAITSFTLLYCWPRGIKKVDSDFMKARLRFDFKNGSTMGMRVFRNTRLQN
FT                   FFDPLA"
FT   gene            <274767..>276587
FT                   /locus_tag="PICST_32630"
FT   mRNA            <274767..>276587
FT                   /locus_tag="PICST_32630"
FT                   /product="predicted protein"
FT   CDS_pept        274767..276587
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32630"
FT                   /product="carbohydrate metabolism, cell wall maintenance"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32630"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67362"
FT                   /db_xref="GOA:A3LWY4"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="InterPro:IPR009644"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWY4"
FT                   /protein_id="ABN67362.2"
FT                   /translation="MLHLLHNRKYKVLTLLFLAVVAACSLNLFIATRIDQKYLESTALK
FT                   LHGDSKFNPRASTRAVFKFVSDRIKHNSQVSRAGNPDGIYFHWDDWVDLSPADRILNRY
FT                   RKGFPLGECDDIIEDFAKVNGYRMESYNRKVLRGMANLYCSKEVPDRIILTTDNEMIEV
FT                   PVVGKRRMGYDSKPIKMNKQMLIRKMKKVEKSVVHSNFTTYPIKALQSNLDISVADFLF
FT                   DPEAETFKLQEKESQTKLTSEESTYLEFLQTSSELSDHADKFFKYPWIVTDVVQGRSHH
FT                   IAYPFFKRFIGDRERQSIIHHMIRAWFSFAETTGYASWIAHGSLLGWTYNGVNMPWDTD
FT                   VDIQMPIVQIDKLGRYHNNSIIVENPRYGNGKYYLVVAPTYLKYGNGRNFIDARFIDIN
FT                   SGLYIDISAVQYTGDVPPNNEQNERRDLSQLWVHCKNWNWNSLDEILPLRHTYFEGGSA
FT                   YIPKKVTQIMSRKYGSDSMSDYSFHHHNFQKDIDLWVPDEICSKPPKIKTRFNEHGGLS
FT                   YKGACHSPVLSDEYDIVKPSADRHKLLNKNLDNPATYRVEEMGELPFLRKDAWDYFNDL
FT                   NENLVHCTGWAINEPVVGKIYETGKANEKQ"
FT   gene            <276858..>277877
FT                   /gene="GRP1"
FT                   /locus_tag="PICST_36555"
FT   mRNA            <276858..>277877
FT                   /gene="GRP1"
FT                   /locus_tag="PICST_36555"
FT                   /product="Cinnamyl-alcohol dehydrogenase Flavonol
FT                   reductase/cinnamoyl-CoA reductase"
FT                   /note="Has EST support"
FT   CDS_pept        276858..277877
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="GRP1"
FT                   /locus_tag="PICST_36555"
FT                   /product="Cinnamyl-alcohol dehydrogenase Flavonol
FT                   reductase/cinnamoyl-CoA reductase"
FT                   /EC_number="1.1.1.195"
FT                   /note="Cinnamyl-alcohol dehydrogenase Flavonol
FT                   reductase/cinnamoyl-CoA reductase GRE2-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36555"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67363"
FT                   /db_xref="GOA:A3LWY5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWY5"
FT                   /protein_id="ABN67363.1"
FT                   /translation="MSKVFITGASGFIAQHIVKLFIDNGYSVIGTVRSIEKGEALKTNL
FT                   NVGDRFQYEIVAEISSPDAFDEALAKHSGVKYLLHTASPFFYDSTDPEHDLVIPAINGT
FT                   KNVLNAIKKFRPEIEKVIITSSDAAIYSSVDEQNPALSFDETSWNNITYEEAIKDPIAA
FT                   YYGAKSFAEKLAWKFLEDEKPSFKIISVNPVYVFGPQAFESEVKEKLNTSNELIHSLIK
FT                   LGPNDTFDVDKGGFIDVRDVAKAHLAAVENDNLIGKRLYMTNGHFSTQMMVDILNKNFD
FT                   NLRGKIPVGKPGTGSEDIKTLAKVSNRTTKKLLGWEFITLDKIVVDTVTQIQKVRSKL"
FT   gene            complement(<277958..>279613)
FT                   /gene="SEO2"
FT                   /locus_tag="PICST_48956"
FT   mRNA            complement(<277958..>279613)
FT                   /gene="SEO2"
FT                   /locus_tag="PICST_48956"
FT                   /product="Suppressor of Sulfoxyde Ethionine resistance"
FT   CDS_pept        complement(<277958..279613)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SEO2"
FT                   /locus_tag="PICST_48956"
FT                   /product="Suppressor of Sulfoxyde Ethionine resistance"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48956"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67714"
FT                   /db_xref="GOA:A3LWY6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWY6"
FT                   /protein_id="ABN67714.2"
FT                   /translation="MKKLPWFIPQYREVNDYESESISLLSNKVGDEASLNSLSENSKDV
FT                   VDEIVIKEYRDESLRPWWKFFDEYEYRPTPEAGKKQEWWRFRWFSKTLSTEERNLLIKL
FT                   DLTVGVYALLGYWIKFLDSANLNNAYVTGLKEDIGMKGNDLIDTQVIFLVGNIIFELPW
FT                   LFLLPRVSLPYVLFGAELIWSFFTLITFKVSTPAMLKAFRFIIGSAEAPFFVIFHYSAA
FT                   SWYKPTEIGTIGAIFYCGQFIGVLTSGFLQGAASTIQGNLKGWQYMFIIDGSISLFVAI
FT                   LTLFLQPGTPSRCYSIWLTDDEIRLGRKRMKENGTDMSHDVKSFFDKQTWKKIITSWQF
FT                   WVLSFLQMFGFNTNNTSSGSFALWLKSLDRYSPKKLNDLTTIPPALGLIWIMIVCVGAD
FT                   ITGKRFGMVFFSFIMNFISNIILAVWNVPESAKWAGFYLSYWSWSQSSVFNPLISDILR
FT                   HDSNQRAIEWMIIYIMGLQSSAWVSRLAFPTVDAPRFLAGFTTCAVLSLAFNLLLIVAY
FT                   FFYKRDERKSAIKNGIYVYNSTKGETPEFIQMHKQ"
FT   gene            <279889..>281094
FT                   /locus_tag="PICST_36557"
FT   mRNA            <279889..>281094
FT                   /locus_tag="PICST_36557"
FT                   /product="predicted protein"
FT   CDS_pept        279889..281094
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_36557"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36557"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67364"
FT                   /db_xref="GOA:A3LWY7"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWY7"
FT                   /protein_id="ABN67364.2"
FT                   /translation="MSALSAEELDRKYNVRPFVDPEPTKIDVNPLVLTAIDLSLFKEGD
FT                   EHLNERKSLAKVLESSVTTYGFFNLVNFGIPKERIEHIRAISQSLLTIPYEEKLKYLAS
FT                   AATKEEEKPKSIGAERGQGFKPKGYWSIKNGIRDSIDFYNVRDTYHDSFLETPEAHPEL
FT                   LQVHLKEVADYYNHLHRVVLPKLLRLFDLIFKIPEGTLLKRYFHKSGTNEDTSGSHGRL
FT                   MLYRPYENQQEFEQTDKMFLRGHSDISALTFITSQPILALQIMDVYTGAWRYVAHRDDS
FT                   LIVNIGDALEFISGGHFKACLHRVVEPPADQRGFNRLVVIYFCNPSDNSEMDPELLDSP
FT                   ALRRLGYTREDKLKQWEKIQFHDWNTTKGELLGRTAAGERNLLQYHGRYIERWHRFSEL
FT                   AN"
FT   gene            <281772..>283595
FT                   /gene="MDR2"
FT                   /locus_tag="PICST_32634"
FT   mRNA            <281772..>283595
FT                   /gene="MDR2"
FT                   /locus_tag="PICST_32634"
FT                   /product="multidrug-resistance transporte"
FT   CDS_pept        281772..283595
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MDR2"
FT                   /locus_tag="PICST_32634"
FT                   /product="multidrug-resistance transporte"
FT                   /note="multidrug-resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32634"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67365"
FT                   /db_xref="GOA:A3LWY8"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWY8"
FT                   /protein_id="ABN67365.2"
FT                   /translation="MSRDSSTEAPQALVEDPEKQSQKKVFIESDAGDGTKREDQYLHGI
FT                   HLVFCFIAVCLSLFLEALDQTIVATILTTVGNKFDDFDKVGWLASGFLLAMAVCIQPFG
FT                   KFSIIFGRKYTMVTAIVLFEAGSLMCALAKNMNVLIGGRVLAGIGAAGIQGMVFVIVTE
FT                   VVPIEKRPIGMAIVSCIFAVASVLGPLIGGAFTSHVSWRWAFYINLPIGGIALAFLLWA
FT                   FNPPKCTSSIVEELKTFDYFGTFLLISGCVVFLLALTFGGNDFSWHSAAVILCFVLGGL
FT                   LLIAFIIWNGWFSKNQIIAVELIKIPQVVASIFAISGIFAAFILSMVFLPIYFQVIHGA
FT                   SAMGAGLHLLPMIVAVVLSSICSGVAIQKSKYVKPFSLVAGILGPIGFGLLAILGVDTS
FT                   FSAQVGLLIIGGVAVGAQMQPAIVSAQISAPKTPGSTIMVTVLLNFSRSLVSALAADLG
FT                   DVIYASSFKNYFKKAFKATTNTTILSDLQDVDISQLVSNTSLLAHLNPVTQHFVKTQIA
FT                   KALRNVFYMGIGLAAITFVACFFITNKKLPEMSDGAANAAEKEKEEKTELTSDSNDIQS
FT                   EAVHEIAEGADFEKKSIQASGDESSTSITRK"
FT   gene            284746..>289562
FT                   /gene="MDR1"
FT                   /locus_tag="PICST_65867"
FT   mRNA            join(284746..286437,289496..>289562)
FT                   /gene="MDR1"
FT                   /locus_tag="PICST_65867"
FT                   /product="multidrug-resistance transporte"
FT                   /note="Has EST support"
FT   CDS_pept        join(284804..286437,289496..289562)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MDR1"
FT                   /locus_tag="PICST_65867"
FT                   /product="multidrug-resistance transporte"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_65867"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67366"
FT                   /db_xref="GOA:A3LWY9"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWY9"
FT                   /protein_id="ABN67366.2"
FT                   /translation="MSRDSSTEAPQALVEDPEKQSQKKVFIESDAGDGTKREDQYLHGI
FT                   HLVICFVAVFLSMFLVALDQTIVTTILTTVGNKFNDFDKVGWLASGFLLAMAVCIQPFG
FT                   KFSIIFGRKYTMVTAIVLFEAGSLMCALAKSMNVLIGGRVLAGVGAAGIQGMVFVIISE
FT                   VVPIEKRPIGMAIISSVFAVASVLGPLIGGAFTSHVSWRWAFYINLPIGGIALAFLLWA
FT                   FNPPRPTSSIVEELKTFDYFGTFLLISGCVIFLLALTFGGSDFSWDSAAVILCFVLGGL
FT                   LIIAFIIWNGWFSKNQIIAVEVLKIPQIVASTFALSGVFAAFILSMVFLPIYFQVIHGA
FT                   SAMGAGLHLLPMIVAVVLCSIISGVGIQKSKYVKPFSVAAGILAPVGFGLLAILGVDSS
FT                   FSAQVGLLIIGGIAVGAQMQPAIVSAQICAPKTPGSTIMVTVFLNFSRSIASALAADLG
FT                   DAIYASSFKNYFKKAFKATTNTTILSDLQDVDISELVSNTSVLAQLNPVTQHFVKTQIV
FT                   KAIRNVFYMGIGLSAITFIACFFVTNKNLLKNVQKDHQRSTVQFTPQFA"
FT   gene            289730..290595
FT                   /locus_tag="PICST_68010"
FT   mRNA            289730..290595
FT                   /locus_tag="PICST_68010"
FT                   /product="predicted protein"
FT   CDS_pept        289732..290478
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_68010"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68010"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67367"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWZ0"
FT                   /protein_id="ABN67367.2"
FT                   /translation="MGCDRRLLNIISDITDLSFERFSKGISETNYQILCNEMRRKLDSM
FT                   SLNLMETMLIPESLSTPSASSEPSTPAEAELCLINSEMEVEEFCFLLSCEVKRLSTVVY
FT                   LECCLLNKTPEDEMIQQLVKQIFSLLEFIVIKNDFKWYSTLLWSVFMASSEISSLSKDC
FT                   EELRYLALQILDILEKTTLGNVGRTRKILLDIWKRRDLEQSDDNSYGYVRKTIDDGNPK
FT                   NDGLFLGFTNDWEKFVVKEDYAISLA"
FT   gene            complement(<290639..>292048)
FT                   /locus_tag="PICST_48836"
FT   mRNA            complement(<290639..>292048)
FT                   /locus_tag="PICST_48836"
FT                   /product="predicted protein"
FT   CDS_pept        complement(290639..292048)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_48836"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48836"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67715"
FT                   /db_xref="InterPro:IPR010856"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWZ1"
FT                   /protein_id="ABN67715.2"
FT                   /translation="MTPTKVVTTTEPPDLENRFIDIKRSLVSPENIEKVTQSWKRLLRA
FT                   LEKQADTISEEGPKYVPQVDFKDIVANNNQLPDNVSALFKERGTLMIHNVVDEEQIDTW
FT                   FNELVGFCKEHPETAGYTYPNPTAWYNVFWSKPQSEARFHPNTRALFKAMANQFHVENE
FT                   DSLIDINTQVVYGDRIRIREPGSVASLKLHLDSSSIERWEDEHYRQAYHEILEGNWEEW
FT                   DAFRLDERTYANENLYEHVLTGKSTICSAFRTLQGWLALSNNKSGEGTLRVLPNLKMAM
FT                   AYIILRPLFWRDPVSGDIDDYEIDLETPKFPGSVPSTGQLFLPEEYFPHLYHQKSVISI
FT                   PDVRKGTFVFWHVDIPHEVDKEHNGEGHSSVFYYGQTPLSITNIRTILDTKKAFLNNKS
FT                   PEDYSSQLSETEKAKEYQGADINHIKNIEGMRSMGLEPFDVNEPFLTKGQREVRALANE
FT                   ALKAGTFDPHS"
FT   gene            <293451..>294263
FT                   /locus_tag="PICST_32638"
FT   mRNA            <293451..>294263
FT                   /locus_tag="PICST_32638"
FT                   /product="predicted protein"
FT   CDS_pept        293451..294263
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32638"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32638"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67368"
FT                   /db_xref="GOA:A3LWZ2"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWZ2"
FT                   /protein_id="ABN67368.2"
FT                   /translation="MNLHPWPNKRNPSPYEIFDLSDGDMSLSQLEMNKLLKKKYVSYVK
FT                   LYHPDLSKNLQIYHKGSLLSENIKRQRFDQVQEAYDILKDPRRRVAFRRYTTNNWDEAP
FT                   RYNQNTAPFSKQNYEAYRRAQGHRSSKSFKADEEFWSAGTWEDYYKMKYNRAPPTKEEL
FT                   EKNKYKILAGVLLVASLAFSLQIMLALDRTNEYLLQSRLTNLQVMEDLQHSTDNYGDGL
FT                   QPLDRMRRFLISRRSTLLMKEKGDIVDDTDLKNQDDELLIKYAQKVEK"
FT   gene            <294674..296139
FT                   /gene="ARO7"
FT                   /locus_tag="PICST_73224"
FT   mRNA            <294674..296139
FT                   /gene="ARO7"
FT                   /locus_tag="PICST_73224"
FT                   /product="ARO7"
FT                   /note="Has EST support"
FT   CDS_pept        294674..295477
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ARO7"
FT                   /locus_tag="PICST_73224"
FT                   /product="ARO7"
FT                   /EC_number="5.4.99.5"
FT                   /note="Chorismate mutase; go_function chorismate mutase
FT                   activity; go_process aromatic amino acid family
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73224"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67369"
FT                   /db_xref="GOA:A3LWZ3"
FT                   /db_xref="InterPro:IPR008238"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR037039"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWZ3"
FT                   /protein_id="ABN67369.2"
FT                   /translation="MDFTKPETVLDLNNIRQALVRMEDSIVFDLIERSQFFSSPSVYEP
FT                   NKFKIPNFNGSFLDWALLQMERAHSQIRRYEAPDETPFFPNDLLPTILPSINYPKILAN
FT                   YADEINVNDNIKKFYVEEIVPQISCKEGEQQENLGSVSTQDIECLQAISRRIHFGKFVA
FT                   EAKYQNDKPLYIKLIKEADVDGIEASITNSAVEQKILERLVIKAESYGVDPSLRYSQNP
FT                   QSKINPQVIAKLYKDWIIPLTKKVEIDYLLRRLEDEDQSQIEKYV"
FT   gene            <296949..>299264
FT                   /locus_tag="PICST_32640"
FT   mRNA            <296949..>299264
FT                   /locus_tag="PICST_32640"
FT                   /product="predicted protein"
FT   CDS_pept        296949..299264
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32640"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32640"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67370"
FT                   /db_xref="InterPro:IPR021829"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWZ4"
FT                   /protein_id="ABN67370.2"
FT                   /translation="MSETLLDLFPTDISKLQVVTSISIVCGLIFLSAKVNQTVHSLLVF
FT                   AWACFIKPLIQKKTSGKKKDQQHSLEQFYKNQAHIYDTTREFLLKGRQECLRLAVSHLQ
FT                   KKKELVWIDVGGGTGSNIEYMDQFCSISENFKAVYLVDLSPSLCEVARARFAARNWKNV
FT                   KVIVADACDFEIDYKTADLITFSYSLSMIPTFNAAIDNAVTKLDKQGIIAAVDFGIQSF
FT                   DTSMGRINTVGGLVNRNIPWVLRNFWRIWFEADKVFLDSSRRNYLEYKFGTIKSLNTYN
FT                   KKLGKIPYYIWIGCDKSKSQNILHRLNCLATESPYLAPSTTPITTALKDVPISKGHEAA
FT                   LTNLQKNLPFPSFYYQREIWRVYYEELNQHYEQFKNQYIYAFTWEDPREDHNILKFNSN
FT                   DTVLAITSAGDNILSYATLPDPPKRIHAVDLNPCQNHLLELKLAAFRSLTHQQIWQMFG
FT                   EGKIENFTDLLIDKLSPHMSSNAFQYWMDRGHKCFSKNGLYDTGSSRWALRLAKYTFKA
FT                   FGVTKDIKQLCEAATMDEQMKIWEERVKKSLFNSVVATLLVGNPLFLWKALGVPANQAS
FT                   MMGESVFKYVVDTIEPLLKRSLISKDNYFYYLCLMNKYAYNNCPDYLTVKGYKRLTAQT
FT                   TPQRENPLDNIRIHTDFLNDVFARLSKKSLTIAIIMDHMDWFDHDSKDVNDEISVLKES
FT                   LVDGGRVLLRSASQHPWYISTFESMGFSCKAAAVRISGESIDRVNMYASTWVCTKLPTK
FT                   EDEEEIGIGRRRMSSLKI"
FT   gene            299760..300565
FT                   /gene="LYS7"
FT                   /locus_tag="PICST_90546"
FT   mRNA            299760..300565
FT                   /gene="LYS7"
FT                   /locus_tag="PICST_90546"
FT                   /product="copper chaperone involved in lysine biosynthesis
FT                   and oxidative stress protection"
FT                   /note="Has EST support"
FT   CDS_pept        299780..300526
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="LYS7"
FT                   /locus_tag="PICST_90546"
FT                   /product="copper chaperone involved in lysine biosynthesis
FT                   and oxidative stress protection"
FT                   /note="go_function metal ion binding; go_process metal ion
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90546"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67371"
FT                   /db_xref="GOA:A3LWZ5"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWZ5"
FT                   /protein_id="ABN67371.1"
FT                   /translation="MSNTFEIVLAVPMECQACVDSVSTVLKKTEGIKNFKVDLGANLVT
FT                   TEGSIPPSEIVKAIQSTGRDAIIRGTGKPNSAAVCILESFDPKDFQQPVKGLARIVSVS
FT                   QNDLFIDLTVNGLPKGTYYPSIRSSGNLSQGALSTGSLFYQLQPVEVELPSTLSTTINA
FT                   LGATVVEQDGLFSGQSFLHAKLSIDDLIGRSVILSKLKDEVTSDSLCGVIARSAGVWEN
FT                   DKQVCTCSGKTVWQERTDALNKGISV"
FT   gene            <301481..>304360
FT                   /locus_tag="PICST_62257"
FT   mRNA            join(<301481..302420,302589..302664,302698..303382,
FT                   303413..304125,304210..>304360)
FT                   /locus_tag="PICST_62257"
FT                   /product="predicted protein"
FT   CDS_pept        join(301481..302420,302589..302664,302698..303382,
FT                   303413..304125,304210..304360)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62257"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62257"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67372"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR019487"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWZ6"
FT                   /protein_id="ABN67372.2"
FT                   /translation="MSQSYLLHKSQLWPLLTDQLDAVHRKKSIKLANLPGSKLVVSDII
FT                   EVIKDFVNSYNPPLELERLSLQSCQLSEISGNFSSFSSSIKYLDLHQNNVHSISESIIS
FT                   CFPSLEILDLSSNNLSTLPGNLSQLKNLRIISIRNNKFKYLPPVLAELPSINLMEIAEN
FT                   PLVVPSLELIRSLQKSNSDYDWILELKSYLMAHKSLLDFKIQEQQQNLQKQSQPLSAPP
FT                   ALPNGQQPMLTRPKSISDKSKASRAARRMGLLIKREDASSPPSSADASSVSIHDSTNDT
FT                   FASSGVSNANSTLDDTTASFPFASQAQTNGNHTSNSPTSIAAPISKTANASVASSNTTR
FT                   NRSRSNTLKEIDRILEKNDKVDTEHKSGAYFRRLSTLQEIPGDKKDVQSENVRSIQNSQ
FT                   TTKTNEDTITKTHSAANRTAPAIVSNDISPSRTNPVAVANKKHSISSIVKVSRKVLFSF
FT                   SELHSSVRRFTGFCADKKVTMKMVSLLYTTKSNIDSLVENLEIMEETGTNLDQIVASLH
FT                   VCISSFKAIMTLLSENFASFVDKIDVCFIRMLYLTLYGSFNELLNAYRTLFNVPVTAAA
FT                   TESTKQKLSINTTHFDHDDVDEKLYVTIDSATTTAQNIFSELNKAINKSAIASASSSDP
FT                   ATNASVANKVNELTNVCVSFFDITKRLKTKLITIRNNPSQTTKKSFGEDINLFIKSIVQ
FT                   TLACVKGIVKDLPILDDIRASMSTLTKTAKEVTYMLEVSSYKTLATDSTGTQYPPALVS
FT                   IPSVSNLFTPVSAHPPLQSPSSVNLAQLASNGNMGVTRTPLTSSLTASSIKTPGLVNGH
FT                   NIGPLTAPTQSSGQYYAKNGMNPFDGLIMASRNHDREIVDAE"
FT   gene            306257..307262
FT                   /gene="YMC2"
FT                   /locus_tag="PICST_84609"
FT   mRNA            306257..307262
FT                   /gene="YMC2"
FT                   /locus_tag="PICST_84609"
FT                   /product="mitochondrial carrier protein"
FT                   /note="Has EST support"
FT   CDS_pept        306263..307165
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="YMC2"
FT                   /locus_tag="PICST_84609"
FT                   /product="mitochondrial carrier protein"
FT                   /note="Carrier protein, mitochondrial precursor;
FT                   go_component membrane; go_function binding; go_process
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_84609"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67373"
FT                   /db_xref="GOA:A3LWZ7"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWZ7"
FT                   /protein_id="ABN67373.1"
FT                   /translation="MTIELEEPPLTQDNNQVFKDLLGGTMGGIAQVLVGQPFDTVKVRL
FT                   QSAPEGTYSGALDVIKRLLKNEGPRGFYKGTLTPLVGVGACVSVQFSVNEYMKRYYDQK
FT                   LQGQPLSLAQFFTCGAVAGFANGFLASPIEHIRIRLQTQTGSEKLFNGPIDCAKKLYNA
FT                   KGLGHGIYRGLVPSLFRESVGLGIYFATYEALIARELKKDKSIARSDISSLKLCLFGGL
FT                   SGYTLWIAIYPVDVIKSKLQTDSLTKPNFTGSIDVVRKVFASSGIKGFYRGFIPTILRA
FT                   APANGATFAVFEITMRFLG"
FT   gene            complement(<307381..>309132)
FT                   /gene="MEP3"
FT                   /locus_tag="PICST_47780"
FT   mRNA            complement(<307381..>309132)
FT                   /gene="MEP3"
FT                   /locus_tag="PICST_47780"
FT                   /product="putative ammonium transporter"
FT   CDS_pept        complement(307381..309132)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MEP3"
FT                   /locus_tag="PICST_47780"
FT                   /product="putative ammonium transporter"
FT                   /note="with sequence similarity to S. cerevisiae MEP genes"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_47780"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67716"
FT                   /db_xref="GOA:A3LWZ8"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWZ8"
FT                   /protein_id="ABN67716.2"
FT                   /translation="MSDDTDILDLRSGLNSLYMIYCTSLLPLVIIGIAFFYSGLTQRRS
FT                   SLTMFAIPFLISPLIFIDWFIWGYSLCYAKASNKFIGSMEFVVLRHLKDSLLTVYANTR
FT                   GEIFALNHFLFNGLFKVICAALTFPGCIAERGRMLPMLVFLFFWSCMIYNPVTYWFWNP
FT                   NGWLSVDLNKLPVLDFAGGNCIHIVSGFTSLAYSYILGPRNPKILYNYRNINTGHIIFG
FT                   TFLVMCGWVGFVGGCDFKFSPYSLFIFVNTILCACVGGIVWMSIDYYYSSIPLEGTQDS
FT                   DNQDEQQQNRHVDSSARLSPLTSHLSNVAPVISETGVLLNQHLRETKSNFVERRKFSMI
FT                   SFSSGIMTGLVVITPGGGYVSSPNEFWKSIVYGVVGAICCNLSTRLKYFFHIDDALDIF
FT                   AIHGVAGFVGSILTGIFANKQFNSDGGWVVGHWKQVGYQLLGSVVTASYVFIMTYFFLY
FT                   IIDLVPGLHLRIDKTFNRRMKEEKMKAKAEGKDEESKMSTADHPHADDMSFLEAAELMG
FT                   TDCYEFNGEYMMDFVEFIKVLRPQDYEEDQLEELYPNTDTQFENIHGLGSDYEMQHEGG
FT                   THLTKRE"
FT   gene            complement(<309396..>311519)
FT                   /gene="PLB2"
FT                   /locus_tag="PICST_62092"
FT   mRNA            complement(join(<309396..309747,309805..>311519))
FT                   /gene="PLB2"
FT                   /locus_tag="PICST_62092"
FT                   /product="phospholipase B"
FT   CDS_pept        complement(join(309396..309747,309805..>311519))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PLB2"
FT                   /locus_tag="PICST_62092"
FT                   /product="phospholipase B"
FT                   /EC_number="3.1.1.5"
FT                   /note="go_function phospholipase activity; go_process
FT                   phospholipid catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62092"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67717"
FT                   /db_xref="GOA:A3LWZ9"
FT                   /db_xref="InterPro:IPR002642"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A3LWZ9"
FT                   /protein_id="ABN67717.2"
FT                   /translation="DEKEYTTRRNSKTEISLREFFKNSKIPGFNYDLFSRLKAKPTKIA
FT                   LAFSGGGYRSMLIGAGCVAALDIRNENTSERLGGILQASSYIAGISGGSWLVMSQFVND
FT                   FPTIDGLKESWDLEHQLLEGVPSFDPIGIQTQVRIQDNKSGTEIKKEEPLKKKSQEETS
FT                   FFGNIYSFFVKKTPNQLLLTKDDMNGPSPNNMIVKFMKSMFVNNNNNNSVTPNIKGYTR
FT                   DTPLEKIFSYYKELQIEVRDKRKAGYQISLTDYWGRTIARRIFRSTARSPGATMSTSIQ
FT                   MSSFQNYEQPFPIITTIERDPRYIETNIDSHQFEITPFEFGSWDSFLNGFLPIKYLGTK
FT                   LINGSSTSRTDNNSYARCVTGFDNIGFLTGTSSSLFNHIFVYLYQILLDIKSEASTAVG
FT                   TILKSLGLSSEFRSLMNPSLHPDNAIYSPNPFYGYENKHGCDGRNITSNENLYLFDGGD
FT                   DGQNIPFQPLLVSSRELDIILAFDLTADYLNYPNGTTLVRSQERFHNRDSKMGTPKFTL
FT                   ASTYNGTTRSSVRSSFPFAPSPEEIVENGLNKRPLFLGCDVYQDYPELDVKWMNNYSSK
FT                   IDNKNSSFHLPPLIVYYSNGDYGYKANTSTFQLSYSKDEVDGMVSNGINLATFNNSSYY
FT                   EMCLGCALLKREFDRLELDHKTDAYGNSLFTTPAICRRCYADFCWKGSIRAIR"
FT   gene            complement(312001..315291)
FT                   /gene="ETF3"
FT                   /locus_tag="PICST_90176"
FT   mRNA            complement(312001..315291)
FT                   /gene="ETF3"
FT                   /locus_tag="PICST_90176"
FT                   /product="translation elongation factor"
FT                   /note="Has EST support"
FT   CDS_pept        complement(312115..315261)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ETF3"
FT                   /locus_tag="PICST_90176"
FT                   /product="translation elongation factor"
FT                   /note="Elongation factor 3A (EF-3A) (EF-3) (Translation
FT                   elongation factor 3A) (Eukaryotic elongation factor 3)
FT                   (eEF3) (Yeast elongation factor 3); go_component membrane;
FT                   go_function ATP binding; go_process transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90176"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67718"
FT                   /db_xref="GOA:A3LX00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040533"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX00"
FT                   /protein_id="ABN67718.1"
FT                   /translation="MSAASESKYSTEVLSELLAKLQVADNKDDAAASLSSFLNSSIVEH
FT                   DAPVEFFQDLKKQISNKATAIGALQAYRHIASANALSPSIEPYVVELVADVAAKAGDKD
FT                   KDVQTAASDALLAISTAITPTAIKVLLPKLLESLTTTNKWTEKVAVLRSITQLVDTAKD
FT                   QIALRMPELIPVLSESMWDTKKEVKEASTATMTKSTETIDNKDIEKFIPKLIECIAKPT
FT                   EVPETVHLLGATTFVSEVTMATLSIMVPLLSRGLAERDTAIKRKAAVIVDNMCKLVEDP
FT                   QVVAPFLDKLLPGLKANFQTMADPEARDVTQRALNTLKRVGTVGEDDVIPEVSTAGDIP
FT                   VTLGEFEKLLEGKNINKRFDVVKTYIAAIAGDLIDEREIQPEAWLHNILPFATIFLHEA
FT                   ESKDIIEEFRKRALDNIPQPPAFEDEEDEGEDLCNCEFSLAYGAKILLNKTQLRLKRNR
FT                   RYGLCGPNGAGKSTLMRAIANGQVEGFPTQDECKTVYVEHDIDGTHADTTVTEFVIQDG
FT                   EVGLTEEVVTEKLIEFGFSDAMTKMPIQSLSGGWKMKLALARAVLKNADILLLDEPTNH
FT                   LDTVNVAWLVNYLETCGITSIIVSHDSGFLDNVCEYIIHYEGFKLRKYKGNLSEFVKKC
FT                   PSAQSYYELGASDLEFRFPEPGFLEGVKTKQKAIVKVSSMSFQYPGTTKPQIQDINFQC
FT                   SLSSRIAVIGPNGAGKSTLINVLTGELLPTTGEVYVHENCRIAYIKQHAFAHIDNHLDK
FT                   TPSEYIQWRFQTGEDRETMDRASRQISESDEQNMNKIFKVEGTPRRIAGIHARRKFKNS
FT                   YEYEISWNLGENVGMKNERWVPMMSVDNTWLPRGELMETHSKLVAEVDMKEALASGQFR
FT                   PLTRKEIEEHCAMLGLETELVSHSRIRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYL
FT                   DRDSLGALSKALKAFEGGIVIITHSAEFTKDLTEEVWAVLDGRMTPSGHNWVQGQGAGP
FT                   RLENKEDDEEDKFDAMGNKVAGAKKKKKLSSAELRKKKKERMKKKKELGDAYVSSDEEF
FT                   "
FT   gene            <317330..>318892
FT                   /locus_tag="PICST_62196"
FT   mRNA            <317330..>318892
FT                   /locus_tag="PICST_62196"
FT                   /product="predicted protein"
FT   CDS_pept        317330..318892
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62196"
FT                   /product="predicted protein"
FT                   /note="go_function catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62196"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67374"
FT                   /db_xref="GOA:A3LX01"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR030667"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX01"
FT                   /protein_id="ABN67374.2"
FT                   /translation="MLIDKESRYDRQLRLWASTGQTNLENSHICLINATPTGSEILKNL
FT                   VLPGIGEFTIIDNRRVTPQDLSGNFFLKRQDLNQVLADAVKANLSELNSEVCGHSINRS
FT                   IISILSEESHQFWDQFNVVIVSDYVPQLELLKEILWNKKTPLLIVNTIGFYGSLNIIAN
FT                   EITVIETHDPSRLYDLRIDKPWPELQAFVNSIDLDSLDDTDHAHVPYIVIYIKALQTWK
FT                   VDHNGSVPQNYHEKKLFRSYIEQLSRNINLEANFIEASNSIHRALQTTGIPISIQKLFE
FT                   KVTAANESFDASTPIFWIFIKALKRFVEKNDNQLPLPGTLPDMASDTTSYLCLQTIYRE
FT                   KAWKDQELFTREVIKVLEEVGRSKEELNRDSITSFCKNSQMLYVTSGSKKLYSSSLIQE
FT                   LLNSSNDAENDPYNTLGIYFAILTYNLFIEKCNRSPTLKDLDLLEILFADNILNRSSVP
FT                   SSVITTFRELLSHNTRHYHNINSLMGGIASQEVLKLATAQYTPLDNLFVFDGIRSVSEK
FT                   WKI"
FT   gene            complement(<318927..>320780)
FT                   /gene="SPB4"
FT                   /locus_tag="PICST_62830"
FT   mRNA            complement(<318927..>320780)
FT                   /gene="SPB4"
FT                   /locus_tag="PICST_62830"
FT                   /product="ATP dependent RNA helicase"
FT                   /note="Has EST support; involved in the maturation of 25S
FT                   ribosomal RNA"
FT   CDS_pept        complement(318927..320780)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SPB4"
FT                   /locus_tag="PICST_62830"
FT                   /product="ATP dependent RNA helicase"
FT                   /note="involved in the maturation of 25S ribosomal RNA;
FT                   go_function nucleic acid binding; helicase activity; ATP
FT                   binding; go_function nucleic acid binding; helicase
FT                   activity; ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62830"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67719"
FT                   /db_xref="GOA:A3LX02"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR025313"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LX02"
FT                   /protein_id="ABN67719.2"
FT                   /translation="METKKGSLDWKNLQYDLQPWIKEAIASLGFPTMTPVQAATIPLLS
FT                   GNKDVVVEAVTGSGKTLAFAIPVLQKVSNRLYDSQEEGEAPEKVKQGHMLAIVLSPTRE
FT                   LASQIQSVFNNVIEYLPEDKIPIKTQLLVGSLSTVRDDLDRFLKDKPHILIATPGRMLD
FT                   FMSSQYVKMNSVEIAILDEADKLLDFSFEKDVVNILKRLPKQRRTGLFSATISAAGNTI
FT                   FRAGMNNPVKVAVKSKSTTANSAPSALHISYLMIEPEKKITTLIKLLHDYRYKKCIVYF
FT                   PTCTSVKHFYSIFQKIVNGNDNTESFKFYSLHGQLATKPRLRTLQSFTDGDVALNKHIL
FT                   MTTDVAARGIDIPDVDLVIQLDPPTDPDVFLHRCGRTGRANKVGRAIVMLNDGSRELDY
FT                   VDFMEVKGVAMQEMPTPDLNQSDHQQFQDKLRKYMLDDRARHEIAIKSYVGFVRYYTKH
FT                   MATSIFRYQTLDYLGIAKMYGLLRLPKMPESKYIPNDNMPDDGWLGEPIDMDKYSYADN
FT                   QQEASRLENLNAEKIKKIADAKRRKELKVKNEAWSSKTETKETKQERREKMKRKREAIE
FT                   KQIMEESSDDEETKVDWKDIVKSNKKKKANSGSMQGSFDDL"
FT   gene            321058..322639
FT                   /gene="DEG1"
FT                   /locus_tag="PICST_84338"
FT   mRNA            join(321058..321358,321404..322639)
FT                   /gene="DEG1"
FT                   /locus_tag="PICST_84338"
FT                   /product="pseudouridine synthase"
FT                   /note="Has EST support"
FT   CDS_pept        join(321148..321358,321404..322590)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="DEG1"
FT                   /locus_tag="PICST_84338"
FT                   /product="pseudouridine synthase"
FT                   /EC_number="4.2.1.70"
FT                   /note="tRNA pseudouridine synthase 3 (tRNA-uridine
FT                   isomerase 3) (tRNA pseudouridylate synthase 3) (Depressed
FT                   growth-rate protein DEG1); go_function pseudouridylate
FT                   synthase activity; go_process tRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_84338"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67375"
FT                   /db_xref="GOA:A3LX03"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR041707"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX03"
FT                   /protein_id="ABN67375.2"
FT                   /translation="MLRYRPTWAMLKRTFSSMTKTEARVDYENWTKEQLIERIQQLENS
FT                   SSKLNSTLPVASPVVNDAVASAKDIRSKKKKKVRTFDMNKYNKRFIALKFAYLGWNYNG
FT                   LAYQSEPTPLPTVEEVVLKALTMSRLITEPTPDKCKFSRCGRTDKGVSAMNQVISLVVR
FT                   SNLNEEEQLLKENDHKEIKYLSIINALLPPDIRMTAVCLRPPPKFDARFSCDYRHYRYL
FT                   FKKHDLDIELMNEACIKYIGSHDFRNFCKIDGSKQITNYVREVYSMKIIHLKDDFYAVD
FT                   LKGSAFLWHQVRCMVAILFLIGQKLEATTIIEDLFDLEKYPTKPVYEMANDIPLVLYDC
FT                   IYPEMEWLSPIGSEGTIEKFYKHFAMFRGQVLDYQVKANMIGIMEPLVMKDAPEIENTQ
FT                   KRGTMNVGDGSGRNYSKYVPISKREVGETVEAINSRHKEKKRKRAIALSEANSRADSEV
FT                   SSILEEQ"
FT   gene            complement(<322632..>323348)
FT                   /gene="SNF8"
FT                   /locus_tag="PICST_36569"
FT   mRNA            complement(<322632..>323348)
FT                   /gene="SNF8"
FT                   /locus_tag="PICST_36569"
FT                   /product="sucrose non-fermenting"
FT   CDS_pept        complement(322632..323348)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SNF8"
FT                   /locus_tag="PICST_36569"
FT                   /product="sucrose non-fermenting"
FT                   /note="involved in glucose derepression"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36569"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67720"
FT                   /db_xref="GOA:A3LX04"
FT                   /db_xref="InterPro:IPR016689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040608"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX04"
FT                   /protein_id="ABN67720.2"
FT                   /translation="MSNRNDDAYTKLGRSLSERHSDQLSTQLAVFQSALINFASDHGDE
FT                   IKSNSEFRNKFTHICQSVGIDPLDLLLYSSSLSNTKSSQDSNYTISLAVRIVEVCQETR
FT                   DVNGGLIRLKELVSIIRENTYINIEVTEANIEKSLATLTTLGKGYEILTISGKKWLKFT
FT                   SAIGGSITNDQKKIYEICGFMGGFVTYRLLRDNYGWDKVRCKSVIDEMIMNGFLWVDSQ
FT                   GEKGEWQYWEPSWISS"
FT   gene            complement(<323942..>326116)
FT                   /gene="DUR5.1"
FT                   /locus_tag="PICST_49064"
FT   mRNA            complement(join(<323942..325810,325946..>326116))
FT                   /gene="DUR5.1"
FT                   /locus_tag="PICST_49064"
FT                   /product="urea transport protein"
FT   CDS_pept        complement(join(323942..325810,325946..326116))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="DUR5.1"
FT                   /locus_tag="PICST_49064"
FT                   /product="urea transport protein"
FT                   /note="go_component membrane; go_function transporter
FT                   activity; go_process transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49064"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67721"
FT                   /db_xref="GOA:A3LX05"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX05"
FT                   /protein_id="ABN67721.2"
FT                   /translation="MSQSVELLGQGAGYGILVGVGALFAGGMILTTKLLQKYLNENAHS
FT                   TETFSVANRSVGTFLSASAVYSSWSWATELLWVSTMVYSYGIQASYYYGAGLAVQIAVM
FT                   SLIGIHAKKKVPTAHTSLEIVELRYGRANHLLYLFLALANNLLSCSSMILGASGAISII
FT                   AGNLHPVASTMLIPFGVLLYTVVGGLKATFLTDFVHTLILLLILCYLNTSVLTSDQIGG
FT                   LDGLYDLLVKKDGERYIAGNYDGSILTGKSQGALFFGLILTCGNFGLTVLDSSFWQKTF
FT                   SASPKATVPAYLIAAFFIFANVWPLGSIIGGAAIVLDGTPGWPTYPRALTQYEIDSGFV
FT                   LPYVLKQVLGNGAVGALLLIIYLAVTSTVSAQMISVSSILSFDIYKKYINPRAQNKHMI
FT                   RISHIGVVFFGLFCAAFSVMLHYVGVNMTWYGYFYPLIICPGVIPLIFTITWDRQTALA
FT                   VFVAPIFGLVFGITIWLTTAYHYYGKITIVSTGGQLPALFGSLTALLLPGIVSIIVSLA
FT                   YPSKFDWKKLQEADLLITQEEDKPDSESNGEYSDEVNEKREHTHTTINETGSKEELSSK
FT                   ELDEKLIGEELELHQLTERELDFWIKIATGAAIFILLITWVLWPLPLYRNWKFSRAYFK
FT                   GYVTVSLIWLYGAFIVIGLVPLVAGRKSFYKVFNGVYRDYIKRD"
FT   gene            <328853..>330814
FT                   /locus_tag="PICST_36571"
FT   mRNA            <328853..>330814
FT                   /locus_tag="PICST_36571"
FT                   /product="predicted protein"
FT   CDS_pept        328853..330814
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_36571"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36571"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67376"
FT                   /db_xref="GOA:A3LX06"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX06"
FT                   /protein_id="ABN67376.2"
FT                   /translation="MSYDPIPVPKEIQVTIGKGISGTIAIPHSAEAENPYEDGYAPATH
FT                   KAALILHGQGGHRDYCYQKRLAHKLAADLGIYSLRIDFRGCGSSAENEDAQKGRVLAQD
FT                   VDDIQACAEFLRDGKLNPLGMSFTLSSIIGHSRGSVAMFLWAMLQDEYSKLGDPNAIIV
FT                   PNLINCSGRFSSPTVADRYPLHDEFFKEVPMMCLRHGQMSEILIPKSELVSLSKPDLSK
FT                   LHGLTTEWSVLSIYGLEDEIIPINDSSLYANALNRGYFSHRLELIPKADHNFYGVEPIE
FT                   HDDHNIEQNPENLPLNKKQVVNYNFKVIDIIANFLSPENELQRFLHTSLEIGRLSRWKN
FT                   VEGVSNFRDIGGWKIHNPTFPLNSSSSFPEKSALQYYVKPHTAFRCANISGIKPAGLKT
FT                   LQELGVKAVFDLRSDGEVEQDGVPQNLEQYGIKRIHAPVFSKDDYSPHAIAIRYTNLMT
FT                   SWNTYVHVYENMLEFGIGAYRTIFEYILKENKPFVFHCTAGKDRTGILGMLILLLLGVD
FT                   KNTIAKEYELTTIGLRPDHPQLREKFVETTRKLREKLGDNSDVELLISQGRKNWTIEED
FT                   GFNNLISSRYEAMLATIEMFHDTYGNIVKYMKTELGFTDSEIKRIYENLIIIDPQSRGF
FT                   EVSGALNWDHRNSGRVKL"
FT   gene            complement(<330918..>331394)
FT                   /locus_tag="PICST_62274"
FT   mRNA            complement(<330918..>331394)
FT                   /locus_tag="PICST_62274"
FT                   /product="predicted protein"
FT   CDS_pept        complement(330918..331394)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62274"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62274"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67722"
FT                   /db_xref="GOA:A3LX07"
FT                   /db_xref="InterPro:IPR018607"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX07"
FT                   /protein_id="ABN67722.2"
FT                   /translation="MPSAIVDLSGVRSIANSERSSVNTPDDVISTPFGLSLIEIQGELN
FT                   LPHEAPINVQKNDTNAEYIRNFVTVDEIKHAVNFGQLQLDEKDPSKVTLFIGKSQRLLG
FT                   SIVELDLPLGVMKIPLNQDTSPENGNEKQKEDIQIVDIVRKKMIFKQRPLPIMQ"
FT   gene            <332261..>333685
FT                   /locus_tag="PICST_36572"
FT   mRNA            <332261..>333685
FT                   /locus_tag="PICST_36572"
FT                   /product="predicted protein"
FT   CDS_pept        332261..333685
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_36572"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36572"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67377"
FT                   /db_xref="GOA:A3LX08"
FT                   /db_xref="InterPro:IPR021460"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX08"
FT                   /protein_id="ABN67377.2"
FT                   /translation="MSATNYTAVYGLMQLLRYQNNYPDLSSGSWPQAQQGRNLLGSIPP
FT                   VMQQFTTDYQINLFGDYPGPSDLVPSVIFAVIFGIIALAHLFIFIMNYSRGHYFWLSLG
FT                   WFIYGVMRVIGFSLRPVWGRDLSYVLYGPPCEVFLILPSILIVSFNLILAQRIFTWRHP
FT                   VGGSRKLFWGVMITLYVVVAGVVAMTIVASIVPYLYFLSERVYTRYKKVVQVTSVLVSL
FT                   YSLTSISLLGLAYFFKPTKKDEDLYTFQPWWIESFSPLYYVKKGAAQEAAQSFARRHSI
FT                   HRRAIRVIPASHHHYRIVEGLSKERGNINHNASLLLITVTTVLIFVGCILRAIVVFQGR
FT                   YRKDSSILCRPVAMYIVWGVFELFINLCYLIGRVDLRFYRPDRLPKDIRDIMTANVSQE
FT                   PSLISRESESDGFESPEENDKETYDDSEGFDFSDPEPASSVRGPYEPPKRPFQIPYPVD
FT                   EKYIHKEDDEDEEFHF"
FT   gene            <333956..>334765
FT                   /locus_tag="PICST_32655"
FT   mRNA            <333956..>334765
FT                   /locus_tag="PICST_32655"
FT                   /product="predicted protein"
FT   CDS_pept        333956..334765
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32655"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32655"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67378"
FT                   /db_xref="GOA:A3LX09"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR022238"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039769"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX09"
FT                   /protein_id="ABN67378.1"
FT                   /translation="MSRPEELAPPEVFYNDTESFKYTSSTRVQHIQAKMTLRALELLNL
FT                   EKEQPHFLLDLGCGSGLSGEILTEEGYNWIGMDISPSMLATGLDRDVEGDLFLSDLGNG
FT                   VPFRAGTFDAAISISAIQWLCNADTAGVDPKKRLLCFFNTLYSSLRRGGKFVAQFYPMN
FT                   DSQTEAILGAAKVAGFGGGLIIDDPDSKRHKKYYLVLTAGLSERTVNLTGATMEAPVMN
FT                   KKVNKKLLRKMESGKDFINRKKETMKRRGKKVALDSKFTGRKRRPRF"
FT   gene            <335065..>335643
FT                   /locus_tag="PICST_36574"
FT   mRNA            join(<335065..335077,335213..>335643)
FT                   /locus_tag="PICST_36574"
FT                   /product="predicted protein"
FT   CDS_pept        join(335065..335077,335213..335643)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_36574"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36574"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67379"
FT                   /db_xref="GOA:A3LX10"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX10"
FT                   /protein_id="ABN67379.1"
FT                   /translation="MFGLNVPTVYEPLPKKRGGENAISYLHKQLVQKYDPTGKRRALVD
FT                   SKTGLRAGDVIKVTYMDRTDVVGRVLGIKRGQNNVGTNILIRNKINRVGCEVRIPLFSP
FT                   KLRNIEVLYKPKKYLSRAKQYYIRNTKLDVDDVEAYVKRQQHK"
FT   gene            <336822..>337100
FT                   /locus_tag="PICST_49015"
FT   mRNA            <336822..>337100
FT                   /locus_tag="PICST_49015"
FT                   /product="predicted protein"
FT   CDS_pept        336822..337100
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49015"
FT                   /product="predicted protein"
FT                   /note="go_component nucleus; small nucleolar
FT                   ribonucleoprotein complex"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49015"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67380"
FT                   /db_xref="GOA:A3LX11"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR034110"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX11"
FT                   /protein_id="ABN67380.1"
FT                   /translation="MASASNPSLTPDQFIGSNLRVAIKDGRVVTGILTVIDPFGNLLLS
FT                   NVIEESEDIISPPGIHKRDIGLVSVPRETIVTVSVDTNTHRRLFSKK"
FT   gene            complement(<337312..>338136)
FT                   /locus_tag="PICST_61692"
FT   mRNA            complement(join(<337312..337539,337714..337747,
FT                   337775..>338136))
FT                   /locus_tag="PICST_61692"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<337312..337539,337714..337747,
FT                   337775..338136))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61692"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61692"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67723"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX12"
FT                   /protein_id="ABN67723.2"
FT                   /translation="MSWFCSITLMALVIAYVNATPPACFLSCIAEVAKTCPLQKMDITC
FT                   LCAKEDSVLGCMVDICPYGTFFSGRDHFIGTCMEHGKPSISNPHPPDPIYPPKLSSSIS
FT                   TKPTPISSFSSTITDGLVSLSKPARSSIQQIETGKPESDCDSDTESEDEYNSDEDCEWE
FT                   ETQSVDADGNVIFIRRPINVPQKYRNPKNNGKTRKVIIKKPPQDY"
FT   gene            <338989..>339426
FT                   /locus_tag="PICST_23026"
FT   mRNA            join(<338989..339240,339268..>339426)
FT                   /locus_tag="PICST_23026"
FT                   /product="predicted protein"
FT   CDS_pept        join(338989..339240,339268..>339426)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_23026"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_23026"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67381"
FT                   /db_xref="GOA:A3LX13"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX13"
FT                   /protein_id="ABN67381.1"
FT                   /translation="MQGSYKNNGLPRPYYMKPQSKRKHSPYDNMKMPVAFFTSSPRKIL
FT                   GYLILLSLFGTCVYWISQDMRPSPPPSYEIIKPETIKATKIANAVGSKADKEALNIDLA
FT                   ENLAAGSKGQKGIGVAEAPKGGIANEAAVVGSD"
FT   gene            complement(<340508..>342019)
FT                   /locus_tag="PICST_61460"
FT   mRNA            complement(join(<340508..341840,341865..>342019))
FT                   /locus_tag="PICST_61460"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<340508..341840,341865..342019))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61460"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61460"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67724"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX14"
FT                   /protein_id="ABN67724.2"
FT                   /translation="MKFAKVLEQTLIEDDIPEEWMEAAIQYKALKKCINKVVNELKFLG
FT                   LEKNTLNKIVELDENDTTASNPIVAEYTLTKSKDNSHDIKPMLKITLDYSNDQYTDDHI
FT                   YELGQQLKKRIESLLNDDAPLQHLKPPPLESFKADTPEVDSSEDSDTEKIIELKEENDE
FT                   IIVISPAHSREGSPPAVAKSISEKSEATNIDSALSESTPPATHNRKKNEIYIMLNSDSK
FT                   FFQMLEGELENLDKLKTAEEKKLIDEVQELGGIVATLSNNASRWKNSDMYTWRELFRIY
FT                   LDSEVFFKYNETSLLSSQRNSEQIKKNLAQFLDNVEKSGILQKFKNSKSLDAFNQFVSM
FT                   NYHLLKILQFQSINTEAFRKILKKFDKQTSLGISHKFPELVSNDHIFITGTSIAQSICY
FT                   ILQNRVLTLIPQLEDYTCPICMSIAYKPIRLQCGHLFCVRCLVKLKQQNKINCPICRNE
FT                   NAILIADGSNLDMDAMNVMEKYFPVEVKEKLRDRKKEQ"
FT   gene            <344383..>345426
FT                   /gene="ARR4"
FT                   /locus_tag="PICST_48071"
FT   mRNA            <344383..>345426
FT                   /gene="ARR4"
FT                   /locus_tag="PICST_48071"
FT                   /product="pump-driving ATPase"
FT   CDS_pept        344383..345426
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ARR4"
FT                   /locus_tag="PICST_48071"
FT                   /product="pump-driving ATPase"
FT                   /EC_number="3.6.3.16"
FT                   /note="Putative arsenical pump-driving ATPase
FT                   (Arsenite-translocating ATPase) (Arsenical resistance
FT                   ATPase) (Arsenite-transporting ATPase); go_component
FT                   membrane; go_function ATP binding; go_process anion
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48071"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67382"
FT                   /db_xref="GOA:A3LX15"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027542"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LX15"
FT                   /protein_id="ABN67382.1"
FT                   /translation="MDFELEPTLESIVQQDTLKWIFVGGKGGVGKTTTSSSIAVQLALN
FT                   HPNDQFLLISTDPAHNLSDAFCQKFGKDARKVDGLSNLSCMEIDPEAAMSDLQQQAQQY
FT                   NNDPNDPLKSMMNDMTGSIPGIDEALSFMEVLKHIKSQKVDENDDKDKISYRTIIFDTA
FT                   PTGHTLRFLQLPSTLQKLLSKFQALSGKFGPMMSMLGGGNQQEMFDKLNEVQKNVTEVN
FT                   EQFTNPDLTTFVCVCISEFLSLYETERMIQELMSYNMDVNSIVVNQLLFADDDEKPCKR
FT                   CVSRWKMQKKYLDQMAELYEDYHLVKMPLLGTEIRGVENLKKFSKFLLTPYDPKVNGDL
FT                   VTSLEEK"
FT   gene            <345686..>345841
FT                   /locus_tag="PICST_47694"
FT   mRNA            <345686..>345841
FT                   /locus_tag="PICST_47694"
FT                   /product="predicted protein"
FT   CDS_pept        345686..345841
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_47694"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_47694"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67383"
FT                   /db_xref="InterPro:IPR007513"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX16"
FT                   /protein_id="ABN67383.1"
FT                   /translation="MARGNQRDLARAKNLKKQQDAAKNAKKSGDPAKRMESDAEKMRRK
FT                   QAEGMW"
FT   gene            346280..347397
FT                   /gene="DLH1"
FT                   /locus_tag="PICST_78962"
FT   mRNA            346280..347397
FT                   /gene="DLH1"
FT                   /locus_tag="PICST_78962"
FT                   /product="carboxymethylenebutenolidase"
FT                   /note="Has EST support"
FT   CDS_pept        346524..347333
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="DLH1"
FT                   /locus_tag="PICST_78962"
FT                   /product="carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="go_function hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_78962"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67384"
FT                   /db_xref="GOA:A3LX17"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX17"
FT                   /protein_id="ABN67384.1"
FT                   /translation="MLIEETYHDVKTSYGTTMRLFVFHPKVPNYPKVKFPGVIVYSEIY
FT                   QVTGPVSRFAKDIAGQGFIVVCPSIYHNFESYEALTYDDEGTDKGNKYKIEKELKSYDE
FT                   DNNLSIEYLLSLPTCNGKIGATGMCLGGHLAFRSSLDPRVKAAVCFFATDIHIHALGKG
FT                   KNDDSLKRSSEIKGEIIMIFGCKDNHVPLEGRDLIRSTLRANNVDMTFIEINDAQHAFV
FT                   RDELSKGRYDPATTKNCFEWLLELFNRKLKLDYGDHDGKAEVIENIC"
FT   gene            <347640..348873
FT                   /gene="TIF34"
FT                   /locus_tag="PICST_90188"
FT   mRNA            <347640..348873
FT                   /gene="TIF34"
FT                   /locus_tag="PICST_90188"
FT                   /product="Eukaryotic translation initiation factor 3 39 kDa
FT                   subunit (eIF3 p39) (Translation initiation factor eIF3, p39
FT                   subunit)"
FT                   /note="Has EST support"
FT   CDS_pept        347640..348692
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="TIF34"
FT                   /locus_tag="PICST_90188"
FT                   /product="Eukaryotic translation initiation factor 3 39 kDa
FT                   subunit (eIF3 p39) (Translation initiation factor eIF3, p39
FT                   subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90188"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67385"
FT                   /db_xref="GOA:A3LX18"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR027525"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LX18"
FT                   /protein_id="ABN67385.1"
FT                   /translation="MRPIKLMGHERSLTQVKYNREGDLLFSVAKDNAASIWYSSNGERL
FT                   GTLEGHQGVIWSIDVDPDTHLCATGGGDLAIKLWKVETGKCVFTWESPSPVRRVAFSPD
FT                   GSRLLAIADQVMGHIGTIVVYEINHDDESLTNQSTEPSLVIETPQDGAKATVAGWSANG
FT                   EFIISGHDDGYIYKYDAQTGEAVNSLEAHGIHTEEKNVTVTDIQFAAEDRSYFITSSKD
FT                   KCSTLIDVDTFEILKVYKADAPMNTAAITPLKDFVILGGGQEARNVTTTAESQGKFEAR
FT                   FYHKVFEDEIGRVKGHFGPLNTVAVHPDGTGYSSGGEDGFIRVHTFDKSYFDFYVDAAE
FT                   KNTEKSAEKA"
FT   gene            <349209..>350168
FT                   /locus_tag="PICST_32663"
FT   mRNA            <349209..>350168
FT                   /locus_tag="PICST_32663"
FT                   /product="predicted protein"
FT   CDS_pept        349209..350168
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32663"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32663"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67386"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX19"
FT                   /protein_id="ABN67386.2"
FT                   /translation="MLDFYYPNKSYPFVVENGILSDLINRFDRSAIIPSQQELYRIRQQ
FT                   QERERYARRQAALREREYERICRQQAYHQLSRPSHLKQLETSQDYQIQVFKRYGDFNNY
FT                   QIRVVKNSDEVFLKIHSDEDDFDRSFHLDEESIDVHNVTWKWLKGNNALVVYLPKLDVA
FT                   VTSPLTKEEKRKFKKQQVTEKIHKSKQRRLEKKLKKRAERELAHKQREEARISRKERKN
FT                   RHKYGYQNPEKSVLATEDSDLEVEPIFGVPASPVLEPVVAPVSSSTDSEYETPSESEEE
FT                   EETSSPSITPTHTISLEEIEDEEFVNYNKRLADSQDCL"
FT   gene            <350961..>353066
FT                   /gene="RAD16"
FT                   /locus_tag="PICST_49179"
FT   mRNA            <350961..>353066
FT                   /gene="RAD16"
FT                   /locus_tag="PICST_49179"
FT                   /product="nucleotide excision repair protein"
FT   CDS_pept        350961..353066
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RAD16"
FT                   /locus_tag="PICST_49179"
FT                   /product="nucleotide excision repair protein"
FT                   /EC_number="3.6.1.3"
FT                   /note="go_function DNA binding; ATP binding; nucleic acid
FT                   binding; helicase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49179"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67387"
FT                   /db_xref="GOA:A3LX20"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX20"
FT                   /protein_id="ABN67387.2"
FT                   /translation="MAIELSEDDLDLEDDLPLSSRGANKKGKVTKKKPRKKKEPKVKVP
FT                   YFTRITNRLYEFHPHLKDVFPYLASLERIPVERSPQPPSMNIKLLPFQLEGLNWLKKQE
FT                   DGEFQGGILADEMGMGKTIQTIGLFTSDLTKRPNLVVGPTVALMQWKNEIEKHTEPGLL
FT                   KVLLYHGANRTTDVKELSKYDVILTSYSVLESVYRKENHGFKRKSGLVKEKSALHAVEF
FT                   YRVILDEAHNIKDRTSGTAKAANNLRCKKRWCLSGTPLQNRIGEMYSLIRFMKMEPFHQ
FT                   YFCTKCDCKSDEWKFSDWRHCDQCGHAPMVHTNFFNHFMLKNIQKFGIEGDGLVSFQNI
FT                   RLLLQNVMLRRTKIERADDLGLPPRIVEIRRDRFNEEEKDLYTSLYSDSKRKFNDYVAE
FT                   GVVLNNYANIFTLITRMRQLADHPDLVLKRVGTNQISSEIEGVIMCQLCDDEAEEPIES
FT                   KCHHRFCRMCISEYVESFMGEEKNLQCPVCHIGLSIDLEQTALEVDEELFSKASIVNRI
FT                   KMGSHGGEWRSSTKIEALVEELYKLRSDKHTIKSIVFSQFTSMLDLIEWRLKRAGFQTV
FT                   KLQGSMSPQQRDNTIKYFMDNTEVEVFLVSLKAGGVALNLCEASQVFLMDPWWNPSVEW
FT                   QSMDRVHRIGQKRPIRITRFCIEDSIEMKIIELQEKKANMIHATINHDDGAVNRLTPDD
FT                   LQFLFMN"
FT   gene            <353493..357715
FT                   /gene="LYS2"
FT                   /locus_tag="PICST_68020"
FT   mRNA            <353493..357715
FT                   /gene="LYS2"
FT                   /locus_tag="PICST_68020"
FT                   /product="L-aminoadipate-semialdehyde dehydrogenase, large
FT                   subunit"
FT                   /note="Has EST support"
FT   CDS_pept        353493..357677
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="LYS2"
FT                   /locus_tag="PICST_68020"
FT                   /product="L-aminoadipate-semialdehyde dehydrogenase, large
FT                   subunit"
FT                   /EC_number="1.2.1.31"
FT                   /note="L-aminoadipate-semialdehyde dehydrogenase large
FT                   subunit (Alpha-aminoadipate reductase) (Alpha-AR);
FT                   go_function catalytic activity; cofactor binding;
FT                   go_process metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68020"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67388"
FT                   /db_xref="GOA:A3LX21"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR014397"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX21"
FT                   /protein_id="ABN67388.1"
FT                   /translation="MSFWSEYLDSPTLSVLPHDFLKPANNQSVEATYSFEIEKEESFIT
FT                   GLAVFSALIYRLTGDEDIVIATDAKTSGTEFIIRLSLTPELSFDQLVANVTKEFENNVA
FT                   KIDYTSLSEVSEQIRAAKKLEEHPGLFRLSYQHSNPNQQLSTTVEGSIRDLAVFTEGNK
FT                   FTIFYNSLLYKHDRVVVFGEQFSQYIAKASSNSNVQITKVNLITPSQKEHLPDPTLDLD
FT                   WGGYRGAIQDIFMKNALAHPEKPCVIETKSFLDPSTKTRTFNYKQINQASNVVGNYLKE
FT                   TGIKKGDIVMIYAYRGVDLMVAVMGVLKAGATFSVIDPAYPPARQNIYLSVAKPSGLIG
FT                   LEKAGTLDSLVVDYIKNELKVVTTIPQLKINDDGSLVGGVIEGQSADCLQGYEKFQDQA
FT                   TGVIVGPDSNPTLSFTSGSEGIPKGVLGRHYSLAYYFPWMAKTFGLSEKDKFTMLSGIA
FT                   HDPIQRDMFTPLFLGAQLLVPTADDIGTPGKLADWMAEYGATVTHLTPAMGQLLSAQAS
FT                   TPIPSLHHAFFVGDILTKRDCLRLQTLAENVFIVNMYGTTETQRSVSFFEIKSRKADST
FT                   YLKNLKDVMPAGTGMYNVQLLVVNRNDRSQTCGVGEVGEIYVRAAGLAEGYRGLPDLNK
FT                   EKFVTNWYVDSSEWVKKDEENKKPEEVWREHGWLGPRDRLYRTGDLGRYLPDGNVECCG
FT                   RADDQVKIRGFRIELGEIDTHLSQHPLVRENVTLVRRDKNEEPTLISYIVPKESPELAQ
FT                   FKAEVDDETDSDPIVQGLVSYRELIKDIKNYLKKRLASYAVPTVVVPLAKLPLNPNGKV
FT                   DKPKLPFPDTAQLSAVAKLVASSRAGGAEAAEEEEFSKLEEVIRDLWLEVLPTRPATIS
FT                   KDDSFFDLGGHSILGTRMIFELRKRLNVDVPLGVIFKNPSIEAFAKEVEKFIKGSDFQL
FT                   ADGKETEEEAEEIIDYSKDAAELAQSALLEKYDSLKELDTSKTINVFVTGGTGFLGSFI
FT                   IRDILTSRPNQSFKIYAHVRASSKEAGLERLRKAGLTYGIWQDEWSKNIEVVLGDLSKP
FT                   QFGLDDTDWVQLANEIDVIVHNGAFVHWVYPYSQLRDANVNGTINVLNLCGQGKAKFFS
FT                   FVSSTSALDTDYFVHLSDELIAKGLPGLPESDNLQGSAKGLGNGYGQSKWAAEYIIRAA
FT                   GKRGLRGCITRPGYVTGFSQTGASNTDDFLLRMLKGSAELGFYPNISNNVNMVPVDHVA
FT                   RVVVATALHPPVDTELAVAHVTGHPRIEFNDFLGTLKTYGYNVDIVDYPEWRKELERFV
FT                   VEDSKESALFPLLHFVLDNLPQDTKAPELDDSNAATSLKADAAWTGVDFSSGRGVDAKQ
FT                   MSIYISYLIKTGFLPVPTGEGAKLPQIEISKVTLDLINSGASARSSAAAPK"
FT   gene            <357941..>359487
FT                   /locus_tag="PICST_32667"
FT   mRNA            join(<357941..359425,359449..>359487)
FT                   /locus_tag="PICST_32667"
FT                   /product="predicted protein"
FT   CDS_pept        join(357941..359425,359449..359487)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32667"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32667"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67389"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX22"
FT                   /protein_id="ABN67389.2"
FT                   /translation="MHPMISRDYTPNKAQPSVPTGTSAPNNTPKGKEVPFENHLKSVED
FT                   RSNTIVEMELDPISSSNIAYNKEYARSMDTNLLTSDISRESSTTSVQSAFMKRGKDSGR
FT                   RKSTPFESSSSLYSTESTPVRSTVGGGSINNGNGSLLSSPMSPRQYTTHQAQQRTISGS
FT                   SRSPMTSNRKFIGALTPLVAGSVQSISGSDAKAALASSSEADKKRLVDQFYNSVNESNP
FT                   VSRASSSSELAQHFKSTSTNLQSPTAEKALKWIENSSSNESDQKPFKIRTTPKIINYTE
FT                   EKFNSIINNGGFTYTSNSSKLIEDQELTNYLLNIDTILEDPNKENDNNGKSKRHDHHKQ
FT                   NKDSLEPLATIMKSLSSTLVEKSKLNLIDDDDDHIESLAQLNGLSKYLSDLHNSTNELL
FT                   QRLILNREEIKSNYRSEIKDSLNRLSDLSAELNNLEIKLSVIKNKINDSKTVMSREMAD
FT                   KIELLEYVNDRFKDYSTQKRNMRFKQYNIALAVLVVVIAVMRNEYKRVT"
FT   gene            360811..363102
FT                   /gene="PDE2"
FT                   /locus_tag="PICST_78746"
FT   mRNA            join(360811..362153,362200..362217,362292..363102)
FT                   /gene="PDE2"
FT                   /locus_tag="PICST_78746"
FT                   /product="nucleotide phosphodiesterase"
FT                   /note="Has EST support"
FT   CDS_pept        join(361231..362153,362200..362217,362292..363048)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PDE2"
FT                   /locus_tag="PICST_78746"
FT                   /product="nucleotide phosphodiesterase"
FT                   /EC_number="3.1.4.17"
FT                   /note="go_function 3',5'-cyclic-nucleotide
FT                   phosphodiesterase activity; go_process signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_78746"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67390"
FT                   /db_xref="GOA:A3LX23"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX23"
FT                   /protein_id="ABN67390.2"
FT                   /translation="MAEILSLVPDTPGARAFNLHHRSFKYYQNFRDIVAYLFSKGNNEA
FT                   DTNYPIVVVVDETEGGTSTATSLHELSFSDKKLVLKYFFIHQNIIIVSPRDLNPDYINN
FT                   KITQVTNLITNRISRVETWTGTGTNSINDFYSQEEDLELGEVISTMSFLLSNNTNKSSQ
FT                   TTEHIIYLKDLIIADIDFKSLLSNHTPEHLARLCHAVGHWAFPAHELSNDDLVYCVFLM
FT                   FKYALKQVKKNHSGSLLHIPTSNELLAFVFMVRDTYKNGNPFHNFRHAVDVLQACFHFL
FT                   IRLDCLPVFKQLKNDPKSDELAFLQTNSIILHISPAHSPNHLNHLQTLGLLVAALGHDV
FT                   GHPGVTNAFMIKNFAPTSILFNDRSVLESFHSSVFINKILAVNWPSLLTVFTESGESVS
FT                   GLSLREIIISSILATDMAEHFEYIDRLKNLKSHDFIKHNNRVKLISSLLIKCADISNVT
FT                   RPLRVSSQWAMVLGREFDEVAMLEKKITSEDHLGDLDTAKDLTYTKVPLSLNEILKSTP
FT                   NLHKGQIFFINTFAENLFSNIAELLPELKYTCDIIRENKEFWVNRDKA"
FT   gene            363547..366052
FT                   /locus_tag="PICST_65878"
FT   mRNA            363547..366052
FT                   /locus_tag="PICST_65878"
FT                   /product="predicted protein"
FT   CDS_pept        364104..366005
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_65878"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_65878"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67391"
FT                   /db_xref="GOA:A3LX24"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR037635"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX24"
FT                   /protein_id="ABN67391.2"
FT                   /translation="MESNESPNPYMSRPIILSPPPLEQHKFANFQSSSASTAASTTPSG
FT                   SAGSTQQLPVGHAERQQSVGYNLQHEFETLTVDLDLDLRNNRDSNSITSSSRNNTTGGN
FT                   PSPAAASSTSLGHGHSLLAPAASKHGFSSELLMSSGNSSGLNHPFRENAISPIPAVASA
FT                   NAGIASLLATTSSGNTTNNGNSLLHPPPLASIPNRPQSVNDFSNFFNRQQQLEPQASAP
FT                   LTSNFYSELMTFTGWIENLNPQDTVSMIDYLCSNLPLDILLTFKSKLDNHLTSHPSQQK
FT                   GQTAPPYGNIMSPYSSYSQSDLYNDMDQLNLGNEKTLTQPQPTHLYQPKPKQNTYRTAA
FT                   QYLAFVEQKNPRPKSAEPSLNVNGANRFSAHQQFERAKSPTSHLYEKTNFLQLAAGNSS
FT                   HNTHSQQQQQPQQQPQQQQQQQQQQGSSQDDSLELNAHTALKLGALATINSRVALDSNR
FT                   KHVYHQHAGNVSYYQTNASPHYPGQQMKTMAQSLSHEEQINRTLNSSSVPVSIHRNNAN
FT                   SSKSPKSKKSEQKQENLSGINSVVTGSTNMSVSSSLTGSSNSSMPSEVANIELLNNIPA
FT                   WLKLLRLHKYTDCLKDTPWKELIELDNEQLELKGVAALGARRKLLKAFDAVKLTLEE"
FT   gene            complement(<366064..366848)
FT                   /locus_tag="PICST_65879"
FT   mRNA            complement(<366064..366848)
FT                   /locus_tag="PICST_65879"
FT                   /product="predicted protein"
FT   CDS_pept        complement(366246..366848)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_65879"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_65879"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67725"
FT                   /db_xref="GOA:A3LX25"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR010908"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX25"
FT                   /protein_id="ABN67725.1"
FT                   /translation="MKIYYIGILRTSGEKALELTSARDLTQFSFFERTGVSQFMTFFSE
FT                   TVSQRTQAGQRQSIEEGNYIGHTYTRSEGIACVIISDKEYPVRPAYTLINKILEEYLAL
FT                   HPQQEWANISATSPSLAYDQLEQYLKKYQDPSQADSIMKVQQELDETKIVLHKTIESVL
FT                   QRGEKLDSLVDKSEALSSSSRMFYKQAKKTNSCCIIM"
FT   gene            <367591..>368376
FT                   /gene="RAB7"
FT                   /locus_tag="PICST_32671"
FT   mRNA            <367591..>368376
FT                   /gene="RAB7"
FT                   /locus_tag="PICST_32671"
FT                   /product="GTP-binding protein"
FT   CDS_pept        367591..368376
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RAB7"
FT                   /locus_tag="PICST_32671"
FT                   /product="GTP-binding protein"
FT                   /note="Ras-related GTPase; go_function GTP binding;
FT                   go_process small GTPase mediated signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32671"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67392"
FT                   /db_xref="GOA:A3LX26"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX26"
FT                   /protein_id="ABN67392.2"
FT                   /translation="MSSSSDDLLKQTTPTLKVVLLGDSGVGKTCLRSQFVHHVFTNAYR
FT                   ATIGGDYLTTTVTLPPETPTPSSYRMEHELDESRSSDELAKKRTKTTAPRVVNLQIWDT
FT                   AGQERFNSISKAFYRGTDVVVLVYDITNYESVLSIRDWFKRFMEFCFVEKPGVIIVGNK
FT                   VDKVNERCVDLEEIQEIITANTDVSVGDYVEDWETDLREVTSKRLDQVEALFTQVAKVG
FT                   VAVTDGGVKKRNLKGFDRIDINTLNTLNNSNTTSSRCSC"
FT   gene            complement(<368658..>369353)
FT                   /locus_tag="PICST_32672"
FT   mRNA            complement(<368658..>369353)
FT                   /locus_tag="PICST_32672"
FT                   /product="predicted protein"
FT   CDS_pept        complement(368658..369353)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32672"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32672"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67726"
FT                   /db_xref="GOA:A3LX27"
FT                   /db_xref="InterPro:IPR010625"
FT                   /db_xref="InterPro:IPR039289"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX27"
FT                   /protein_id="ABN67726.1"
FT                   /translation="MYRFIARSSALRQSSMRLSQRMYSVKPVRIARPFSSRMVFAAGLV
FT                   PAVIAFSMLNDNRINNDVDAEKLAQEKSVIVDIVSEDEGKVIEEVVDIEVTPEEVTETV
FT                   VERVSEDAGAEEADGQESYEGAAYNPETGEINWDCPCLGGMAHGPCGEEFKEAFACFVY
FT                   SETEPKGIDCIKKFEAMRSCFKKYPEHYKEELYEDSEETSELPSKEQSETDSTPVESSE
FT                   ASAEISSTK"
FT   gene            complement(<370409..>372649)
FT                   /gene="TIP39"
FT                   /locus_tag="PICST_32673"
FT   mRNA            complement(<370409..>372649)
FT                   /gene="TIP39"
FT                   /locus_tag="PICST_32673"
FT                   /product="Tuftelin-interacting protein TIP39, contains
FT                   G-patch domain"
FT   CDS_pept        complement(370409..372649)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="TIP39"
FT                   /locus_tag="PICST_32673"
FT                   /product="Tuftelin-interacting protein TIP39, contains
FT                   G-patch domain"
FT                   /note="low similarity to Tuftelin-interacting protein 11 in
FT                   humans similar toprotein required for cell viability in S.
FT                   cerevisiae; go_component intracellular; go_function nucleic
FT                   acid binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32673"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67727"
FT                   /db_xref="GOA:A3LX28"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX28"
FT                   /protein_id="ABN67727.2"
FT                   /translation="MSFSGLAFTKASNNNSNNDTTNNNVGSKPFSMMAAAVRDGYSDYE
FT                   EEMEEDVVVHNNERDSKSKFASPTESFNKNAAWLNPPTAVNSNFQKYGIGAQLLVKMGY
FT                   QVGKGLGANEEGIVNPIETMLRPKGLGVGGIRERKDSNRKKGNDDVDMDIESSDDESTS
FT                   LQKRESINLYSIVEELELKNMTVPKKYIELSDQYSQNQYSEDLYDQVKEAYNQLSRISE
FT                   ELNSLDQQEKFITYQLKDINLKSNTLESELSSTVVTLEKIEETLPILQNTKDSIAIIKE
FT                   VDILLRSILETPSKSYPNISSLCGSIVAVAIPLLFNDGNIDEKSSSFNTLAEWSIIYRE
FT                   VEKSASSELSFFDSLIYPQIANQISKTISSTIPAEERSIQILNYLQFWLESPIIINPQF
FT                   CIQEKLMSELVIPFISESIDQWNPLDPKDSSPTFLIDYLAGVVDGDISLFEEILQNVNQ
FT                   KYLDFINYNNPKSIWQNICKATSIEEIAWIEEINKFTKVWIPLFKEYPQLDFAASNGTE
FT                   LLEALTCGLQFPFNIRSDLRVKLLLAFELLSLIEENDSVILLQFTWGNNWIESLLSMIE
FT                   ENPSRVAESYREWFKYFQETKNSYSERILDVIKWYLDLVLNIIENGRDVANKLPNINGN
FT                   AHPEKSEVLKLIQNSTSNEKEEHRSVHGIPAYRLMTSFKDVVADYCLQKGLLFGSEKNR
FT                   VHPTLGYPLYTIKSSRGTKLFCYADQDVLWIAQSGEAMEYDPISLDDLLSYL"
FT   gene            complement(<373250..>374734)
FT                   /gene="ATG17"
FT                   /locus_tag="PICST_61658"
FT   mRNA            complement(join(<373250..374344,374378..>374734))
FT                   /gene="ATG17"
FT                   /locus_tag="PICST_61658"
FT                   /product="Autophagy-related protein 17"
FT   CDS_pept        complement(join(373250..374344,374378..374734))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ATG17"
FT                   /locus_tag="PICST_61658"
FT                   /product="Autophagy-related protein 17"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61658"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67728"
FT                   /db_xref="GOA:A3LX29"
FT                   /db_xref="InterPro:IPR007240"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LX29"
FT                   /protein_id="ABN67728.2"
FT                   /translation="MHATVDRATVTAWAKQAQSTLEKAQTLCTNAQTSLHATSYQLTSH
FT                   LPDLLEEANVLYESLKTQHELLAKISESLRRSIRDQLLNTLEKQQSTLLQPALNNLDDI
FT                   VGHLSATIVPSFLIEKDEAENRTLADFISTDSINLLRRNIQIYTNNHEKIRQLLNNKLQ
FT                   DVILSPFHEIGSKKFNKTVKLYEEITPLQLKLKAITSNIAPLDSSNVVATLLKENAALE
FT                   NELVSILEMLTNHYDQCTQGVQILYSGGSQQVNLEILKNDAQELPDVLKELHTVYDIIV
FT                   NNEARAQKFINAHSPSIEVVIATMKDQLSFYRSFKSKNIPEIMVLFTVCEEILMKSPIE
FT                   DPGGPEQTPIEKFTDTVNQLVYHYTQFLNVFKSQYLRELHHEQFSYPRKFLSKLTNFLN
FT                   DELYKMQIEEKERRRAWLTKYGDFIPKEFRLPGEYNQPVITQVVTEGLEDVQKEGADAE
FT                   RHITQEKELLELLRKMEELNRERRY"
FT   gene            375176..376354
FT                   /gene="CDC73"
FT                   /locus_tag="PICST_78878"
FT   mRNA            375176..376354
FT                   /gene="CDC73"
FT                   /locus_tag="PICST_78878"
FT                   /product="accessory factor associated with RNA polymerase
FT                   II"
FT   CDS_pept        375190..376329
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="CDC73"
FT                   /locus_tag="PICST_78878"
FT                   /product="accessory factor associated with RNA polymerase
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_78878"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67393"
FT                   /db_xref="GOA:A3LX30"
FT                   /db_xref="InterPro:IPR007852"
FT                   /db_xref="InterPro:IPR031336"
FT                   /db_xref="InterPro:IPR038103"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX30"
FT                   /protein_id="ABN67393.2"
FT                   /translation="MSSVVSASILHRATTHKEPIKFFKIEGSDSQSTESIKDATHVQFG
FT                   NNEENIYDLNSITNFYNEDKPQNLRAVIFCWLHDKSSIVDYKNECSELGIADFKFLVKT
FT                   ELTTWLNGNSDSCTFVKDEKVGEVAVDSSSKSKLITPSTATDATTTDKKHKLEDPQIER
FT                   ISQFERDSIDHNAALRGSKNVEFGQLVSDAKRLIQQLKRSKPNGAAASRDSGPKKKPLI
FT                   IVSPASTALLSLSNVKQFLEEGKFTEPNPTNRPSGGLVTINHPSERLIPVAHQIMVVDN
FT                   VDMFTKPEYWDNVVAIFTTGQSWQFAKYKYSQPETLFQRYAGFFLSYSGDPTPPQIKDW
FT                   NVSEIKVDRGDKRFRDKMIVKDFWAEIEKILLAKGYGKQ"
FT   gene            complement(<376451..>377800)
FT                   /gene="MST1"
FT                   /locus_tag="PICST_47981"
FT   mRNA            complement(<376451..>377800)
FT                   /gene="MST1"
FT                   /locus_tag="PICST_47981"
FT                   /product="mitochondrial threonyl tRNA synthetase"
FT   CDS_pept        complement(376451..>377800)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MST1"
FT                   /locus_tag="PICST_47981"
FT                   /product="mitochondrial threonyl tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /note="go_function tRNA ligase activity; ATP binding;
FT                   go_process tRNA aminoacylation for protein translation;
FT                   protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_47981"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67729"
FT                   /db_xref="GOA:A3LX31"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX31"
FT                   /protein_id="ABN67729.1"
FT                   /translation="RYYSTSHQEAESSTQNNQTISNKQLLYTTDPLTPGSIFFLPHGTR
FT                   IFNKLVQFMKNQQTKYGFQEVITPLIYKSKLWETSGHWQNYKDDMFKVVGNDVSKEHDI
FT                   HNEQYSHDKSEGLHEYGLKPMNCPGHCLIFSKFDRSYNELPIRLSDFSSLHRNEASGAL
FT                   SGLTRVRRFHQDDGHIFCEMGQINQEIHNTINLIKGTYKVFGIGEKDIEYFLSTRPEEK
FT                   FMGDIETWNMAEEQLKNVLDTAAGQGNWQINEGGGAFYGPKIDVLLTDAFNKKHQVGTI
FT                   QLDFQLPARFDLKYVAEDGTRDNQPIMVHRAVFGSLERFFAILLDHYQGKWPFWINPRQ
FT                   AVIVPVNASHVEAAEKLHKMLSGDIINSVNDISPITGYNFYVDVDRRAETVGSRIKDAV
FT                   QKGYSYIIMIGDKDIKNGTVAIRTRDSRQIVNLKPEEIYEKFVELEKSFQ"
FT   gene            <379120..>379494
FT                   /locus_tag="PICST_49115"
FT   mRNA            <379120..>379494
FT                   /locus_tag="PICST_49115"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        379120..379494
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49115"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49115"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67394"
FT                   /db_xref="GOA:A3LX32"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX32"
FT                   /protein_id="ABN67394.1"
FT                   /translation="MEQPPQRERLPSRLDILSNGHKLDVRAHQRTYEGAYTRSAIGCLS
FT                   FSILIIKLFSKEFLPIGTIYTVYGSLLYFIGVYKASSVDTYYNPDKDMVMFKTSGDSVL
FT                   LLSVISLVSYVALLVLILRM"
FT   gene            complement(<379625..>381436)
FT                   /gene="MDM31"
FT                   /locus_tag="PICST_32678"
FT   mRNA            complement(<379625..>381436)
FT                   /gene="MDM31"
FT                   /locus_tag="PICST_32678"
FT                   /product="Mitochondrial distribution and morphology protein
FT                   31, mitochondrial precursor"
FT   CDS_pept        complement(379625..381436)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MDM31"
FT                   /locus_tag="PICST_32678"
FT                   /product="Mitochondrial distribution and morphology protein
FT                   31, mitochondrial precursor"
FT                   /note="Hypothetical membrane protein similar to
FT                   Mitochondrial distribution and morphology protein 31,
FT                   mitochondrial precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32678"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67730"
FT                   /db_xref="GOA:A3LX33"
FT                   /db_xref="InterPro:IPR012571"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX33"
FT                   /protein_id="ABN67730.2"
FT                   /translation="MISFRLFGPNISKRLGPPLVARTSIVKPLKLFYPSATIIPRRFNP
FT                   VHIYSIRNYTSKDNGIRSEKSNSLKKPSDGQKDSSQQPHNLQEELANLNRVTKEQLLAR
FT                   ANNIFSRFKIRFRWLLKKSNRPFNTDDYSAIFSWLVMGNVLMFFLATTTFFSIIIFTAN
FT                   TVLAQEFVARKLGDFITRNSNLAVTFENAVVPGWSDGKISFRKCFVSKRPRLSNRFSKG
FT                   SQAEAYAASISKYEEEEYDDGNYTQFDLTIEEVNISLSFSKWVNGTGIVDNMEMKGVRG
FT                   VVDRTHVHWDPDDDATNYLNKYQPGDFEFEDFKMEDVLFTLMQPNGFRPFEVAIYNCEL
FT                   SRLRKHWLFYDFLNANIMSGAYDNSLFTIHKKQRLNDFSEDGETTPQSWKRVTRMRVDN
FT                   LNIDHLNTGLEGPFGWISSGRVDMIGDVMVPQENEDLNMTELVSVIAESIKKEANRYKN
FT                   PEVTKPPKHPDQHMRLTRNDINDISKYFVLDLTIRLHNVRASVPFQTPELTYINYALIR
FT                   PIVAYINSKNTFIKIHNRIVKNIEDFSGSWTIYDSLLMDDISEEVYDNFVDYVADEEAR
FT                   YVRMKKVGFWSIQLIFQVIVFGLGALT"
FT   gene            <382568..>383860
FT                   /gene="CSD1"
FT                   /locus_tag="PICST_61494"
FT   mRNA            <382568..>383860
FT                   /gene="CSD1"
FT                   /locus_tag="PICST_61494"
FT                   /product="cysteine desulfurase Selenocysteine lyase"
FT   CDS_pept        382568..383860
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="CSD1"
FT                   /locus_tag="PICST_61494"
FT                   /product="cysteine desulfurase Selenocysteine lyase"
FT                   /EC_number="4.4.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61494"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67395"
FT                   /db_xref="GOA:A3LX34"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX34"
FT                   /protein_id="ABN67395.2"
FT                   /translation="MTQTVPFGKKFKETYFTNINPQYTAVNHGSYGLFPDKIFHRYVEE
FT                   MKKDLYNPDNYVKVQQPETYKKALQTLGEFFHCDYRNLALVDNATTGVNTILRSFPLDK
FT                   GDKIVYPSTIYGACGLTIKFMVNRYGIEAVPIELVYPLEETEILSKFEKVFKEQKPKIA
FT                   LFDVVISMPGVKFPYEEMTELCRKYGVLSLIDGAHCAGLNPIDLGKLRPDFFVTNLHKW
FT                   LFVPRVCASLYIDKKHHRSVHTLPVSHSYLDDNSKVSAEDEENWLVDRFTFIGTKNFAS
FT                   IAVIGDCIRFRQEECGGEQAVYDYCHSLAIKAGDAVSKIWGGPVLQNKAKTLVSTMVTV
FT                   ELPLEQFGLSITDFTGNYVETIEYVFGREFQEYNTYVPVIVHNKKMYGRFSAQVYTELS
FT                   DFEVAARKVVEVFNTLADDPKFRKLSGKSKL"
FT   gene            complement(383879..386317)
FT                   /gene="EXG2"
FT                   /locus_tag="PICST_78873"
FT   mRNA            complement(383879..386317)
FT                   /gene="EXG2"
FT                   /locus_tag="PICST_78873"
FT                   /product="Glucan 1,3-beta-glucosidase precursor
FT                   (Exo-1,3-beta-glucanase)"
FT                   /note="Has EST support"
FT   CDS_pept        complement(384082..385398)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="EXG2"
FT                   /locus_tag="PICST_78873"
FT                   /product="Glucan 1,3-beta-glucosidase precursor
FT                   (Exo-1,3-beta-glucanase)"
FT                   /EC_number="3.2.1.58"
FT                   /note="go_function hydrolase activity, hydrolyzing
FT                   O-glycosyl compounds; go_process carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_78873"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67731"
FT                   /db_xref="GOA:A3LX35"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX35"
FT                   /protein_id="ABN67731.2"
FT                   /translation="MVQLTSIVSSILVLSQSLLVASASINNPLLDNNNNLKKLTKKGAS
FT                   WDYQNDVIRGVNLGGWFVLEPYITPSLFEQWENWGDDSQVPVDEYHYTQKLGKLVAGQR
FT                   LDTHWKTWYTEQDFSDIAAAGLNFVRIPIGYWAFQLLDNDPYVQGQVEYLDQALGWANK
FT                   YGLKVWIDLHGAPGSQNGFDNSGLRDTVQYQQPNNVQVTLNVLEQIFEKYGNGEYSNYV
FT                   IGIELLNEPLGPVSDMNNLKNFLTQGYNNLRQTGSVTPVIIHDAFQAPGYWDNFLTVEN
FT                   GDYWSVVIDHHHYQVFSYGELARDIDQHISVACNWAWDSKKEYHWNVAGEWSAALTDCA
FT                   KWLNGVGRGARYAGQYDNSAYIGDCTPYLDLGTWTQDYKTNVRKYIEAQLDGFEQTGGW
FT                   VFWNWKTENAVEWDFKRLTAAQLFPSPLTDRQFPNQCGF"
FT   gene            <389444..>391156
FT                   /gene="HOL12"
FT                   /locus_tag="PICST_36589"
FT   mRNA            <389444..>391156
FT                   /gene="HOL12"
FT                   /locus_tag="PICST_36589"
FT                   /product="transport protein"
FT   CDS_pept        389444..391156
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="HOL12"
FT                   /locus_tag="PICST_36589"
FT                   /product="transport protein"
FT                   /note="Putative ion transporter similar to the major
FT                   facilitator superfamily of transporters"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36589"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67396"
FT                   /db_xref="GOA:A3LX36"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX36"
FT                   /protein_id="ABN67396.2"
FT                   /translation="MNLEAPILSNVQINDKANDDFIPGTKNIYTDAIGPEDEVTKKKVK
FT                   TQGNIILIPQPCNSPNDPLNWSKYRKFVNFAILAVITGFTAATSNDAGAIQDSLNELYD
FT                   ISYDKMNIGAGVLFLGIGWGTFFITPLASLYGRKLSYFICIFLGLLGAVWFALSRRTAD
FT                   AIWSQLFVGISESCAEASVQLSLSELYFQHQLGSVLTVYILATSVGTFLGPLIAGFIVQ
FT                   YVGFRWVGWIAVFISIGLLFIIFFVLEETMFDRKIFSRGVINGVSPSSDKQVPEFDDIK
FT                   KEHSKEFTTVDESNSSEDEDTDLINMGENDPPKSYWKNVQLITLAPNLQGTGFLQYLTQ
FT                   LRMLLKVFLYPPVIFSGLVWGMQDALLTFYLTVEDDEYYDPPYSYGNTGVALMNVPTLI
FT                   GAIIGCFFAGPLSDKFSIWMAKRNNGIQEAEYRLWFLFAPAVIAPVGLILFAVGTDQVW
FT                   DWPPTYVGLGFIGFGFGCSGDVSMSYLMDAYPDMVIEMMCGVSVINNMIGCIFTFACSP
FT                   WLDAMGNTHTFIILAVIEAVIMFSAAPMIWYGKRIRNWTKDWYIEFCQLRDGM"
FT   gene            391792..392410
FT                   /gene="RPA1"
FT                   /locus_tag="PICST_79093"
FT   mRNA            391792..392410
FT                   /gene="RPA1"
FT                   /locus_tag="PICST_79093"
FT                   /product="60S acidic ribosomal protein P1-A"
FT                   /note="Has EST support"
FT   CDS_pept        391837..392163
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RPA1"
FT                   /locus_tag="PICST_79093"
FT                   /product="60S acidic ribosomal protein P1-A"
FT                   /note="60S acidic ribosomal protein P1-A (CaRP1A);
FT                   go_component intracellular; ribosome; go_function
FT                   structural constituent of ribosome; go_process
FT                   translational elongation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_79093"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67397"
FT                   /db_xref="GOA:A3LX37"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX37"
FT                   /protein_id="ABN67397.1"
FT                   /translation="MSVETALSYAALILADSELEITSEKLLALTTKANVEVEGIWADIY
FT                   AKALESQDLKALFFNISAAPASGAAPVAAAAGAAAGGEEAAAEEKAEEAKEESDDDMGF
FT                   GLFD"
FT   gene            complement(<392807..>393415)
FT                   /gene="RPL13"
FT                   /locus_tag="PICST_48494"
FT   mRNA            complement(<392807..>393415)
FT                   /gene="RPL13"
FT                   /locus_tag="PICST_48494"
FT                   /product="60S ribosomal protein L13"
FT                   /note="Has EST support"
FT   CDS_pept        complement(392807..393415)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RPL13"
FT                   /locus_tag="PICST_48494"
FT                   /product="60S ribosomal protein L13"
FT                   /note="go_component intracellular; ribosome; go_function
FT                   structural constituent of ribosome; go_process protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48494"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67732"
FT                   /db_xref="GOA:A3LX38"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="InterPro:IPR018256"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX38"
FT                   /protein_id="ABN67732.1"
FT                   /translation="MAISKNLPLLKNHFRKHWQERVKVHFDQAGKKASRRQARLSKAAS
FT                   IAPKPIDTLRPVVRAPTVRYNRKVRAGRGFTLAELKAVGLTAKYARTIGISVDHRRQNK
FT                   AQETFDANVARLQEYKSKLVIFDKKTKAAEAAAYEQVSTGAVFPVVQPSVESAPRAVEV
FT                   PEQTAFRTLRLARNDKKYKGIREKRAKDKAEAEADKKKK"
FT   gene            <394078..395173
FT                   /gene="RPS16"
FT                   /locus_tag="PICST_73324"
FT   mRNA            join(<394078..394098,394616..395173)
FT                   /gene="RPS16"
FT                   /locus_tag="PICST_73324"
FT                   /product="40S ribosomal protein S16"
FT                   /note="Has EST support"
FT   CDS_pept        join(394078..394098,394616..395023)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RPS16"
FT                   /locus_tag="PICST_73324"
FT                   /product="40S ribosomal protein S16"
FT                   /note="go_component intracellular; ribosome; go_function
FT                   structural constituent of ribosome; go_process protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73324"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67398"
FT                   /db_xref="GOA:A3LX39"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX39"
FT                   /protein_id="ABN67398.1"
FT                   /translation="MSTQSVQTFGKKKTATAVAHVKAGKGLIKINGAPITLVQPEILRF
FT                   KVYEPLTLVGVEKFQNIDIRVKVTGGGHVSQVYAIRQAIAKGLIAYHQKYVDEASKNEL
FT                   KKIFASYDKTLLVADSRRMEPKKFGGRGARARFQKSYR"
FT   gene            <396751..>399915
FT                   /gene="RIC1"
FT                   /locus_tag="PICST_49032"
FT   mRNA            <396751..>399915
FT                   /gene="RIC1"
FT                   /locus_tag="PICST_49032"
FT                   /product="WD40 repeat protein"
FT   CDS_pept        396751..399915
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RIC1"
FT                   /locus_tag="PICST_49032"
FT                   /product="WD40 repeat protein"
FT                   /note="WD40 repeat protein part of complex that catalyses
FT                   guanyl nucleotide exchange on Ypt6p"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49032"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67399"
FT                   /db_xref="GOA:A3LX40"
FT                   /db_xref="InterPro:IPR009771"
FT                   /db_xref="InterPro:IPR040096"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX40"
FT                   /protein_id="ABN67399.2"
FT                   /translation="MVWVSSCPQLSTSLLHHEKILKVIRVPHTPLLIVLTNTTITAYDQ
FT                   NTLLPIASHTRAEDSVAQHGTNKDIQTKQITVNTAQLLKIHTVNLFVQTEHNYLVIYSV
FT                   LINHSKSLFEVNNNVNYELIQTGLPLSSTVEKNSFSRMIKSATKAIVSGNENHVDLENI
FT                   ENFNNVQLEDEEGNFTIPTVKLSVFKILKIGIGLQNYWLKHNSHNLIIFNNKNERQSSA
FT                   IQAQEGNYFQIINMQSFRSEVFQLSDSDWYHSTDPESNISYINYNTEQNYFIFLNDNKE
FT                   LWYFTVEFNDSDLLVPVGHKIFTFEAIESLENFKISFNPQSNLILIHVNRRIELFKLFT
FT                   DTSKLVYLKDIKSKGLEKSSIIWSPCGDYFVLLDDSTGYWSISTKFGSFTFSTTEIIKE
FT                   LDEVYEENRGFLRAAKILIGPNANSLFIVGHDYSKLYKVNLLAANDSADVFYDHEYLSI
FT                   IQNNKSFVRFPIQPRVKKIISQIERFNGNTSKSTSKSMSGVLNISRNKYNQLAISYGDN
FT                   ISLSTPFSSGGTEFNNILWFNFRNYYLDAYNIVSQFWFNDYLVIVNRKTKDNFEDETEN
FT                   GKSAANESSAMVDELIVLDTTRFKYGNGGEELRLDNDSTLWKYDFKTTFIKIQPITISE
FT                   HVCNVVILTHDLRLIILELNDNKALARKSSSADLKVRGIRRNYKIFIGVNKTIHLLSVQ
FT                   HKLAIKDVIQIGMVDRRHFFFLLKTGELFLLKNQTMPTPPSQSTPIGALKPNNMYDLIK
FT                   IGDTIEFFKFQKLRFNDSLTEYIYVFNGEELLIYELEDLIENSFDMSTIIIDELEKEKH
FT                   VFPIPISIETENFQPIILDGVVAPNSLSVKSLDLVGLENVIVNKLSSGGLVVKTKVARK
FT                   LVLNNFIENELVKTSNDLEAAVTKYKQFSNYHYCLELLLFKYLTSDNNNILKRLITLIE
FT                   LNEHSEYIYINCLRKIEVIYWDKFFTILDTKPVTFMKRLIEINNVELCYNYLIIYLNYK
FT                   REGEDEDSAADEEALNSNDKEIILKIMKMLDDSSKWDWCFELCRFIKLLQPSGELLKQI
FT                   KETLQK"
FT   gene            <400165..400815
FT                   /gene="NBM4"
FT                   /locus_tag="PICST_84570"
FT   mRNA            <400165..400815
FT                   /gene="NBM4"
FT                   /locus_tag="PICST_84570"
FT                   /product="NADH-ubiquinone oxidoreductase B14 subunit
FT                   (Complex I-B14) (CI-B14)"
FT   CDS_pept        400165..400530
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="NBM4"
FT                   /locus_tag="PICST_84570"
FT                   /product="NADH-ubiquinone oxidoreductase B14 subunit
FT                   (Complex I-B14) (CI-B14)"
FT                   /EC_number="1.6.99.3"
FT                   /note="NADH-ubiquinone oxidoreductase B14 subunit (NB4M)
FT                   (Complex I-B14) (CI-B14); go_function oxidoreductase
FT                   activity, acting on NADH or NADPH; go_component
FT                   mitochondrial inner membrane; go_process electron
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_84570"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67400"
FT                   /db_xref="GOA:A3LX41"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="InterPro:IPR016488"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX41"
FT                   /protein_id="ABN67400.1"
FT                   /translation="MTLATEFAETTRRSATAPELRKRVLHLYRRYMRYSKEFCDIYELD
FT                   MPVANVKTKIRQEFERQRFVNNLDVSNVLLMKGQMEFQELINFWKQQCHVLRYFDDQHS
FT                   YNVVDKNDFVKNFLRGN"
FT   gene            complement(400790..402872)
FT                   /gene="TUB2"
FT                   /locus_tag="PICST_84476"
FT   mRNA            complement(join(400790..402360,402571..402606,
FT                   402822..402872))
FT                   /gene="TUB2"
FT                   /locus_tag="PICST_84476"
FT                   /product="Tubulin beta chain (Beta tubulin)"
FT                   /note="Has EST support"
FT   CDS_pept        complement(join(401062..402360,402571..402606,
FT                   402822..402833))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="TUB2"
FT                   /locus_tag="PICST_84476"
FT                   /product="Tubulin beta chain (Beta tubulin)"
FT                   /note="Tubulin beta chain (Beta tubulin) involved in
FT                   chromosome segregation and nuclear migration; go_component
FT                   tubulin; go_function GTPase activity; GTP binding;
FT                   go_process microtubule polymerization"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_84476"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67733"
FT                   /db_xref="GOA:A3LX42"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002453"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR013838"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX42"
FT                   /protein_id="ABN67733.1"
FT                   /translation="MREIIHLSTGQCGNQIGAAFWETICGEHGLDSNGNYHGDDDLQKA
FT                   KLDVYFNEATSGKYVPRAVLVDLEPGTIDGVKTSHIGNLFRPDNYIFGQSSAGNVWAKG
FT                   HYTEGAELVDSVLDVVRREAEGCDSLQGFQITHSLGGGTGSGMGTLLISKIREEFPDRM
FT                   MATFSVVPSPKVSDTVIEPYNATLSVHQLVENSDETFCIDNEALYNICQKTLKLPTPSY
FT                   TELNNLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTSIGSKSF
FT                   RSLTVPELTQQMFDSKNMMAASDPKNGRYLTVAAFFRGKVSVKEVEDEMLKVQTRNASY
FT                   FVEWIPNNVQTAVCSVAPKDLDMSATFIGNSTSIQELFKRVGDQFSAMFRRKAFLHWYT
FT                   SEGMDEMEFTEAESNMNDLVSEYQQYQEASIEEEELDYADEIPLEDQLE"
FT   gene            <404050..>405972
FT                   /gene="UGA3.2"
FT                   /locus_tag="PICST_62201"
FT   mRNA            join(<404050..404476,404579..405338,405416..405435,
FT                   405449..>405972)
FT                   /gene="UGA3.2"
FT                   /locus_tag="PICST_62201"
FT                   /product="putative transcriptional regulator"
FT   CDS_pept        join(404050..404476,404579..405338,405416..405435,
FT                   405449..405972)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="UGA3.2"
FT                   /locus_tag="PICST_62201"
FT                   /product="putative transcriptional regulator"
FT                   /note="zinc-finger transcription factor of the Zn(2)-Cys(6)
FT                   binuclear cluster domain type; go_component nucleus;
FT                   go_function transcription factor activity; zinc ion
FT                   binding; go_process regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62201"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67401"
FT                   /db_xref="GOA:A3LX43"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX43"
FT                   /protein_id="ABN67401.2"
FT                   /translation="MYLVLDVNSLETVESRSSPTSAHIGSYSSKRILSRNIILGPTKRS
FT                   RNGCLNCRKRKKKCDESFPTCGSCKYRGAECIWRDSTKFKMKRYSDSRDSTKKSAVVRH
FT                   VSTKSPSEELSEAIVESQDKMELSKGIIELVNDEIDQVNLRLDTSEFTTKNIDFLMSDD
FT                   FSDFPYLSPTTTPIFNPFRHLDDKAKYFLDGFIHKVARNLCIGPDWCNYFLKTFYQMAE
FT                   QDKSVSFALASWGGLFLEGSTDATKSYMIKAYKSITERFPNFNELSKEDIYILLNFFLI
FT                   GIGVHVCAGDVSQWNILFKQCIEVIQKNGGLSEICRMFDYSNDIKWLISDVQFHDIMSS
FT                   RAFSKGTILPMEEYNTIFQRNKILELGNYGLDPLQGCIQPIYLLLGEILQVSSDLKFTQ
FT                   HCYIINLRILRQNFYNEMEEVIDQLKEKLKRCQPNIQQMEPIIDDKHEVELHLTLFEVY
FT                   SYTCQLSMNYQIKGMPASSAEMQSILVNAVSCIDILVDTKLVSSLSLSLLLCGITCCTA
FT                   TDRLDMEVRIKKIQSAYEVANLTRMVDIIKEVWKRNSNGNVCIDWVEVCNEKDWNLSVC
FT                   "
FT   gene            406345..>407403
FT                   /gene="SED5"
FT                   /locus_tag="PICST_90189"
FT   mRNA            406345..>407403
FT                   /gene="SED5"
FT                   /locus_tag="PICST_90189"
FT                   /product="SNARE protein SED5/Syntaxin 5"
FT                   /note="Has EST support"
FT   CDS_pept        406405..407403
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SED5"
FT                   /locus_tag="PICST_90189"
FT                   /product="SNARE protein SED5/Syntaxin 5"
FT                   /note="go_component membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90189"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67402"
FT                   /db_xref="GOA:A3LX44"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR021538"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX44"
FT                   /protein_id="ABN67402.2"
FT                   /translation="MSLSIQNRTFEFQQCVTSYDKINRKQHNYIKPNNQEWPPKKSKFS
FT                   QQASIIAKDIVHVTELLSKLALLAKRKPLFDDKPVEIGELTYVIKQEIFKIEQNMQNLQ
FT                   RFVKGDASVVVDSQTTQFSKNVLNLLNSKMKNVSGEFKNVLEIRQKNEIMNKNRTENFL
FT                   SAASNHRSSNNPSPLVESGDHLSNLGENPYLMNTQRAESPLPYDPDADPDVSYPYSNGE
FT                   YLSIPNQTQQMLLMEEQGGQYLQQRNRAVETIESTINEVGNLFQQLATMVSEQGEQIQR
FT                   IDENVEDISLNISGAQRELLKYYAHITSNRWLFLKIFGVLIVFFFLWVLVS"
FT   gene            <408113..>408781
FT                   /gene="SNF7"
FT                   /locus_tag="PICST_32690"
FT   mRNA            <408113..>408781
FT                   /gene="SNF7"
FT                   /locus_tag="PICST_32690"
FT                   /product="Vacuolar sorting protein SNF7 (Vacuolar protein
FT                   sorting-associated protein VPS32)"
FT   CDS_pept        408113..408781
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SNF7"
FT                   /locus_tag="PICST_32690"
FT                   /product="Vacuolar sorting protein SNF7 (Vacuolar protein
FT                   sorting-associated protein VPS32)"
FT                   /note="Vacuolar sorting protein SNF7 (Vacuolar protein
FT                   sorting-associated protein VPS32) Involved in derepression
FT                   of SUC2 in response to glucose limitation involved in late
FT                   endosome to vacuole transport; go_function molecular
FT                   function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32690"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67403"
FT                   /db_xref="GOA:A3LX45"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX45"
FT                   /protein_id="ABN67403.2"
FT                   /translation="MWNYFFGGNSSTKKELPKKAIVELREHINTLNKKRSHLEQQMADQ
FT                   EAIARKNLSTNKAAAKNALKKKKGYEVALIKTENQIESLETQLGAIEGANLNLETMKAM
FT                   KQGASAMKQIHGEYNVEKVEDTMDDIREQVELADEISEAISRPVGTEFVDEDELEEELA
FT                   ALQAEEQQQQVPAQKAAPEKQPAQQLPSFPTVNKAQPEATVEEDEDEEALKALQAEMGL
FT                   "
FT   gene            <409562..>413317
FT                   /gene="RPO41"
FT                   /locus_tag="PICST_36598"
FT   mRNA            <409562..>413317
FT                   /gene="RPO41"
FT                   /locus_tag="PICST_36598"
FT                   /product="mitochondrial DNA-directed RNA polymerase"
FT   CDS_pept        409562..413317
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RPO41"
FT                   /locus_tag="PICST_36598"
FT                   /product="mitochondrial DNA-directed RNA polymerase"
FT                   /EC_number="2.7.7.6"
FT                   /note="go_function DNA binding; DNA-directed RNA polymerase
FT                   activity; go_process transcription"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36598"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67404"
FT                   /db_xref="GOA:A3LX46"
FT                   /db_xref="InterPro:IPR002092"
FT                   /db_xref="InterPro:IPR024075"
FT                   /db_xref="InterPro:IPR029262"
FT                   /db_xref="InterPro:IPR037159"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX46"
FT                   /protein_id="ABN67404.2"
FT                   /translation="MHQFLEHLKLQDQEIKKSPSIHNKTFSEIIENEPESITDEQRRLR
FT                   VWSSDYDPVTRSPFAKDVSHLQSLLEVLLTSKNFDRARKILEAIHPLLSEPHTFIFSVN
FT                   KYLQTWSHDPSVHYGDLEQFFSTMEQRYGITANERTFAIILAKYISEDGPYISYLNRFS
FT                   QSKKTQILSYIDVIGVEGLMKVFSDNSISIEDVPEDLVNLFREVRNELNDKETLISEPE
FT                   YFNDDNTEVPTVDKDAESLRAVDSFGLKVIRHTLLGLREEADSKEIVSIIKQMEDGLGN
FT                   QSWSDDEASKLDFFKVYKTLKTEEQREKFNSGLHSFNLTRQRRLEVRGADGAKEKWKHE
FT                   FEEMQKRGALPLNKGLNAQLFQWYKNLLPYVKKEAEMCQKLMDGKVSKTDLSPDEKKLY
FT                   KDREYYAPYMVLVPPEKMCVITILELLKLNSTGGIVDGMRAARALISVGKAVELEYKSQ
FT                   SLLKSEIKAFSKKVKSTNQWKRILSNKKNNIIENPDDSTDWSYTVYAKLGAVLTNLLLF
FT                   VAKVPVKAHNPTTGKTITGSQPAFFHTYQFLNGQKLGVIKLHKEIIKQLAGRSLSNAVQ
FT                   PQLLPMLVAPREWHSYNDGGYLYSRSTLVRIKDSAETTAYLRKAADLGNLNEVYDGLNV
FT                   LGKTPWTVNRRVFEIITRYWNSGEEFLDIPPIMEEPNLPEPLPVDAEPAQKFEYQRKLR
FT                   SALNEAASLRSQRCDTNYKLEIARGFLGEKVFFPHNVDFRGRAYPISPHFNHLGNDLTR
FT                   SLFLFWEGRELGERGLEWLKIHLANVYGVDKAPLNERVQFVNDNLENVFESARNPYDTD
FT                   AWWKKAEKPWQALGVCFELEEAYKLENPTQYVSHIPIHQDGTCNGLQHYAALGGDIEGA
FT                   RQVNLLPADRPQDVYKYVASLVQKRIDAEAEEGNKYAVFLQDKITRKVVKQTVMTNVYG
FT                   VTFVGATAQIKKQIDQYFSGEEDVADYARYLTMHVFNSIRELFEGAHLIQDWLGDAAKR
FT                   VSKSVRIDYEDAKSNDGKPNHLSSVIWTTPLGLPCVQPYRISKNQLIKTNLQDISISDP
FT                   FSASQVDARKQQAAFPPNFVHSLDATHMLMTAKACGDARLSFASVHDSYWTHAADVDHM
FT                   NKEIRNQFVKLHSSNLVQELKEEFEKRYKNCLQVISISGEHPLAKEIKEVRRNNVKILG
FT                   RAMTAADEIYLEKTRLEHLNSEDPEKVKIGKEMVTTVSVTEKYDLNSIVGTTKNFQILV
FT                   PLTFPDIPAKGELDVEVVKESPYFFS"
FT   gene            complement(<413577..>414449)
FT                   /gene="MOB2"
FT                   /locus_tag="PICST_48394"
FT   mRNA            complement(join(<413577..414282,414373..>414449))
FT                   /gene="MOB2"
FT                   /locus_tag="PICST_48394"
FT                   /product="protein kinase activator involved in cell cycle
FT                   and shape regulation"
FT   CDS_pept        complement(join(413577..414282,414373..414449))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MOB2"
FT                   /locus_tag="PICST_48394"
FT                   /product="protein kinase activator involved in cell cycle
FT                   and shape regulation"
FT                   /note="Maintenance of ploidy protein MOB2 (MPS1 binder 2)
FT                   Cell cycle-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48394"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67734"
FT                   /db_xref="GOA:A3LX47"
FT                   /db_xref="InterPro:IPR005301"
FT                   /db_xref="InterPro:IPR036703"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX47"
FT                   /protein_id="ABN67734.2"
FT                   /translation="MSFLNTIRGFGRSSKKNKKELDSSSLVHNQIQFANSHSPTKGHRS
FT                   GQQSSRQMSPKRSSHSSTSAFNGSSSIKEQQLPLFLCEPFVKTALVKGSFKTIVQLPKY
FT                   VDFGEWLALNIFELFNNLNQFYGVIADYVTPEAYPTMNAGPRANYLWVDGNGQTVNLPA
FT                   CQYIEYVIAWISNKINDQSVFPTKTGGAFPPNFMKDCKNISRQMFRIFAHIYHNHFDKI
FT                   VHLSLEAHWNSFFAHFISLVKEYNLIDRNELEPLLPLI"
FT   gene            complement(<414989..>416743)
FT                   /gene="PSD1"
FT                   /locus_tag="PICST_32693"
FT   mRNA            complement(<414989..>416743)
FT                   /gene="PSD1"
FT                   /locus_tag="PICST_32693"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /note="Has EST support"
FT   CDS_pept        complement(414989..416743)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PSD1"
FT                   /locus_tag="PICST_32693"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="go_function phosphatidylserine decarboxylase
FT                   activity; go_process phospholipid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32693"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67735"
FT                   /db_xref="GOA:A3LX48"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033661"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX48"
FT                   /protein_id="ABN67735.2"
FT                   /translation="MNINHPLSRATTMAEIALKAQRNQQQEQQQKRNFSQFTSYYYQFP
FT                   KIPRPKRNVLYYSTWTSKGSKFMPTRKNIHFPNLRISRRSLSNANQKLKVKTKNFHKRF
FT                   FSVEARKRRQQRRRFIRWWTITSLAIVLGGVAAKVSYERGEQNDEESGPHQYRIKPQSW
FT                   HLYAYSTLPLKTISRIWGQVNSINLPVWVRSPSYRLYSALFGVNLDEMDEPDLTTYSNL
FT                   SEFFYRKLKPGIRPLGDSDLVSPSDGKVLKFGVIEDGEIEQVKGMTYSIDALLGLKTQR
FT                   LAAPSHSLDFDYNSDDFAVMERHEEFAKINGISYSVDDIIGGEGSETYHINKLDYKDVH
FT                   DGTAKGSRATFSKEMAVAKNLAPTPLDAIKTSPNKQLYFTVIYLAPGDYHRYHSPTNWV
FT                   TTLRRHFIGELFSVAPFFQKTLQGLFVLNERVALLGYWKYGFFSMIPVGATNVGSIVVN
FT                   FDKDLKTNERYEHEVYSRNSTPDENTPLLEGVSDSESSTDLTTLSTTSSEPDKKEKKKL
FT                   KKNTVYEATYTKASRLLGGVPLSKGQEVGGFKLGSTVVLVFEAPENFKFNLQIGQKVKM
FT                   GQSLGDFV"
FT   gene            complement(<417593..>422311)
FT                   /gene="APC1"
FT                   /locus_tag="PICST_62242"
FT   mRNA            complement(join(<417593..422017,422087..>422311))
FT                   /gene="APC1"
FT                   /locus_tag="PICST_62242"
FT                   /product="Anaphase-promoting complex (APC), subunit 1
FT                   (meiotic check point regulator/Tsg24)"
FT   CDS_pept        complement(join(417593..422017,422087..422311))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="APC1"
FT                   /locus_tag="PICST_62242"
FT                   /product="Anaphase-promoting complex (APC), subunit 1
FT                   (meiotic check point regulator/Tsg24)"
FT                   /note="go_process regulation of cell cycle"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62242"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67736"
FT                   /db_xref="GOA:A3LX49"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR024990"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX49"
FT                   /protein_id="ABN67736.2"
FT                   /translation="MSEKQSQVLSSPALSLKDELQVPFSTSPYSIQLFSHYRQLLTSTR
FT                   EVIILVGSSVSKKLAFEEDIVTATFTSFNSPDREASNSSAECLVVCFRKAANIYYSDGR
FT                   NYVVSFPFAVKNAFPFESGLVLERDVNSAELSNTQESIQLSQLGGAKFLTLVDPIGDFR
FT                   IIATSSTSIVSPNEVLLSFPRQGLNKTSSLCATFNPQERNVIIYSIRASHRGTKILDSG
FT                   TKYSRRNYSLLSTPNPSRVLEEEGHFDASVGSSGVNQNVLSLNMEKKRTSTLLADISSI
FT                   ARMGTENNFPDNTKRKSHVAHEVPILRRDMILTRTDVLPTNTDKAHMQVFGINFEEQEA
FT                   IVVVNKLKKEARVYLYKHHSNHFHHCYQITCKECIPLNSRKMEGFVIALKEDGSIILVN
FT                   PFVDVSSQKIYLKSKFPNVDGLQSSFEENLAIKYKDGNVGTIRLLLQPNNEFVANCLHS
FT                   FKYLSGSKVTETIWMLWRSALALDESKDEWNALVIALLTLFFPFQDGIEQCTPNEITNL
FT                   LPSAKRLSECLDSKVNYGDLASYIALSLHLLREEARLDCTSKSCLNKLGVLLAQFTVWM
FT                   GWPESWTKYYLIDFSSIDKSVRFLSLLMLDSAPNLFESLASLFTGKIIRYLTFSQLSEE
FT                   SDSVDSLITPRTHCILKLFEILVSPNFGPTAVVDMMCEYGITRGELETYPPGISILLKE
FT                   AISLCQENPSFAWTNKTLELVGRKDLTMFLSRNSNPRSFTGSKVEVKSISSILSNVLTK
FT                   YESISPWDGQSEADRIGLTKLIFDYDRRYYEITTLLHQTKTQTATLLAEEGISEYDLVL
FT                   QQRNLAALVALRTLTIPLGRAALFYAGRKPLLTEKFPVPKFNLNTLIAPTMTNIILSDG
FT                   SIPAKISEWGYFHNGVSSGLSISREAKGITGSWIIFNKPPELNTQHAGFLLGLGLNGHL
FT                   KKLEEWHIYNYLGPKHPLTSVGLLIGMAASIRGSMDNKLTKVLSVHAVALLPQGANDLN
FT                   VPIMVQTAGLIGIGLLYLESQHRRMSEILLSQITSSVSQNDTEQIHEGYRLAAGISLGL
FT                   VNLGKGNDLSGLNDTHVVDRLSSLATSMKDYQPVQELDKSCCGAIMALGFIYIKTENAT
FT                   VANKLKVPNTEQMLDYIRPDLLLLRSIAKNLILWNDIGKSVEWVQSEVPSVLFEKYGKG
FT                   HIQVLDSDQLGFFNILGGSCLSMAVKYASSHDSTVRNTLLHYLDLMMRISSFNTNNYDQ
FT                   KIAHQCAGKIRNLIALSLSVVMAGSGDLETFRRLRILHDDTNKEMGYGNYMAINTALGF
FT                   LFLGGGQYAFGNSNFAIACLITSLYPIYPNENSEVDVHLQALRHFWALSVEPRCLIIRD
FT                   VNSHNPLKIPVSISLKNGEVKEALSPCLLPPLDEILTIQTRSRDYFNAQIDFELNSEYL
FT                   EIFKKSLTVFVYKRRNFKLLSPSIGSLIKNENKSLQIENGEIKISEDVSTLLKLEAMGH
FT                   IDDYEKQVLLYECSENDDSHAYSTELSIFNIIDNKIDLARMANSPQSMEDLWNLKLLFS
FT                   YSDRLMNSELHYVSVEFIDQLKQEVWAIS"
FT   gene            complement(<422497..423856)
FT                   /gene="TUF1"
FT                   /locus_tag="PICST_65888"
FT   mRNA            complement(<422497..423856)
FT                   /gene="TUF1"
FT                   /locus_tag="PICST_65888"
FT                   /product="mitochondrial translation elongation factor TU"
FT                   /note="Has EST support"
FT   CDS_pept        complement(422564..423856)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="TUF1"
FT                   /locus_tag="PICST_65888"
FT                   /product="mitochondrial translation elongation factor TU"
FT                   /note="go_function GTP binding; go_process protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_65888"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67737"
FT                   /db_xref="GOA:A3LX50"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX50"
FT                   /protein_id="ABN67737.1"
FT                   /translation="MYRSVVSTVSALRTAGRVGVLKFRPALTRGYAAFDRSKPHVNIGT
FT                   IGHVDHGKTTLTAAITKVLSEKGGANFLDYSSIDRAPEERARGITISTAHVEYETDKRH
FT                   YAHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQELVVFV
FT                   NKVDTIDDPEMLELVEMEMRELLSTYGFDGDNTPVIMGSALCALEGKQPEIGKEAIDKL
FT                   LDAVDEHIPTPTRDLEQPFLLPVEDVFSISGRGTVVTGRVERGVLKKGEEIEIVGNFDK
FT                   PFKTTVTGIEMFKKELDSALAGDNCGVLLRGVKRDEVKRGMVLAKPGTVTSHKKFLASL
FT                   YVLTTEEGGRHSPFGENYKPQAFFRTTDVTCSFSFPEGEGVDHSQMVMPGDNIEMVGEL
FT                   IKATPIEVNQRFNIREGGKTVGTGLITRILE"
FT   gene            complement(424262..>425217)
FT                   /gene="PMT3"
FT                   /locus_tag="PICST_84640"
FT   mRNA            complement(424262..>425217)
FT                   /gene="PMT3"
FT                   /locus_tag="PICST_84640"
FT                   /product="mannosyltransferase"
FT                   /note="Has EST support"
FT   CDS_pept        complement(424262..425140)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PMT3"
FT                   /locus_tag="PICST_84640"
FT                   /product="mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_84640"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67738"
FT                   /db_xref="GOA:A3LX51"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX51"
FT                   /protein_id="ABN67738.2"
FT                   /translation="MLHIPRGLVIRDDSCSVFEGASTVNLIFSILITLGIFISYLPQYH
FT                   RIYSKRTSEGLSTNFLLLGSCSSIFTLTNIILVSSKARHCCATGALNTFNCINSQLNLV
FT                   QIGLQCTCAILILVFVLILTQNSLKQDKHEYQRIVQVGKLVALHGVVSIVQIVVGLYSD
FT                   KSVLYSIASINGLLSTLLTVIKYVPQIYTTYTLKHPGTLSIGMMCIQTPGGFVFTATLF
FT                   FTKGSHWSSWVSYLVAASLQGVLLAMCLYYEYFHNKGQDAELAERLAVERIIAENLQEQ
FT                   EIDGEEAAPLL"
FT   gene            <426001..>428654
FT                   /gene="MUC1.8"
FT                   /locus_tag="PICST_32696"
FT   mRNA            join(<426001..428374,428611..>428654)
FT                   /gene="MUC1.8"
FT                   /locus_tag="PICST_32696"
FT                   /product="possible mannoprotein"
FT   CDS_pept        join(426001..428374,428611..428654)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MUC1.8"
FT                   /locus_tag="PICST_32696"
FT                   /product="manno protein"
FT                   /note="low similarity to MUC1, part of complex that
FT                   catalyses guanyl nucleotide exchange on Ypt6p"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32696"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67405"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX52"
FT                   /protein_id="ABN67405.2"
FT                   /translation="MSSRLWAVNATKKKKNELVPGSSRWITNEMSLQYDSALTNCEDHF
FT                   QDCSSRYDSLSSFVQKVLDITNSTEDHTEDLSLLLAVSNPTVFSPEFSKSTTFVQPTEP
FT                   EDMYSSNHKDSTPNIRTANSNDITIPVKPENIKEDTVISESRNSLKQAIIAQSSPIRHR
FT                   TSQYRQTPVKPRINQPPRLMHASPNQIDISPPHSNSSMDRIDTGRKSLSSSSPPKVVQQ
FT                   SLPSVETHQTEHTSTARNTSLINGIDDSFQAISTAIRKSIAGKSALTISSSTPAKAKKS
FT                   GVYEEFETKINLQPEEANRSSTIHSTASSNENTRKISASMRSSIFVGLPTREPITVNTK
FT                   SSKHSSIKSRSSRLFERLDIASRRDTSSEIAIDNKVANKGEDKADKEHDVDANFDMSPV
FT                   AIPKRAFANFNSIKSQVDMKNNGTTNLNSVPDLSNTTSKSNLLPDKPVKIPNKEHTIPS
FT                   RAETEENIISEIGVPSTKAPREPEDVKSTSATVRKTLLSESPSIRPFNSSTNGSRSPTR
FT                   SYLSFKYKGSPREPTTRSRSRSPTRSVGPLSKKSSPISKIHDTTGYDVPENDEKGLISR
FT                   LTIPTSSSAAKRKTPTSSKRETESRKSEGRKTDLMNTKNRFLTTTLNSNNPQFSLKRPQ
FT                   FQGNQSVAAKPLHSPTRRRNPAIEDLEIKTAPKLEPDAIPILKKKSMMAERSEAAAQKP
FT                   KQKFTISMNHTSKHKAEIVPFSNQKQLGDVFARDEDTKESHDVHQFEKYSYRNNAVALP
FT                   EAARGGFGSAKRRKTNKEDKTPSRTGALAKKQFLEKKATQHGGDIRFPFFQS"
FT   gene            complement(<430195..>432480)
FT                   /gene="BUL5"
FT                   /locus_tag="PICST_62784"
FT   mRNA            complement(join(<430195..432383,432414..>432480))
FT                   /gene="BUL5"
FT                   /locus_tag="PICST_62784"
FT                   /product="ubiquitination pathway protein"
FT                   /note="Has EST support"
FT   CDS_pept        complement(join(430195..432383,432414..432480))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="BUL5"
FT                   /locus_tag="PICST_62784"
FT                   /product="ubiquitination pathway protein"
FT                   /note="ubiquitin ligase binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62784"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67739"
FT                   /db_xref="InterPro:IPR007519"
FT                   /db_xref="InterPro:IPR022794"
FT                   /db_xref="InterPro:IPR039634"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX53"
FT                   /protein_id="ABN67739.2"
FT                   /translation="MEDRKKFNLKLSSLSLRRKSKSNGNDSELVNILPSYQMYRSTISK
FT                   QLIPSREDLRTQPPSYELSPISSASSYNEYGGFDGIPSTYSLPTSPVRELFANPLDLEG
FT                   ESNETILENAHKLKRISASNKEISKALHIHIFMTETVGKVGVKPKIIDPLSIEIKQGDY
FT                   LYGFVLVTNKTKYDVPFDMFSTVLEGCATFGSNGNLQSSVVRPPTTVVRFLTMFDFNAS
FT                   WNDAALDRLVSDNNNPMVPTIIIDPIDGTHVQLDPRKILEPNITYKKFFAFKVPEKLLD
FT                   VTCEHGFVKHLQIPPTLGISKNEVITSLRQKYKESDLESSLSEEDAHRGKCYASLTNDM
FT                   FFSSASIDFSVSARIIGRASDYESIFVKSLGKQGDDEYVVANEDYCYLRVIPVTTNSFE
FT                   LNRSMINEEAKLLSASMEQNIKEKISLARELSAIPVDERSNTTSPDNQLHPTDSAADVA
FT                   KMQQSYYSKVRARHVHRSRDDLYEVLFPFKRRNVFGTSKVLGMCGLTTPKSEYHVDYHP
FT                   LPRYLRGKAPPTTTVSIPMELTFLPAENGSRDLPGFKRISVELIALTVKSKKLPIPLVI
FT                   HPEMMFENKGKSVDNFDTVTLRTYQKYALELSKLIKDVGVESLNLEKQMLRDLKCMANL
FT                   STKYDHFKIDKMKLQSDVSSTPVQLLSSIPWEQEAVAGAGSTAPHDEVKFTKKFNINID
FT                   LSSAIHLPSMSSDFCLVPDFQTCYVARLYYLNIGLRTPNGEKFHVKVPLILQRQKQV"
FT   gene            complement(<433033..>435258)
FT                   /gene="BUL2"
FT                   /locus_tag="PICST_61563"
FT   mRNA            complement(<433033..>435258)
FT                   /gene="BUL2"
FT                   /locus_tag="PICST_61563"
FT                   /product="BUL1-like protein"
FT                   /note="involved in protien ubiqutination"
FT   CDS_pept        complement(433033..435258)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="BUL2"
FT                   /locus_tag="PICST_61563"
FT                   /product="BUL1-like protein"
FT                   /note="involved in protien ubiqutination"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61563"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67740"
FT                   /db_xref="InterPro:IPR007519"
FT                   /db_xref="InterPro:IPR022794"
FT                   /db_xref="InterPro:IPR039634"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX54"
FT                   /protein_id="ABN67740.2"
FT                   /translation="MNLQSQFSGISISPIVSAGEEDELINNILPSYHMYQSTISKNLTP
FT                   TDENFRVDPPIYEVSPVTTSNTLNSSSLFGFQTPMNESVNNSVEAFPLSITESSTFNEE
FT                   SAQVWENTILANAHKLPNLTKTNNAVSSNLEVKITVTEKVCQVGMKPTVIDPSNKEFRQ
FT                   GDYIHGYVTIVNKSDKPISFDMVYIVFEGVITVLDNNKGFLDSENPVNVFKFLNMTDLY
FT                   ASWTYANIDRLVTDNGDPHDWCEGETDPYDNTALSIDVKRLFQPGVTYKRFFTFRVPQK
FT                   LLDDICEPHSLSRHTDVPPSIGIPRGLIAPSLLLANRESQIRDMAFIDTCISYSVDARV
FT                   IGKSSDYNYETHDSRDRYIIAKEATCPIRVIPTTNLEYECNPKAMIQEAGLYYKAFVDS
FT                   IVSKIEYGNDLTNASTNPRTLNLQALTPVGSRDSNHKLRQLYDVADMSIKHNLKKNRKQ
FT                   FADDIYQFTTSFKKKSLTGSVKVLGIVSLSTPKEHYSISYVPPIKFREPGKKYNTTISV
FT                   PIELSYFVEGSNTSKVVFPEIKSLQSELVVFSVRSKKHCFPFEFTHEMCFKDENIDSSK
FT                   KNEPDNFDSIIVKPFQGYINEIQNLIKNVSNEVLRFETQMYKDIRSVSASSTKYINLSI
FT                   PDFELHSKSSKSSGNHASVKTIPWESERIEQEDHLLYSKKFDVTLDLNSCHLKGPDNKH
FT                   NRGFDYLTLVPSFQTCLMARMYYIKIVIKMVSGDSLVVHVPLTVDNY"
FT   gene            436214..438475
FT                   /gene="EMC38"
FT                   /locus_tag="PICST_78698"
FT   mRNA            join(436214..437506,437525..438475)
FT                   /gene="EMC38"
FT                   /locus_tag="PICST_78698"
FT                   /product="gamma-glutamyltransferase"
FT                   /note="Has EST support"
FT   CDS_pept        join(436391..437506,437525..438361)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="EMC38"
FT                   /locus_tag="PICST_78698"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="Gamma-glutamyltransferase precursor
FT                   (Gamma-glutamyltranspeptidase) (Gamma-GT) (Extracellular
FT                   matrix protein 38) (CIK1 suppressor protein 2) [Contains:
FT                   Gamma-glutamyltransferase heavy chain
FT                   Gamma-glutamyltransferase light chain]; go_function
FT                   gamma-glutamyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_78698"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67406"
FT                   /db_xref="GOA:A3LX55"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX55"
FT                   /protein_id="ABN67406.2"
FT                   /translation="MTLNEKTTLLQHQQQRSVRGLRYLPAIHFKSRFLVVLAAIMTILV
FT                   MHTLLVLQGKQPLLEEKIKYIKRPDPYRSLHKIFINDDPLLDRIGVPTLSPSEEHLHLG
FT                   SKAMVTSDVPLCSTMGKDILLSGGNAADAAVTVALCIGTINSHSSGIGGGGFIVSKHKN
FT                   DFISIDAREMAPSGAFKDMYGDNFVLSKIGGLAIAVPGELKGLYELFVRHGSGRLSWKQ
FT                   LLEPVIHLNRNGFRCTKVLETVIAMENSIVFSQVPEIKTNWDFIFKNDETVKEGDWIRR
FT                   PNYANTLELIANNGSSAVFYDPEGPIVGSLVKTIKQFGGILTKDDFKNYKVNVEHPINV
FT                   NLTIGDKDLSVYTANGVSSGLALVAGLNFFNEIINDKDDVSLTHKLVESFKWLSAIRSE
FT                   FGDVNIDNYKQDLITKYTSKSWIKEVFDKGEYSDERTFPWTNYHPKYELTEPEGTSHFS
FT                   IIDEEDNAISMTTTVNLLFGSLVYDNSTGIILNNEMDDFSQPKVPNAFNLTPSIYNFIG
FT                   PHKRPLSSTAPTIIVDSDTGKPDLLIGAAGGSRIPTAVLQAIVRIYYERKQLLHTISFP
FT                   RLHHQLIPRNIMVENFTVFDDEHGHNNIQTALCKLGHTFYESGSLTSMNGIHRNGDHLE
FT                   GVSDFWRKRGEADGY"
FT   gene            439406..441899
FT                   /gene="YAT1"
FT                   /locus_tag="PICST_68034"
FT   mRNA            439406..441899
FT                   /gene="YAT1"
FT                   /locus_tag="PICST_68034"
FT                   /product="mitochondrial carnitine acetyltransferase"
FT                   /note="Has EST support"
FT   CDS_pept        439564..441822
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="YAT1"
FT                   /locus_tag="PICST_68034"
FT                   /product="mitochondrial carnitine acetyltransferase"
FT                   /EC_number="2.3.1.7"
FT                   /note="go_function acyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68034"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67407"
FT                   /db_xref="GOA:A3LX56"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="InterPro:IPR039551"
FT                   /db_xref="InterPro:IPR042231"
FT                   /db_xref="InterPro:IPR042232"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX56"
FT                   /protein_id="ABN67407.2"
FT                   /translation="MATYQHQDSLQKLPIPDLTETCANYLKVLKPLQTESEHEQTVKAV
FT                   ESFLKSGTGKYLDSELRTFAKTRNSYIEQFWYDAYLNYDNPVVLNLNPFFLLEDDPFNN
FT                   DNNVHSNPQIKRATSLTLSSLKFIQALKNETLPPDVLKNGQPLCMYQYSKLFGASRIPT
FT                   DDGCIMQSDNKSNHIVVMSKSQFYWFDVLDSKNNILLSESELSVNFTSIVQDSLTTDHA
FT                   DIAKSSFGVLTTENRRIWANVRNNLIHNNPINNEILSIIDSALFILCLDDIEINDLSEL
FT                   SKNMLCGLSILDKGIQVGTCTNRWYDKLQIIITKNGKAGINFEHTGVDGHTVLRFVSDI
FT                   YTDSILSFAQSINTNSPSLWKNTRKNSNEIEINDDLITIPRKLEWDLTPDLSLALRFGE
FT                   TRLSDLINQNEFRHLEFKRYGASFIKKMKFSPDAFVQMAFQATYYALYGKVECTYEPAM
FT                   TKHFFHGRTEAIRTVSQESNLYVRKFFDSLISNEEKLKYLAEACNSHSKQTRLCSAGKG
FT                   VDRHLYALFCLWKRYLDTHEDEEDGESTNMDPRASISTLVDDDDSSSENTIVDHHSHAK
FT                   AQNSMANLKVLPEIFADNGWDKLNNTIISTSNCGNPSLRLFGFGPVSANGFGIGYILKD
FT                   DSISICASSKHRQTQRFLTTLESYLNEIETMFKQVKGEKKAAAAVAAKAATVASLPKIV
FT                   QPTPVSNLSSLLGGYGYFDMGDDDIKSRGPSPELPFLNRNNSGFSIREIGKKLRLSEY"
FT   gene            complement(441860..445320)
FT                   /gene="MSB1"
FT                   /locus_tag="PICST_68035"
FT   mRNA            complement(441860..445320)
FT                   /gene="MSB1"
FT                   /locus_tag="PICST_68035"
FT                   /product="polarity establishment and bud formation protein"
FT                   /note="Has EST support"
FT   CDS_pept        complement(441984..445154)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MSB1"
FT                   /locus_tag="PICST_68035"
FT                   /product="polarity establishment and bud formation protein"
FT                   /note="Morphogenesis-related protein MSB1 (Multicopy
FT                   suppressor of bud emergence 1) polarity establishment and
FT                   bud formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68035"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67741"
FT                   /db_xref="InterPro:IPR012965"
FT                   /db_xref="InterPro:IPR037508"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX57"
FT                   /protein_id="ABN67741.2"
FT                   /translation="MAAQQTRRADFDLPKLPDMATVRKSANLIRPEQFSKRKLKSILHL
FT                   ITAELKARGTNVPHILLPFRSKINDSKLEQFLEQLFPNGELIDVDHDENHALIIIQSYD
FT                   EFTLICALKYMWSRLPNNEIIGWDVYLEYRRREREAGYPKNAFLSIMPKCLSSPAHASI
FT                   VYDFLDLLISITSNSQYNYLSGRKVTKMASIWAFNPTSKLSKSAFYDATINQEFNFIQG
FT                   VEAWKSSGNALFHLLLSFLRAMLPENDAETLKLPKALQSLLITTAYPPSEDTGRTLKSM
FT                   ITIPCVVVKSTRPSSNVYELLSKVRHTLSFDKKDAFLSIENYTILKNIFKKDSTDDIVR
FT                   GLTEESRRVLGRLTDDSIESKYELYPGWPKSQPEIDDNIPLFSQVSVYDVTLQDFYIWT
FT                   WLSTLGSDQSTEFKKIFGRSLVMESDLKGFQKWIIISEQTMSSDEYLKHFKLEPVQTTT
FT                   PPRSRNPSNESIKRKNSPLPPLPPKDFKHLDETVDPLPNISFEEKDYKLDVGSLTLEDD
FT                   QMSYIYPSKVSADEASEYRRYLETTSIAEVSIQTRSRTNSTVPIPRKVPPSSDFDINSA
FT                   PSSSLSLGQPCQTPVTQYSSNTGDFKEPFDSYTTEQERKEMIKQNKSDEPFEDYYVPGT
FT                   GQSPMELLERHQQLNSPVSEQSLDKAKDPIDTELASDTPKLDDKLDAKLDSKFEAEYAE
FT                   SKEAKKERRRMRKEKKEKLKREKEVAEVMAAAAAAAGFTDTPEFASVGTPPIRSPPGSF
FT                   APPDVIMSPVPESPKRVKDKSQDKEKKKKKKKKPTSYVADEKQTDYTMALPPPQPIFNQ
FT                   VPPPLDLNMASHSPAVQNGIFFSPFSAPPMPYQPQYAYHGSQEYLPVPPTQYMYHSSQE
FT                   QLSLPTEYHKSRGSSPQSRSPEKSHTKLNSNTEPQGQVYSAIPPQQFPHPQQYLHPQQY
FT                   SQQYLPHNPQQYLPHPPQQQKPSHHSPALSSQPQYQAYQPVAHEPIHHPNHTPAPQPIY
FT                   LNRPSASNHHPISPPHSRPTSDTGSGGKHGVSDFTMMSIPKQGKHNKNSTTNKANLRAA
FT                   FIQGSFGI"
FT   gene            complement(<447250..>449281)
FT                   /locus_tag="PICST_32703"
FT   mRNA            complement(join(<447250..449148,449270..>449281))
FT                   /locus_tag="PICST_32703"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(447250..449148,449270..449281))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32703"
FT                   /product="bZIP protein that binds to CRE motifs, interacts
FT                   with Mig1p"
FT                   /note="go_component nucleus; go_function DNA binding;
FT                   go_process regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32703"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67742"
FT                   /db_xref="GOA:A3LX58"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX58"
FT                   /protein_id="ABN67742.2"
FT                   /translation="MTNEQQKTTFDLEPNPFERSFASKDSSVSNASSVSEHHNRDSENS
FT                   SATSSTKSSNKHNLHIPNLSTLNGANNNINNNININSNNNSINNSSNSTSNKLPGITPP
FT                   LFTPGGRRLHPLGLSPPVPGSNGAAVTANGTALSNPGTPGSNLWNSLLSATNNHNNNGS
FT                   NVNTANVATNGANANVIAAGNGPNSQANFNQFVNTLRKTGLTPNESNLRSGLTPGILSH
FT                   QFSFGAQVPGLTTPSALLNSPMTPGLSSLLGLTSNNSANNVATINSLQPTHQQTYDTLP
FT                   SIPQEPSESLPTSEPLRQPMAAPVVKQEIKKQETSKRSQSKKRKADTADSSKGKRQKAD
FT                   SAAAKKAAATRANSESDSDKESSPPRNSNNPKSEDEKRKSFLERNRVAASKCRLRKKQL
FT                   VQKMEDELAFYSTGYRELSAEVNQLRDSLITLKSIIENHKGCALLAQNVGGFDQIERII
FT                   QQANYIAEMSNNSSNDVTSIPSTIPTTLHSTNSVSAIPARGNDSQFQAMSNTLVTKTIG
FT                   TPNSNDVQANSSTNTTTVVTPELAGAYSHATINHAHGMSDMPQSNPDGPVAMNGGNGEL
FT                   RAINSMSNLSALNTGAQAQMQQLPHPQQALQNYSLRPVSSMVELQQAMHAHGNLGSELN
FT                   V"
FT   gene            complement(450054..452486)
FT                   /gene="MNS1"
FT                   /locus_tag="PICST_84949"
FT   mRNA            complement(450054..452486)
FT                   /gene="MNS1"
FT                   /locus_tag="PICST_84949"
FT                   /product="mannosyl-oligosaccharide 1,2-alpha-mannosidase"
FT                   /note="Has EST support"
FT   CDS_pept        complement(450323..452233)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MNS1"
FT                   /locus_tag="PICST_84949"
FT                   /product="mannosyl-oligosaccharide 1,2-alpha-mannosidase"
FT                   /EC_number="3.2.1.113"
FT                   /EC_number="3.2.1.24"
FT                   /note="Endoplasmic reticulum mannosyl-oligosaccharide
FT                   1,2-alpha-mannosidase (ER alpha-1,2-mannosidase)
FT                   (Man(9)-alpha-mannosidase); go_component membrane;
FT                   go_function mannosyl-oligosaccharide 1,2-alpha-mannosidase
FT                   activity; calcium ion binding; go_process N-linked
FT                   glycosylation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_84949"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67743"
FT                   /db_xref="GOA:A3LX59"
FT                   /db_xref="InterPro:IPR001382"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR036026"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX59"
FT                   /protein_id="ABN67743.2"
FT                   /translation="MSSFSFSADKLSLGNRWKAKSSSSSLPMYYKDKPNLKSPRPSKII
FT                   MLVKGFIGSLVLYYIYSLTFGSSGLFGLTYSSGSKWTRAQQEVRSAMLDSWHTYEKFGW
FT                   GYDIYHPVRQKGENMGPKPLGWMIVDSLDTLILMDAEDEVARAKKWIKEDLDYRFDYNV
FT                   NTFETTIRMLGGLLSAFHFTNDDSLLDKAVDLANALDGAFASKTGIPFSSVNLESGEGI
FT                   PNHVDNGASSTAEVATLQLEFKYLAKLTGEVLYWNRVEKVMQVLEANQPADGLVPIYVN
FT                   PQTGNYQGKLIRLGSRGDSYYEYLLKQYLQTNLQEPIYEGMYRESVRGVRKHLVRRSKP
FT                   SDLAFIGELENGIGKHLSPKMDHLVCFYGGLLALGATNGLTYSEAKKLPDWTDEKEEEF
FT                   QLGADLTYTCYRMYADTQTGLSPEIAVFNEDKTQNSDFHIKPADRHNLQRPETVESLFV
FT                   LYRLTGDEKYRQYGYEIFNSFMKHTKIENENGDISFTSLKDVTSIPSPTKDNTESFWWA
FT                   ETLKYLYLLFDDTNKVPLDKYVFNTEAHPFPRFDLNSNLKTGWIRKIDGSKEPELQQPM
FT                   VKIDKNKLPEAQPVDKPAAEEAKEILKKNPEAAKEENVEANKKKLDELIKDDIGAAAVR
FT                   E"
FT   gene            <453852..>456524
FT                   /gene="WAR1"
FT                   /locus_tag="PICST_32705"
FT   mRNA            join(<453852..455938,456017..456219,456310..>456524)
FT                   /gene="WAR1"
FT                   /locus_tag="PICST_32705"
FT                   /product="WAR1; transcription factor activity"
FT   CDS_pept        join(453852..455938,456017..456219,456310..456524)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="WAR1"
FT                   /locus_tag="PICST_32705"
FT                   /product="WAR1; transcription factor activity"
FT                   /note="heme binding fungal transcrption factor;
FT                   go_component nucleus; go_function transcription factor
FT                   activity; zinc ion binding; go_process regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32705"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67408"
FT                   /db_xref="GOA:A3LX60"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX60"
FT                   /protein_id="ABN67408.2"
FT                   /translation="MSQANNSDDASTGTKKSKSARRSVACKSCHSLKVKCTPADPTNPS
FT                   GSCIRCLNANRKCEIDLNQTRKRRKKADILLANLRDRSEAPTVESSVAPSTPIIASVSE
FT                   APSPAPTTSEEVIENLKRQVKSLEAQLQQQQAFNQHAMHHSRNINTSNDTISDVDSPPF
FT                   ISKSDLEREILFLCDSSVTKLTDLTNDLKTVADRRTSLFRDSRPVDVVSTGLLSLEEAT
FT                   ERLETYRKVLFVQHPLIEIPNEISIQELREKSPFLFNAVMSVTSVVYNKQLDIDKALNI
FT                   DNAAVQSIAVEVMVSGTKSDELVKSLILLCVWYNSPELFRQRRYHLLNTLGVTMLHDLG
FT                   IVARPSYSFKGEDRAVTQDDNKKQNSEYQSLVLIVYFTTVSICLILKRTIYVKWTPFVE
FT                   ECCSTLERSPNRTWRELALFSRLSHLLDKIHHIIHSPEISESRRSTPHYIIHEMQKALS
FT                   IVRHKIRDDDHAFLAYYFSVEAYLHEPCLTNVFTNDENGDNMKLTESSAKSISNCTNSC
FT                   LNALDEFNKLSLEEVAGIPLFYSSRIIYTAGMLLRLRYLILSLPSHIEKDLVPYHAIFA
FT                   IQRANKILDQASIAHSANHFLKKTRLVLQLFIQTYATQVQELLRKNGETPQNLKPTPKK
FT                   ELHEMDRLSNIFRAHHQAGQKSIINDDANQYDSNVPLDILSYAASYRRDSKDSNMRGRS
FT                   SPALPLTSSASVGAISIPPLRASETLQPSNLSHLHRSSSLGIINNSSLPIPSNGHALPP
FT                   MFGTNGNPNAGQLPSQFRQPSIGSNKQAYNNLANPDQLENSYMALNDEFWSDLLSTESD
FT                   RINFSNNNYNSAQVNDELFFMN"
FT   gene            <456808..>457392
FT                   /locus_tag="PICST_61331"
FT   mRNA            <456808..>457392
FT                   /locus_tag="PICST_61331"
FT                   /product="predicted protein"
FT   CDS_pept        456808..457392
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61331"
FT                   /product="putative steroid binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61331"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67409"
FT                   /db_xref="GOA:A3LX61"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX61"
FT                   /protein_id="ABN67409.2"
FT                   /translation="MAGPKRTNSGARDAFTLIDIVRVVGGLLFLNAFFSWWFTSTSTWG
FT                   YNGKWINTQYLKHRLTNNYVNLTIDELALYNGSDMSLPIYIGVNGYVYDVTASRGIYGP
FT                   KGSYSKLSGKDASRLYVTGCFMNPEEYTYDLRGLKEEEAKQELSEWQQFFEEHPKYWLA
FT                   GYVQRPDPVGEPPAPCEHIKFPGRRTKNAGN"
FT   gene            complement(<457802..>459592)
FT                   /locus_tag="PICST_36608"
FT   mRNA            complement(<457802..>459592)
FT                   /locus_tag="PICST_36608"
FT                   /product="predicted protein"
FT   CDS_pept        complement(457802..459592)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_36608"
FT                   /product="cystathionine gamma-synthase"
FT                   /note="go_process amino acid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36608"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67744"
FT                   /db_xref="GOA:A3LX62"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX62"
FT                   /protein_id="ABN67744.2"
FT                   /translation="MPSQEIGMPIPNIPHAVSVTLPTWEATVGYEEGEDWVVSKMNSGY
FT                   PRFFIHSVIQSLSKKIETKYGRDGERCMIFPSYKVAKRCRQFIKEKSEKSLVVRVLQLS
FT                   TPAPANEEERSTVIEATIGVVFFPADVFPLAKNYWQHSGEGISSRMGEYISRALFESES
FT                   RSISPSPRPSIRAANSNLKQELQVQSIQRKSPSISASIRSPSFTVSEEEIKEHDTFIEQ
FT                   KFGRVLDLKFAKEAKIALRRRICGKVDKSHNQKEEMEKARRGKNLSETDVYLFPSGMAS
FT                   IFYAHHVLLNVSKKPKKSVCFGFPYVDTLNILKKFGPGVHFLGLGDDKSLDTLESELES
FT                   GELDIMALFCECPSNPLLKTPNLKRIRKLADKFNFAVVVDETVGNFLNIHVLPFADMVC
FT                   SSLTKVFSGDSNVMAGSLVLNPASPMYHALKEYFNREYEDLFWAQDALWLERNSRDFAE
FT                   RSAKIDRTSWLTVQLLQKSPLISKVYYPKISESKQYYDEIKTATGGYGGLISFLFKEPH
FT                   QAVAFFNAVNLHKGPSLGTNFTLACPYAILAHYQELDEIAKWDVDRNLIRISIGLEDPD
FT                   ELLDVLQKSLDIAAAEPKTD"
FT   gene            complement(459901..463684)
FT                   /gene="HMG1"
FT                   /locus_tag="PICST_72872"
FT   mRNA            complement(join(459901..463278,463610..463684))
FT                   /gene="HMG1"
FT                   /locus_tag="PICST_72872"
FT                   /product="3-hydroxy-3-methyl-glutaryl coenzyme A reductase
FT                   (HMG-CoA)"
FT                   /note="Has EST support"
FT   CDS_pept        complement(460129..463272)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="HMG1"
FT                   /locus_tag="PICST_72872"
FT                   /product="3-hydroxy-3-methyl-glutaryl coenzyme A reductase
FT                   (HMG-CoA)"
FT                   /EC_number="1.1.1.88"
FT                   /note="go_function hydroxymethylglutaryl-CoA reductase
FT                   (NADPH) activity; go_process biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_72872"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67745"
FT                   /db_xref="GOA:A3LX63"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="InterPro:IPR023282"
FT                   /db_xref="InterPro:IPR025583"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX63"
FT                   /protein_id="ABN67745.2"
FT                   /translation="MVLGFITRATSALARTSAHRPIHFIIITSLLASIAYLSVVDEYIP
FT                   ENFSDTDIGTSYYHPAGRADYKNWIKIDNASEYPKANHVTVVPLRFKRVLHSEIPTVEN
FT                   TFQGLQQNERVLIVDSDVVDSALQSIDKISYNGLTWRARNNNRIMKYYEYIRTSLSKIR
FT                   SLMQNAENFDITLITVAYLAMWYTLIKVFVDMRLVGSKFWLAFSTIISSTFAFLFALVV
FT                   TTKVLDTKVPLISISEGIPFLVAIIGFKHKVSIASAVQTASNTSEDVRTIVARVISSHT
FT                   VSMLRDHVAVIGVLLACASYGSHLAGLRNFCILSSLILSIDLVLVYTFFSAILALKVEI
FT                   NRARRTEDLKEALEEEGISSLIAQDVALQSSNIEHPNEKNFFASDDSSIVSFKVAMILG
FT                   FLGFHAFWLGSSWLYNSTGDATLSVLDTAPQLTKSTAKYITIGSKGTIVTILPARIYLP
FT                   LGYLVLTEDFVLSVLEKISYAIRDNLISKFLLFGFAISISVNAYFLNASRYQVSATTKL
FT                   IQREFSRPQLSEKSKTQTVTSAQAPRVSKIDTKESYEDSSSEELEIKVPAKQLPLEECI
FT                   EIMKDGKVKTLNDNEVSSLVVSGKLPLYALEKQLADNTRAVAVRRKAIAKLANVPSLDS
FT                   GRLPYKHYDYDRVFGACCENVIGFMPIPVGVAGPLIIDGKPYHIPMATTEGCLVASTMR
FT                   GCKAINAGGGVQTVLTRDGMTRGPCVSFPSLARAGAAKLWLDSEEGQSTIKKAFNSTSR
FT                   FARLQHIQTAMAGDLLFIRFRTTTGDAMGMNMISKGVEYSLKYMVEECGWEDMEIISVS
FT                   GNYCTDKKPAAINWIEGRGKSIVAEARIPSEVVKKVLKSDVDALVELNISKNLIGSAMA
FT                   GSVGGFNAHAANLVTAVFLACGQDPAQNVESSNCITLMKRVGDDLQISVSMPSIEVGTI
FT                   GGGTILEPQGAMLDLLGVRGPHPTNPGDNARQLARIVACAVLAAELSLCSALAAGHLVQ
FT                   SHMQHNRKGAAATPAAPAANGSANGSAKAQTKAPKPNGAANGNDLKRLKEGAVTCIKS"
FT   gene            complement(<464414..465785)
FT                   /locus_tag="PICST_78835"
FT   mRNA            complement(<464414..465785)
FT                   /locus_tag="PICST_78835"
FT                   /product="predicted protein"
FT   CDS_pept        complement(464490..465785)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_78835"
FT                   /product="FKBP-type Peptidylprolyl isomerase"
FT                   /note="go_process protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_78835"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67746"
FT                   /db_xref="GOA:A3LX64"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="InterPro:IPR041232"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX64"
FT                   /protein_id="ABN67746.1"
FT                   /translation="MASLIPISTYNLAVKPFFPVPAIEDEYPVTIRLTLAAVDPEAVDD
FT                   KEEPSTLRLLKRSNPFIDDEEDDFEDEDEEDELDEDEDEEEEEKEEDKKSKKSKKTKRA
FT                   EKEEEEEEDEEEDEDDEDDEDDEDDVSEFVVCTLSPKVQYQQTIDLTISPDEEVYFVVT
FT                   GSYPIHLTGNYVEHPADEDSDDSDYDDEYYDDDEYDLSPEEDELVGGYNLEDLEDESDI
FT                   ESKIEELVEEEEAKGTKKRAAEESETKSAKKSKKEEKKSVQFTKELEQGPTGSTLVDKK
FT                   KEKKEKAKAKKEEAKAKKDEAAKEAKEAAKEAAKDGKKFPTKTLLGGVVTEDRKVGTGP
FT                   TAKSGNRVGIRYVGKLKNGKVFDKNTTGKPFAFGLGKGECIKGFDLGVAGMAVGGERRV
FT                   VIPAKMGYGSQALPGIPANSELTFDIKLVSLK"
FT   gene            complement(<466213..>467232)
FT                   /locus_tag="PICST_36611"
FT   mRNA            complement(join(<466213..466731,467221..>467232))
FT                   /locus_tag="PICST_36611"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(466213..466731,467221..467232))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_36611"
FT                   /product="ribosomal protein"
FT                   /note="go_component intracellular; ribosome; go_function
FT                   structural constituent of ribosome; go_process protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36611"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67747"
FT                   /db_xref="GOA:A3LX65"
FT                   /db_xref="InterPro:IPR000915"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041997"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX65"
FT                   /protein_id="ABN67747.1"
FT                   /translation="MSQIAPKWYQSEDVPAPKQTRKTARPQKLRASLVPGTVLILLAGR
FT                   FRGKRVVYLKNLEDNTLLVSGPFKINGVPLRRVNARYVIATSTQVSVEGVDVSKFNVEY
FT                   FAREKTPRSKKSEADLFNEAQPKKEIKAERVADQKSVDAALLAEIKKTPLLKQYLSASF
FT                   SLKNGDRPHLLKF"
FT   gene            complement(<467989..>471822)
FT                   /gene="XYC2"
FT                   /locus_tag="PICST_61977"
FT   mRNA            complement(join(<467989..468776,468816..>471822))
FT                   /gene="XYC2"
FT                   /locus_tag="PICST_61977"
FT                   /product="putative xylanase/chitin deacetylase"
FT   CDS_pept        complement(join(467989..468776,468816..>471822))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="XYC2"
FT                   /locus_tag="PICST_61977"
FT                   /product="putative xylanase/chitin deacetylase"
FT                   /EC_number="2.4.2.18"
FT                   /note="Anthranilate phosphoribosyltransferase (tentative)"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61977"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67748"
FT                   /db_xref="GOA:A3LX66"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR017147"
FT                   /db_xref="InterPro:IPR031468"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR037756"
FT                   /db_xref="InterPro:IPR037761"
FT                   /db_xref="InterPro:IPR037762"
FT                   /db_xref="InterPro:IPR037765"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX66"
FT                   /protein_id="ABN67748.2"
FT                   /translation="FRRFNRDIRDDLARVNAINRLDNEAETMEWLNSFLDKFWVIYMPA
FT                   MSEMVLTIANGILKDLAPGFGIDKLSLDEFTLGSKAPRINSVRSYPKKAEDHIEMDWDF
FT                   SFTPNDTDGMTKAEIKKKIDPKVALGVTIGKAFISKSFPVLVEDMSMTGRLKIRLKLSQ
FT                   NFPHVKIVSVQFLEAPTIEYGFKPMGGDTLGLDIMSFIPGLRTVVNGVIHSILRPMFYA
FT                   PNSFDVDVEEMLAAQSNDSIGVIAVTVLRLQKLKKGNPTKPNSINPYVQLKISNNASIN
FT                   EKTTVKKLINDPVYNETKYLLVNQLDGNHLNFNVFHLVEDKADDQLIGSVDFQLADLLQ
FT                   EEAHNNVIKTLTESGKAVGKIEFNLKYFPVRAPLVLEDGTKEPILDAEVGILKLNLHEA
FT                   RDLDISSSVLGILNPYAEIYVNDELVKKCRRLRRTNEPSWGQSLESLITQQSETTVQVL
FT                   IKDSVDDTIVAKLNSNLQDLVFETSRGQEWIETDPVTEGGPRPRVRITANWKAIKIDDT
FT                   SIVKTHENAPIGGLRLHLRSAKSLKNLEAVGLVDPYVRVLLNGKLRAKTATFENTLDPL
FT                   FNTAYFLPVANEHQHYLLQIMDEEPEGKDRSLGTAAVHIGDFLKRDQNGYFLPHDGADT
FT                   ILEQPVIFNGQPTGTIYYSVSFIPAIPVYSLSQIKNKEAYLEEVKEKEAAAIAKQAADE
FT                   KLFKEKPNEYEWIEVEEEEVVEPKKVQMGLDSSIKYRSGIVSVHLLGGSFEKSDVYVHT
FT                   LFDEQAYSSGVSPKSEGNRLSVPSSGDGFVRDLPLSKLIIRIAKKVEVDFESDIIAEQI
FT                   FDTLDILKKSYSKPITLRIQDRNQVKLQLEFIPSDVQLNPLDTVLDIGKVKLEVIGADN
FT                   LKSVDTNGKSDPLCVVKLDGKEILKTDKKRKTLSPVWNESVDFSLLSRSRQSIVLEVYD
FT                   WDYTHDDELIGKTVVNLSSLEPSKTQEFSSELDTQGRINLRATFKPEYIRPKLAAKSAL
FT                   PMDLNFDAPMNVVVVGGAGAVAGGVVGGVGGIASEGIARGGSFLKGFGRSKKKHSSNGD
FT                   ETSTIADDSFASHDKNFSDIESEAAHDNASRHSPMSPSKKGREVVNKSAELQSLRSGAA
FT                   PVSNSLQHSQVDGIARPPIPGHLRTPSAASDAASIASSFAPGAIPGRLTIVSASNLNTK
FT                   DPVEVKVVLKQPTKQKDLFKTRNTKGDKSANTFKWNESVPFKSVTEGELIFDIREHHTF
FT                   GKNVSLGQATVKLSDVIGRPDNLELNVGSGQLVVNVRYN"
FT   gene            complement(474024..475010)
FT                   /locus_tag="PICST_90304"
FT   mRNA            complement(474024..475010)
FT                   /locus_tag="PICST_90304"
FT                   /product="predicted protein"
FT   CDS_pept        complement(474157..474927)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_90304"
FT                   /product="ribosomal protein S3Ae"
FT                   /note="go_component intracellular; ribosome; go_function
FT                   structural constituent of ribosome; go_process protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90304"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67749"
FT                   /db_xref="GOA:A3LX67"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="InterPro:IPR027500"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LX67"
FT                   /protein_id="ABN67749.1"
FT                   /translation="MAVGKNKRLSKGKKGLKKKVVDPFTRKDWFDIKAPSTFENRNVGK
FT                   TLINRSTGLKNAADGLKGRVVEVSLADLQGSEDHSYRKIKLRVDEVQGKNLLTNFHGLD
FT                   FTSDKLRSLVRKWQSLVEANVTVKTSDDYVLRVFAIAFTKRQANQIKKTTYAQSSKLRE
FT                   VRKKMIEIMQREVSNVTLAQLTSKLIPEVIGREIEKSTQTIFPLQNVHIRKVKLLKQPK
FT                   FDLGALLALHGEGSTEEKGKKVNAGFKDVVLESV"
FT   gene            <475641..>476441
FT                   /locus_tag="PICST_62699"
FT   mRNA            join(<475641..475672,475874..>476441)
FT                   /locus_tag="PICST_62699"
FT                   /product="predicted protein"
FT   CDS_pept        join(475641..475672,475874..476441)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62699"
FT                   /product="GTP-binding protein of the ras superfamily"
FT                   /note="go_function GTP binding; go_process small GTPase
FT                   mediated signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62699"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67410"
FT                   /db_xref="GOA:A3LX68"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR017231"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX68"
FT                   /protein_id="ABN67410.2"
FT                   /translation="MDDNQHGQNNQVALKIGLIGDSQIGKTSLMVKYVEGSFDEDYIQT
FT                   LGVNFMDKKIQIRNTTITFSIWDLGGQKEFINMLPLVSNDAVAILFMFDLTRKSTLNSI
FT                   KEWYRQVRGFNKTALPFLIGTKYDQFIDLSYQDQVEITSQAKKFGRAMKAPVIFCSTSH
FT                   SINVQKIFKIILSKAFDLRLNLDEINNIGEPILLYK"
FT   gene            <477115..>479757
FT                   /gene="ORC1"
FT                   /locus_tag="PICST_62569"
FT   mRNA            join(<477115..477774,478030..>479757)
FT                   /gene="ORC1"
FT                   /locus_tag="PICST_62569"
FT                   /product="Origin recognition complex, subunit 1"
FT   CDS_pept        join(477115..477774,478030..479757)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ORC1"
FT                   /locus_tag="PICST_62569"
FT                   /product="Origin recognition complex, subunit 1"
FT                   /note="go_function ATP binding; DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62569"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67411"
FT                   /db_xref="GOA:A3LX69"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR020793"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041083"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX69"
FT                   /protein_id="ABN67411.2"
FT                   /translation="MASNQKELEAYNFVLESVSVDGSASSASTTRRSRRDKSTASPVLS
FT                   LRRETDGMVLRTGDTILVQQKGADKPEVAFIKEIKYGIVNFIEIVVTWFIRMEDIVFED
FT                   LPKVLEYADKSKLNTNELFLTVYLEEIFVSEIVEKVNVLSYHEFEDIIIDDSNASNTFM
FT                   ARRACSSEGDNITEEINYRDLCVLFENDPNAFVDFLGEATETVQRTKTPKQTPQLKKKD
FT                   EVEQIQDSQDAKVINHGDNDEYIKEQNGDESSDEDDLSASASDDLDSDEAEVSESDEEF
FT                   QVETTRKRPTRQQKRIVTPSRTKSPAKKPRLTKQEKIKEFMDGVLASPSSNPRQKFKVR
FT                   TSPKKQTNILSSLKIQKTSGNFIKNLDTSSKAFKEIKEKLHSSQAISHLIGREEQFASI
FT                   YVSLMNAIEQETGCSIYVCGTPGVGKTAVVRAVINQLKEDFTNGFDYLEINGLKLLSPA
FT                   VAYEQLWEKISGVKVTAANAALFLENYFKNDAKRKPLVVVMDELDQIVTQKQNVMYNFF
FT                   NWPTYASSKLIVIAIANTLDLPERVLSNKISSRLGLARVEFHAYSYDQLGEIIAQRLKM
FT                   LTEQSKQKVAIKDDAVGFASRNVSRVRGDARRVLSICRRAVEIAEQEYIEKKNEKLVAE
FT                   DEIYNVQIPHIAKAINESINSPLAKYLESLPFGSKLLLVAVVLRMRRSGLGENSLGDVI
FT                   DEMKQTLQMFTSQDSTSLLKESEPNVTLSNFLYASDIFDLSNGVPDVRISHFKRILNEL
FT                   VEGGVLTQQNIPGERYRQIRLHVSQEEVVSVLKRDNSIAGMI"
FT   gene            479936..480595
FT                   /locus_tag="PICST_79024"
FT   mRNA            479936..480595
FT                   /locus_tag="PICST_79024"
FT                   /product="predicted protein"
FT   CDS_pept        479940..480560
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_79024"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_79024"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67412"
FT                   /db_xref="GOA:A3LX70"
FT                   /db_xref="InterPro:IPR019398"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX70"
FT                   /protein_id="ABN67412.1"
FT                   /translation="MNAIDPTEYVEVPEGVESLKFSIEKQQAKFELGVCMAIYKWEELN
FT                   TAVENSWGGPKSGEKRDWLSGVVIDLFDEKAVDIQLIEETLLYAMVDEFDTEIDNDSAL
FT                   EVAALVMKFYKDVSLEKYAQIDELYEKWSAKQAIKTNAHKVHVEEDPNNPDVSDSDEDE
FT                   EDEEEDATQMDVDAMEVDEEPQGPIVDDDGFELVQKKGRKGRR"
FT   gene            complement(<480648..>483689)
FT                   /locus_tag="PICST_62764"
FT   mRNA            complement(join(<480648..481720,481748..>483689))
FT                   /locus_tag="PICST_62764"
FT                   /product="protein putatively involved in cell wall
FT                   biogenesis and architecture"
FT   CDS_pept        complement(join(480648..481720,481748..483689))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62764"
FT                   /product="protein putatively involved in cell wall
FT                   biogenesis and architecture"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62764"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67750"
FT                   /db_xref="InterPro:IPR026705"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX71"
FT                   /protein_id="ABN67750.2"
FT                   /translation="MKTADDKLRYKNHFFKLGQGRVIAGNDSDYWKVLWTEPDNSDDIF
FT                   ELLTSYDIRTIRDQNRVNYLVMIHVLCNQIIATARDSEFPSSKSPLSIRQLLTCIRLLV
FT                   KLIPFLYEIPEYTQEIEPRLFWVENFDPLVFIKPSTFASLSSSTSQPCLTKESIHNVTA
FT                   VQLMRALVDLLFIRTFTIDAPRSKSNKILSVWEPGIGTSSKYLAPNLIIDSNRAEVLKL
FT                   LLTLCSSTFYNTPSEVVSAGSKFMTLLVTSTPRVELLTLVCSLTNLVCRSTRSSPEDNA
FT                   LSYPSNSQLTEMRHLTVTYSIQLLTAMVVYPLPSPEKLDFLKETELISTSKPGNLARLY
FT                   MGKLHKDQELVFLSTYLIAILKLPVVTSKDVESSKFNIIKSGNQPSLWATEATMLIWEL
FT                   IQCNKKFKTLIYEQSLPELLVVLFYYIFAFHSNVQHKNLVRICAYLMLYCSSDKNLDSI
FT                   FEPMDHNLYESLPTNYKTNPAPTTTRDFLVTQICNLLIYMQTPQSTYTYGATLTPSPLM
FT                   VTTLVEILYNLIPPVATKSLEATNDPAKKLTNSNPNGGLSYSTCSVINLLIGKYSSRTF
FT                   LQEKSINSDLLALLIRAVCTAALKYPKSSRMLLFSILKNAKVYDQVWNTIYSFRTEYFN
FT                   GNKLNRIDDGEEENENILSVVNSNNSERFKPESETTDSESPQTRKNSMFGIGTPPMTIP
FT                   EESQQSDAEEELEASLRPKLPTGMSERAREKLPKESSLKRSWGGNDSLRILLTIVIPYL
FT                   KVVLKEIWSSKDGPTVDSYLLVEHIEKADFDDLLERSKTQINYDFLPDKPLDKLKFNWS
FT                   HLSLGWYISLLGGAVYNSVDSVKTYTGNNNKIMKNITTSIASVSKLTSSWTGFMKHSTT
FT                   AYSANDSAEVAEWVKSSLTAVNQWNHTDVKLFKIETSSGSFFGKLGSVNEAVPGTPGGV
FT                   NDMANSIVRRLSDFRLNNSSRGSISSVHSGLTTPVEEQEQYFPKFSARNSITSLHSLNA
FT                   INRSRSATPRNSMSN"
FT   gene            complement(<484194..>485042)
FT                   /gene="LOT5"
FT                   /locus_tag="PICST_62387"
FT   mRNA            complement(<484194..>485042)
FT                   /gene="LOT5"
FT                   /locus_tag="PICST_62387"
FT                   /product="low temperature responsive protein"
FT   CDS_pept        complement(484194..485042)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="LOT5"
FT                   /locus_tag="PICST_62387"
FT                   /product="low temperature responsive protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62387"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67751"
FT                   /db_xref="GOA:A3LX72"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR039924"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LX72"
FT                   /protein_id="ABN67751.2"
FT                   /translation="MGPKSRIIHEQPNIENTIPASLYQAVSPERFSLEDDDKFVIYGGG
FT                   NSYAIQVLQNDPSQELVVCPELESVDYSNVSLFVLNTSLIVWFNSADLGLELPYQSIIL
FT                   HALHTLSDDTFLYLQILSNECITSIPSGTTEFVPSIEIRIVKNDKPGNPLNDNPLLVHN
FT                   SNSSIETVYEAMSKCSAFHFDSDSEDESGTYAFDSAEQTPALEIPSHWLNNNVDDVDSD
FT                   EALLRNTGIADDLEIDDVDETGNVNEVAAMHVDVGYASIAGSIRKRDEDDVSIAKARRV
FT                   E"
FT   gene            complement(485476..487525)
FT                   /locus_tag="PICST_90276"
FT   mRNA            complement(485476..487525)
FT                   /locus_tag="PICST_90276"
FT                   /product="predicted protein"
FT   CDS_pept        complement(485541..487247)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_90276"
FT                   /product="predicted protein"
FT                   /note="go_function hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90276"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67752"
FT                   /db_xref="GOA:A3LX73"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX73"
FT                   /protein_id="ABN67752.2"
FT                   /translation="MSQQEAINNANQISNALNALQQKNPKPKRDLSIYVMEDGTTINTQ
FT                   ERAISTIEPPATFKPTDEQLFLPNGLPNCAFLKDHFFREGRLHEEQAIRIVRAATELLR
FT                   KEPNMLHVPAPVTICGDVHGQYYDLMKLFEVGGNPESTAYLFLGDYVDRGSFSIECLVY
FT                   LYALKLNYNSSFWMLRGNHECKHLTEYFTFKSECLHKYSADLYEECLASFNALPLAAIM
FT                   NNQFFCVHGGLSPELKTLADLERLDRFREPPTKGLMCDLLWADPTEEYDEDNMDQTFVR
FT                   NTVRGCSYAFTYKASCQFLERTGLLSVIRAHEAQDAGYRMYKRTKTLGFPSLLTMFSAP
FT                   NYLDTYNNKAAVLKYENNVMNIRQFNASPHPYWLPHFMDVFTWSLPFVGEKVTDMLVSI
FT                   LNICTEEELDEETPLAEEAITQNVSAVSTNPGQAPGAVSSVQTNPPTTVQEDDSLDAKK
FT                   LALRNKIIAIGRISRMYQVLRQESENVAHLKELNSGSLPKGSLLNGADGLKKTITSFEE
FT                   ARKADLVNEALPPTAEEFRKIEEERGERAKREIERNDNPSPVFSRLIRRLS"
FT   gene            complement(<488192..489666)
FT                   /gene="SPE1"
FT                   /locus_tag="PICST_90612"
FT   mRNA            complement(join(<488192..489542,489609..489666))
FT                   /gene="SPE1"
FT                   /locus_tag="PICST_90612"
FT                   /product="ornithine decarboxylase"
FT                   /note="Has EST support"
FT   CDS_pept        complement(join(488224..489542,489609..489666))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SPE1"
FT                   /locus_tag="PICST_90612"
FT                   /product="ornithine decarboxylase"
FT                   /EC_number="4.1.1.17"
FT                   /note="go_function catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90612"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67753"
FT                   /db_xref="GOA:A3LX74"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX74"
FT                   /protein_id="ABN67753.1"
FT                   /translation="MTPSIEVFQDEPIFESSLKTSVVAEISSSSSSSKDQLARELINRA
FT                   LVNHISGIDHEECEAGDEDSFFVCDLGEVYRSFGVWQQKLPQVQPHYAVKCNTNLEVIK
FT                   LLASLGVNFDCASKNEIDTILNLGISPDRIVYANPCKTNSFIRHASKANVNLTTVDNAQ
FT                   ELHKLKKFHPDCGILIRLATDDETAQCRLSTKFGCTLSAAINELLPLAKELGLNVRGVA
FT                   FHVGSGAKDFDSIYKAIRDSRDVFNRAITEYGFEMSILDIGGGFELETFDESSSMVCSS
FT                   LNKFFPADFVSQNGIKFIAEPGRFMVSNAFTLAAHIIARRDLDLKATFVSEEDKQVSAM
FT                   VYINDGVYGNMNCILFDHQNPQAHVLQHKNKFFYHQDEESDDQKLIDDDAKGEHHFSIW
FT                   GPTCDGLDCVASKCTLSHDVEVGDWLYFPNLGAYTSAATTAFNGLGGNSHIIYVCSEDL
FT                   "
FT   gene            complement(<490270..>492723)
FT                   /gene="VPS27"
FT                   /locus_tag="PICST_36619"
FT   mRNA            complement(join(<490270..490526,490569..490871,
FT                   491025..491526,491566..491595,491617..>492723))
FT                   /gene="VPS27"
FT                   /locus_tag="PICST_36619"
FT                   /product="vacuolar protein sorting-associated protein
FT                   hydrophilic protein"
FT                   /note="has cysteine rich putative zinc finger esential for
FT                   function"
FT   CDS_pept        complement(join(490270..490526,490569..490871,
FT                   491025..491526,491566..491595,491617..492723))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="VPS27"
FT                   /locus_tag="PICST_36619"
FT                   /product="vacuolar protein sorting-associated protein
FT                   hydrophilic protein"
FT                   /note="has cysteine rich putative zinc finger esential for
FT                   function; go_function zinc ion binding; go_process
FT                   intracellular protein transport; go_function zinc ion
FT                   binding; go_process intracellular protein transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36619"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67754"
FT                   /db_xref="GOA:A3LX75"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LX75"
FT                   /protein_id="ABN67754.2"
FT                   /translation="MSWFGSSSDSTIELDNKIQEATSESIPNGELDLPLALEVTDLIRS
FT                   KSLPPIQCMRSLKKRLGMTYSNPNLLSSTLKLVDLCIKNCGSHFLNEIASKEFMDYLVD
FT                   FIFKVHYDTKNYQVRNSEAKMNVGELILSLIKEWSILFSNSSDLSYVTRCFERLESEAY
FT                   NFPDFAETSALNSKFVDTEVPPDWVDDDKCMICYDKFSMINRKHHCRACGGVFCQTHSS
FT                   NFIPLVSLGISKPVRACDNCLAKQKSKNKPSQHNSSSHSRGTSRVQEDDEDEMLRKAIE
FT                   LSLQDTQIPVSAPVARDAPTNSSQTKTITDEDDDEDLKAAIAASMKDYQDQERLREEQQ
FT                   KQWQQEQEEKHHQEEQSDFYNYSIPKPSNYSQQLPYVQSVASLTEEEEADINKFITLMY
FT                   QVKNDQNISYARLHDEKLTDLHTKVCPLRSKVTKNLIYTVERQKAFTELNNKIAAITRL
FT                   YEEHLDSKLKQTYGYQQSVPPVQLPEINDYMRGPQSNYEQSIPAQGTGYQQQAGYVHPE
FT                   TTGYPSYPGGQQPIPQQPIAQQPSGSRPSAQQAQKAPEQKHEQQQTSVPTFAYPPQESY
FT                   PPEGEDDEEQSNFELPPLPNQAQNDFSYPPTQSYDSPSEPMYPNDSTDQQYNVYPPNGA
FT                   GSEESKDEYSSGELQPVQPTREHVLRTRSSELPPHAVEQASARFPPIDTVEEEYQNSNN
FT                   SSVPYPDVSFPIAPTQNLQPQQEPPKKFVPEPEPLIDI"
FT   gene            complement(<493307..>493972)
FT                   /locus_tag="PICST_36620"
FT   mRNA            complement(<493307..>493972)
FT                   /locus_tag="PICST_36620"
FT                   /product="predicted protein"
FT   CDS_pept        complement(493307..493972)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_36620"
FT                   /product="suppressor of tor2"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36620"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67755"
FT                   /db_xref="GOA:A3LX76"
FT                   /db_xref="InterPro:IPR019623"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX76"
FT                   /protein_id="ABN67755.1"
FT                   /translation="MAELVGTWTSKSNTVFTGPGFYDPEDELLIEPDLPGISYSFTEDG
FT                   HYEEALYRVVGNARQHECPIASVTYQHGTYELLSNGSLVLTPIAVDGRQLLSDPCATGN
FT                   NQSTYTRYVQPTWFKTYQVFVDSYHGRYTLQIYQFDGSMMQPLYLAYKPPLMLPTYALN
FT                   PTDAASKTKSSLRRRVKRSLENQYRTNAVKDIAGENFEKYWWISVACLGAASSYLFLK"
FT   gene            complement(<496192..>497157)
FT                   /locus_tag="PICST_19145"
FT   mRNA            complement(<496192..>497157)
FT                   /locus_tag="PICST_19145"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<496192..>497157)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_19145"
FT                   /product="G1/S-specific cyclin CLN1"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_19145"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67756"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="InterPro:IPR039361"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX77"
FT                   /protein_id="ABN67756.2"
FT                   /translation="QFTQKDYSSHLYEAELAVHQQSFEEYEDDIFKSMVQLTNSNRPDL
FT                   DLYKQQPYLTFAIRSKLIDFLLKMSVRLKILPFVFFRAVRIFDRYCSKRIVLLDQAQLI
FT                   ITTCLWIASKVQGGNNHFVNLNNLEKITCIKTINDLGYGSGGKYLGPTERFRLPKLHEL
FT                   VKLCGAKCKYDQGMFKQMEIHILSSLDWSLNDPGIEEFITTSREFCIMSAYSADNEMFK
FT                   VKEFLCYLSLYAPELIDINIIELSQVMLALINEALGFYPGDRLFQKVIGEEAIHTEIEP
FT                   HRYRAIKTNLIKAVMGATDYSLRLFNSRGPQFFYNQINALY"
FT   gene            <499987..>501015
FT                   /locus_tag="PICST_32723"
FT   mRNA            <499987..>501015
FT                   /locus_tag="PICST_32723"
FT                   /product="predicted protein"
FT   CDS_pept        499987..501015
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32723"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32723"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67413"
FT                   /db_xref="InterPro:IPR029330"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX78"
FT                   /protein_id="ABN67413.2"
FT                   /translation="MFKYLFGSNEDSTTPLTNEPTIDYNNTIHTIASERNRLSASRFNT
FT                   ESRSNSNYVLDYSDDELDSEEELTRDFQRISRNLTRSTESIRDWDLPTNHSLPTNYPGK
FT                   FPKSTRTQEAQVSNGAHKGAGTYGDHVSRTYEPLSDRVPSADYSENFIEKSDTTEQIAK
FT                   LEQEINEELRSSRKRTKTDGIQLDSVILKVKQQNQFLSNLNELIDINNNDQEIDNIPSS
FT                   ILRKYQALKEAYIKELNNSQIFYKGYYKLIGKYRQLKNAGNGVRSSAPDVNTSKSGFFI
FT                   KEKVRLIKSSTKEENIKLICVNILRELDAMEDKDKTIAKYKQDLDAANERIRQLELQAQ
FT                   SK"
FT   gene            complement(<501951..>503660)
FT                   /locus_tag="PICST_32724"
FT   mRNA            complement(<501951..>503660)
FT                   /locus_tag="PICST_32724"
FT                   /product="predicted protein"
FT   CDS_pept        complement(501951..503660)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32724"
FT                   /product="ethionine resistance protein"
FT                   /note="go_component membrane; go_function drug transporter
FT                   activity; antiporter activity; go_process multidrug
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32724"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67757"
FT                   /db_xref="GOA:A3LX79"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX79"
FT                   /protein_id="ABN67757.2"
FT                   /translation="MSSLTSREATPLLAPINSAFSDIDESEIVAYIDQRRVSIASAGPD
FT                   RIPPSFLTSKSPIPHERDRLTHSISRNSLYVPDISDIISNSDIAPEPETDLATEVKVLL
FT                   YYSVPLVVTFLLQYSLTVASVFSVGRLGSTELAAVSLSSMTANISGYAIIQGVSTCLDT
FT                   LCAQSFGRKDYNTVGLHFMRCNYMLLLLFVPIFFLWVFGAEPVLHSIIGKEEAKLCQLA
FT                   ARYLRILSFGMPGFILFENGKHFLQSQGIFHASTYVLVICAPLNALLNYLLVWDKTVGI
FT                   GFAGAPLSVVITNWLMCVLLFAYIFYVKGYQCWPKQQLSDSVYFTSWTKMINLSVPGVL
FT                   MVEAEWLAFEIITFTASKFGTEVLAAQSIVSTTCVLMYQIPFAISIAASTRIAWYIGAA
FT                   SIKSAKIATSATIRTSLSLGIVNCCIIYVFREFFASLYTNDKKVIKLASEVLIIGAVYQ
FT                   INDFLSCATGGVLRGQGRQKIGGILNLISYYLIALPVAFLCAFYFKLGLLGLWIGMIIA
FT                   LFFISVSQYYFVATSNWEAVINECINEGIMEEGNITIDAHSTIPSMSSSTYV"
FT   gene            <505025..>505933
FT                   /gene="AKR4"
FT                   /locus_tag="PICST_48452"
FT   mRNA            <505025..>505933
FT                   /gene="AKR4"
FT                   /locus_tag="PICST_48452"
FT                   /product="aldose reductase"
FT   CDS_pept        505025..505933
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="AKR4"
FT                   /locus_tag="PICST_48452"
FT                   /product="aldose reductase"
FT                   /note="similar to conjugated polyketone reductase (PKR1)"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48452"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67414"
FT                   /db_xref="GOA:A3LX80"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX80"
FT                   /protein_id="ABN67414.2"
FT                   /translation="MSLQGKFFKLSNGNTIPAVGYGTGTKWFKSALGDIDTTLVDTLVQ
FT                   AIKLGFTHIDGAQIYKTSREIGLAIKKSGIKREDLFLTDKFFSGPSTLPKSTSPNPYDA
FT                   LKQSLAEFQLEYVDLYLLHTPYISKESHGYDVVEAWNYLEKLQDEGLVKNIGVSNFAVE
FT                   DLQKILNSNPKHKPVVNQIEYSAYLQNQTPGVVEFAKKNGILIEAYGPSAPITKGKGGP
FT                   LDPVLEKLAKKYNKTEAQIILRWVLDTGVLPVTTSSKEDRIKAFLELTEFKLDAEDVKE
FT                   ISEVGKEKIFRQFFTEYSRFD"
FT   gene            complement(<506089..>506994)
FT                   /locus_tag="PICST_61958"
FT   mRNA            complement(<506089..>506994)
FT                   /locus_tag="PICST_61958"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<506089..506994)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61958"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61958"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67758"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX81"
FT                   /protein_id="ABN67758.2"
FT                   /translation="MSSISRDVTLIVQSTSLSDFQKIKQLKSVVTISNVAELALPISEI
FT                   DDSYNVILYLIRIELIIAHSEDYSKLPDLFRELSLVPYLKNINSSSVSPQNFKETYIKT
FT                   TYNDNLTDYQYLIQNPNNRKLLDLINKKMLLVSNLPSTDETYHDLNRLINLKILELFII
FT                   SSYDFRKKNILKHLQEDMKLDTDESSPVTELVDLLASGRVIPFDLWQKALSSDFGNNYY
FT                   FLIRRCMNTSQLIVNWLENNIVLLSKYYISIKISKVYQLFHISSDIEVEQVILDMVVHK
FT                   KLPTNSKIDQIEGILVFGQEE"
FT   gene            complement(<507260..>507904)
FT                   /gene="ALG13"
FT                   /locus_tag="PICST_61591"
FT   mRNA            complement(<507260..>507904)
FT                   /gene="ALG13"
FT                   /locus_tag="PICST_61591"
FT                   /product="syntenic homolog of ALG13_YEAST
FT                   UDP-N-acetylglucosamine transferase subunit ALG13
FT                   (Asparagine linked glycosylation protein 13)"
FT   CDS_pept        complement(507260..507904)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ALG13"
FT                   /locus_tag="PICST_61591"
FT                   /product="syntenic homolog of ALG13_YEAST
FT                   UDP-N-acetylglucosamine transferase subunit ALG13
FT                   (Asparagine linked glycosylation protein 13)"
FT                   /note="go_function transferase activity, transferring
FT                   hexosyl groups; carbohydrate binding; go_process
FT                   carbohydrate metabolism; lipid glycosylation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61591"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67759"
FT                   /db_xref="GOA:A3LX82"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR039042"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX82"
FT                   /protein_id="ABN67759.2"
FT                   /translation="MPTVLITTGATVTFRSLLDYVVSPEFIENLSKFKVSRLKLQYGNE
FT                   INPTTNEHVSRDYFERLVKQSEIVSKFQLDISTDRKSDTDGSITYSSTKYDFVLEAFPF
FT                   SMDIDSHIRSADVVISHAGTGSIIDALKLHKKLVVIVNDALMDNHQAEIANEFAKLNYC
FT                   VSHNVNELFGTEKLINSVRSLLDGSIQLTEFPANKKEIVESIIAEELQKAV"
FT   gene            <508476..>509228
FT                   /gene="YKH1.2"
FT                   /locus_tag="PICST_36622"
FT   mRNA            <508476..>509228
FT                   /gene="YKH1.2"
FT                   /locus_tag="PICST_36622"
FT                   /product="Predicted short chain-type dehydrogenase"
FT   CDS_pept        508476..509228
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="YKH1.2"
FT                   /locus_tag="PICST_36622"
FT                   /product="Predicted short chain-type dehydrogenase"
FT                   /note="hypothetical protein Glucose/ribitol dehydrogenase;
FT                   go_function oxidoreductase activity; go_process metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36622"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67415"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX83"
FT                   /protein_id="ABN67415.1"
FT                   /translation="MSSLTYFVTGGNRGIGFELVKQAADAGHKVIATARDVAKATELQK
FT                   LADSNKNVKIVTLDVADVKSIEALDAQLAAVTDGIDVAILNAGISDAYYKVVDAPRQVW
FT                   IDHYLVNSLGPVLVFQKLYKYLQKRETKKVVFISTLVGSITDFIPVSVSAYGQSKAALN
FT                   YSVKELSFELKPEGFVTIALSPGLVTSDMGSYGAKKLTESAPEAGAALASSAITAEESS
FT                   AAILKIVDGLAEKDNGLFLNYTGELAKW"
FT   gene            509545..510316
FT                   /gene="ERG2"
FT                   /locus_tag="PICST_73274"
FT   mRNA            509545..510316
FT                   /gene="ERG2"
FT                   /locus_tag="PICST_73274"
FT                   /product="C-8 sterol isomerase"
FT                   /note="Has EST support"
FT   CDS_pept        509584..510237
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ERG2"
FT                   /locus_tag="PICST_73274"
FT                   /product="C-8 sterol isomerase"
FT                   /note="C-8 sterol isomerase (Delta-8--delta-7 sterol
FT                   isomerase); go_component endoplasmic reticulum; go_function
FT                   C-8 sterol isomerase activity; go_process ergosterol
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73274"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67416"
FT                   /db_xref="GOA:A3LX84"
FT                   /db_xref="InterPro:IPR006716"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX84"
FT                   /protein_id="ABN67416.1"
FT                   /translation="MRYAFYILIPLFFYSVLDRLFDTWLPTNYRFSKDKLVELSREVIA
FT                   NHPDGNATAIMIELAPKIKAEYPDLINDLNFDDWVYNNAGGAMGTMFILHASISEYLIF
FT                   FGTAIGTEGHTGVHFADDYFTILSGKQLAAYPGALAPEVYLPGDCHHLPRGDVKQYAMP
FT                   GEAFALELAQGWIPAMLPFGFMDTISSTLDIHTFYRTSYFTGKDMIRNLLNGKF"
FT   gene            <514167..>515123
FT                   /gene="ATG3"
FT                   /locus_tag="PICST_36624"
FT   mRNA            <514167..>515123
FT                   /gene="ATG3"
FT                   /locus_tag="PICST_36624"
FT                   /product="protein involved in autophagocytosis during
FT                   starvation"
FT   CDS_pept        514167..515123
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ATG3"
FT                   /locus_tag="PICST_36624"
FT                   /product="protein involved in autophagocytosis during
FT                   starvation"
FT                   /note="Autophagy-related protein 3 (Autophagy-related
FT                   E2-like conjugation enzyme ATG3)"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36624"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67417"
FT                   /db_xref="GOA:A3LX85"
FT                   /db_xref="InterPro:IPR007134"
FT                   /db_xref="InterPro:IPR007135"
FT                   /db_xref="InterPro:IPR019461"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LX85"
FT                   /protein_id="ABN67417.2"
FT                   /translation="MLRSKLSSLREYLTPINHNSNFSTTGEISPEEFVQAGDYLVYKFP
FT                   TWQWSTCPKNLQKSFLPADKQFLITRHVPSYQRASNYLTGGNVDFDDDEEYEDDEEGDG
FT                   WVKSRKVVSVTKPQDGQEEEPQEINDIDDLIDVTAEGAEDDGDNLEDFDDLDIRNDGGS
FT                   VRKYDMYITYSTSYRVPKMYLVGFNANGIPLTPDQMFEDINADYKDKTATIENLPVAHN
FT                   TTSVSIHPCKHSSVMKVLMKHSKSKKTREEVNHLSEELGKTNISDKSQEDTGKDAEAAA
FT                   GPEAEDSIRVDQYLVIFLKFIASVTPGIEYDYTMDAL"
FT   gene            515541..517691
FT                   /gene="LRO1"
FT                   /locus_tag="PICST_72946"
FT   mRNA            515541..517691
FT                   /gene="LRO1"
FT                   /locus_tag="PICST_72946"
FT                   /product="phospholipid:diacylglycerol acyltransferase"
FT                   /note="Has EST support"
FT   CDS_pept        515552..517594
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="LRO1"
FT                   /locus_tag="PICST_72946"
FT                   /product="phospholipid:diacylglycerol acyltransferase"
FT                   /note="Phospholipid:diacylglycerol acyltransferase (PDAT)
FT                   (Pombe LRO1 homolog 1); go_function
FT                   phosphatidylcholine-sterol O-acyltransferase activity;
FT                   go_process lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_72946"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67418"
FT                   /db_xref="GOA:A3LX86"
FT                   /db_xref="InterPro:IPR003386"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX86"
FT                   /protein_id="ABN67418.2"
FT                   /translation="MSNLSNRRRSKSEDSLDVSEGAAKASGVAYLGKVFSAHTTGPDGQ
FT                   EGHHIHQHIGKPSSIEEKDTPRPPIISTSSSSSTSSKSKRKFHEKRRVVFIFGAFLGLF
FT                   LTIGYSTYYNPSIKNEIDKIVRIDRFNDFFEDWKDWKDILPVGLQSILSEQLGQKDDAL
FT                   QYSPDSFSVGRRLAATMNLTSEYNVLLVPGVISTGIESWGVSTEGDCPSISHFRKRLWG
FT                   SFYMLRTMVLDKKCWLKHIMLDPVTGLDPHNIKMRAAQGFEAADYFMVGYWIWNKILQN
FT                   LAVIGYGPNTMQVASYDWRLAFLDLEKRDGYFSKIKSQIEVTKNLNGKKSIIVGHSMGA
FT                   QISYYFLKWVEAENYGGGGPNWVNDHIEAFVDISGSTLGTPKTIPALLSGEMKDTVQLN
FT                   ALAVYGLEQFFSRKERVDLLRTFGGIAGMLPKGGSTIWGDLERAPDDDISDYSEDVEGA
FT                   IKKNNDSFGNFIRHKKKDGTVSNFTIEQSIDMLLDESPNWYKERVEHQYSYGIAKTKEE
FT                   LERNNKDHSKFSNPLEAALPNAPDMKIFCFYGVGKPTERAYNYVDADSQTGLHKVIDPD
FT                   AETPVYLGDGDGTVSLLAHTMCHEWKKGSESRYNPSGIPVTIVEIMNEPDRYDIRGGAK
FT                   TADHVDILGSAELNELVLRVAAGVGDGIEDHYVSNLRYIAEKMAI"
FT   gene            517980..520210
FT                   /gene="GON1"
FT                   /locus_tag="PICST_90151"
FT   mRNA            517980..520210
FT                   /gene="GON1"
FT                   /locus_tag="PICST_90151"
FT                   /product="possible rho-like GTPase involved in secretory
FT                   vesicle transport"
FT                   /note="Has EST support"
FT   CDS_pept        517984..520026
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="GON1"
FT                   /locus_tag="PICST_90151"
FT                   /product="possible rho-like GTPase involved in secretory
FT                   vesicle transport"
FT                   /note="go_function calcium ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90151"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67419"
FT                   /db_xref="GOA:A3LX87"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013566"
FT                   /db_xref="InterPro:IPR013567"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR020860"
FT                   /db_xref="InterPro:IPR021181"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX87"
FT                   /protein_id="ABN67419.2"
FT                   /translation="MSQDTLRVVVCGDDTVGKSSLVSSLIKETIITEQEVLPPITISGD
FT                   DYTNSFSEYASSTEGKSSKKSRKHPSKKDESLQKFNETGMKLVSKYIPNKTVIIDTISS
FT                   DMVQLQKELKRADVIWLVYSDHYTYERISLHWMPMFRSMGVNLPIVLCANKSDLLPKDT
FT                   LKTQNTDEFIPLIHEFKEIEACVRCSAKANYNVVEAFYLCQRAITHPISPIFDSKEGNL
FT                   KPSAIAALKRVFFLCDKDQDGHLNFEELSDLHKKCFGKSATQAEYDVIVKTLDQRIYPD
FT                   LSSGSTGISEDGFILLNKIYAETGRHETIWGILRAYHYTNSLSLNDRFLFPKLDVNPNS
FT                   SVELSPTGYRFLVDLFLKFDKDNDGGLNEEELNNLFRPTPGIPKLWQESNFPSSIVCNE
FT                   AGYVTLQGWLAQWNLTTFLDYKATLEYLAYLGFDEDISVKALRITKPRKRRQKQGKFYR
FT                   QNVNDRNIFNCFILGAPKSGKSSLLESFLRGSYSETYSPTIKPRLCIKDIELRGGKQCY
FT                   LILEELGVHESAILENKSRLDQCDVICYAYDSSDPESFQYLVELRDKYSVLLDEIPSVF
FT                   VALKADLDKQQQRSDVQPENYTRDLYLGSPLHISSAWTTSLHELFIQLVDAAKMPSTAT
FT                   PGLESEPDFTDQENFKHLVMAGGAVTVMTIVSVWIWRSSVQSSRI"
FT   gene            <520204..>520806
FT                   /locus_tag="PICST_61583"
FT   mRNA            <520204..>520806
FT                   /locus_tag="PICST_61583"
FT                   /product="predicted protein"
FT   CDS_pept        520204..520806
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61583"
FT                   /product="predicted protein"
FT                   /note="go_component nucleus; go_process ribosome biogenesis
FT                   and assembly"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61583"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67420"
FT                   /db_xref="GOA:A3LX88"
FT                   /db_xref="InterPro:IPR007023"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX88"
FT                   /protein_id="ABN67420.1"
FT                   /translation="MSDEKEYKPVTVDKLIPNTFDLGNLATFDPNPLDNEKLKDDSQKE
FT                   QYLASVTRDNVQLLINQILSLPVKTTTDTHGSSTGQNSTMTLIHLPEPTTPLPREKSIP
FT                   KAKPPTKWEQFAARKGIKAKAKDGKMVYDEATGEWVPKWGYKGKNKDLDSQWLVEVDDK
FT                   VKPDEELIDPRTLKRAERKKLIKKNELQHKRNLKNQS"
FT   gene            <522095..>522568
FT                   /locus_tag="PICST_61327"
FT   mRNA            join(<522095..522283,522308..>522568)
FT                   /locus_tag="PICST_61327"
FT                   /product="predicted protein"
FT   CDS_pept        join(<522095..522283,522308..522568)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61327"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61327"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67421"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR019835"
FT                   /db_xref="InterPro:IPR036885"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX89"
FT                   /protein_id="ABN67421.2"
FT                   /translation="KSINDLILGRYYDLVDKRAEEEKYEKKRLEEIGRQDALMAARLSK
FT                   SEINGPVMRARTVLAKRKKKREAGTLAKTGFNKEMVLSTELSDILGISRTSRPQVVKQL
FT                   WIYIKDNELQNPDDKRQIMCDEKLQKLFKKSMCNFCLEIFVIFSY"
FT   gene            <523497..>527483
FT                   /locus_tag="PICST_48230"
FT   mRNA            <523497..>527483
FT                   /locus_tag="PICST_48230"
FT                   /product="hypothetical protein"
FT   CDS_pept        523497..527483
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_48230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48230"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67422"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR014770"
FT                   /db_xref="InterPro:IPR014772"
FT                   /db_xref="InterPro:IPR019558"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX90"
FT                   /protein_id="ABN67422.2"
FT                   /translation="MLGRLKDSARAQSTSSSILLADNKHYESIDLTKLYESVLKLVILE
FT                   YCNEARFRTPLPRPAPSPNVSAASSNSLSSSSSKFYMKSRSSDSNKDVKLPANFLANLE
FT                   KRLNRIAFKKEGHSLDDATRRSFLAFYNELLKPSFKSELEKVNKPEYVVMKFVALANKE
FT                   LVKLDTVPQHDISVAVFKQEETFVQQLIELVTKDKDSEAIIERLQETRDSLKPTKVSSS
FT                   TSAMGNLSISDSNAQYPKPSFRVTDMNMSWIELLQKLFSLDQVKIQQDVFRLKDIAQEK
FT                   PLQKDIQQVLFFLDKNLGSFAPESFTSRDAYQSWKERQIAFCEQLQKKYQVPPAMKLLP
FT                   IPPVPEKEDFYVFPRTTLTRSYFVIMIKLCLELELKENPGAISDPDKTIFSKAEISLLN
FT                   VCARVWRLDYTTRSTAIFTASHLSGVLKDKLMPVENAKDVGPIDLGATIKIFHYCKKIT
FT                   EDGVLDWDAKDTWSLRDQDEWFKNLTFSYNQAMFSIKDCLQMICSKTVRPKFGPYLAIL
FT                   GDYIESDCLFRRVEESGLVRKWEKKLSKSLINVAGARYAELVGIVPRDDTLNISHVLDI
FT                   SENMVSDIRTLQKRYKNPLLGFLDVSRVVAAVLTTMYSADAKHILDHIKAYAANRGEFI
FT                   HYGDAMEAYKSLSEIRFIHNQVSEPDSAFKFNLENFFYPYLESWADESGQKIYDIVNRS
FT                   IEMDSYEPIDLERDDKKYSSSVLDMFSLIKQFLNILKSLNWANEYQLAKVYTKLLKSIS
FT                   DGTLHYANSITEKIIKELDEEEQKRLLQLQEAKLDAKKGGAGGWLNEVKSVVSNIQNSS
FT                   NKLDLEEPYNFKPETCVALNNLSAMMEQLARLEDVLDPEQISNSVSSYDPKSKKSYSSH
FT                   VVSLRLIRAENLKTSISAVSGAPSTLRPYVTLIDTAARKTIGKTRTMNHTTEPEWDEEF
FT                   EMNLHPNTSLTISATVWDEKFGTHSLCGRALIQLDPRRFKHDGIPQEIYLDLDTQGRLL
FT                   IEIAVESEREDAVFVMGRAFRTLKRSQERCIKLIVEKFSRFIHYCFSRSNLRSICGNNG
FT                   NLKPTEEQVHDAMMPLYDYLNMNLKVLAEYLTNELLLKVMLAAWIVVLASADELLLPKL
FT                   ASAKTFQLTAQAPPAASGWQTAVSSAVANITSSIGISGFGKMLTNNELETVFLWLHFLC
FT                   KEFFHNDGYGLPMSDLKNEQYQALLVLPVYYDSRLDYLEQEVDRLSPAFVSALRNRNNF
FT                   DNDASLPSINGAQKGLSRAGSLIRSKTIMANATSKSREKAMREAREARSEIVTQTTIED
FT                   IILRILIIKGEQKYVAKRLDQREKLAHSIATQRLAREAAEGRFR"
FT   gene            complement(<527655..>531341)
FT                   /gene="SIN3"
FT                   /locus_tag="PICST_62296"
FT   mRNA            complement(<527655..>531341)
FT                   /gene="SIN3"
FT                   /locus_tag="PICST_62296"
FT                   /product="transcription regulatory protein"
FT                   /note="Has EST support"
FT   CDS_pept        complement(527655..531341)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SIN3"
FT                   /locus_tag="PICST_62296"
FT                   /product="transcription regulatory protein"
FT                   /note="DNA binding protein involved in transcriptional
FT                   regulation; go_component nucleus; go_process regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62296"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67760"
FT                   /db_xref="GOA:A3LX91"
FT                   /db_xref="InterPro:IPR003822"
FT                   /db_xref="InterPro:IPR013194"
FT                   /db_xref="InterPro:IPR031693"
FT                   /db_xref="InterPro:IPR036600"
FT                   /db_xref="InterPro:IPR039774"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX91"
FT                   /protein_id="ABN67760.2"
FT                   /translation="MKDFKSQSIDTPGVIDRVSTLFRGHRNLIQGFNTFLPPGYRIECS
FT                   LDPSDPNPIRVTTPTGTTTRPNINNGTYGQRWGNEEQGHQQIAAGQYSQDQQQLQAQHQ
FT                   MQQQVAENGGGQIEFNHAISYVNKIKTRFANQPDIYKQFLEILQTYQREQKPIAEVYEQ
FT                   VTVLFANSPDLLDDFKQFLPDTSNQAYVQQQAQQQAVTEGAYSANNATAQLPPVGNFQP
FT                   PTGLSPSAAQPYPQQNFQVPSGNPEPHGITVVTEQELPKKKKSLSEGYTYDNYEDAQIS
FT                   SVRGGPQVKTGTTKAVASGKNGPVSTITVNPTLVPGIPEPVPPSASVKTSSLSEEISFF
FT                   DKVKKAIGNKQSYNDFLKILNLYSQEIIDKRTLVERVNGFIGDSHPDLFNWFKSFVGYE
FT                   EKPQHIENITFKKHQLELSLCKAYGPSYRQLPKAETYMPCSGRDEMCWEVLNDEWVGHP
FT                   TWASEDSGFIAHRKNQYEEILFKIEEERLEFDYYMESNLRTIQILETIANRIANMTPEQ
FT                   KANFKLPPGLGHNSTTIYKKVIRKIYDKDRGFEVIDALHENPAIAVPIVLKRLKQKDEE
FT                   WKRAQREWNKVWREMEQKVFYKSLDHLGLTFKQADKKLLTAKQLVSEISSVKVEQQNKR
FT                   LHPLTPKPQEQLSYVFKDYDILKDILKLADVFINRSSNYSSNDRDKLTQFFQFFVSLFF
FT                   GIPTEDIERALTSRGKSEKTTADETDENGTTSENAEASGQSLIPKKRSRESDLLRDVLK
FT                   KQSKSKKDERSDSPTPQSNDLEEQELVDEVEKSSELWIKTANTKFSLNDDDSDTKRDKY
FT                   NFFCNTTIYVFFRHLRTLYERLEEIKAMNEEVGKEIRARRHPRFAKDLNLLSHQLEDMG
FT                   VEILGTKDCYLQVLELSERLIEGEIEHQWFEESLRQGYRNRAYKVYTVDKVVQAMVKHM
FT                   HSMVTDSKTSEMMVLYESDRSSPTSTAKDQILYRMQVRALMSTDENMFKITFKESTNSA
FT                   NIQFVSLDDLTINDHENAEEEYNYYVTSYVMSHPTEGVPASKINMPFSRSFIESVDEDQ
FT                   VEGRVSSGLKVSVCENSYRLFFEANSHDEFTSKVVYNKQAEDGKKKSEKVDALRKLIND
FT                   DEVGWKRGLAGDEDANLLDQQAKALFEKGSSAYFQFSTKKEVVEPKKEAEPHTEAVAQV
FT                   SETETRHDADATVVQENNDTTIQQDVNDTTTDETTVNQDDASIIAEGQTEHSTITVIPG
FT                   KEA"
FT   gene            complement(<531444..>532365)
FT                   /locus_tag="PICST_32737"
FT   mRNA            complement(join(<531444..531766,531880..531926,
FT                   532307..>532365))
FT                   /locus_tag="PICST_32737"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<531444..531766,531880..531926,
FT                   532307..532365))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32737"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32737"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67761"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX92"
FT                   /protein_id="ABN67761.2"
FT                   /translation="MSSQQDPWNAQQRPLTQQFNRSHPPVLPPPATLEAGGQAFYPLPS
FT                   LPSLGNGAGHPQPGHSFNIPSINPTGEVQIHNDPNRQSQELRRPSNVAINPPAPQLPPP
FT                   ATIAASTAEQQQQQQVTAQHSTQPPAIGGGIPNRSSTTN"
FT   gene            <532979..>533427
FT                   /gene="RBP11"
FT                   /locus_tag="PICST_62535"
FT   mRNA            join(<532979..533031,533112..>533427)
FT                   /gene="RBP11"
FT                   /locus_tag="PICST_62535"
FT                   /product="RNA polymerase II core subunit"
FT   CDS_pept        join(532979..533031,533112..533427)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RBP11"
FT                   /locus_tag="PICST_62535"
FT                   /product="RNA polymerase II core subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62535"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67423"
FT                   /db_xref="GOA:A3LX93"
FT                   /db_xref="InterPro:IPR008193"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR037685"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX93"
FT                   /protein_id="ABN67423.1"
FT                   /translation="MNAPDRFELFILPDGVDKIKITPDSKVPNAAIIKIEREDHTLANL
FT                   LRAQLLKDPRVLFAAYKVEHPLFANFVLRIQTEDDYSPREALKNACSGLISELDVIKNR
FT                   FKDEWALKSLLNTNEDDY"
FT   gene            complement(533655..536286)
FT                   /gene="CDC5"
FT                   /locus_tag="PICST_68049"
FT   mRNA            complement(533655..536286)
FT                   /gene="CDC5"
FT                   /locus_tag="PICST_68049"
FT                   /product="CDC5"
FT                   /note="Has EST support; dispensable for premeiotic DNA
FT                   synthesis and recombination, but required for tripartite
FT                   synaptonemal complexes, haploidization, and spores"
FT   CDS_pept        complement(533958..535958)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="CDC5"
FT                   /locus_tag="PICST_68049"
FT                   /product="CDC5"
FT                   /note="dispensable for premeiotic DNA synthesis and
FT                   recombination, but required for tripartite synaptonemal
FT                   complexes, haploidization, and spores; go_function protein
FT                   kinase activity; ATP binding; protein serine/threonine
FT                   kinase activity; go_process protein amino acid
FT                   phosphorylation; cell cycle; go_function protein kinase
FT                   activity; ATP binding; protein serine/threonine kinase
FT                   activity; go_process protein amino acid phosphorylation;
FT                   cell cycle"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68049"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67762"
FT                   /db_xref="GOA:A3LX94"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000959"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR033695"
FT                   /db_xref="InterPro:IPR033701"
FT                   /db_xref="InterPro:IPR036947"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX94"
FT                   /protein_id="ABN67762.2"
FT                   /translation="MSNLRTQSLQPLQPLSGGQLNNRVNNVTPIKQPVRRLKENVETIA
FT                   PPPSNTAKPQQQKKKKEKLSALCKTPPSIVRTRNGRDYRRGNFLGEGGFARCFQMKDSS
FT                   GQIYAAKTVAKASIKNEKTKTKLLSEIKIHKSLKHANIVNFIDCFEDDVNVYILLEICP
FT                   NQSLMELLKTRKRVSEPEVRFFMVQIVGAIKYLHSRRVIHRDLKLGNIFFDPDMNLKIG
FT                   DFGLATVLPSNSTRKYTICGTPNYIAPEVLGGKNTGHSFEVDVWAIGIMMYALLVGKPP
FT                   FQAKDVQVIYERIKKTEYGFPEDKPISDSAKALIKDLLSLNPIHRPTIDEILSYEWFKG
FT                   PFPEKTHELSLNGTPSGLDQISLAQSALNFNNTKTNAGIYTPKNRNPVEILRSDLHSEQ
FT                   PRAMLPQSLSPNDTKNKYEEVDPTSLGRPRKINLSSNYSTTLKRLNNICLETYQNMRRL
FT                   QYSQHESIDVMELPRCENPTLISKWVDYSNKYGFSYQMNNDDIGVLFNDGNTLLKLHNS
FT                   DRFLELIYHENEGWTCIENSSSHPPTQTRRQLEIVDFFAKYMNSNLSKVSENEERKETV
FT                   FLRRYTRTPEYIMFEMTNGNFQFNFKDHHKICVSKNGLAITHISPSRAIQTHPLILILK
FT                   QGNFPSEEVPECLEKIAVIKDAIKKKAFKET"
FT   gene            complement(<537373..>540540)
FT                   /gene="SET1"
FT                   /locus_tag="PICST_32740"
FT   mRNA            complement(<537373..>540540)
FT                   /gene="SET1"
FT                   /locus_tag="PICST_32740"
FT                   /product="histone methyltransferase involved in gene
FT                   regulation"
FT                   /note="Has EST support"
FT   CDS_pept        complement(537373..540540)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SET1"
FT                   /locus_tag="PICST_32740"
FT                   /product="histone methyltransferase involved in gene
FT                   regulation"
FT                   /note="Histone-lysine N-methyltransferase, H3 lysine-4
FT                   specific (COMPASS component SET1) (SET domain protein 1)"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32740"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67763"
FT                   /db_xref="GOA:A3LX95"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR017111"
FT                   /db_xref="InterPro:IPR024636"
FT                   /db_xref="InterPro:IPR024657"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX95"
FT                   /protein_id="ABN67763.2"
FT                   /translation="MSRHRGFRRERSRYRSFNNNDYEDDDRETNGSTRGSRYPKDSRYS
FT                   HNDSGNSQSSSVRLSRVPSGERSPSIASGHGFKSETPDITYSNIPGTDPVTGENSADKN
FT                   FTKLLHHIDFLGKFPQSRDTDVRKNYRVVYDPELDKSLTKEERKSRTKKIRFNGESLPF
FT                   SERTDPRTANLQFYFQRPNKKSKKFPFKQLPQPKFAFDKDSLGPAPQTELVVWDLPATT
FT                   NEVYLTNYFKSYGDPIQDMKFVNDPINAVPLGIATFKFQGPPEKAMRLAKKLISIIRVE
FT                   GAKVDGVDLRIALNDNDNNLLKNKIDLARDKLRASRQKREEEERRRLRRQQEEERAKRD
FT                   EERKAAAESKRREEEAKVEKLQHQKTSGKNHSKFKPNTSTLSIRHHNKVVPGVFLPKEL
FT                   VKYIKDRPYIVIHDKYVSAKKVSSQDIKRALNKYDWTRVLSDRTGFFIVFNSLKECERC
FT                   FFNEDGKRFFEFRLYMELAIPEGYDTSSIESAEDLLELQNKKHDILEEATNILIKEFET
FT                   FLAKDIRERIIAPAVLDLLSHDKYPKLVEELKAKENASKPTSFVSTNDQLKQSALSILA
FT                   GRKSQQSQSLPSFKKKVESPTKNKPLRKSLIPMQHALNYDHDSDEEDEDDSSRSATPAA
FT                   SILKRERSSTVTTVNNEDNEEQPSKKQKTGLQKSFLYESSSDEEMEDEDVSDGAASTMV
FT                   INTEELELKDEGDVKKEAEDKAEEDIDYSKFEARYHPTERKPYTVYAETNLLPTDNFNL
FT                   DVLQDVLKDEEDIKLAKEVLQETNPPSSDIRNIDYWAWKQKDISGASQEIVEDAELIEK
FT                   LDSRLESQSGAFRSDGYRRIPDVDKIEYLPHRRKVHKPLQTVQHEEVEEEAGNRNNEGT
FT                   NSAIQSSRVNRANNRRFAADITAQLGNETEVLSLNTLTKRKKPVSFARSAIHNWGLYAL
FT                   EPIAAKEMIIEYVGESIRQQVAEHREKSYLKTGIGSSYLFRIDENTVIDATKKGGIARF
FT                   INHCCSPSCTAKIIKVDNQKRIVIYALRDIDANEELTYDYKFERETNDAERIRCLCGAP
FT                   GCKGYLN"
FT   gene            complement(<541531..>541887)
FT                   /gene="NUO21.2"
FT                   /locus_tag="PICST_62206"
FT   mRNA            complement(<541531..>541887)
FT                   /gene="NUO21.2"
FT                   /locus_tag="PICST_62206"
FT                   /product="NADH-ubiquinone oxidoreductase 21 kDa subunit,
FT                   mitochondrial precursor (Complex I-21KD) (CI-21KD)"
FT   CDS_pept        complement(541531..>541887)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="NUO21.2"
FT                   /locus_tag="PICST_62206"
FT                   /product="NADH-ubiquinone oxidoreductase 21 kDa subunit,
FT                   mitochondrial precursor (Complex I-21KD) (CI-21KD)"
FT                   /note="NADH-ubiquinone oxidoreductase 21 kDa subunit,
FT                   mitochondrial precursor (NUYM) (Complex I-21KD) (CI-21KD);
FT                   go_function oxidoreductase activity, acting on NADH or
FT                   NADPH; go_process electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62206"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67764"
FT                   /db_xref="GOA:A3LX96"
FT                   /db_xref="InterPro:IPR006885"
FT                   /db_xref="InterPro:IPR038532"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX96"
FT                   /protein_id="ABN67764.1"
FT                   /translation="IVSGAPKDLITSRVVRIYKESKPATQSGHYNGHLWKLDWDVLGKS
FT                   NRWENDLMGYQGSGDYMQGTIMKFDTKEAAIKFAEGQGWDHYVQEPKTRHFRKKDYSAN
FT                   FYHSAGPLKHIRTK"
FT   gene            <542877..>544454
FT                   /gene="DAL9"
FT                   /locus_tag="PICST_48474"
FT   mRNA            <542877..>544454
FT                   /gene="DAL9"
FT                   /locus_tag="PICST_48474"
FT                   /product="allantoate permease"
FT   CDS_pept        542877..544454
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="DAL9"
FT                   /locus_tag="PICST_48474"
FT                   /product="allantoate permease"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48474"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67424"
FT                   /db_xref="GOA:A3LX97"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX97"
FT                   /protein_id="ABN67424.2"
FT                   /translation="MSSREENIDSKDNVMVSISSPSTGRQAKPDGDVDDAMEYAIRNKT
FT                   ENPKYDKSRDAKLLRKIDFFLMPIICCLYAIQFMDKLTNSLASILGLRTELRMHGNMYS
FT                   WTGSAFYLGYMVFEFPAVRFLQSFPVSKTLSVFIVLWGVVLCLHSIPNYAGFVALRTIL
FT                   GILESSITPGLVIITSQYYRGANPDAGAKEKSKYKDEIFLRTAWWFASTGFGIIVGSAI
FT                   AYAIVVHQDSYSIQAWKLIFIVTGVITIFVGLVFLVHVPDKPTKAWFLTEEEKKLVVER
FT                   IRVNQQGFGNKKFKIYQFKEALLDLRTWLFFLAALSISLPTGGLTNFGSILLAEGFGYS
FT                   LKKTMLMQMPVGAVNICGCVIFAWLHRFVESRMFWATFGNAVTFAAQCMLAFGKTNQIM
FT                   FAGYIVQSLGPIAFICLLANISSNVTGHTKKVTVNAILLVGYCVGNLIGPQTFLDSEAP
FT                   NYKTAKACIVAFGLLNLLLFVLIWLSYLWDNRKKNRAYAEAGEIDMFENYEFADLTDKE
FT                   NPLFRYKI"
FT   gene            <545126..>546358
FT                   /locus_tag="PICST_62776"
FT   mRNA            join(<545126..545714,545763..>546358)
FT                   /locus_tag="PICST_62776"
FT                   /product="predicted protein"
FT   CDS_pept        join(545126..545714,545763..546358)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62776"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62776"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67425"
FT                   /db_xref="GOA:A3LX98"
FT                   /db_xref="InterPro:IPR008721"
FT                   /db_xref="InterPro:IPR016811"
FT                   /db_xref="UniProtKB/TrEMBL:A3LX98"
FT                   /protein_id="ABN67425.2"
FT                   /translation="MSTTQLRSSLQEIVPTYHGKFPPQLLSFIESLYSLSLQKKPTLPN
FT                   RAEIARFHICAFLAAEKYQSTFSLPQPEVRRIPLQPKIAAKLLDDFRDNLLNQIRSCTS
FT                   TPRKNASSNSTSPAGSPESAYSTPLSTPTGLTKLSPLKLNINKSKISSPLKRLRDLENE
FT                   DDSEEERSVRKKTPRKPNKEFNIESPFNPKPSAKSPDGSPKKKKSKSTKLNIYKYDRKH
FT                   VSIVDFIAFANSFFIPAEITPRMVETFLVHKHKFVKKSEWLLACGMIHSAYIRINHKIL
FT                   TSKMGAKQKIVDQLFQYQKGGLMKKAMQLWLDIVEDWINDEAWIRDIEKQFMYDKDSVQ
FT                   QQQLTKEREARIGPGWGLLEKFGSMLHGDVLYDSKTQEDYYNTWTSRVLESTST"
FT   gene            <546870..>549821
FT                   /gene="PDZ1"
FT                   /locus_tag="PICST_47702"
FT   mRNA            <546870..>549821
FT                   /gene="PDZ1"
FT                   /locus_tag="PICST_47702"
FT                   /product="hypothetical signaling-associated PDZ domain
FT                   containing protein"
FT   CDS_pept        546870..549821
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PDZ1"
FT                   /locus_tag="PICST_47702"
FT                   /product="hypothetical signaling-associated PDZ domain
FT                   containing protein"
FT                   /note="go_function protein binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_47702"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67426"
FT                   /db_xref="GOA:A3LX99"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR025926"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LX99"
FT                   /protein_id="ABN67426.1"
FT                   /translation="MSVPTKRRLSFDESTNKRFLNGTHSTENNTSNIEVDEDYGSDGSE
FT                   QIFDLPATTNNNQWQETITKVVNAVVSIQFTHVSNFDTETSLVSEATGFVVDATRGLIL
FT                   TNRHVVGPGPFCGYVVFDNHEEAVVKPIYRDPVHDFGFLQFDPKEVKYLQLTQLELKPD
FT                   LAKVGTEIRVVGNDAGEKLSILAGFISRLDRNAPEYGSLTYNDFNTEYIQAAASASGGS
FT                   SGSPVVNEDGDVVALQAGGSTEASTDFFLPIYRPLRALQCIQKKQPITRGDIQVEWQLK
FT                   PYDECRRLGLTPEAEARARKLFPNKIGLLVAELVLPQGQADGLIKEGDTLISIDDIDIS
FT                   TFIKVDEILDENVGNELKFVIQRGGEVITQMIKIGDLHSITPDRYVDVGGASFNNLSYQ
FT                   VARCYCIPVKGVFINDASGSFEFASYEKSGWLLETVDDMPTPDLDTLIEVMKMIPDCRR
FT                   VPITYRHVSDLHTENIQIIYIERHWQSSFRLAVRNDTTGLWDFTDLQEKPLPPLSHEPQ
FT                   NAKFIDIPFSDETRSGCSSLVRSFVQVRLIAPVPMDSYPYRKEICYGVVVDSVNGYVLV
FT                   SRRFVPHDMCDIFLIFAESIDVPAKVVFLHPNQNYAILKYDPSLVLADVKTPKFGDKPL
FT                   KRGEKSYFIGYNYNLRLVTDDVKISGVSSLNIPPASLSPRYRGTNLECILLDSKISVEC
FT                   DSGVLADDDGTVRAFWITYLGEATCDQGSDRMYRMGLDVTDVLSVIEKLKVNEIPKQLR
FT                   LLEAEFTSVTILQGRTRGVSQEWINKFEEVCEDEIKFLAVERVSAPTLHQEKNPLKAGD
FT                   IILSVNDIIVKNMRDLKPMFTEQELKFRIIRQKKETEIVVPTIDTTTINTSHVVFWSGA
FT                   IIQAPHYAVRQLMERVPSEVYVTRKSAGGPAHQYGIATNSFITHVNDVETKDLVSLMKV
FT                   VKDIPDNTYIKLRLMSFDNVPIAISLKTNYHYFPTSELKKKEGSDEWIEIEHK"
FT   gene            complement(<549977..>550246)
FT                   /locus_tag="PICST_62530"
FT   mRNA            complement(<549977..>550246)
FT                   /locus_tag="PICST_62530"
FT                   /product="predicted protein"
FT   CDS_pept        complement(549977..550246)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62530"
FT                   /product="predicted protein"
FT                   /note="go_component intracellular; ribosome; go_function
FT                   structural constituent of ribosome; go_process protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62530"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67765"
FT                   /db_xref="GOA:A3LXA0"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXA0"
FT                   /protein_id="ABN67765.1"
FT                   /translation="MIGNIFASATRAVFGKQPIMNTLIQTRNKMKTHKAAAKRFIKTGT
FT                   GIKRKQAGRNHGNGGFSANSLRHLDSFVPVGARGRHLKKLEEFF"
FT   gene            complement(<550605..>551258)
FT                   /locus_tag="PICST_32745"
FT   mRNA            complement(join(<550605..551098,551165..>551258))
FT                   /locus_tag="PICST_32745"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(550605..551098,551165..551258))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32745"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32745"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67766"
FT                   /db_xref="InterPro:IPR019331"
FT                   /db_xref="InterPro:IPR039845"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXA1"
FT                   /protein_id="ABN67766.2"
FT                   /translation="MSEVTDPRSLSTEEDEGSERKTLQQQLKENRERKQREYQEQLAAK
FT                   NSTYKLDEKSAQFYEELRAKELAKENLHKQQERQQLEKFRSLKSAASYKAESGKQVSTT
FT                   PPTISSSAPSVESVSGVVENVESGSVKKATPTIVLRKRSSQKSVETAPPTKLAKSEKHA
FT                   EKQVPAAGSAVPEQTVGSKVESLLGDYSSDED"
FT   gene            complement(551428..553281)
FT                   /gene="MAL8"
FT                   /locus_tag="PICST_78743"
FT   mRNA            complement(551428..553281)
FT                   /gene="MAL8"
FT                   /locus_tag="PICST_78743"
FT                   /product="alpha-glucosidase maltase"
FT   CDS_pept        complement(551513..553231)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MAL8"
FT                   /locus_tag="PICST_78743"
FT                   /product="alpha-glucosidase maltase"
FT                   /note="alpha-D-glucosidase (maltase) ( alpha-amylase)
FT                   (MALT); go_function alpha-amylase activity; go_process
FT                   carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_78743"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67767"
FT                   /db_xref="GOA:A3LXA2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXA2"
FT                   /protein_id="ABN67767.1"
FT                   /translation="MTVAHKWWKNSTVYQIWPASYKDSNGDGVGDIPGIISTLDYLKDL
FT                   GVDVIWCSPMYDSPQDDMGYDISDYEKVYAKYGSDEDMQALIDETHKRGMKLILDLVIN
FT                   HTSSEHAWFKESRSSKTNPKRDWYIWKPPKYDAEGNRQPPNNWGSYFSGSAWEYDEVTD
FT                   EYYLRLFARTQPDLNWENDEVRETVYKSAMKFWLDKGVDGFRIDTAGLYSKDQSFPDAP
FT                   ISFPDLEYQPSHKYAHNGPRIHEFHKEMFSKVTGNYDAMTVGEVGHCSREEALKYVSAK
FT                   EQEMNMLFLFNVVEVGCDDSDRFRYKGWKLTDFKKALEGQCTFIEGSDAWSTVFIENHD
FT                   QPRSVTRFGSTKYRNESAKLLSLLQTTLTGTLFIYQGQEIAMENLPRDWSVEEYKDINT
FT                   INYFKEFKNKYGNDADYKEKEEKLMDVVNLMARDHSRSPVQWDSSAHGGFTTGTPWTKV
FT                   NDNYPTVNVASQIQDPNSILNFWKKSVQIRKRYQDLLVFGKFEILDFDNERVFTYVKKD
FT                   HNSESPKAYVVLNFSSDSVKFEKLLDGNFELVHSNIADVEESTLSPYEGRLYIVD"
FT   gene            <554444..>556195
FT                   /gene="MAL4"
FT                   /locus_tag="PICST_48369"
FT   mRNA            <554444..>556195
FT                   /gene="MAL4"
FT                   /locus_tag="PICST_48369"
FT                   /product="maltose permease"
FT   CDS_pept        554444..556195
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MAL4"
FT                   /locus_tag="PICST_48369"
FT                   /product="maltose permease"
FT                   /note="go_component integral to membrane; go_function
FT                   transporter activity; go_process transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48369"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67427"
FT                   /db_xref="GOA:A3LXA3"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXA3"
FT                   /protein_id="ABN67427.1"
FT                   /translation="MSTEYVEDNKNPDKSTTVGSITKKILSDDSSTNSVDDYVAKFLDM
FT                   SNEARENDNKEKNMPLKECLRTFPKAVMWSIILSTAIVMEGYDTNLLNSLFGFPAFNKK
FT                   FGHFDERLDRYIIEARWQTGLNMAYNCGCVVGLTIAGFFADIFGYRKTLMTALATSVGL
FT                   IFLQFFSPNKEVLLLAYVLLGINWGSYQTLTVTYASEVAPTTLRVYLTTYVNVCWVFGQ
FT                   LISSGVIKGVSSINDNPNSYRIPFAVQWVWPIPLFIGVYLAPESPWFLVKRGRNQDAKN
FT                   SLKRLLSENPNLPDKDALAQAMLTKIQMTVQEEDSDDQGSFRECFRGTNFRRTRVAAMA
FT                   WMLQSITGSCLIGYSTIFYQQAGLAVSMSFNFSIIQYCLGIIGTVGSWFLAQRVGRFKI
FT                   YFYGLCAMFVILIIVGGLGVSNSNGAKWGIGTLLLIFNFVYDLTIGPMAYCIVAEIPSS
FT                   KLRTKTVMLSRNLYNVANIIVGIVTPYMLSPTAWNWRAKTGFFWAGFALLGCVWVWFEL
FT                   PETKDRTYAELDVLFQDGVKARDFKHTEVEVFDAGKLMEKFGENGIKHFVEHVDNKDDN
FT                   NEIFEKA"
FT   gene            <559912..>560739
FT                   /locus_tag="PICST_32748"
FT   mRNA            <559912..>560739
FT                   /locus_tag="PICST_32748"
FT                   /product="predicted protein"
FT   CDS_pept        559912..560739
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32748"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32748"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67428"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXA4"
FT                   /protein_id="ABN67428.2"
FT                   /translation="MYELLVLNNHWFFNPDEDKSRFKGLFQLLNKSYDKARFKFGIIKS
FT                   TRIKKPESALADLSITPDRDVFLTILLGPEDSFSKLKQRDDYERNFSVPSMSLSDSFDC
FT                   DIPNEYLSHFPIDDIEKDLKVTVASPDTNIESILGRALGTVGVRSIPDTSDKSIKHLEL
FT                   TAFTSLRRNLGPNLLDVLINSCLLNDDMFSRLLNDRLDQFSTIRLHLDCIREHGLVEYY
FT                   SSTCKFIRADQEDVRIQINENNRTIGGPLEEGIIATQDFHIAFMHRDVAVTKQ"
FT   gene            complement(560790..563487)
FT                   /gene="APE2.2"
FT                   /locus_tag="PICST_65905"
FT   mRNA            complement(560790..563487)
FT                   /gene="APE2.2"
FT                   /locus_tag="PICST_65905"
FT                   /product="alanine/arginine aminopeptidase"
FT                   /note="Has EST support"
FT   CDS_pept        complement(560855..563467)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="APE2.2"
FT                   /locus_tag="PICST_65905"
FT                   /product="alanine/arginine aminopeptidase"
FT                   /EC_number="3.4.11.7"
FT                   /note="go_function membrane alanyl aminopeptidase activity;
FT                   go_process proteolysis and peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_65905"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67768"
FT                   /db_xref="GOA:A3LXA5"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXA5"
FT                   /protein_id="ABN67768.2"
FT                   /translation="MCRHSSSDSSSVVPADREVLPTNVKPLHYDLTLEPIFSTFKFNGQ
FT                   ETIDFHVNEDTDYITLNSLEIEIQEAIINGSAVSDISFNVDKQTVTFKLPQPLAQGSNA
FT                   KLALKFTGDLNNKMAGFYRSSYQENGETKYLATTQMEPTDCRRAFPSYDEPSAKAKFTI
FT                   SLIAEKSLVALSNMDEASTVELADNKKKVTFNTTPLMSTYLVAFIVGDLKYVENNDYRV
FT                   PIKVWATPGSEHLGQYSADIAAKTLSFFDKKFDIPYPLPKCDMVAIHDFSAGAMENFGL
FT                   ITYRTIDLLLDPSNTNIVTKQRVTEVVMHELAHQWFGNLVTMDFWDGLWLNEGFATWMS
FT                   WYACDSLYPDWKVWESYVSDSLQHALTLDALRASHPIEVPVKRADEINQIFDAISYSKG
FT                   SSLLKMISRWLGEDVFIKGVSNYLKKHKWGNTKTSDLWEALSDVSGQDVVKVMDIWTKN
FT                   VGFPIVHVEEAGSDIKVTQHRFLATGDVKPEEDSILYPVFLGLKTSSGLDETAVLDSRS
FT                   TTLTLPTSDGFFKINGDQAGIYRTAYTSSRWIKLGQAGVEGKLSVEDRVGLVADAGSLA
FT                   SSGFIETTSFLNLIKSWSKESNFVVWDQILSDIGSVKSAFIFEAEEFKDALNLFTVDLI
FT                   SEKLKSIGWEFSDNDSFADQQLKGSLFASAANAGHAEVIDFSQKSFAAYVAGDKKAINP
FT                   NLRATIFNVVAKLGDEHTFEQLLNIYKNPQSNEEKIAALRSFGRFTKPEILDKVTALLL
FT                   QTDIVKQQDIYIPMQGLRAHKLGVEKLWAWLTENWDKVYEILPPGLSMLGSVVTIATSG
FT                   FTKKEQRDAVEKFFATKNTKGFDQGLARSLDIIASKGNWASRDGQVISEWLSENGYSK"
FT   gene            complement(<564375..565030)
FT                   /gene="ESS1.1"
FT                   /locus_tag="PICST_79040"
FT   mRNA            complement(<564375..565030)
FT                   /gene="ESS1.1"
FT                   /locus_tag="PICST_79040"
FT                   /product="Peptidyl-prolyl cis-trans isomerase"
FT                   /note="Has EST support"
FT   CDS_pept        complement(564497..565030)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ESS1.1"
FT                   /locus_tag="PICST_79040"
FT                   /product="Peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="go_function isomerase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_79040"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67769"
FT                   /db_xref="GOA:A3LXA6"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXA6"
FT                   /protein_id="ABN67769.2"
FT                   /translation="MSKTATGLPPGWAIRVSRTHNKEYFLNQATSESTWEAPFGSDDAK
FT                   LAEYLKHFRANGNKPVVQDDGKVRVSHLLIKNVQSRKPRSWKSPDGITLSRDEAISILK
FT                   KHQARILNGEIKLSELAETESDCSSHSQGGDLGFFGKGQMQPKFEEAAYGLNVGEISDI
FT                   IETDSGVHILQRTG"
FT   gene            complement(<565333..>565863)
FT                   /gene="ESS1.2"
FT                   /locus_tag="PICST_32751"
FT   mRNA            complement(<565333..>565863)
FT                   /gene="ESS1.2"
FT                   /locus_tag="PICST_32751"
FT                   /product="peptidylprolyl cis/trans isomerase"
FT   CDS_pept        complement(565333..565863)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ESS1.2"
FT                   /locus_tag="PICST_32751"
FT                   /product="peptidylprolyl cis/trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="go_function isomerase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32751"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67770"
FT                   /db_xref="GOA:A3LXA7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXA7"
FT                   /protein_id="ABN67770.1"
FT                   /translation="MSKTSTGLPPGWAIKLSRTHKTEYYLNQTTNESSWVPPFGTDTAV
FT                   LNEYVEKYRANGHKPVIREDGKVRVSHLLIKHNQSRRPRSWKSPDGITTTRDEAIQKLK
FT                   QLQAKILNGEKLSELAESESDDSSHSTGGDLGFFGKGQMQPAFEEAAFGLNVGEISDIV
FT                   ETDSGLHLLERTG"
FT   gene            complement(<567988..>569849)
FT                   /gene="POL5.6"
FT                   /locus_tag="PICST_32752"
FT   mRNA            complement(join(<567988..568097,568136..569310,
FT                   569667..569733,569771..>569849))
FT                   /gene="POL5.6"
FT                   /locus_tag="PICST_32752"
FT                   /product="putative RNA directed DNA polymerase"
FT   CDS_pept        complement(join(567988..568097,568136..569310,
FT                   569667..569733,569771..569849))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="POL5.6"
FT                   /locus_tag="PICST_32752"
FT                   /product="putative RNA directed DNA polymerase"
FT                   /EC_number="2.7.7.49"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32752"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67771"
FT                   /db_xref="GOA:A3GEU1"
FT                   /db_xref="UniProtKB/TrEMBL:A3GEU1"
FT                   /protein_id="ABN67771.2"
FT                   /translation="MYNHMALTNLLNLEVQGHITVDDTESILSSDNHHTIITLNAPSCA
FT                   DLNVFPDRHDEVLTLFKEIVEYSAFVKNNTPRKSLQYRTPAAVFFNYKDAYHRPIVPFG
FT                   MDVVIKASSKEEYEKYGRPLLKTEPHAFFGSIVGFATDNYSYRILVQAEHFPIITNCNA
FT                   KLLNSRQFIENYFQSLDLLQRDSAQYNATVLDALEDKLADHIDIADKEVIFDATLLKNG
FT                   DTSVQTANIGDTNLSTPSPQNPEALSNTPSSQMTIESLSTRHPEVATQHKRRIEELTSD
FT                   TLPFPTDQEGNSVDGKHIKRSPRLGGVKTTPLSATRTIRDHKTKSKIVDNNRDYAADPI
FT                   KTAIEETRTKMSEDHNLNSTTTNSEELTSQLASQEDRISGELSGETNVDLSTTPAQNTR
FT                   SHTKSRLDKQIESSKNWSNLDTRKTQSWNKVPPEIHGKGKIRCTKLTNSKNDHLRNNKK
FT                   KEEDTRFRFQSTTDKCIA"
FT   gene            complement(<570393..>571637)
FT                   /gene="HMC1"
FT                   /locus_tag="PICST_32753"
FT   mRNA            complement(<570393..>571637)
FT                   /gene="HMC1"
FT                   /locus_tag="PICST_32753"
FT                   /product="Hypothetical multicopy protein"
FT   CDS_pept        complement(570393..571637)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="HMC1"
FT                   /locus_tag="PICST_32753"
FT                   /product="Hypothetical multicopy protein"
FT                   /note="hypothetical protein occurs in multiple copies
FT                   through genome"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32753"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67772"
FT                   /db_xref="UniProtKB/TrEMBL:A3GEU2"
FT                   /protein_id="ABN67772.2"
FT                   /translation="MSNFSTNASSTGRSESPEEQTFSPITASLLAEAIREQANQLLEKQ
FT                   SDEFEAKFLSLQNQIHDILTLISAEKSGNRKGVSRNTDDSSTITSTNSDINLIQSSIES
FT                   SSVLADDDLSVNISDPPKIEHSPSFKSSKHSAEKTFNLFERTNDTIRKSQKRFHESWRK
FT                   LPKLNDSSVELWSRALQELNSDPDYKALSKANFKVDWNSFESRTGLHGNELKYYYDCWK
FT                   DDLIAPYCNNTLSILAATRDHTVTLEDLIEYTSEHADDAKTMSILEEVQRRYRIDISCK
FT                   DYVSELRGKNTHDYDRIIQFIDGIPSDLYGTISHYCNQRHDGNCIIAAATANFYYKEFM
FT                   TKENFHYPTPNTFQKKMISTPGFSGKVLSDSSKSRTNSKHRKDRSNYNNYSQNKSSLEN
FT                   NQKSHRRQTDNVNHN"
FT   gene            complement(572123..573089)
FT                   /gene="URA6"
FT                   /locus_tag="PICST_90609"
FT   mRNA            complement(572123..573089)
FT                   /gene="URA6"
FT                   /locus_tag="PICST_90609"
FT                   /product="Uridylate kinase (UK) (Uridine monophosphate
FT                   kinase) (UMP kinase)"
FT                   /note="Has EST support"
FT   CDS_pept        complement(572180..573052)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="URA6"
FT                   /locus_tag="PICST_90609"
FT                   /product="Uridylate kinase (UK) (Uridine monophosphate
FT                   kinase) (UMP kinase)"
FT                   /EC_number="2.7.4.-"
FT                   /note="go_function ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90609"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67773"
FT                   /db_xref="GOA:A3LXB0"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006266"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXB0"
FT                   /protein_id="ABN67773.2"
FT                   /translation="MFVRSSRLLGRKSSPQFTRFSTKSRGPSSAIRFNSTKSTSTPPPP
FT                   PPPPPQTGSKGKILLAIGALAIGSTIAASLYNKDSPKSAVEPVAQKGPAFQDGKIKVIF
FT                   VLGGPGSGKGTQSALLVKEHGFVHLSAGDLLREEQKREGSKYGELIANYIKEGLIVPQE
FT                   VTVALLEQAIKESYAKGSTKFLIDGFPRKMDQALTFENQIAKSSFTLFFECPEQVMLKR
FT                   LLERGKTSGRTDDNIESITKRFRTFIETSMPVVNHFEEQGKVIKVQCDQPVDVVYTQVK
FT                   NALSEKGVN"
FT   gene            complement(<573424..>574250)
FT                   /locus_tag="PICST_61312"
FT   mRNA            complement(join(<573424..574148,574214..>574250))
FT                   /locus_tag="PICST_61312"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(573424..574148,574214..574250))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61312"
FT                   /product="glucose/ribitol dehydrogenase"
FT                   /note="go_function oxidoreductase activity; go_process
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61312"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67774"
FT                   /db_xref="GOA:A3LXB1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXB1"
FT                   /protein_id="ABN67774.2"
FT                   /translation="MTHVTILTGASKGIGRSIAEVLLKKDASYKLIAVARSGSDLNELV
FT                   KQFGADRVCVVVGDVTEAETSQKAVNLAVSKFGQLDSVIANAGVLDPVGPFQSVDIAKW
FT                   RRLFDINYFSVIELIQASLPELRKTKGNVIAVSSGASTKPYSGWHAYGGSKAAVNHLIA
FT                   SVAADEPDVSALSIAPGVVDTSMQKDIREKFGKGMDPESLKRFIDLHANNELLQPDVPA
FT                   RVYVNLATEGWSKDIDGQYLRFNDGVLKKYA"
FT   gene            complement(<574514..>575323)
FT                   /gene="SPS24"
FT                   /locus_tag="PICST_61314"
FT   mRNA            complement(<574514..>575323)
FT                   /gene="SPS24"
FT                   /locus_tag="PICST_61314"
FT                   /product="peroxisomal 2,4-dienoyl-CoA reductase"
FT   CDS_pept        complement(574514..575323)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SPS24"
FT                   /locus_tag="PICST_61314"
FT                   /product="peroxisomal 2,4-dienoyl-CoA reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="go_function oxidoreductase activity; go_process
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61314"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67775"
FT                   /db_xref="GOA:A3LXB2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXB2"
FT                   /protein_id="ABN67775.1"
FT                   /translation="MVDYNVNGKVAVVTGGTRGLGLYCAEAFVLNGASVVAITSRKADA
FT                   CAQSKKYLEDVAAKNGKKVKIISIPADLTVEAEAKKFFDDVASQVDRVDIVIANAGASW
FT                   GAPLDTHPISAIKKVLNLNVVAVFHTIQLFAPLLEKSGTAEDPSRILIMSSVASLAAND
FT                   PVGTYGYLASKAGVSHLGKNLAVQLGPKNITVNSLAPGFFPSKMSAGLLEAAGSIMVDT
FT                   NPRGRLGVKEDIQNATLFLCAKQSGYINGIVLPIDGGAHLNNPSSKF"
FT   gene            complement(<576058..>580023)
FT                   /locus_tag="PICST_61902"
FT   mRNA            complement(join(<576058..579606,579634..579745,
FT                   579941..>580023))
FT                   /locus_tag="PICST_61902"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(576058..579606,579634..579745,
FT                   579941..580023))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61902"
FT                   /product="GDP GTP exchange factor"
FT                   /note="go_function small GTPase regulator activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61902"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67776"
FT                   /db_xref="GOA:A3LXB3"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR001180"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXB3"
FT                   /protein_id="ABN67776.2"
FT                   /translation="MTGESQFYMNSPKPMGPKELIDYSVSSVPSIHNRKSHRSSHPNVP
FT                   YPVDSSEESEQGDYEDLPDTEYNFLRPEVVLHIDSPTPPPSETPPQASRTQQIINESII
FT                   TPTKISPLRNSIYDTPPSYNGSYSVNDSGLTGSPPRRSSISPARNDTFLSSRKHSPNRD
FT                   SRDNSKSPKFRSSPSLSYDFPIAQRTFVEGDSDDDEGYSYDTTRQSATEYSIINQEMGG
FT                   QACYPEEDNVDLFDDESIIHPSTFFGRLPTLPSPGTSPTRNNTFSYSPNRDSMTSITRN
FT                   STLYSVSQQRKDEDLPALPFELPPLPFSAKSLNNQHFSVFNGPLWSLKSIFEWSIKLQD
FT                   WLDDSFISLAEFKVALTDLVTYHKPDIPPTVLSTLVDSIVDSLLRSHAISLTYRVVISP
FT                   NNASGREEENGITIDEMAAVSGVFPALTTCYYSGSHDKAQDLRLKCYSRFCHWNAVIEH
FT                   EEQLKNLDENEIYLAQDWVSYWKVTDVKTLDKRVVTLQSHVLDLLRNEWGFSARARLFV
FT                   EDFGPQFFARAKTDPKIKIPSNYQNEVIDSRSELLEIHKTMVLDPLIEIYKSDGKFVHS
FT                   FDAIAKIYSKWTKKAEQAFMRYMSTVPLLYELLNVEFLKEWVAKVHDKRLSKLNADCLI
FT                   LFQSTFSSRAFKLPLELRGISDLLGEEDKQSLAKAVEDVQNLTSKIQKMKVSVENKNEL
FT                   RKLQEIKWGNFNKERVNLKSTNRRFIKRGPLVRRGELKINTYNNHVILLDNYFIITERS
FT                   RNRAINEYIVEKNPIPVELLLVEERESSSKTISHSPVTSGPSQNQEEEPSNYQFKVRYA
FT                   GRGKRFAFTFITKSEKDRADWIRDIKYARTALCSRLRRTEPYSLNLISNTCFGYEQIDK
FT                   IEKLPICAEQDPVYDLSVDTMKKLNFSSGSDIYSLAGSVVFSKVLSMCSFEFMGSQFVL
FT                   IGLASGLYCSDLQNKWRKVANGANFVSLATDTSMSLLLVLAGNRLLYYALDSIVDVYYE
FT                   RRKHLTSVQLASKASFFEIGKHRAMTMIFVAKANSSGTDFTVFIPETDNGGVFSTFKEY
FT                   KKFHVAAACYGVSLFNSSFAVHTNRGIEILNLSTLLPRSVPEFSNTESLSRRSSTTSAN
FT                   SNSNNIEAIRSAVVATGIKPMGMFKISRGQESDLHEFLLVYSNFAIFIDPSGKLSRSSI
FT                   LRFEFQAKSIAFVKNSLFLVCDEVIEIWRISEFSNGSNGLIQVITGKGIQMINSDKLAF
FT                   SMANPMVPGMQLVFELRKKSSM"
FT   gene            <581701..>582861
FT                   /locus_tag="PICST_12169"
FT   mRNA            <581701..>582861
FT                   /locus_tag="PICST_12169"
FT                   /product="predicted protein"
FT   CDS_pept        581701..>582861
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_12169"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_12169"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67429"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019544"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXB4"
FT                   /protein_id="ABN67429.2"
FT                   /translation="MSYSSEVNKLLADGSRAYSSKNYELASEKYGEACEKYSDEKGDED
FT                   ADLLFLYGKSLFQNAVSKSEVFGGQPGDDEQEEDDKEEENEENKEDGDKFQFFDVAPVA
FT                   EEEGEDGAPQDEEEEADEENAGEVDQEEQEESNGKEKHDKENEEEQSDFELAWEMFDIT
FT                   RNLLEAKLQDIEEQGKDLTVPYLKTDDEETDNQYIILTKKLSETYDLLGEVSLESENFP
FT                   QSAQDLKSSLQLRLKLYNPETSALISESHYKLSLALEFCVEDPTSRQSAVEHMKLAIDS
FT                   VKKRNESETDASKKKENEELIQDLDARYQELKRDPTEELKSEQLDIIKGILGEPTADGA
FT                   GSSGSAAALVNDLSGIVKKKKVAQVNDLSAVVKKRKAPGKISGSEKK"
FT   gene            <584412..>586061
FT                   /gene="ICL1"
FT                   /locus_tag="PICST_62080"
FT   mRNA            <584412..>586061
FT                   /gene="ICL1"
FT                   /locus_tag="PICST_62080"
FT                   /product="Isocitrate lyase (Isocitrase) (Isocitratase)
FT                   (ICL)"
FT   CDS_pept        584412..586061
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ICL1"
FT                   /locus_tag="PICST_62080"
FT                   /product="Isocitrate lyase (Isocitrase) (Isocitratase)
FT                   (ICL)"
FT                   /note="go_function catalytic activity; go_process
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62080"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67430"
FT                   /db_xref="GOA:A3LXB5"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXB5"
FT                   /protein_id="ABN67430.1"
FT                   /translation="MPYTAIDINEEEQFFQQQVKEINEWWSQPRWRKTKRIYTAEDIAK
FT                   KRGTLKIEYPSSDQAKKLFKLLGEHDKQKSVSFTFGALDPIHVAQMAKYLDSIYVSGWQ
FT                   CSSTASTSNEPSPDLADYPMDTVPNKVEHLWFAQLFHDRKQREERLGLSKAERAKLPYI
FT                   DFLRPIIADADTGHGGITAIIKLTKLFVERGAAGIHIEDQAPGTKKCGHMAGKVLVPVQ
FT                   EHINRLVAIRASADILGSDLLAVARTDSEAATLITSTIDHRDHYFVVGATNPNSPELAA
FT                   LMSEAEAKGIYGEKLAAIEAEWTKTAGLKLFHEAVIDTINAGNYSNKAALIKKFTDKVN
FT                   PLSGTSNKEARKLAKELTGKDIYFNWEVSRAREGYYRYRGGTQCAVMRGRAYAPYADLI
FT                   WMESALPDYNQAKEFADGVKAKWPEQWLAYNLSPSFNWNRAMPPNEQETYIKRLGKLGY
FT                   VWQFITLAGLHTTALAVDDFSAQYAKIGMRAYGQAVQQPEIEKGVEVVKHQKWSGAEYI
FT                   DGLLKMVSGGVTSTAAMGAGVTEDQFKDKAKY"
FT   gene            <586479..>587984
FT                   /locus_tag="PICST_32760"
FT   mRNA            <586479..>587984
FT                   /locus_tag="PICST_32760"
FT                   /product="predicted protein"
FT   CDS_pept        586479..587984
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32760"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32760"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67431"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXB6"
FT                   /protein_id="ABN67431.2"
FT                   /translation="MGFIKPGKALRRSRSMKKENSRGSTSDESPYKKSRSNTPTPEVSK
FT                   IITDKVDDRVISFLERFPDDIAIRIFVCAGPDNSLPLLNRRFHSLFKVDTKAENKKIWP
FT                   NLSLILQMIRSWYLFDLNSRLDFGVLKKKMAYYHKRLQDIQSRWDQQHDPQLLRRNHWH
FT                   KQVSLTLLITQSNIEDFESDCFACAINEQILKLKFITLPILDELFHSRVMVTGNIAGKE
FT                   TSSRASIITYDNYLSEMKSRLKFLRIKFQEISFCFEKLDHAVVCNFEESDSLSQDSDRY
FT                   LTQLQQHEEIILEGNHPLVEYDDENRIPGKDQIEFQNVVQNADSFKTFAFNSIIVSDSK
FT                   PLPSWILRKGITSIRIFQIVERMKSFGYSLSESESLLSASLDNFRPNLIDLINTREISL
FT                   ANLVLLGPMSKVTDLMVINAFELFNIYEQEDCSKFGRNYAGDTVPEDISKLILNLLQIY
FT                   YNSDHWNDTALWIYVVEIKSFSLVQVLMKFNEIPPHGIIGSMM"
FT   gene            complement(<588141..>589103)
FT                   /gene="PHO85"
FT                   /locus_tag="PICST_48986"
FT   mRNA            complement(<588141..>589103)
FT                   /gene="PHO85"
FT                   /locus_tag="PICST_48986"
FT                   /product="Negative regulator of the PHO system
FT                   (Serine/threonine-protein kinase PHO85) (CaPHO85)"
FT   CDS_pept        complement(588141..>589103)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PHO85"
FT                   /locus_tag="PICST_48986"
FT                   /product="Negative regulator of the PHO system
FT                   (Serine/threonine-protein kinase PHO85) (CaPHO85)"
FT                   /note="go_function protein kinase activity; ATP binding;
FT                   go_process protein amino acid phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48986"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67777"
FT                   /db_xref="GOA:A3LXB7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXB7"
FT                   /protein_id="ABN67777.1"
FT                   /translation="TSRFQQLEKLGEGTYATVYKGRNRSTGAFVALKEINLDSEEGTPS
FT                   TAIREISLMKELDHENIVTLYDVIHTENKLTLVFEYMDKDLKRYMEVHGNQGALDLKIV
FT                   KSFMFQLLKGIMFCHDNRVLHRDLKPQNLLINNKGELKLGDFGLARAFGIPFNTFSNEV
FT                   VTLWYRAPDVLLGSRAYTTSIDIWSAGCIFAEMCTGKPLFPGTANDDQLIKIFRLMGTP
FT                   NERTWPGISQYANYKSNWQIFVPQDLRLIVPNLDLMGLNLLQSLLQMRPEARITARQAL
FT                   QHPWFHEITNPNPIVHHLGDPYQQQQQQQQQPVLDQQYQ"
FT   gene            complement(<589704..>591452)
FT                   /locus_tag="PICST_48845"
FT   mRNA            complement(<589704..>591452)
FT                   /locus_tag="PICST_48845"
FT                   /product="predicted protein"
FT   CDS_pept        complement(589704..591452)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_48845"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48845"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67778"
FT                   /db_xref="GOA:A3LXB8"
FT                   /db_xref="InterPro:IPR011671"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXB8"
FT                   /protein_id="ABN67778.2"
FT                   /translation="MSEERDTSGSPGETLLISEQSVLGDPWVPIYKRAVDFDAHHFETA
FT                   MANLIRQPNINSTVILRADILKENVYDPEKGDTMFVSKMIDKVPDFPSTSNSDDNSHKT
FT                   DLILHRYLDDATFRSIPTENCSVNLVSKCEIVRRIIPRNPFKDHIINQTCLVLTSQEGD
FT                   KGLKSDDSVLVVYIPHIKSSEETPFYLPPVYAVGILYHQGSLSIQYLGFNYEKSNDETT
FT                   LLRNMDPAERPIRIALRLLQTSAKHSLGAKTGYEKRVNHDMVVPKTAFQNRYISLKKKY
FT                   SSKLVNQWCESTDPKKHVFEDLAIAAFLIEFWSLKYKDSHSFEFRDLGCGNGLLVYILI
FT                   NEGYRGIGIDARARKSWAIYPKEVQDCLKEQVIIPSILLRPHPAVSRIAPHVTDNGRYY
FT                   QVAVQGETASQSSEVMAPGGIAYYSSSSLLSSPQVCTTDDFPKDTFIIGNHSDELTCWI
FT                   PLLGYSFMVIPCCSHALSGAKARYSPRKAARASKSSSTSTVNSSTYGALVDHVEDLAVQ
FT                   MGWDVEKEMLRIPSTRNAAIIGSSKKEISDEAWQTRVLDILALSGGAEGFVENSMALTK
FT                   RAPRNH"
FT   gene            complement(<591735..>593507)
FT                   /locus_tag="PICST_32763"
FT   mRNA            complement(join(<591735..593272,593351..>593507))
FT                   /locus_tag="PICST_32763"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(591735..593272,593351..593507))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32763"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32763"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67779"
FT                   /db_xref="InterPro:IPR024964"
FT                   /db_xref="InterPro:IPR027711"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXB9"
FT                   /protein_id="ABN67779.2"
FT                   /translation="MSLLETLSSEIGTFTKSGGDNLHDLYNESESLLKELKELEASLES
FT                   QLEQENIKCLSKFTNKWYKTSIDSLKSYNTATNRFSKNILVNSKFNIDLDDAYTYPLLL
FT                   NNFPVYTDSTEKDKTESVGFSSDLKGIKIENREELIKAIILHLLKIGQCDIVKEIVKEL
FT                   SLGSSVVIDESLLAKFEFLNKIVQDIVVNHDLSKALSWFKDKYNEKVRNSSRISQLSNP
FT                   VPSNFNDIEFKFHMLEFIILLNGKDSSFSLNDALDAYLYSKDNFSRFFKEYLSEISPLM
FT                   TLLLFQNNRSEDDFDLGNHKDKLLADFIAKMKHSFNIERDRKKNNASEMRFVSELLDHF
FT                   ENIHSQQSLFVNISNEFISEYCKDLRLSNDSSLFQSILAGYIYLPSFYKYNQIQSKMNK
FT                   LISVSSEARNGDDSKNGTSTEMSNGGEATIINYEATFNYDLPFQLPDSNRFLFNYHPIF
FT                   ICPISKEQLVPITHNQDQNVDEEPQSKRKKSSSLDPAASSSSTTTSFSTSSSSPNNPVV
FT                   VLNFCQHLALRESVWQLSKKGSDIFKCHYCYKKHKFSDVTDAYFIDL"
FT   gene            complement(<594561..>594857)
FT                   /locus_tag="PICST_62848"
FT   mRNA            complement(<594561..>594857)
FT                   /locus_tag="PICST_62848"
FT                   /product="predicted protein"
FT   CDS_pept        complement(594561..594857)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62848"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62848"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67780"
FT                   /db_xref="GOA:A3LXC0"
FT                   /db_xref="InterPro:IPR001232"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR016073"
FT                   /db_xref="InterPro:IPR039948"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXC0"
FT                   /protein_id="ABN67780.2"
FT                   /translation="MDTSGAYVTLVSADNHKFVVLKEVASISSVLRSTQGFEEGKTGKI
FT                   SLDMDGDILECVVEYLYYHYKYKEQAESGAIPEFHIPTHLALELLVKADFLDI"
FT   gene            complement(595288..597192)
FT                   /locus_tag="PICST_90103"
FT   mRNA            complement(join(595288..595980,596173..597192))
FT                   /locus_tag="PICST_90103"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(595547..595980,596173..597187))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_90103"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90103"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67781"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019417"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXC1"
FT                   /protein_id="ABN67781.2"
FT                   /translation="MEGLRENSSQNFKPNAYYIPGVGISVNHWQLRNLLKYDASSNVVY
FT                   YTTNDSINKLDMSSFVSSSYVNLHYNPRCYSHAPNGVVVTGGLLVNSSKLYLMNIDILL
FT                   LPESPQPTQNRQKLSKGLFSFYNPDLDVAKTVRLGEKINNDVAVFQSSNSNYTAYVCNN
FT                   DSNLYCMDISNNDDFRVVNSINCEVNTCLNNVVRSPTNDKLLAVTGDSQSIFLLDPTAS
FT                   NPNVRTIASGHEAGFGIAYHPSGNLLSAAFQDGTCLVYDLRNISENKPLIEVKSTRCGH
FT                   SSGAFRACKFSPAYDMSDMLIISEHVGRVHLVDLRHLDYSNVDDHQVVVVPLALGQYVS
FT                   IYCDSDSRSAQFSSFTSPLIFDYDYLTNNEKLFQDFVFTPPKQSSTSLKTDSQFPAKSN
FT                   SIRENSLNSSSPCMNTHPTNDNNSHQGNSYRPSLNFINGEMMLSGIDFCTPRKANESCI
FT                   LIGCEDAGAVMWGVNDATREASAS"
FT   gene            <597391..600249
FT                   /locus_tag="PICST_84351"
FT   mRNA            <597391..600249
FT                   /locus_tag="PICST_84351"
FT                   /product="predicted protein"
FT   CDS_pept        597391..600207
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_84351"
FT                   /product="vacuolar sorting protein"
FT                   /note="go_component cytoplasm; go_process intracellular
FT                   protein transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_84351"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67432"
FT                   /db_xref="GOA:A3LXC2"
FT                   /db_xref="InterPro:IPR006925"
FT                   /db_xref="InterPro:IPR006926"
FT                   /db_xref="InterPro:IPR016534"
FT                   /db_xref="InterPro:IPR038132"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXC2"
FT                   /protein_id="ABN67432.2"
FT                   /translation="MPSSPSLGWQKLQNVYYSIRPCYDGLSWSIDNLYSNFKVAISTRA
FT                   TILALSSKFVAHPNIIDVYSISGNKLWSIAYNSRPEDHIVDYVFRNEDLCLVLSNGRFR
FT                   YYNNFKGNFIEYSYIKDLVILDNVGSTFNSEASDVGVHGSDVARSYLITNLENNESEEI
FT                   IKVLEVKTWKQYLIVRLTSKIILTNLDTLTNYEIPLNTVDPLKIHGFSVVDGPDSSLVL
FT                   LTSYESTILTFKVDLGLTSYELNDEGLTEGPFTSIRASSNGQLISLYNVKSSKIYVISN
FT                   TFDQVLLEYGTSNESSSPYQIEWCGNDAIILSFKDEIKLIGPDQQSISFFYDIVDEEEF
FT                   DLDQLLRPGLDDLSFTIPILKSEPDGLKIFTTNKVEFLSRVPQCSINLYQIGSAHPSSI
FT                   LLDCIDKLNHHSSKADTSISLLKSDGTLYAAMSECLEVAQDEFVPVWQKKILRAVSFGK
FT                   AYFDGYYNADEFLSVLNNIKVLNQLRSPELGIFLTYQEVVQAGWKEIITMLLKRDQYLL
FT                   ALRIIELLKLDNYKEFVYSDWCCSKIRKELNMSDIDLFKIVAKKLISLTDDNRNYISVQ
FT                   AISEVAHEEGRINLCKLLVNLEPSIEKKIQQFLQFEEVELALLKAFQTGDYDIAKIILL
FT                   HLRDTLSISQFFRVLNQNEQTESITDLSTEELNKLDITIPSEKLSISGDLIGNFWVNSA
FT                   GKFDSKMLSTYYKQEDKNNELNTFKLKVYLSGNKDSQADEYYENYKAKLQKSLSTSNTK
FT                   RVNRLFQRELEVLELQKKLGEIYLTQFYGERSLNSILVRLIKLNQLKMASKVVKDFKIT
FT                   QEKYWYLVLNTYSQLKEFDRLYEFAVGMDQADSSSLRSPIGFEPFVDASFANGAPKDHI
FT                   STYIRNSNLKYTDKVKNYLKNGDLKSAAQEGFKNKDIDVLRSLLEATSDTDEETNKVIK
FT                   SYITKLGY"
FT   gene            complement(<600284..>601648)
FT                   /locus_tag="PICST_32767"
FT   mRNA            complement(<600284..>601648)
FT                   /locus_tag="PICST_32767"
FT                   /product="predicted protein"
FT   CDS_pept        complement(600284..601648)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32767"
FT                   /product="putative cell segregation machinery component"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32767"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67782"
FT                   /db_xref="GOA:A3LXC3"
FT                   /db_xref="InterPro:IPR007902"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXC3"
FT                   /protein_id="ABN67782.2"
FT                   /translation="MGKSHSKNVLPNTYVPVLSKKVLANVLVRLPKISLIEFMNVWPKI
FT                   ANTQPHMDKENSHHNQLQYNRHVSQDAQGLKKAVGKTPKRKVIDKIVYQYWSKGLNLLQ
FT                   LSQLDCQLIVDRPNSYYWITSTVKDSHDSEIPLSLDPKRFLDNLAHELSTLFLTYIYLC
FT                   RHPSLPLIIVRIQLFDLQAFSTSSDSRRPHISSLKAYFLALPLNSPTIIHSTGNDLITK
FT                   IVMQVVERSLPQNANNLLRIVTPERQTPIRSLESIHILHGNSRFGNSMGIWTPYADATV
FT                   DMLPFNALEKHSSIAKDEADDDYDSDDVKLKKLKSIANLRFNGSKTGKLKSEKLYEDNR
FT                   KTKTKRRKIYSNDDEDDFDELDEATENSEFASIAPVQFSEFLLKKKIHHDSPEKSSITI
FT                   RLTGSDVFAGLHELSVKTTDRDQMILDPSKVPGWLTGEEGASCGTVEDGVFKKYA"
FT   gene            601914..>604119
FT                   /gene="NOP4"
FT                   /locus_tag="PICST_90702"
FT   mRNA            join(601914..603889,604001..>604119)
FT                   /gene="NOP4"
FT                   /locus_tag="PICST_90702"
FT                   /product="RNA recognition motif-containing protein"
FT   CDS_pept        join(601924..603889,604001..604119)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="NOP4"
FT                   /locus_tag="PICST_90702"
FT                   /product="RNA recognition motif-containing protein"
FT                   /note="nucleolar RNA recognition motif-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90702"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67433"
FT                   /db_xref="GOA:A3LXC4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXC4"
FT                   /protein_id="ABN67433.1"
FT                   /translation="MSEDQTEHVAEVSIKQSSSVDEDGLDRKTLFVRSIPFEATSEELS
FT                   EFFSQFVPVKHAVIVNDENQKSRGFGFVSFTLDDDTLTALVEARKSKFKGRLLRVDIAK
FT                   RRERKDRNELPSSSPRSSAAPVEKRRARLIIRNLPWSCKKPDVLKKIFSNFGAVFDAYI
FT                   PKKKGGQMCGFAFVTMKKQAAAERAVKESVGLKIDGREVAVDLAVEKSKWEEIKEDEED
FT                   QEDQDEDEDEDVEEEEDDDEENGEDEDNKNEDNDDEEENAEEEEEDFNNLNEINSDAEV
FT                   EEDQEEEEEEEAPRKKNNRQEPYAIFVRNIPYDADEDSLEEHFSKFGPVKYALPVIDKE
FT                   TGLARGSAFVAFVNEDAYTDCLSNAPSSASTSMLIADDVSPAYVYQGRILSITSAVDRQ
FT                   SASKLAERNSEKRKEVLGKAPGEKDKRNLYLLNEGRITSNSKLAQFISKTDMEMREKSY
FT                   KLRVQQLNKNPTLHLSLTRLAIRNLPRAMNSKALKALGRKAVVQFATEVKEEKRQPLSK
FT                   EEVNRSIKHKQELGELEPKGATEEDKKKSSKHKGVVKQAKVIMEVKGSGDTGRSRGYGF
FT                   IEFRDHKVALMGLRWLNAHEVTVPEILEGLDEDEKKLAQLDGLSKRNLIVEFAVENAQV
FT                   VKRRRDKVFHSRQHDKNDEEGNMNKGPTTDGEKKEHKSGLSDDIKKIIGQKRKRRKGKN
FT                   "
FT   gene            complement(<604206..605461)
FT                   /locus_tag="PICST_68058"
FT   mRNA            complement(<604206..605461)
FT                   /locus_tag="PICST_68058"
FT                   /product="predicted protein"
FT   CDS_pept        complement(604517..605461)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_68058"
FT                   /product="ser/thr protein phosphatase"
FT                   /note="go_function hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68058"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67783"
FT                   /db_xref="GOA:A3LXC5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXC5"
FT                   /protein_id="ABN67783.2"
FT                   /translation="MGERGPDQWLEQIRKCIALSESDMKQLCELVKELLMEESNIQPVQ
FT                   SPVTVCGDIHGQFHDLLELFRISGGLPSEDNNTNYIFLGDYVDRGYFSLETFTLLMVLK
FT                   VKFPHRITLVRGNHESRQITQVYGFYEECLTKYGSTTVWKYCCQVFDFLTLAAIIDGKI
FT                   LCVHGGLSPEIRMLDQIRVLSRAQEVPHEGGFCDLVWSDPDNVDTWAVSPRGAGWLFGS
FT                   KVSREFNHINNLSLIARAHQLVMEGFRYHFKEKDVVTVWSAPNYCYRCGNVASVMQVDE
FT                   DLEPNFKIFSAVQDGDLTVKNNASKQQRSDYFL"
FT   gene            <606729..>607292
FT                   /locus_tag="PICST_36650"
FT   mRNA            <606729..>607292
FT                   /locus_tag="PICST_36650"
FT                   /product="predicted protein"
FT   CDS_pept        606729..607292
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_36650"
FT                   /product="30S ribosomal protein S18"
FT                   /note="go_component intracellular; ribosome; go_function
FT                   structural constituent of ribosome; go_process protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36650"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67434"
FT                   /db_xref="GOA:A3LXC6"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXC6"
FT                   /protein_id="ABN67434.1"
FT                   /translation="MLSSSRGLRVVSSRAAGSVRTFAVSAVRTNSPLPSTPEMKSEKSW
FT                   VNNEENTITRDVVGLARSIQESTQPPLDISSQFTRRFTFGENYDPFDFSNNKLDMEKKH
FT                   NYARNKQIADPFETTGINPSTLYLMPEILSRFLTSTGQILPRSITGCSAKNQKLLSDAI
FT                   RTARCCGLLSATHKHSRYLPSRNL"
FT   gene            <608808..609420
FT                   /locus_tag="PICST_84721"
FT   mRNA            <608808..609420
FT                   /locus_tag="PICST_84721"
FT                   /product="predicted protein"
FT   CDS_pept        608808..609068
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_84721"
FT                   /product="ATPase inhibitor mitochondrial precursor"
FT                   /note="go_component mitochondrion; go_function enzyme
FT                   inhibitor activity; go_process negative regulation of
FT                   nucleoside metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_84721"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67435"
FT                   /db_xref="GOA:A3LXC7"
FT                   /db_xref="InterPro:IPR007648"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXC7"
FT                   /protein_id="ABN67435.1"
FT                   /translation="MLSLASKRALPSTLRTSVRAFSVSRVAMTEGAINQANDAFSEKER
FT                   AQENIYIKKHEAEQLKALKEKLEKQKETIEKLEKEIGDIKK"
FT   gene            <610125..>612215
FT                   /gene="MUC1"
FT                   /locus_tag="PICST_32772"
FT   mRNA            <610125..>612215
FT                   /gene="MUC1"
FT                   /locus_tag="PICST_32772"
FT                   /product="hypothetical protein"
FT   CDS_pept        610125..612215
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MUC1"
FT                   /locus_tag="PICST_32772"
FT                   /product="hypothetical protein"
FT                   /note="Required for invasion and pseudohyphae formation in
FT                   response to nitrogen starvation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32772"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67436"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXC8"
FT                   /protein_id="ABN67436.2"
FT                   /translation="MHLFSGNRHKQLSPGSQTPETAVSGSPSVTNPNSTMGRGSPSSVH
FT                   QPAFTPVTRVYSSSRITVPSTANQSSSGSSTPPSIRISDESASPVARIESPPRKPQKSV
FT                   KSKKVSSSSSPSPSSPSKTPKRKNQKARTSSSSSPTKNKKAPSQPVQTAETQEESSSSP
FT                   ARRRRPPPLPPIDPVEASHSVLNDNIAERCRNSIDEQLERSTILAADISRNRRKSRIIR
FT                   SEQDETPSSSRVTPEVETVPVHEVLSPIPNASIPVESVAGPARMEQLLPSPVDSSVTSE
FT                   YRTLDPAVFPSLSTTPVDLPPTVTESSTPEVQVTEITAPMYIHAETATTTTTESLENLP
FT                   STQESSSRTDGDRRTRRNDSDQNRRERRVRTDRSRQTSTTANMPVTTSQRTGSNQRASN
FT                   QRTRERRLRRRRRRTSSDVESIPSLPPPQDEYTDIHPYLHEDSPPYREKLHKYVDLISF
FT                   DPRYTIPVLRFNKALINNDKKLQKCIKKLSQFNLLPSEINLWDVDQVDDREFYAVLPSL
FT                   LPELDGNGGPHVLGQVLEMERREQENTELQIAMELSLHAENQVVPQAIPASEEDSGDES
FT                   TYFYDAFETQASFSRSSDLFRGFRYQEATNYDAASVSDTNSFNDALSSNLSNSNINLVN
FT                   DPNQVNLSNSRDQMVSPAGSNNPIDAGRLNIRLNSPLYHVFRYNEPGISSSSSHHGRLV
FT                   DV"
FT   gene            <613083..>614111
FT                   /locus_tag="PICST_32773"
FT   mRNA            <613083..>614111
FT                   /locus_tag="PICST_32773"
FT                   /product="predicted protein"
FT   CDS_pept        613083..614111
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32773"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32773"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67437"
FT                   /db_xref="GOA:A3LXC9"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXC9"
FT                   /protein_id="ABN67437.2"
FT                   /translation="MSSLLPDEYLPYLNLLPDIHKVANLFMTFTPVFSYGTTCWGIYRK
FT                   QTSMGFSIDICATMLMASILRINYYVISPYEVTLLRQSIMMVLSQCVLLKVSLAYRPAN
FT                   YDPDFLTPMPVFRNELNAFMPRRMSASFPAEHESYYVDNSLTKSAQLIINDIVKWSKCY
FT                   VITIFNQSLKFFDVYYQRPLRFWQWKEEQYYWRFLAQFVVVFAVLTAVFHNSTPYGQFV
FT                   GISGLFIESLLPLPQILLLNRLQSVKNFKIILLLSWLGGDCIKLSYLFFGAENVSIIFI
FT                   FAGLFQMSLDIYIAFQYVHYKYHGTDSDISEVVSSGSRDLNYLVEELVKHDVESIPMAQ
FT                   MV"
FT   gene            complement(<614320..616001)
FT                   /gene="RPN4"
FT                   /locus_tag="PICST_65910"
FT   mRNA            complement(join(<614320..614932,614954..615205,
FT                   615254..615431,615480..616001))
FT                   /gene="RPN4"
FT                   /locus_tag="PICST_65910"
FT                   /product="zf-C2H2 Zinc finger, C2H2 type"
FT                   /note="Has EST support. strongly"
FT   CDS_pept        complement(join(614409..614932,614954..615205,
FT                   615254..615431,615480..616001))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RPN4"
FT                   /locus_tag="PICST_65910"
FT                   /product="zf-C2H2 Zinc finger, C2H2 type"
FT                   /note="Regulatory Particle Non-ATPase. zf-C2H2 Zinc finger,
FT                   C2H2 type; go_component nucleus; go_function nucleic acid
FT                   binding; zinc ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_65910"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67784"
FT                   /db_xref="GOA:A3LXD0"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXD0"
FT                   /protein_id="ABN67784.2"
FT                   /translation="MTSIAVFPPLKRSITDIMDEELYHIPNSPIQFSSRNATQPQTQTQ
FT                   QNQNQSQLFSGFKSINSSPALAHNTLFIHNAVNGSSSSLNASTTDSFLDQYVYSNNLNA
FT                   TSSINSSTNVSTANANSNHGSNVNTNPANFDAMDVDEAFNTPSLFVSPFTDYGNPDSSL
FT                   LTNNQINPFSFAFPARPTRRRHITTLDDDSSLRSSTKKEDDYLLFNPDIQPSHLINNKS
FT                   FFNDDYLFVPNIANLAANGIIPGYENDYLLVDDFDEEIEADLSDDEEDDDNYFHFDDDL
FT                   DDLVMNSNEYPEDNININVNLMDMDDYLKNTSSTNNNPAETIRLNKNDVMNGGYIDVKQ
FT                   DKIAQSHEISSHEIDHEDDIDELELEDEEFDDRRHSTKSFAHKSAAEISANNPNHQCDL
FT                   INPLTGVPCNKQFSRPYDLIRHQETIHASKKKIFRCVICEGRANGGPGNGKSKTFSRGD
FT                   ALSRHIKVKHGLVGKEAIDIINAAKENVEYVSV"
FT   gene            complement(<617397..>617816)
FT                   /locus_tag="PICST_61775"
FT   mRNA            complement(join(<617397..617708,617763..>617816))
FT                   /locus_tag="PICST_61775"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(617397..617708,617763..617816))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61775"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61775"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67785"
FT                   /db_xref="GOA:A3LXD1"
FT                   /db_xref="InterPro:IPR029164"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXD1"
FT                   /protein_id="ABN67785.2"
FT                   /translation="MDFDEPLPLIRPPKQIPSSSEEASADNSAIYYAYGYGIIAVSWMI
FT                   FLVSANSFFRIWQFVIEPLRSCGYESLYFQLATVFSTADNYVLSMWSIYVVVWWWAIVS
FT                   WCGLKLFRHSKGGVEAV"
FT   gene            complement(<618238..>619020)
FT                   /gene="GPM1.2"
FT                   /locus_tag="PICST_48292"
FT   mRNA            complement(<618238..>619020)
FT                   /gene="GPM1.2"
FT                   /locus_tag="PICST_48292"
FT                   /product="phosphoglycerate mutase"
FT   CDS_pept        complement(618238..619020)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="GPM1.2"
FT                   /locus_tag="PICST_48292"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="go_function catalytic activity; go_process
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48292"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67786"
FT                   /db_xref="GOA:A3LXD2"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXD2"
FT                   /protein_id="ABN67786.2"
FT                   /translation="MSGKVHKLIILRHGESQWNHENKFCGWIDIPLSEKGKSEAANAGK
FT                   LIKQFGLDPDIIYTSKLTRSIESGLIILQYLNKLWINHIKTWRLNERHYGQYQGRDKHE
FT                   VFKSLNSDKEQFQYIRRNYHGLPPLIEGKDPSIDERYSDIVNKDILPRGESLELVMKRL
FT                   IPYFVSEIVHHQLIQLDKTVLIVTHGSIVRSLIKYLSNVSDDDISNINVPTGVPLVFEI
FT                   DDNAELVRDYYYLDPELAQRGMEKVKNEGLKKEPHVNL"
FT   gene            <619722..>620441
FT                   /locus_tag="PICST_62290"
FT   mRNA            join(<619722..619790,619833..>620441)
FT                   /locus_tag="PICST_62290"
FT                   /product="predicted protein"
FT   CDS_pept        join(619722..619790,619833..620441)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62290"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62290"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67438"
FT                   /db_xref="InterPro:IPR022036"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXD3"
FT                   /protein_id="ABN67438.2"
FT                   /translation="MFVSTNSSSTASYLATPPATPTLSLDEYYQILNIQEVRSELMPNM
FT                   SKVKVDKPFTWNEVHFIVTTNQLELFARSQAATDRYLKFKHDLKESKVNILDHILANEV
FT                   RWDVEDLREEGAIFADKSDLRIIHNRFPYYFEDDVSHLCVWSKVRIPTDPNSADGDITT
FT                   ETRNKINQYIEETFIRPLGLTWEQVEWFKNWTSLQSVKSISHIHVLIKGGDKNKIEQMV
FT                   ESV"
FT   gene            complement(<620980..>621291)
FT                   /locus_tag="PICST_61679"
FT   mRNA            complement(<620980..>621291)
FT                   /locus_tag="PICST_61679"
FT                   /product="predicted protein"
FT   CDS_pept        complement(620980..621291)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61679"
FT                   /product="histone H4"
FT                   /note="go_function DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61679"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67787"
FT                   /db_xref="GOA:A3LXD4"
FT                   /db_xref="InterPro:IPR001951"
FT                   /db_xref="InterPro:IPR004823"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR019809"
FT                   /db_xref="InterPro:IPR035425"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXD4"
FT                   /protein_id="ABN67787.1"
FT                   /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVK
FT                   RISALIYEEVRVVLKSFLENVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG"
FT   gene            622213..622738
FT                   /locus_tag="PICST_90527"
FT   mRNA            622213..622738
FT                   /locus_tag="PICST_90527"
FT                   /product="predicted protein"
FT   CDS_pept        622218..622628
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_90527"
FT                   /product="histone H3"
FT                   /note="go_function DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90527"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67439"
FT                   /db_xref="GOA:A3LXD5"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LXD5"
FT                   /protein_id="ABN67439.1"
FT                   /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPG
FT                   TVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSL
FT                   FEDTNLCAIHAKRVTIQKKDIQLARRLRGERS"
FT   gene            complement(<623052..>624320)
FT                   /locus_tag="PICST_32780"
FT   mRNA            complement(<623052..>624320)
FT                   /locus_tag="PICST_32780"
FT                   /product="predicted protein"
FT   CDS_pept        complement(623052..624320)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32780"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32780"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67788"
FT                   /db_xref="InterPro:IPR021848"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXD6"
FT                   /protein_id="ABN67788.2"
FT                   /translation="MEANASFADGGLLVSLYKQQYVAYSNLTNGSSETSFNILLASIVV
FT                   SVLALIVRNQKNSKNKNSAALKPKKANIINRVWGKWTPDYDFKTPTPEPFKYWDFKKTK
FT                   PMPYRAFKHKYTVTMGIRNMEWDSWIELDNQWLRYHNNKLDRFKERGDELYATSPLATA
FT                   AAYELLDEFKRYLPARYPALFKATDIGMDNLETGESYDFRPGHHDDPMKLAAMFTQDDL
FT                   AIMIEHEDGNYSLEAGAIALAGFWRLRDKFQMKLNEIHTSGDVPKYETNLKMGMTKFFR
FT                   RLTVDKPVVRNNYFIQTDDNLGWSDSIGREDVEEIGGWYTAKVASEIDKLYFRSERQSL
FT                   RRLPISGGVVFTIRTYFIPITELCDEPHIPRRLLNGINSWSDDVEEYRGYHKYKDILLP
FT                   YLEKRAEEQEKEGLGSEPEVYPF"
FT   gene            complement(<624795..>625979)
FT                   /locus_tag="PICST_61651"
FT   mRNA            complement(<624795..>625979)
FT                   /locus_tag="PICST_61651"
FT                   /product="predicted protein"
FT   CDS_pept        complement(624795..625979)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61651"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61651"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67789"
FT                   /db_xref="GOA:A3LXD7"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXD7"
FT                   /protein_id="ABN67789.1"
FT                   /translation="MPTIPLGKLLATFILLKSLQLTLLYFTPAQFDTSSEIIVSQTKSP
FT                   YGYVLTHLLNRFIVWDSVYFNYMFVNGPKYEHQYVFCPNWLKFIRNFPIGGNGYYEKLF
FT                   VSLVISNALHFFSVILLYVLTLRFFKNDSKMALHSSLLMIIAPAGIFLTASYSENANNV
FT                   LSLAQILAYDIAVNPQDPTRNNTKSIVSKPLYLLSGFLVAVNYTIRANSLLLGIPYLMD
FT                   LFEIGVSQEAAWPILSGGSLFLSFLWSNFEAYRTFCPQRGEWCNNTLPILFSYAQNKYW
FT                   GVGFLQYWSPNNIPNFLIALPVVAIHGLSIAYFWSRLPTLKKVLPWLVVNSVVIVGGLF
FT                   FWNVQILVRITSFLPLSYWYVASLTGHQHKSLVYYMLIWNLLQTMLFSAFLPPA"
FT   gene            complement(626234..629837)
FT                   /gene="ACS2"
FT                   /locus_tag="PICST_79135"
FT   mRNA            complement(join(626234..628577,629029..629837))
FT                   /gene="ACS2"
FT                   /locus_tag="PICST_79135"
FT                   /product="Acyl-CoA synthetase 2 (ACS2)"
FT   CDS_pept        complement(626360..628399)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ACS2"
FT                   /locus_tag="PICST_79135"
FT                   /product="Acyl-CoA synthetase 2 (ACS2)"
FT                   /note="Acetyl-coenzyme A synthetase 2 [EC:6.2.1.1]
FT                   [KO:K01895] (Acetate--CoA ligase 2) (Acyl-activating enzyme
FT                   2); go_function catalytic activity; go_process metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_79135"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67790"
FT                   /db_xref="GOA:A3LXD8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXD8"
FT                   /protein_id="ABN67790.1"
FT                   /translation="MTVTPQHQVVHEANGVTPRPTPKEFFDKQPRPGHITSIEQYQELY
FT                   QKSIADPEGFFGPMAKELLSWDRDFDKVKSGSLKDGDVAWFIGGQLNASYNCVDRWAYA
FT                   TPDKTAIIYEADEEKDSYKLTYAELLREVSKVAGVLKSWGIKKGDTVAIYLPMTPQAVI
FT                   AMLAVARLGAIHSVIFAGFSSGSIRDRVNDASCKALITCDEGRRGGKTVNIKKLCDEAL
FT                   KSCPTVEKVLVFKRTGNENIELEEGRDFWWDEETAKFSGYLPPVPVNSEDPLFLLYTSG
FT                   STGTPKGVVHTTGGYLLGAAMTTKYIFDVHPEDILFTAGDVGWITGHTYALYGPLALGI
FT                   PTIVFEGTPAYPDFGRFWQIVEKHKATHFYVAPTALRLLRKSGEQEIPKYDLSSLRTLG
FT                   SVGEPISPDIWEWYNEHVGQGRCHISDTYWQTESGSHFIAPIAGVTPNKPGSASLPFFG
FT                   IETALIDPVSGHELEGNDIEGVLAIKSTWPSMARSVWNNHTKYMDTYLNPYPGYYFTGD
FT                   GAARDHDGYYWIRGRVDDVVNVSGHRLSTAEIEAALIEHNGVSEAAVVGITDDLTGQAV
FT                   VAYVALKNEYVDKIAGKETSDEAFALRKELIMTVRKEIGPFAAPKSVIIVADLPKTRSG
FT                   KIMRRILRKISANEADQLGDITTLSNPQSVVGIIDSFAAQFAKK"
FT   gene            complement(630566..632679)
FT                   /gene="SSA2.1"
FT                   /locus_tag="PICST_84662"
FT   mRNA            complement(630566..632679)
FT                   /gene="SSA2.1"
FT                   /locus_tag="PICST_84662"
FT                   /product="heat shock protein 70, Hsp70 family (SSA2)"
FT                   /note="Has EST support"
FT   CDS_pept        complement(630721..632652)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SSA2.1"
FT                   /locus_tag="PICST_84662"
FT                   /product="heat shock protein 70, Hsp70 family (SSA2)"
FT                   /note="heat shock protein 70, Hsp70 family (SSA2)
FT                   upregulated under oxygen limitation very low under aerobic
FT                   conditions highest on XOL"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_84662"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67791"
FT                   /db_xref="GOA:A3LXD9"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXD9"
FT                   /protein_id="ABN67791.1"
FT                   /translation="MSKAVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSFVAFTDS
FT                   ERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDDAEVQGDVKHFPFKVVDKGGKPQIEVE
FT                   FKGETKVFTPEEISSMILTKMKETAENFLGTQVNDAVVTVPAYFNDSQRQATKDAGLIA
FT                   GLNVMRIINEPTAAAIAYGLDKKSEEEKNVLIFDLGGGTFDVSLLSIEDGIFEVKATAG
FT                   DTHLGGEDFDHRLVNHFVNEFKRKNKKDLSTNQRALRRLRTACERAKRTLSSSAQTSIE
FT                   IDSLYEGIDFYTSITRARFEELCQDLFRSTLDPVEKVLKDSKIDKSSVHEIVLVGGSTR
FT                   IPKVQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILSGDTSSKTQDLLLLDVAPLSL
FT                   GIETAGGIMTKLIPRNSTIPTKKSETFSTYADNQPGVLIQVFEGERAKTKDNNLLGKFE
FT                   LSGIPPAPRGVPQIEVTFDIDANGILNVSALEKGTGKTQKITITNDKGRLSKEDIEKMV
FT                   SEAEKYKEEDEKEASRVQAKNGLESYAYSLKTSLGDEQFKSKLEASEVEEVTKAADETI
FT                   EWLDSNQSATSEEYADKQKELEGKANPIMAKAYQAGAAPAGGAAPGGFPGGAAPEPSNE
FT                   GPTVEEVD"
FT   gene            complement(633382..634708)
FT                   /locus_tag="PICST_68064"
FT   mRNA            complement(join(633382..634327,634543..634708))
FT                   /locus_tag="PICST_68064"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(633620..634327,634543..634623))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_68064"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68064"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67792"
FT                   /db_xref="GOA:A3LXE0"
FT                   /db_xref="InterPro:IPR005344"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXE0"
FT                   /protein_id="ABN67792.2"
FT                   /translation="MSTPSNTAATPASSAKFDQEKLLATVKTSQFAWFVGHLVTLISVF
FT                   FYVLTYIKFGVGLYKFWFVLALVGVVESFGILVFQSIKKNGFDFGQLIKDDNTFYFLLG
FT                   SLLLFVRSRVLLTLLPFGLFSFYHVLTYANGYILPIFNLENSAISSKIGSFVANTNNKS
FT                   IQLAALLEVVTYGYLFLRVIAFRKRSLSPFLIYTVFLKKKFETSVYTRNYFKAAEVQVD
FT                   NVVNQIGQPQVKKVWIQIKDVFKKIGTVHLVHDPTKDKSI"
FT   gene            complement(634937..636634)
FT                   /locus_tag="PICST_84419"
FT   mRNA            complement(join(634937..636373,636604..636634))
FT                   /locus_tag="PICST_84419"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(635085..636373,636604..636613))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_84419"
FT                   /product="cell division control protein 3"
FT                   /note="go_function GTP binding; go_process cell cycle"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_84419"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67793"
FT                   /db_xref="GOA:A3LXE1"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXE1"
FT                   /protein_id="ABN67793.1"
FT                   /translation="MTSETETRPVSIENKIPIQDIKILKKKLNGYVGFANLPKQWHRKS
FT                   VRRGFSLNIMVAGESGLGKATLVNTLFNREIINHENDIDDEDISDKDDISVKIKSTTAE
FT                   IEEDGVKLSLSVVTAPGFGESINNVDSWKPIVDEINSRFDSYLEAESRINRTTTVDNRI
FT                   HAFLYFIEPTGHSLKSLDITLMKQVHEKVNLIPIIAKSDTLTEEEIAAFKGRILDDIKA
FT                   QGIKTFSPSDYENDDEETVLNTRQILQKFPFAVVGSTKEVTTADGRQVRGRKYPWGVIE
FT                   VDNEDHNDFIQLRQLLVRNFLEELKEQTSNNLYENYRSEKLKKMGIEQDNSVFREFDPL
FT                   TRQEEERALHEAKLAKMEAEMKAVFQQKVSEKEKKLQRSEADLFSRHKEMKDKLTKQIK
FT                   LLEDKKVQLEKQKTLPQDPPAPAPQKSRKGFLR"
FT   gene            complement(<637844..>638398)
FT                   /locus_tag="PICST_32786"
FT   mRNA            complement(<637844..>638398)
FT                   /locus_tag="PICST_32786"
FT                   /product="predicted protein"
FT   CDS_pept        complement(637844..638398)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32786"
FT                   /product="CinA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32786"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67794"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXE2"
FT                   /protein_id="ABN67794.2"
FT                   /translation="MSFPPDDIERLVTKIAAILRSRKENLAISEAACGGLLSAYIVTVP
FT                   GASNFYIGGKLVYSLRQRLKLSGCTDEEISSYVGPSEQVALRLARTAKYELGSTYVLSE
FT                   TGFAGPSKDLHLSDSDSKSTATASDAEVGTVYLGLCGPTGEVSCMRNTGSKVRASNMVE
FT                   FARLGLQFLLDQLERIESTES"
FT   gene            <638898..>639329
FT                   /locus_tag="PICST_36661"
FT   mRNA            <638898..>639329
FT                   /locus_tag="PICST_36661"
FT                   /product="predicted protein"
FT   CDS_pept        638898..639329
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_36661"
FT                   /product="proteasome subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36661"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67440"
FT                   /db_xref="GOA:A3LXE3"
FT                   /db_xref="InterPro:IPR006773"
FT                   /db_xref="InterPro:IPR038633"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXE3"
FT                   /protein_id="ABN67440.1"
FT                   /translation="MSKTIRFHAGKVDYDRDTNRCTPLAHKGVISIKPSVDEPDFYDFT
FT                   WVPKADLTAGGTVDRDELLLIPGDVSFKHIKSCTSGRVFALTFLSSGAKYLYWLQDVGD
FT                   IDQLDKLTEKDLQIVKDIDELITIKDEEEEEEEKDEAKE"
FT   gene            <639454..>639828
FT                   /locus_tag="PICST_48188"
FT   mRNA            <639454..>639828
FT                   /locus_tag="PICST_48188"
FT                   /product="predicted protein"
FT   CDS_pept        <639454..639828
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_48188"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48188"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67441"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXE4"
FT                   /protein_id="ABN67441.2"
FT                   /translation="RLPIMAVSDFLDLDVVEQHLDSLDSEQLKSLYAEHLPDSIAKNPS
FT                   KTAILDVLRSGFYQQSEQKLSKSLSSGNGAGYLLAQSLKFEYKGEGIDAFLAGVRELAQ
FT                   KEKEKESEQDEEKKDVDMEE"
FT   gene            640318..643299
FT                   /locus_tag="PICST_72879"
FT   mRNA            640318..643299
FT                   /locus_tag="PICST_72879"
FT                   /product="predicted protein"
FT   CDS_pept        640357..643260
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_72879"
FT                   /product="lipase/thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_72879"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67442"
FT                   /db_xref="GOA:A3LXE5"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039529"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXE5"
FT                   /protein_id="ABN67442.2"
FT                   /translation="MLFTSPMTGADSPGCRPVYMYPSYARITSFDESHTKFASKYSLYL
FT                   YREQGKDPIPDENNGYERLDGIPVLFIPGNAGSYRQARSIAAQSSNLYFDKKVHNSGAR
FT                   NFDFFTADFNEDFTAFHGRTMLDQAEFLNEAIHFILGLYSNTDNPPKSVIIVGHSMGGV
FT                   VARVMLTLPNYTDGTVNTIITLASPHAAAPLTFDGDILKIYSAVDRFWFDGFHPTTSDI
FT                   SQTAHRRLHDVSLISITGGLTDTTLPADYTTLSFLVPPSNGFTVYSTGIPNVWTNVDHL
FT                   AIVWCHQLRTQIAKAMLEIADFSSPSRTYSLERRMQVFRNNFLTGYEDYASQDLVPNIE
FT                   QQQNLAMKLDLAQIKSFNINGDKKLRITKDNQNSKWNIFQLGNDAKLQLDVLSSLEPTE
FT                   WESWLADEESNRPVILLCSNLGENNQELDLTDFTNDQTNEFVELKCIDTARDVHLVPRS
FT                   MSDSKSLGESSFGGEKTPFYSLQYNDTILTRYDLVVVAQRNIATDSDFVIAELADQKST
FT                   IFELGKHMSTLFHSKADLSLSSNRPLSVNIKLPAAWSSLLSYKLKLNLPDKTEGKFASF
FT                   IRQWIDEPYESKWHINVEKNNVITLRMHGISPFVPFKVKDDYGLNIQLWSDTNTKEEIP
FT                   LDIELSVDLIDSFRLFVMRYRLSIVATCVSISLLAMLVQFQLYFRTGKFPNFIFVLSYL
FT                   NTGWPLAMIISILIGLNPIVKLGWVQYLLNFIDPVVLSDANEVNLSLKQEFRLNSFYLG
FT                   LEESSLWFIGIMLYFIGTFLVVATYYLLSAISVLGYALVNHLPKTTSPTKTRIVVTFLL
FT                   IMMIPIYIPYQIVYIISCVIQAINVLKSVNNSQLFNYQISLLILMLWILPVNIPIVIVF
FT                   VHNLSVNWKTPFSSHHNLLSIVPVLLLTERNGLLSRLPKKKDQFFFKWYMGYFIFYCLI
FT                   YGSRHTYWLHHLFNLMSCLVLVLTFGDEEKKEEVSIT"
FT   gene            complement(643520..644023)
FT                   /locus_tag="PICST_73488"
FT   mRNA            complement(643520..644023)
FT                   /locus_tag="PICST_73488"
FT                   /product="predicted protein"
FT   CDS_pept        complement(643614..644009)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_73488"
FT                   /product="histone 2B"
FT                   /note="go_function DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73488"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67795"
FT                   /db_xref="GOA:A3LXE6"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LXE6"
FT                   /protein_id="ABN67795.1"
FT                   /translation="MAPPKAEKKPASKAPAEKKPAAKKTASSTDAKKRTKTRKETYSSY
FT                   IYKVLKQTHPDTGISQKAMSIMNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVR
FT                   LILPGELAKHAVSEGTRAVTKYSSASN"
FT   gene            644962..645551
FT                   /locus_tag="PICST_73490"
FT   mRNA            644962..645551
FT                   /locus_tag="PICST_73490"
FT                   /product="predicted protein"
FT   CDS_pept        644993..645388
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_73490"
FT                   /product="histone 2A"
FT                   /note="go_function DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73490"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67443"
FT                   /db_xref="GOA:A3LXE7"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="InterPro:IPR032458"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LXE7"
FT                   /protein_id="ABN67443.1"
FT                   /translation="MSGGKGKAGSSEKASTSRSAKAGLTFPVGRVHRLLRKGNYAQRVG
FT                   SGAPVYLTSVLEYLAAEILELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGHVTIA
FT                   QGGVLPNIHQSLLPAKKAKPGKASQEL"
FT   gene            <646033..>646926
FT                   /locus_tag="PICST_47978"
FT   mRNA            <646033..>646926
FT                   /locus_tag="PICST_47978"
FT                   /product="predicted protein"
FT   CDS_pept        646033..646926
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_47978"
FT                   /product="vacuolar protein sorting protein 66"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_47978"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67444"
FT                   /db_xref="GOA:A3LXE8"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXE8"
FT                   /protein_id="ABN67444.2"
FT                   /translation="MEKFSSWRDKGTGISPFMPVPLPLSQEKSAFKRTLLSVVKVPLFI
FT                   IKLPFFILFTLAYYITSLKPLANFVFFVLFGFKNIDFSVEGVKKSNIDVINKNKPSPND
FT                   IIVANYSSPIDGLIYALVANTYNWHNVKFLVPNQSGELFEYSLWSLVNHSFDNSVSGSK
FT                   VESLSSYKNKVVFLLLEGTTSNNKALLPFVPLSPNYNFDGFAVKTLVSKISPGYLTMPI
FT                   PVSKLGYLFELLTNLNKLTLNYIKLKCYKFDKFEVVELRKTFALNSLNSIDKNLNIAEK
FT                   QKFVAYYKNHDVKKTD"
FT   gene            complement(<646967..>647668)
FT                   /locus_tag="PICST_48043"
FT   mRNA            complement(<646967..>647668)
FT                   /locus_tag="PICST_48043"
FT                   /product="predicted protein"
FT   CDS_pept        complement(646967..647668)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_48043"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48043"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67796"
FT                   /db_xref="GOA:A3LXE9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXE9"
FT                   /protein_id="ABN67796.2"
FT                   /translation="MNSIQKINAINQKELATNTSYKASWHYDYRDTNYIYIGNIASDIE
FT                   EKDIITIFSQYGVPTHINMIKDKETGRHRGFAFLKYANMKSCVLAVDNFNGVVVYERKL
FT                   RVDHTYYKLKKDENEDDFLIDYSEVRKQQSEKKETKRIEGKKQESITAVSDTIDDEFKD
FT                   PMADHIAQAANEDEEFKDPMADYVKKDSHKRHREHRSREHRHRHHSRHGHDHRSDRKSE
FT                   HTSRDRSPTRE"
FT   gene            <648024..>650330
FT                   /locus_tag="PICST_32792"
FT   mRNA            <648024..>650330
FT                   /locus_tag="PICST_32792"
FT                   /product="predicted protein"
FT   CDS_pept        648024..650330
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32792"
FT                   /product="eukaryotic ribosome biogenesis protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32792"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67445"
FT                   /db_xref="GOA:A3LXF0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR012953"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR028598"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LXF0"
FT                   /protein_id="ABN67445.2"
FT                   /translation="MDGLLDAEASEDDEEDEENSEDDEEEDSDKELNELLGEEEDPSDY
FT                   DSENFSDEPQESDTRSITDAISGVKIRSLSDISSQDKQEFHTKYSDGSERIIKPEIEPV
FT                   YDSDDSDAENFNTIGDIPLSAYDEMPHLGYDINGKRIMRPAKGSALDQLLESIDLPQGW
FT                   TGLLDQNTGSSLNLTDEELELIRKIQQQENTDANIDPYEATIEWFTSKVEVMPLTAVPE
FT                   PKRRFVPSKHEAKRVMKIVRAIREGRIIPPSKVKEQIEEERLNYDLWNDDDIAVEDHIM
FT                   NLRAPKLPPPTNEESYNPPEEYLLTEEEKKQWESLDPADRERNFLPQKFGALRKVPGYQ
FT                   ESVRERFERCLDLYLAPRVRHNKLNIDPESLIPELPSPKDLRPFPIRCSTVYQGHTDKI
FT                   RTISIDPQGLWLATGSDDGSVRIWEILTGRQVFNVQLINKEINDEDHIESLEWNPDSQT
FT                   GILAVCAGENIYLVVPPIFGFDIENMGRLRIESGWGYDTFGNKTKEEKFKNDEGNEDED
FT                   DEDDSATSTAVKKDVARWFPPNQEQTKLGISAIIQCRKTVKKVSWHRKGDYFVTVSPDS
FT                   KNTAVLIHQLSKHLSQSPFKKSKGIIMDAKFHPFKPQLFVASQRQVRIYDLAQQVLVKK
FT                   LMPGVRLLSTIDIHPRGDNLLASSYDKRVLWHDLDLSATPYKTLRYHEKAVRSIKFHKG
FT                   NLPLFASASDDGNIHIFHGTVYDDLMTNPLLVPLKKLTGHKIVNSIGILDLIWHPKEAW
FT                   LFSAGADGTARLWTT"
FT   gene            complement(<650501..>651058)
FT                   /locus_tag="PICST_36667"
FT   mRNA            complement(<650501..>651058)
FT                   /locus_tag="PICST_36667"
FT                   /product="predicted protein"
FT   CDS_pept        complement(650501..651058)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_36667"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36667"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67797"
FT                   /db_xref="GOA:A3LXF1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXF1"
FT                   /protein_id="ABN67797.2"
FT                   /translation="MTQGKDKLRLKYTLGLIYCPETNEILLLNRYKSPWMGKWNGVGGK
FT                   LDADETPLQCIVRETKEETGLDISTYKSRGVFTWKVKFTEGAPQHEPPVGGMYLFTAAV
FT                   SKEVVDSYATPIKYCKEGVLDWKDMDWVMHPENYGVVDNIQKVLETLFEADENDLYTTR
FT                   YDDITLLECKYHKGGNTDYPVF"
FT   gene            complement(<651390..>652247)
FT                   /locus_tag="PICST_61741"
FT   mRNA            complement(<651390..>652247)
FT                   /locus_tag="PICST_61741"
FT                   /product="predicted protein"
FT   CDS_pept        complement(651390..652247)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61741"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61741"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67798"
FT                   /db_xref="InterPro:IPR028071"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXF2"
FT                   /protein_id="ABN67798.2"
FT                   /translation="MNLILLDTNPYLYKYWSVHYSQLSSILKIYGLSPLNDLKLHFKNC
FT                   SIESLVISKPEQNLGNKSTAIVTPTNSLSYMGGGFDKYLLQSLLLPSTISYKQIEPLIQ
FT                   HYSLNKFNGYLPVNSTNIIELLTVFGDVHDYEQSHAYKNWNITTVIQVPSMIVPEAVGS
FT                   KTNIFDSIFNVMLATAQQPIGNLIIPGIGTGYGQLDPEEIAKIMIFSIVLFNLNLGTDR
FT                   FSHLKKSCLILFFFNKDYRKLSNELDLFELHEKVISEYGKTRVTQCGDELMEFEELFKC
FT                   IRLE"
FT   gene            complement(<652782..>653544)
FT                   /locus_tag="PICST_32795"
FT   mRNA            complement(join(<652782..652931,653020..>653544))
FT                   /locus_tag="PICST_32795"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(652782..652931,653020..653544))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32795"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32795"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67799"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXF3"
FT                   /protein_id="ABN67799.2"
FT                   /translation="MKFQVLLCLFSILCLAISVKTASYSDELSLFASGNSYFPLDSGII
FT                   KFDSIEIPFDGIGGYFRSIDSFSFDRFSKLKVLSKILRAAVEAKATGDILYLYNFIAFN
FT                   GQDRSMTLDYTSNFKDEVCLFLCKYDTNSTTELSETTADSRLSAYYKNFPVEECEYSRE
FT                   EGFCGKNVWVSTPTSVEKNWQVEPFYSFISTTKVHFMGYSTLKTVGFEIQLRTYLERTY
FT                   SD"
FT   gene            657383..658485
FT                   /gene="POR1"
FT                   /locus_tag="PICST_90315"
FT   mRNA            657383..658485
FT                   /gene="POR1"
FT                   /locus_tag="PICST_90315"
FT                   /product="Porin/voltage-dependent anion-selective channel
FT                   protein"
FT                   /note="Has EST support"
FT   CDS_pept        657409..658257
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="POR1"
FT                   /locus_tag="PICST_90315"
FT                   /product="Porin/voltage-dependent anion-selective channel
FT                   protein"
FT                   /note="go_function voltage-gated ion-selective channel
FT                   activity; go_component mitochondrial outer membrane;
FT                   go_process anion transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90315"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67446"
FT                   /db_xref="GOA:A3LXF4"
FT                   /db_xref="InterPro:IPR001925"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR027246"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXF4"
FT                   /protein_id="ABN67446.1"
FT                   /translation="MAPAAYSDIQKSTNDLLNRDFFHLATAAVDVKTVAPNGVTFTVKG
FT                   KTNKDDTIAASVDAKYVDKATGLTLTQGWNNANALNTKIELSELLTPGLKGELDTSVVP
FT                   NGTRNAKLNFFYQQSAVNARLFFDLLKGPVATADLAVAHDGFTAGAELGYDIASAKVNK
FT                   YSVGVGYTNLNYALAATATSNLSVFSAAYFHKVSPLVEVGAKTTWDSVKSSSVNVEFAT
FT                   KYSLDKSAFVKAKIADSGLTALAYSQELRPGVRLGLGASFDALKLAEPVHKLGFSLSFT
FT                   A"
FT   gene            658759..660120
FT                   /gene="CTK2"
FT                   /locus_tag="PICST_90608"
FT   mRNA            join(658759..659153,659244..659506,659555..660120)
FT                   /gene="CTK2"
FT                   /locus_tag="PICST_90608"
FT                   /product="RNA polymerase II C-terminal domain kinase beta
FT                   subunit"
FT                   /note="Has EST support"
FT   CDS_pept        join(658873..659153,659244..659506,659555..659958)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="CTK2"
FT                   /locus_tag="PICST_90608"
FT                   /product="RNA polymerase II C-terminal domain kinase beta
FT                   subunit"
FT                   /EC_number="2.7.1.-"
FT                   /note="cyclin-related subunit of the kinase complex that
FT                   phosphorylates the RPO21 CTD (carboxy-terminal domain) also
FT                   called CTDK-I beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90608"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67447"
FT                   /db_xref="GOA:A3LXF5"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXF5"
FT                   /protein_id="ABN67447.2"
FT                   /translation="MRVFQFSFHIIKQLKFPLRVLSTTMNYYQRFYLFNRFQASEEAQD
FT                   IGDLERDPFMVAVACLFLAAKNEDCIKKLKEIQSVANKLRDIDDTQRISSSTVADLQRR
FT                   AVMSLEFKLLQIIKFDFNNGATVSIKSSDQLVTQFCKKLNINYRLSLFSWLINFDLMSS
FT                   PLCLVIPPHCIALAIIIINEESDEELNAKLDSFDCYVDFRCPESLVNEGILYVLDYYIH
FT                   SYQHSILNQYLPAIDRETGKEQIFKFMEFKSRFNDLKTLNEHSTATRPLLQQDKYLQPW
FT                   DYSIATKGTARFMPGNKRRRFSRESGKPRQMSNS"
FT   gene            complement(<660215..>660859)
FT                   /locus_tag="PICST_61854"
FT   mRNA            complement(<660215..>660859)
FT                   /locus_tag="PICST_61854"
FT                   /product="predicted protein"
FT   CDS_pept        complement(660215..660859)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61854"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61854"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67800"
FT                   /db_xref="GOA:A3LXF6"
FT                   /db_xref="InterPro:IPR003511"
FT                   /db_xref="InterPro:IPR027097"
FT                   /db_xref="InterPro:IPR036570"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXF6"
FT                   /protein_id="ABN67800.2"
FT                   /translation="MAPPEASASKLALKGSSKIVTDYFEFAMNNILFQRGIYPPEDFVT
FT                   VRKYGLPLLVSNDPEVRDYISNIMIQIKKWIYGKRIVKLVLVIVSKSTVETVERWEFNI
FT                   DIMGKDSTDIIDSGEEEKSRVETQKEIQTIIRQITSSVTYLPVLKDDDYTYNVLVYTDP
FT                   KNPTSSIPIEWCDTNGDSRLVEGDNVDKVDFTSFSTNIHQVGTSVTYKYDS"
FT   gene            <661167..>662355
FT                   /gene="BET4"
FT                   /locus_tag="PICST_32799"
FT   mRNA            join(<661167..661169,661219..>662355)
FT                   /gene="BET4"
FT                   /locus_tag="PICST_32799"
FT                   /product="Geranylgeranyl transferase type II alpha subunit"
FT   CDS_pept        join(661167..661169,661219..662355)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="BET4"
FT                   /locus_tag="PICST_32799"
FT                   /product="Geranylgeranyl transferase type II alpha subunit"
FT                   /EC_number="2.5.1.29"
FT                   /note="Geranylgeranyl transferase type II alpha subunit
FT                   (Type II protein geranyl-geranyltransferase alpha subunit)
FT                   (GGTase-II-alpha) (PGGT) (YPT1/SEC4 proteins
FT                   geranylgeranyltransferase alpha subunit); go_function
FT                   protein prenyltransferase activity; go_process protein
FT                   amino acid prenylation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32799"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67448"
FT                   /db_xref="GOA:A3LXF7"
FT                   /db_xref="InterPro:IPR002088"
FT                   /db_xref="InterPro:IPR032955"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXF7"
FT                   /protein_id="ABN67448.2"
FT                   /translation="MQHGIKRVSLSAEAKRLKLEKDKSKIAHYKQLTENIFSLRNLQTY
FT                   TVESLKETTQILQINPEFYTMWNYRREIFEHLKNNIPVEDYAQLMDNDLKMLMVILKRF
FT                   PKVYWIWNHRRWCLFELVKINRVDWQYEYAVVSKLLELDSRNYHGWQYRRFVVQNMQIQ
FT                   ATTKAAPASKNEESLVVLGINIEEFKYTTSKINKNFSNFSAWHNRSTLIPKIYNLYLQL
FT                   EAPSEKSPDVYDIFKSPRSILTHELELIKTGMYMDSEDTSIWLYMWWLLTEKFFTDELR
FT                   KEDGAYLAVLEEQLANVEELNELEKSDHIYHWDNCWCLKTIILVKGLIQQEHVKTNKSS
FT                   ALLTQDIKNHIQALIEIDPLRKGKYLDQLEGKASIIPIL"
FT   gene            complement(<662991..>664658)
FT                   /locus_tag="PICST_62202"
FT   mRNA            complement(join(<662991..664369,664385..>664658))
FT                   /locus_tag="PICST_62202"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(662991..664369,664385..664658))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62202"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62202"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67801"
FT                   /db_xref="InterPro:IPR025340"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXF8"
FT                   /protein_id="ABN67801.2"
FT                   /translation="MTSPFAHPWLESFTAILPLPRSKDEWLIVDISNSIREKPQWKSQY
FT                   KDESIASQWKQEIKDCYSDKTQLIDEIIDYVFAELEWYDNVESEYPGFTIACDDKIVFS
FT                   DTAIDPDLKLRLSSELKNLQSSFGDKPDYHPHTGNKVVDLIHPSLFPLEYSATPTYADA
FT                   KKSVVQLHEYSDEIHKVKKWVGKYGTSHKFQWLPSLLRINHETDTFEFKSYINNLHPTK
FT                   YASLYKDIQAVFNAVVPGLNFCLSRYASKPYFRIDIPPFEEAYEEEFQEKFKEFIDSDE
FT                   PWKGEKFWELMNSKVNYLKSFHPKYVEGPDTNKTIDLVQDFHRLKVIVKASNIELTPDN
FT                   PRYEGGKWHVDGTINEDIVASVMYYYDVENITESNLKFKACFGDPKYEQGDDTYPREIY
FT                   GVKDGDVMTRELGSITAHEGRIVISPNCFQHQVAPFELKNKSKPGHRKLLCFYLVDPYN
FT                   HVVVTTDQVPPQQKAWWDDNELKKNLADSLRKKILDLKPDEEFPVSWERAQEVREELMK
FT                   DRNKDLDEFDEDPAFTRKFSFWNYDSSAEETAE"
FT   gene            <665901..>666329
FT                   /locus_tag="PICST_48016"
FT   mRNA            <665901..>666329
FT                   /locus_tag="PICST_48016"
FT                   /product="predicted protein"
FT   CDS_pept        665901..>666329
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_48016"
FT                   /product="mating factor alpha precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48016"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67449"
FT                   /db_xref="GOA:A3LXF9"
FT                   /db_xref="InterPro:IPR008675"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXF9"
FT                   /protein_id="ABN67449.1"
FT                   /translation="MHLRSTAILSAVVFTSVALSAPTSGQNIDIDFPDESIAGAIPLSY
FT                   DLVPIIGSYQGQNVILIVNSTIAAASEAAASEGKSKRDANAWHWTSYGVFEPGKRDANA
FT                   NAAPWHWTSYGVFEPGKRDANADAAPWHWTSYGVFEPGK"
FT   gene            <666771..>668906
FT                   /locus_tag="PICST_32802"
FT   mRNA            <666771..>668906
FT                   /locus_tag="PICST_32802"
FT                   /product="predicted protein"
FT   CDS_pept        666771..668906
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_32802"
FT                   /product="predicted protein"
FT                   /note="go_function RNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_32802"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67450"
FT                   /db_xref="GOA:A3LXG0"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040000"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LXG0"
FT                   /protein_id="ABN67450.1"
FT                   /translation="MAKTKSRGRRVEKSADKLEKKAQSLFEDTKSTGEEGGDDSNEIDA
FT                   SLKSPFFGLVDSNELDYFKQAESTLNVNAFDSDEDREGFIRSVLEEARGKELKLVTNQI
FT                   CSKLMERLILFASDRQLKNIFGQFSGHFVALAHHKYSSHVLETLLVRSAALIEKELIHD
FT                   DSSQNEEEREEQEEGEVTDPMEGLFIKMVDEFKPHLQGMLEHQYSSHVLRLLILILAGK
FT                   ELPSTTTSNSTLRSKKSKIARKMIEIKDNQDFNKSFQTPSSFKIQLRELCNSVSNNQNS
FT                   KRMRELAIHKIASPVLQLLIQVEGLVDRDRTFWHLIFLKDSEDKNSQEEAFVEYLLSDS
FT                   VGSHFLEATIKNDGARIKYIERLYKLYMEDRILKLAKRSTTGVYIIQALLFKLKPVDVE
FT                   HILDEIIPELSNLISISENQNLDLGQRLIDASISRGNYRRDEIIEQLFLKFAPNYNVQD
FT                   PQLKTTSEFIENVLQLTGSTLGNTRDDWPTAEERRRSFFLEKLMEYDYKFVICVWYNFL
FT                   ALPVERFIQMCFHGVFSHIVERALVVIPSSEGEPKPVLILRKRVLNLFKDQIVNMSCNS
FT                   YGSHIVDALWNFSVLLPMYKDRIGTELQGDSHKVKESTYGRLVWKNWSMELFVRKKYDW
FT                   KSLIKQQEQAYYGVNDENGTTSRVKKPIELKMEKLAEERRLREEAAAKSESGYKRRHED
FT                   DNEDDYAKKQKLRGRRR"
FT   gene            complement(<669001..>671007)
FT                   /gene="MSD1"
FT                   /locus_tag="PICST_61618"
FT   mRNA            complement(<669001..>671007)
FT                   /gene="MSD1"
FT                   /locus_tag="PICST_61618"
FT                   /product="aspartyl-tRNA synthetase"
FT   CDS_pept        complement(669001..>671007)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MSD1"
FT                   /locus_tag="PICST_61618"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="go_component cytoplasm; go_function tRNA ligase
FT                   activity; ATP binding; nucleic acid binding; go_process
FT                   tRNA aminoacylation for protein translation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61618"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67802"
FT                   /db_xref="GOA:A3LXG1"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXG1"
FT                   /protein_id="ABN67802.2"
FT                   /translation="TSLPDKELTLAKFDFPLATHSIRKVTYKLDSFLDDKSIKVTINGH
FT                   INRKPRIRPELSFAEIRDSNGDCTQILLTPQTTSSKLFDLLKTTTVEDAVSVTGHVQLK
FT                   KMKPGDATREWELVVDNLQILNSSNLDAARLDKLKHSNPEQLPPQFRYLQLRTKFYQNA
FT                   LKTRSKVAMLIRNIFTENHEFTEIETPLLFKSTPEGAREFLVPTRSPDKFYALPQSPQQ
FT                   YKQILMSSGFTRYFQIAKCFRDEDLRADRQPEFTQVDLEMAYVNNCDQVGVVVEDLIHN
FT                   VWNRIRNISTYRVNEQGYLEAIDFDSTKPNSSLHFGKLKYIDALCKYGIDKPDLRSKLE
FT                   FVNLSELFIPSSTNNGQFPVLEACILKKAFEPSKGKYKLPRSLIDPLSYTRRKPIVIPI
FT                   QDENDATNWYKKFIEKKVFSEAATFSEHKLQASLDLEAGDILAFSTRAELPYENPTPLG
FT                   KFRQLAINEFPEKWNREIYDKSSGTISEVKDTSAIFVGSWVVEFPLFSPVEISSSSNND
FT                   FPEYDFTSFESTHHPFTMAKHEDYDLLETAPLKVRGEHYDLVINGVEVGGGSRRIHDAE
FT                   LQKFVFKNILNITNYNDLFGHLLHALSMGCPPHAGLALGFDRLCAMLLGSASIRDVIAF
FT                   PKNQSGFDPVVESPTSVSESTLNQYYITTKLNS"
FT   gene            complement(<671593..>673158)
FT                   /locus_tag="PICST_47685"
FT   mRNA            complement(<671593..>673158)
FT                   /locus_tag="PICST_47685"
FT                   /product="predicted protein"
FT   CDS_pept        complement(671593..673158)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_47685"
FT                   /product="putative membrane transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_47685"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67803"
FT                   /db_xref="GOA:A3LXG2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXG2"
FT                   /protein_id="ABN67803.2"
FT                   /translation="MTNQLTLEEQSEGLPLFQLVIIGCLQIGQSIAFSSMYPYIYSMVK
FT                   YFDIADNDSQIATYSGYLAAAFSLGEYMSLSYWSSASNIYGRKTILLCGCAGTAFSIVL
FT                   YGFSTNFYMALFARLLMGICSGNTEVLRITIDEIAPEDRHKGFAFGNIFSISNKYKFIG
FT                   YSLGVLGESSVSKSASKSRREDGFSIPSYPFLLPSLIAGSFVVFFINIGWLFLEETHER
FT                   IKYERDIGINVGDSIRRLLRIRVPERPWNSREQYLKVDHQLLEGKIDSSELPYYPTKSR
FT                   SLSVEVADFEEPSQSETGTETSDPIALPAVRNRMINNFMFCFHGVFYFEFLPILLATKL
FT                   RIEDMKFPFHVRGGFGYSSIGIGILVNSSAGIGSCVAMWLIVFVKYCGIKPVSLGLIVY
FT                   PIVYFLLPLLLFTSHQYNNGIPEYVPVLLLFIIILVDLSADFLTISRFQIFFDTTSSKE
FT                   EKQLISRYSIRVISLAKCLAPIIGGWMISKSETHGYSELPWWALSVWSTITLLHSNYID
FT                   KSAW"
FT   gene            <674898..>676313
FT                   /gene="KTR4"
FT                   /locus_tag="PICST_48097"
FT   mRNA            <674898..>676313
FT                   /gene="KTR4"
FT                   /locus_tag="PICST_48097"
FT                   /product="Glycolipid 2-alpha-mannosyltransferase
FT                   (alpha-1,2-mannosyltransferase)"
FT   CDS_pept        674898..676313
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="KTR4"
FT                   /locus_tag="PICST_48097"
FT                   /product="Glycolipid 2-alpha-mannosyltransferase
FT                   (alpha-1,2-mannosyltransferase)"
FT                   /EC_number="2.4.1.131"
FT                   /note="go_component membrane; go_function glycolipid
FT                   2-alpha-mannosyltransferase activity; go_process protein
FT                   amino acid glycosylation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48097"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67451"
FT                   /db_xref="GOA:A3LXG3"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXG3"
FT                   /protein_id="ABN67451.2"
FT                   /translation="MISVLSIRLKRVILVFSLIAACVLVLIGIGTVEISSSYYNKEMIS
FT                   SGIQSLTDKFDFSYLQPGNNGSYNLWNMKSSTLEQTGFIIEPNNVQFKFTNPLGKKGTP
FT                   QEIQEQNDKRYAQVFDKQITEPKDFDIESIRPPADPKKYKLANATIIALVRNNEASSIG
FT                   KTIRRFEKKFNDKFHYPYTFLNDEPFTDAFKSRIAKYTDAPMEFVTVGPEFWKKPSFID
FT                   ETRQKVEMDKLQAQNIAYATMESYHNMCRFYSGMFYNLPELQKYKYYWRIEPNVNFYTD
FT                   IKYDVFKYLQGTGKKYGFTINLYDIHETVVSLWPETLRFLNLGNNYKYVNKNGAFQWLL
FT                   EPHQNPKKNSDTGGYSTCHFWSNFEIADMDFYRSEAYNEWFKHLDRSGGFYYERWGDAP
FT                   VHSLGLSLFADKKDIHWFRDIGYFHDPYFNCPKSENTKLCSAGRFSRWDHLNDQNCMSS
FT                   WIDYSIDDLDKIY"
FT   gene            complement(<676505..>677404)
FT                   /locus_tag="PICST_48928"
FT   mRNA            complement(<676505..>677404)
FT                   /locus_tag="PICST_48928"
FT                   /product="predicted protein"
FT   CDS_pept        complement(676505..677404)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_48928"
FT                   /product="predicted protein"
FT                   /note="go_function molecular function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48928"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67804"
FT                   /db_xref="GOA:A3LXG4"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="InterPro:IPR035896"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXG4"
FT                   /protein_id="ABN67804.2"
FT                   /translation="MSKATVSNSTSLFIDKSKAPSKDDQGIIDIGKNCAKCSQLDFLPF
FT                   HCEFCNLTFCSNHRTLESHNCVGKDKFQTSRTGSPSYDGPSAKSLFPDNDERRRTLNQR
FT                   LQNSQPKPTTILEKQFRVGDIAKKTPNAFSKFNKFLKIQREKSAASSSAISKLFSSKSK
FT                   SSATSRTVELGKLRKDAKGDAKIPANDRIYIWSLYINGNSKESSGSSRESDEFSRINVE
FT                   KDRKPIFVSKNWVVGRALDSIADNLKIPNINNSTNKSEEKLNIFKLDEEVPVHVQNNIK
FT                   SISAFKNGDIIYLVRGTI"
FT   gene            <678164..>679087
FT                   /locus_tag="PICST_61322"
FT   mRNA            <678164..>679087
FT                   /locus_tag="PICST_61322"
FT                   /product="predicted protein"
FT   CDS_pept        678164..679087
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61322"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61322"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67452"
FT                   /db_xref="GOA:A3LXG5"
FT                   /db_xref="InterPro:IPR002738"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXG5"
FT                   /protein_id="ABN67452.2"
FT                   /translation="MLCDLNVPWPCSTYNTQPTQQQLEVLKNTIVTLYSLGYTHQAINF
FT                   SINENVRIPVGTPDLINPINIAYLKSELVPRFPKLKLFTRLTIIVSDPSKLQGLAKIQN
FT                   HFDVLAVQPVNEKALQLCTTNLDIDLVSFNLGSKLPFFLKHKTIGSAIDKGIKFEVCYS
FT                   TVVSGSIGYANVGDSTNVQLIKKNFFNNVLQLIRASRSKGIVVSSGAVQPLQARNGEDI
FT                   LTLLKTLGLDNSRAKSCITLNAERALISGRLRIKSYKQTVIAGNDSDEVLVEKKDPSKP
FT                   DTLAYKKRLGDSSSGRLLKKQKRSKD"
FT   gene            complement(<679747..>680367)
FT                   /locus_tag="PICST_48306"
FT   mRNA            complement(<679747..>680367)
FT                   /locus_tag="PICST_48306"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<679747..680367)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_48306"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_48306"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67805"
FT                   /db_xref="GOA:A3LXG6"
FT                   /db_xref="InterPro:IPR010684"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXG6"
FT                   /protein_id="ABN67805.2"
FT                   /translation="MSDTSEVSEPTFGRPKFPSLVHLATQTISRHLTSLEDFGQTPYHL
FT                   MEPILKRMNAKQLSSMEEKSPHIVPQSDRLWSQLIEKDFPDRPHTADVFSRTKPDATPY
FT                   RTLYHKYVTEREAFRQDSAKRLRRITQQLQNKKSENKIITVSGILKDPTIKRRTYSSPR
FT                   GSYGRQTALNKSSILNKARRELQGRNLIFSRQHVKPYSAYDAFK"
FT   gene            <681450..683240
FT                   /locus_tag="PICST_65920"
FT   mRNA            <681450..683240
FT                   /locus_tag="PICST_65920"
FT                   /product="predicted protein"
FT   CDS_pept        681450..683180
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_65920"
FT                   /product="putative metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_65920"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67453"
FT                   /db_xref="GOA:A3LXG7"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXG7"
FT                   /protein_id="ABN67453.1"
FT                   /translation="MSKMQLAVHQEDADILLKEKNVLNDPVLDKYRVSGQIAQTGLQYI
FT                   ASLINDSYHLGKYPQPLTVQELCILGDSFLTKLLSRVYNNVIREKGIAQPTSIEVNELV
FT                   AGFAPEVDDEGAYTFVAGDVVTISLGVQIDGYTANVAHTVVIYPAGVEVNNEIKPTGPL
FT                   LGGKADAICATHIATETIVALLGLALSPEKIPAQLKINGSATITGGHIRALVDSVAESF
FT                   NCVVLPGSKVRRVRRFLSGQAEGIVAERDFKGVVWDESHQEQKLLQKSTISNSTDLIIQ
FT                   TNNSNTSTSTNTSSAIPTDDFVVLAGEVYQIDMRLASLQEFEGEAGLITTEEIDHFTGK
FT                   NHKNEFNCKSTIHVRDFAVTHQLKLKTSRRLLGEVDKRFSVYPFKLSYTCKHFPVKLEN
FT                   DNVQEQLAQIKSELKTNKLGLSELSNRHLIKSKPVQVTKFIPLDKILLSANPTGKHAID
FT                   MSKPVLPGMEIPLPNLGVSSLKLKALLKHAKPIANVRESTTVVLNNVKNEVVRLTGGSK
FT                   TTTPSWVHSQYKLGGAYVQSIEQIVQLSKDKRFGIKVKECQPYNLSKTVGQAAETMELD
FT                   "
FT   gene            684489..686893
FT                   /gene="BMH1"
FT                   /locus_tag="PICST_84881"
FT   mRNA            join(684489..684507,685798..686893)
FT                   /gene="BMH1"
FT                   /locus_tag="PICST_84881"
FT                   /product="Multifunctional chaperone (14-3-3 family)
FT                   Posttranslational modification, protein turnover"
FT                   /note="Has EST support"
FT   CDS_pept        685924..686706
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="BMH1"
FT                   /locus_tag="PICST_84881"
FT                   /product="Multifunctional chaperone (14-3-3 family)
FT                   Posttranslational modification, protein turnover"
FT                   /note="Brain Modulosignalin Homolog Multifunctional
FT                   chaperone (14-3-3 family) Posttranslational modification,
FT                   protein turnover; go_function protein domain specific
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_84881"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67454"
FT                   /db_xref="GOA:A3LXG8"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="InterPro:IPR023409"
FT                   /db_xref="InterPro:IPR023410"
FT                   /db_xref="InterPro:IPR036815"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXG8"
FT                   /protein_id="ABN67454.1"
FT                   /translation="MPASREDSVYLAKLAEQAERYEEMVENMKAVASSGQELSVEERNL
FT                   LSVAYKNVIGARRASWRIVSSIEQKEEAKGNENQVSLIREYRAKIEAELSKICEDILSV
FT                   LTDHLISSAQSSESKVFYYKMKGDYHRYLAEFAISEKRKEAADLSLEAYKSASDVAVTE
FT                   LPPTHPIRLGLALNFSVFYYEILNSPDRACHLAKQAFDDAVADLETLSEDSYKDSTLIM
FT                   QLLRDNLTLWTDLSEAPAAADEQPAEAAESKEAPADEE"
FT   gene            <688524..>689630
FT                   /locus_tag="PICST_61997"
FT   mRNA            <688524..>689630
FT                   /locus_tag="PICST_61997"
FT                   /product="predicted protein"
FT   CDS_pept        688524..689630
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61997"
FT                   /product="cell division control protein 12"
FT                   /note="go_function GTP binding; go_process cell cycle"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61997"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67455"
FT                   /db_xref="GOA:A3LXG9"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXG9"
FT                   /protein_id="ABN67455.2"
FT                   /translation="MVCGESGLGKTTFINTLFQSSLKSYQSASERHNKFTSAHQNVDID
FT                   IVRAILEEKNFKIRLNIIDTPGFGNNVNNHDSWTPIIDFIDDQHESYMKQEQQPSRKDK
FT                   KDLRVHACLYFIRPTGHSLKPLDIEIMKRLSTRVNLIPVIAKSDTLSPSELETFKTRIR
FT                   DVIEAQDINIYTPPLELDDPASAEHSKQLIEAMPFAVIGSEEEVEVTPGQFVRGRKYPW
FT                   GLVEVENEQHCDFKKLRSLLLRTNMLDLILSTNEFHFETFRSIKMGGTDEDGEDNDKEL
FT                   TNENGEVIKKPSTSKKPRRLHNPKFKEEEDALKKFFTEQVKAEEQRFRQWETNIVNERN
FT                   RLNQDLEEMQTKLKTLEDQVKKLQLAKR"
FT   gene            <690669..>693272
FT                   /locus_tag="PICST_61599"
FT   mRNA            join(<690669..690906,690952..>693272)
FT                   /locus_tag="PICST_61599"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(<690669..690906,690952..>693272)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_61599"
FT                   /product="hypothetical protein"
FT                   /note="go_component nucleus; go_function transcription
FT                   factor activity; zinc ion binding; go_process regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_61599"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67456"
FT                   /db_xref="GOA:A3LXH0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:A3LXH0"
FT                   /protein_id="ABN67456.2"
FT                   /translation="EPFNSGSGSAHSKLRRNYRACLNCRVRKVKCDLGPVDNPREGKCA
FT                   RCLRERKDCVFVESKRGGTANVVSGRKRRKRSESNVLARGVSGSPEGNYTLSEQSSRSS
FT                   SNNLYNQRSQYPILNQEFNNQMPQMPKLPSVNSILNSRSSGTSLAQPQVSVNEKSSVTP
FT                   QPEATESQNNDSKNNGPSNHFSTMEGALVFLAKAAGTIAKADERDNIDGRAKQEQIEAR
FT                   ISHSNSHSQTPTEIMDRNQASSMPGSRSDPGSNMASILNSGTSSSVEQPSVSSETRKSS
FT                   STVPAYIKPTTEAGKRMTMPAAENGYSVRPRASNKLSSIEYIGGPNGILSEDEAERLIH
FT                   LFFTVMHPYFPHLPKFLHSPKILSGYPILLCAILTIASRYHTFENNVGTTGGVPRNIEV
FT                   HDRLWLYVQRLISQTVWAEASTRSIGTIFAFLLFTEWNPRAIHWRWSDYANKAEENNDT
FT                   DSGLSGFSAETGGANIASKNDEPNMAGLGAMRRSYRMAWMLIGSSVRLAQDMGFMEISP
FT                   KTFIATHVAEINSVMNISRSSMLAHSLAEVDLDEDEISEEDMEQDEDDDDKILKMSEED
FT                   LKRLSSEHVLKFTLSQKAQIELLQIISLGHESLYGYKAQLGNMNQRQNLSILNIISPMI
FT                   NNWGRKYKQFLVASNKLLRITNIQQHWYNPSSKIAKEISEAIERESLIFEFNYVKLYIY
FT                   SLALSPSPRAKYEQRRNRKGKATLKLDEISKSAKYIEQAFKSANEMLLVAHRVHKLKML
FT                   RFMPVRWLTRMVRAVAFIVKCYLTITAHKNSANGGSSSVANSADNFDSTILSLSLISIE
FT                   DIIQSIQRAAITLRDCSPDELHLCTRYSNVLMYLCSEMKAK"
FT   gene            complement(693878..696313)
FT                   /gene="FST10"
FT                   /locus_tag="PICST_68074"
FT   mRNA            complement(693878..696313)
FT                   /gene="FST10"
FT                   /locus_tag="PICST_68074"
FT                   /product="putative zinc-finger protein"
FT   CDS_pept        complement(694100..696124)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="FST10"
FT                   /locus_tag="PICST_68074"
FT                   /product="putative zinc-finger protein"
FT                   /note="Fungal specific
transcription factor; go_function FT DNA binding; transcription factor activity; zinc ion FT binding; go_process transcription; regulation of FT transcription, DNA-dependent" FT /db_xref="EnsemblGenomes-Gn:PICST_68074" FT /db_xref="EnsemblGenomes-Tr:ABN67806" FT /db_xref="GOA:A3LXH1" FT /db_xref="InterPro:IPR001138" FT /db_xref="InterPro:IPR007219" FT /db_xref="InterPro:IPR036864" FT /db_xref="UniProtKB/TrEMBL:A3LXH1" FT /protein_id="ABN67806.2" FT /translation="MAGNVEKPKPLKVFGRTHYACTRCKLSKIKCSGEKPACSNCKSVN FT KEFACVYPAKDRKIVIMESDLNKLHDRVEHLETLLRQSGQSDPTDSSSQSELQQQTNPS FT HQYLYSEQSPSSLSVVEKPESYGSILFEDVFAPEFEDTSLSSNMLRVCEQQLPDRKYAM FT QLLEKVYATYSSEFYLIDIAEMHDLFDDVYSLFRRSAANNGQYDFESIANSKSGMNQTS FT FSYLFAVLAFGEQLLNVQTPEGKYPGIKHYLLAERLFRLTKEQIDFTFIQCALLLGLYA FT ANLSRYNTVYNYLGVAARSAVAQGYHRQKEIPKSIQSDQEIFAFRRHAEKAKLLWWSVF FT VIDTTWATKTVHFQYTDTDVDLPCENTFPLSEEFDPNILEVNVHLTKYIAKFVRLIYGP FT NIRTFSINYINTNQFNQKLLLKNIIKSSRDLVNDFETPLLGQFKDSNIIERGRRNLANL FT FLRYHQLIILITKPSLSLVFDASAPSVVENYEDLFSTISKGLFTSCATIDLIANLFVKH FT KIFVLGFWDSQHLFAAILYIIIACLDGKYYPQLNIGIALLRFMAQRTNINAKKCFDKLV FT EINKLLMDAPEVKLRLNLYASVADFITDDKDAPYNPLPQSSLNTTSSTGDFKFTPVLPL FT PYLPEPYRIITYGTNKKRYSESSRSAIFTLINEIQGWDD" FT gene <700611..>701750 FT /gene="ECM33" FT /locus_tag="PICST_61942" FT mRNA <700611..>701750 FT /gene="ECM33" FT /locus_tag="PICST_61942" FT /product="3-prime end of ExtraCellular Mutant protein" FT /note="Has EST support" FT CDS_pept <700611..>701750 FT /codon_start=1 FT /transl_table=12 FT /gene="ECM33" FT /locus_tag="PICST_61942" FT /product="3-prime end of ExtraCellular Mutant protein" FT /note="3-prime end of ExtraCellular Mutant protein (PST1)" FT /db_xref="EnsemblGenomes-Gn:PICST_61942" FT /db_xref="EnsemblGenomes-Tr:ABN67457" FT /db_xref="InterPro:IPR036941" FT /db_xref="UniProtKB/TrEMBL:A3LXH2" FT /protein_id="ABN67457.1" FT /translation="STLTTATPSVASGCSFSSFVATASAQVQQVAACATAVGDITIRGD FT SFGSIELTGLEQVFGSLKIQNTTLATTINAPTLQLISEDFELSGLTILNTLNLAQLNTV FT GSLNWVTLPALESTGLTQGITAADSVVISDTGLTALTGINVVELQTFDVNNNQDINTID FT SALQSVTSLLSISYNAESVDVVLDELTSAKNVVFQSINSLSVGNLTTINGSLSVSQSSI FT DAIEFKDLTSISNSLTINKNSELESLDFPKLTSIGGALEISDNDKLKSFDGFPELKTIG FT GSVDINGTFDNGTFESLSRVAGGFTLKSDGDISCEEFNKLNSDGDIKGNKFFCANAAGA FT SSSSSSSKKGSSTDSSDSTETASETETSSTKASDASVHSG" FT gene complement(<702164..>703048) FT /gene="LAB2" FT /locus_tag="PICST_62311" FT mRNA complement(<702164..>703048) FT /gene="LAB2" FT /locus_tag="PICST_62311" FT /product="Lipoyltransferase (LIP2)" FT CDS_pept complement(702164..703048) FT /codon_start=1 FT /transl_table=12 FT /gene="LAB2" FT /locus_tag="PICST_62311" FT /product="Lipoyltransferase (LIP2)" FT /note="lipoate biosynthesis protein; go_function catalytic FT activity; go_process protein modification" FT /db_xref="EnsemblGenomes-Gn:PICST_62311" FT /db_xref="EnsemblGenomes-Tr:ABN67807" FT /db_xref="GOA:A3LXH3" FT /db_xref="InterPro:IPR000544" FT /db_xref="InterPro:IPR004143" FT /db_xref="InterPro:IPR020605" FT /db_xref="UniProtKB/TrEMBL:A3LXH3" FT /protein_id="ABN67807.2" FT /translation="MSSFIYRTFVRHNSTACVTKFVPIVENYKTLRHIHFPGITSFEKG FT QKIQEMMVNANLDFKKMESKIRRQQRDVAEQGYKLNDYEEELLIKILQMKPLPTLLTFE FT FDNVYTGGKKMKQDPLMAQKIAQYESTGCKYHQLERGGQVTWHGNGQLVAYTILDLKSF FT KNLTVRCFVDSVLLKSVQNLLQKNYSLKSYKNENPGVWMSESNYKIASVGTNIQRAITS FT YGIGLNVDPDLKYLNSFEMCGLPQTTATSIKKLRPDVEVSIKEVGEQYAKELAKLLNIT FT TVEHMSGEDLEIE" FT gene <703925..>705628 FT /locus_tag="PICST_62745" FT mRNA join(<703925..704062,704102..704524,704606..>705628) FT /locus_tag="PICST_62745" FT /product="predicted protein" FT CDS_pept join(<703925..704062,704102..704524,704606..705628) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_62745" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_62745" FT /db_xref="EnsemblGenomes-Tr:ABN67458" FT /db_xref="InterPro:IPR003114" FT /db_xref="UniProtKB/TrEMBL:A3LXH4" FT /protein_id="ABN67458.2" FT /translation="EDDPVVQTAEFKFLYRLYVPNKYLIRNNKMSKKNLLNHLPLIIPS FT AISSRTSNDYAGLNFQVHLFLSSIMVNYISSWYLTKLNTDDMLFLQSVYQLLSDLVRDI FT SRRVNAVLKDEVSIVGVIDDVASILNKHISDLVAHDSQYELEILRTFQNRANSTNVFDE FT DPSDDVETVIDRYLASNHLIFRQNKSAFDDTQLTEPPDDPRQLEYFRIITHNILEATFE FT NTTEDYAINPLSSKIGTKLIVSLVSDLIFIKIFDKLSTPDFILDTVGDGIVSAIEKYLD FT SKSSSISKPVTTSKSVTISSRAQVILSSVYNRVSRIILGVSVSKNTGDTPDSNDVEPDI FT FGNSVFQLFDTITNFSSRKPLLTGILVFCKDLLQINSSVAAKVNSICTGYISKKILSSN FT FIGDGSLSGIISDLRVNIFEKKDDKKEELEKDRVTVDQLTEKIFNLIRDKIPGLLPSFT FT RVTPFFNYFEETDEDLKEAIRRMLVIFNYENGSDNIELHETCKLNKLLMINLIDCVIRT FT LYPELVQNTI" FT gene 705906..706974 FT /locus_tag="PICST_90569" FT mRNA 705906..706974 FT /locus_tag="PICST_90569" FT /product="predicted protein" FT CDS_pept 705916..706878 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_90569" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_90569" FT /db_xref="EnsemblGenomes-Tr:ABN67459" FT /db_xref="GOA:A3LXH5" FT /db_xref="InterPro:IPR007715" FT /db_xref="InterPro:IPR027540" FT /db_xref="UniProtKB/Swiss-Prot:A3LXH5" FT /protein_id="ABN67459.2" FT /translation="MFARSALGRSDQLVTALNSQKRQFVLTAATTALGSLLFSEDNRLA FT SQMEKGLLHNKNAENSASIPNTANKFFSRPEAEYPGHVPLYTFEKMLMFLGSSVGAYTH FT PERNEFIVALGESTAITPVLRRLQHQMLSDPVGRQILRERPRMTSTSLDLEHLRELPDN FT TIGKTYVKWLDKEGVSPDTRVEVKYIDNEELAYIYQRYRECHDFYHAITGLPIIIEGEI FT SVKVFEYMNIGIPMSGLGALFAPLRLKKSQKERLYNIYYPWAFKSGLNSKPLINVYWEN FT ILEEDIDEFRKTMGIEQPPDLRNLRKEYFKKLKEAKKIV" FT gene <707461..>708344 FT /locus_tag="PICST_32818" FT mRNA join(<707461..707496,707718..>708344) FT /locus_tag="PICST_32818" FT /product="predicted protein" FT CDS_pept join(707461..707496,707718..708344) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32818" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32818" FT /db_xref="EnsemblGenomes-Tr:ABN67460" FT /db_xref="GOA:A3LXH6" FT /db_xref="InterPro:IPR025187" FT /db_xref="UniProtKB/TrEMBL:A3LXH6" FT /protein_id="ABN67460.2" FT /translation="MSQFLYQYFLKRTNLDHVFPVGPEEDPYFEEIPPEELHFYQRKGA FT KRKRKLPSVIPKHDLDILNSVKRKAYRLDLQLSICGLRLGWAGIIGLIPWIGDVISLMF FT ALQILHAAQRIEGGLPPSLQSKMIANIALDFGLGLIPLLGDFCNILYKCNSRNFILLEK FT YLVQKHGGIPVKAHSAEKSKKASDFPNDGANHKGVSNVPNSAPNGSEKNQHSVQNSV" FT gene complement(<708538..>708858) FT /locus_tag="PICST_48852" FT mRNA complement(<708538..>708858) FT /locus_tag="PICST_48852" FT /product="predicted protein" FT CDS_pept complement(708538..>708858) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_48852" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_48852" FT /db_xref="EnsemblGenomes-Tr:ABN67808" FT /db_xref="GOA:A3LXH7" FT /db_xref="InterPro:IPR034455" FT /db_xref="UniProtKB/TrEMBL:A3LXH7" FT /protein_id="ABN67808.2" FT /translation="SEDDPDPLELRKLALSYDYLIYKINDHVSTMADTTYQSILSKQKL FT IENNYFEDQLHLQDELDHVETLLDNCTQLELEFMKLDQLKMFIDDFKSRLDVLELEYSN FT LE" FT gene 709462..711900 FT /locus_tag="PICST_73005" FT mRNA join(709462..709568,710099..711900) FT /locus_tag="PICST_73005" FT /product="predicted protein" FT CDS_pept join(709508..709568,710099..711807) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_73005" FT /product="predicted protein" FT /note="go_function protein transporter activity; FT go_component clathrin coat of trans-Golgi network vesicle; FT Golgi stack; go_process intracellular protein transport; FT protein complex assembly; intra-Golgi transport" FT /db_xref="EnsemblGenomes-Gn:PICST_73005" FT /db_xref="EnsemblGenomes-Tr:ABN67461" FT /db_xref="GOA:A3LXH8" FT /db_xref="InterPro:IPR002014" FT /db_xref="InterPro:IPR004152" FT /db_xref="InterPro:IPR008152" FT /db_xref="InterPro:IPR008153" FT /db_xref="InterPro:IPR008942" FT /db_xref="InterPro:IPR013041" FT /db_xref="InterPro:IPR038425" FT /db_xref="UniProtKB/TrEMBL:A3LXH8" FT /protein_id="ABN67461.2" FT /translation="MSSSGSYSLQSINPKLLRRIYRACRPSNSEPNLALNLEICDYVNA FT KQGSIPREAAIAIVKLISQRDAQTSELAISLLDNLVKNCGYPFHLQISRKEFLNELVKR FT FPERPPIRYTRVQRLILAQIEEWYQTICRTSKYKDDFGYIKDMHRLLSNKGYIFPEVKV FT EDAAVLNPSDNLKSLDDIQKEEAVVHSAKLQEMIRRGRPQDLQEANKLMKIMAGFKDDN FT VAENKKQLTDDVARLRRKVEILAEMLNTISSSNSKIEDSNEAIVELYSSVKSSQPIVTK FT IIENDNGDEEYVQELLGLNDNINLVINKFQLLKNGKLDEASQIKVSSGSGAGSNAAEVN FT LIDFDDDDTPVGSNQAEDQGYNDLLSDLSNLAFTSNDASKSNNSSSNTANINLFGAGGS FT IALGDLSNNSTPAPTLQHPQPTTNASGNAGNSLDLLGDLNSPSQQLQSNTSAQLDPFGL FT NFPSSTPSQVQNQLGQFSGSTIAISSSSVLKVEVSVAPNSSNQFFQGRALFSNVQAQTI FT SNFKFLIAVPKSCKLDLRPQTGDTIYGFTNNSISQDFTIENSLDKQLKIKWKAEYTIGG FT ETKDETGVSVLNN" FT gene complement(712062..713163) FT /locus_tag="PICST_84683" FT mRNA complement(712062..713163) FT /locus_tag="PICST_84683" FT /product="hypothetical protein" FT CDS_pept complement(712214..713149) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_84683" FT /product="hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:PICST_84683" FT /db_xref="EnsemblGenomes-Tr:ABN67809" FT /db_xref="InterPro:IPR000782" FT /db_xref="InterPro:IPR036378" FT /db_xref="InterPro:IPR040200" FT /db_xref="UniProtKB/TrEMBL:A3LXH9" FT /protein_id="ABN67809.2" FT /translation="MKLNAVFSLASLVAVVASKNVVKPEEFFNIALENGAPQKRDAKNV FT VSLEDLKIALENESPKKREAKNVINLDDLKIALEHETIQKREPKNVINLNDFKIALEET FT KSTKSKRKYVFDLASFQQAVSKEGQDKREDVQLFFKIDLEDSKQNILQSVLPLIKDISI FT MSGYIRDNEQISAKTELTNETMIIIAPSNDAISNKLEGYKPWEFPRPIVDSDDETVEKI FT LKYNLNSFLSHHIVVNFEENLQIENETRTILTKLMNGDSIRIKQDQVTDEFAVQLESKK FT GKTQNWIRVESVKQVDNGFIFVIDETLVKP" FT gene complement(<713623..714397) FT /locus_tag="PICST_73482" FT mRNA complement(<713623..714397) FT /locus_tag="PICST_73482" FT /product="predicted protein" FT CDS_pept complement(713882..714397) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_73482" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_73482" FT /db_xref="EnsemblGenomes-Tr:ABN67810" FT /db_xref="GOA:A3LXI0" FT /db_xref="InterPro:IPR013251" FT /db_xref="UniProtKB/TrEMBL:A3LXI0" FT /protein_id="ABN67810.2" FT /translation="MSHPYNSLANCIGSLRESVNLLDDSLKTLVDTTSDIPRVRNVILT FT RRVFGLIPESDLNNAKQSFKNEVEPQLDILMVKIDRSLQRLHRRQTNLQNKRDLQAVRL FT SGASKRDSVIDLPLNRISKDVDELKLTRLKFLHNKKERLKYSLSRLNLQEQRTRLSFPP FT LPHPSNEQ" FT gene <715416..>716609 FT /locus_tag="PICST_11073" FT mRNA <715416..>716609 FT /locus_tag="PICST_11073" FT /product="predicted protein" FT CDS_pept <715416..>716609 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_11073" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_11073" FT /db_xref="EnsemblGenomes-Tr:ABN67462" FT /db_xref="InterPro:IPR000253" FT /db_xref="InterPro:IPR008984" FT /db_xref="UniProtKB/TrEMBL:A3LXI1" FT /protein_id="ABN67462.2" FT /translation="VVGRKRSNSQSQVIAMPKAASSSPSASSTSSPSSSSLARQRENPR FT KRTSVQYYVTLLPLNDTFTKKHLPVSTFPETTKLGRPTGTKHKPDVTNGYFDSRVLSRN FT HAQIYIDPSNGKLMLQDLGSSNGTYLNELRLTHEPVEIKMGDIVCLGFNVQAESTHKQI FT SLKIDNISVIPNSTSGLSFNTNSKNDMSSNLFLNRSEALDTPEFKHLSFIEDIYRQMSN FT PETSNNTKSSSEDMTFDNALFGDINPNLEDNLLGLYSATNSGIYNNSQITNTTTLESIV FT NILVSSSVRIKQQNNSLISLEHFFTNYHSRLEEINSQYLESSFKKSLLTIQNDLKKEKI FT GHQKVKEKFKLLEDESSKKLETLQKRLKATDKEKDNLNKMIQEIKDKKEELKLEVEKE" FT gene 717779..718595 FT /locus_tag="PICST_68080" FT mRNA 717779..718595 FT /locus_tag="PICST_68080" FT /product="predicted protein" FT CDS_pept 717801..718508 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_68080" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_68080" FT /db_xref="EnsemblGenomes-Tr:ABN67463" FT /db_xref="UniProtKB/TrEMBL:A3LXI2" FT /protein_id="ABN67463.2" FT /translation="MEGVLALLRDPSRLSYLPELMKIENNQNDYFKNVTDQEMNTLELF FT CFGTFEDYFKYKSSYLDIPSDRELLLKLLRLTVISVSNDYEKFVLNIEQLLENKEYGLA FT GGLELLKLSDNSGDIENELLFEEVLISMVDDGILSAKVDDENRTIHIVKAHVLRDSYSP FT ALHSLLVLTEQDVAKRSVAIAAETLSEWYSTKLVPLRQEYEVIEVDDITLVVPNEELDC FT TNTRKRKTPDQTT" FT gene complement(718717..719421) FT /gene="SDH4" FT /locus_tag="PICST_90476" FT mRNA complement(718717..719421) FT /gene="SDH4" FT /locus_tag="PICST_90476" FT /product="succinate dehydrogenase membrane anchor subunit" FT CDS_pept complement(718920..719408) FT /codon_start=1 FT /transl_table=12 FT /gene="SDH4" FT /locus_tag="PICST_90476" FT /product="succinate dehydrogenase membrane anchor subunit" FT /note="go_function heme binding; go_component mitochondrial FT membrane; integral to membrane; go_process tricarboxylic FT acid cycle; electron transport" FT /db_xref="EnsemblGenomes-Gn:PICST_90476" FT /db_xref="EnsemblGenomes-Tr:ABN67811" FT /db_xref="GOA:A3LXI3" FT /db_xref="InterPro:IPR007992" FT /db_xref="InterPro:IPR034804" FT /db_xref="UniProtKB/TrEMBL:A3LXI3" FT /protein_id="ABN67811.2" FT /translation="MLSLTSRIGLSSSRTILSSQTAALFRPILIRGIKTIPQPPGFIVG FT TVNDAYVPPPPHKLEGSLHWTSERLVAIGMVPLALAPFITGTSSVIDSTFSALLLYHCY FT AGFQSCIIDYIPRRVYGPLHNYAMYLLTFGTGVAGYGLYQIESKEDGVAGIISKVWKA" FT gene complement(<719987..>721321) FT /locus_tag="PICST_62527" FT mRNA complement(join(<719987..720549,720562..>721321)) FT /locus_tag="PICST_62527" FT /product="predicted protein" FT CDS_pept complement(join(719987..720549,720562..>721321)) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_62527" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_62527" FT /db_xref="EnsemblGenomes-Tr:ABN67812" FT /db_xref="GOA:A3LXI4" FT /db_xref="UniProtKB/TrEMBL:A3LXI4" FT /protein_id="ABN67812.2" FT /translation="RPIRHNVVIQTRNLNLSPSALGAVKNYGFVINLIAGAYIGGLLVS FT FGSLYFMYHDANERQNIPFELSFKDQITAVKAINKDDVLKSPRYAVKHYRRLLIEMAKK FT ENPNLEFDEESDENRYEVPILDSKTLVYKKSSSFSNFYIDIVMRYARALLAKGQLEASV FT YVLRKIIDDDEIFYKLGDAERLSQCCRLLTRVFPDPQVKVAYLQRSIDMLTLTFSSMNL FT NEDFLLQENSKLTDELLNCLNDLAFTMAKISISKSDKKDLLTKSLNIYLANIKKLTEIK FT DKSERGELVQTVYPLFNCDENNVDISIYEIKAHISEIMWAKGFKKNAVSWSEDIVEHLY FT FDHNTTARVSILLYNVLNNLVNMYDGLKDVTSRRRCEKLIDELVVFNEDSQGWYDSVIN FT RFSKIIYNRGPLGIIEKPLLERFGSPKRLPEIEEFEEEDVE" FT gene <721672..>722745 FT /locus_tag="PICST_32827" FT mRNA <721672..>722745 FT /locus_tag="PICST_32827" FT /product="predicted protein" FT CDS_pept 721672..722745 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32827" FT /product="predicted protein" FT /note="go_function metal ion binding" FT /db_xref="EnsemblGenomes-Gn:PICST_32827" FT /db_xref="EnsemblGenomes-Tr:ABN67464" FT /db_xref="GOA:A3LXI5" FT /db_xref="InterPro:IPR001594" FT /db_xref="UniProtKB/TrEMBL:A3LXI5" FT /protein_id="ABN67464.2" FT /translation="MEVTSDVQTRKLPFVYRFITNWLVTDPNIIDKYELYDKENQPKKN FT YQASRHQNVPYIYLLGGRWRTIRRKPINVMSIIILIVPMVLFLVFDAKWTWRHVSPSLV FT ILFVYFWLLSMSFFITAAVADPGIVPRNIHLPSKITHSQIAQAPEEYFYTVTLPYHYGN FT DGVTVKYCSTCHIWRPPRTSHCSVCNCCIINHDHHCVFLNNCVGWRTYKYFLWFLLTSV FT TAAGLLIVISFVEVFHYRLVDNSSVHSFHQSIREHPVSLLLAIYGCLSVVYPLLLLVFH FT LFLTSNNITTREYLNYVHKHPSSDYINVYDSHSVIRNLYINWWGRASSVTLVKQSDTYQ FT PGDIRFERVQPLSSFNA" FT gene complement(<722905..>723771) FT /locus_tag="PICST_32828" FT mRNA complement(<722905..>723771) FT /locus_tag="PICST_32828" FT /product="predicted protein" FT CDS_pept complement(722905..723771) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32828" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32828" FT /db_xref="EnsemblGenomes-Tr:ABN67813" FT /db_xref="UniProtKB/TrEMBL:A3LXI6" FT /protein_id="ABN67813.2" FT /translation="MFSLEVALNKEPKEIEKVDATDAGNESDQGSNSESSSESEEDSSD FT DVANEFGIKRFSIPSKKIRKLVSPEMIDHKEKLKNLPNLDSSSKTITKYRLVLDEIFDS FT FPTFKKIILDDFNIDSIKEVTMLLVCYNKASKILFYRYLADSIKRILMSKTTSVIHNES FT GKPTLKEINQYIENNYNASEEIVNYFKGFRKNRKVLKTSDRKRNIERFRSKTDRKIDSF FT FRRIDPRYSIEYYLFVECSSEANIKALGRELNEQYQAYRKDPSKGAASMSQTYSKMGAD FT PDFTEPF" FT gene <724408..>725970 FT /locus_tag="PICST_32829" FT mRNA <724408..>725970 FT /locus_tag="PICST_32829" FT /product="predicted protein" FT CDS_pept 724408..725970 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32829" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32829" FT /db_xref="EnsemblGenomes-Tr:ABN67465" FT /db_xref="GOA:A3LXI7" FT /db_xref="InterPro:IPR038869" FT /db_xref="UniProtKB/TrEMBL:A3LXI7" FT /protein_id="ABN67465.2" FT /translation="MDVDRVSGRRENYDLNFEVHPLQEPQSIFSDSIVSPTSSRHVNRA FT ITTYTAFNAPRERAKKIFYLPRRIFQWIYSISLFLFVCLTIAFIAVTVIDVIVQTSGTS FT FSGIKMFIVIIVCVVFVVLALFLYFSRLYQYRVSMNDIPSKSVYIPFKDDMPDEVFESI FT DEKLRECVGEIKVKAGPLYNEDVINYPGVSPPEYVQNRNRLRTATGEGSRLPPESNYED FT VIRSLGDKFRHDGKVFTQVDLPADLSFREIVIYLKEIFMSEVDGISKERIPNLERIIKL FT YEKFRFGSELIKEGDLFEFMLEFDKLGQICQSNYEIKLPKSRRISRNRSSRTLDDILDN FT SIYHRGSIPQSDMAYYHSEALGESDEEREYDHFYANSDLSTPQFYHQAPEAEFYDHINE FT DTESSDSVIQSKDMLVTDMLDTSRTTGSASLLRRPSSFSSSRSVIRNKLSLAATESSFD FT RQRDQDRDSIRNSKRYSGYMSDSENDEDPNEFYRFRRQPRSSQPESILNKVTFSSSRSP FT EKK" FT gene complement(<726223..>726561) FT /locus_tag="PICST_61790" FT mRNA complement(<726223..>726561) FT /locus_tag="PICST_61790" FT /product="predicted protein" FT CDS_pept complement(726223..726561) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_61790" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_61790" FT /db_xref="EnsemblGenomes-Tr:ABN67814" FT /db_xref="GOA:A3LXI8" FT /db_xref="InterPro:IPR011856" FT /db_xref="InterPro:IPR018593" FT /db_xref="InterPro:IPR036167" FT /db_xref="UniProtKB/TrEMBL:A3LXI8" FT /protein_id="ABN67814.2" FT /translation="MSLGEQVHTNLVHYNLWTGVRLHDVDGDVTFVSGIPPSKLSSSDS FT KNQKEWVVPRSLIQNSSISVSEIANWFSAIARLDQQRPRRVTIGIVNDDGTIVYYFIHD FT GVVEPRQN" FT gene <727868..>728914 FT /locus_tag="PICST_32831" FT mRNA <727868..>728914 FT /locus_tag="PICST_32831" FT /product="hypothetical protein" FT CDS_pept 727868..728914 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32831" FT /product="hypothetical protein" FT /note="go_process oxygen transport" FT /db_xref="EnsemblGenomes-Gn:PICST_32831" FT /db_xref="EnsemblGenomes-Tr:ABN67466" FT /db_xref="GOA:A3LXI9" FT /db_xref="InterPro:IPR000971" FT /db_xref="InterPro:IPR009050" FT /db_xref="InterPro:IPR012292" FT /db_xref="InterPro:IPR023950" FT /db_xref="UniProtKB/TrEMBL:A3LXI9" FT /protein_id="ABN67466.2" FT /translation="MQSQDSVSIYSNKSTISRLSSLGRPKLFGEHFNRYTNNISKHTSH FT ESIQEEPTNYALQRIDTRKSVESLNHVLAHSQYRVSLHLTTSEISLIRYTWNKMLLDDP FT IEKQSTFRNIPGAYPVEQEIPKHKQPATSASSIASSLFCRQFYDNLLMSKPDLEEMFPS FT IRHQAVQFAGVMAMTISQLEDLTLMDEYLMKLGKRHSRVLGIGSDHFELMGEVLILTFQ FT ERFGTRFTQELAVLWIRLYLYLANTLLQFGVDPVMRLPSDLSVESEFNKIRTMSSVSSL FT MNERPSISTSVTSLASTETNTTQAGSVPHSQKSSPMKTMPGSMLKAERVHSLGMDSIRK FT KKKDCVIQ" FT gene 730034..734603 FT /gene="BNI4" FT /locus_tag="PICST_68082" FT mRNA 730034..734603 FT /gene="BNI4" FT /locus_tag="PICST_68082" FT /product="bud neck involved protein" FT /note="Has EST support" FT CDS_pept 730279..734493 FT /codon_start=1 FT /transl_table=12 FT /gene="BNI4" FT /locus_tag="PICST_68082" FT /product="bud neck involved protein" FT /note="bud neck involved extremely serine rich protein" FT /db_xref="EnsemblGenomes-Gn:PICST_68082" FT /db_xref="EnsemblGenomes-Tr:ABN67467" FT /db_xref="UniProtKB/TrEMBL:A3LXJ0" FT /protein_id="ABN67467.2" FT /translation="MSNDLEEFLLNDNFYSGPANPTKHINNFRNSIHIKNSISSKSLNK FT SLLSPSEKTGFMKSSPSMKALESILNDKSDSGYPSVKGAPPIIEEEPEESPALLSTERM FT PTNHFQASHASHGSNSGSSAVTANTVSSTVGTVSTVATSESLVHEKDHGVSLGSQYTLH FT NPSVHSIQSFETARSTQSQIVEPQSEAQSTTTSHKRYPSTIDESSGYTTDDTPVLAQPA FT TFHNIKTIYYNSPQLKIVEHKVEDDTLVEEESKAAAPSNATSTTIPPKRNKDIQTINIE FT DNSETSSTKKAKRESFLMASGFSKDDSERVDYRKTTHKNNISYPDNMSENFRTRDKNRH FT KNSRENFASNETTAKTTSETVTQGSIAPIVNESVKPLDSIKAQIPAAAPTDTHAVTANA FT PRFIQPVVNFAHKSLGAKKPQNFSTDDPASTTPSGEGVISSTNSTISTAPVTATSTSGT FT RSLLPPAPLSKPALHQLQPPPDFASKNRRIGPSKEFHESQSGQTQDESLQNNLNQTQSS FT LPQTRSLLDSPNPQETLASSPRRSPHIRSNSAFSLSLSKPFTSNKNPSSPALSSHRRSN FT TVGDIPSVAMSSTATLAAEPATSKKFSFKALFKSKSKNHSLNDPNINLNIATYSASNPK FT KLSSKSYSSPNISTIGEKTKPKPSVPTPSSSSGSLLNVFKKNKSVDNLTKLKAKQNKHE FT ASQASKKPKISAKSNKKSVEVEKPIGSGLSPDPEQTLKHGISNVNFIREVSDEDIDIPL FT IQEVQVQHPVAPAATIRIPEFVPEYSAAPVEDPISDEETAYDEHNLLLHPPTKLQNTRF FT GEEMKLVGEDYGSPFVVTYNSTQNSPEKRLEVPASGIHLHDSVRDEVSKSQQLLGEALF FT PKSLSAQEVESIVSLERSRSMRSIKSSKRNSFINYDGNNENVIHYNGPASSPAPSGIGR FT SNSILKNSNSRRNLANDINNSIDAAFVATVSATPPLAPQSTFAPDEVDLRDDTNITDLM FT EFTDFIDVENISFSTSPRQMDPESPAKSSTSPRRRVQVDSPVPQTLEVPCVQSTSPSPA FT PVINIQSPVITPPSSQEMDVTSEKFRASLSPSPEITEKKTLSEQFQHTSSIPRSPISLG FT EESEVEEHSSEEEEDDANDAFSYTNERGLLESSPILEAAYKVSNNSPIIDENGRSVFNN FT RPISMSFRGMKPPAFAGKIAQHDIRSSESHQSFTLSFAEDSSSNGVGGGFGSSSEEEDI FT EDEEEVEEVEEVEEEEKENVIPPPSNYNVAVSPPKINSKKFGNVSTTDNYNYNYANVLP FT PPPKNFILNKIPSISDSSANSSPKSFSSIISRKWRKNSPTSNAQSQFNSPRIPTKSDGV FT RFSSRIILYDTYNGEEYDRHPDTATCNQLTPLLAQQIKDELNTFKSQMEIHVDSRCHTH FT FF" FT gene complement(<734748..>734975) FT /locus_tag="PICST_62408" FT mRNA complement(<734748..>734975) FT /locus_tag="PICST_62408" FT /product="hypothetical protein" FT CDS_pept complement(734748..734975) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_62408" FT /product="hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:PICST_62408" FT /db_xref="EnsemblGenomes-Tr:ABN67815" FT /db_xref="UniProtKB/TrEMBL:A3LXJ1" FT /protein_id="ABN67815.2" FT /translation="MYPEFVNDKPPVVTLAEYDGASWASTTCLDFRNNQYVVVIMEEPE FT KVVAVIDSKDYAVLNRIFQSAHAQHAEQSK" FT gene 735237..736222 FT /gene="CSL4" FT /locus_tag="PICST_84802" FT mRNA 735237..736222 FT /gene="CSL4" FT /locus_tag="PICST_84802" FT /product="exosome 3'->5 exonuclease subunit ski4 (Csl4)" FT /note="Has EST support; Represses the replication of FT double-stranded RNA viruses, protecting the host from the FT otherwise lethal effects of the virus" FT CDS_pept 735263..736147 FT /codon_start=1 FT /transl_table=12 FT /gene="CSL4" FT /locus_tag="PICST_84802" FT /product="exosome 3'->5 exonuclease subunit ski4 (Csl4)" FT /note="Represses the replication of double-stranded RNA FT viruses, protecting the host from the otherwise lethal FT effects of the virus" FT /db_xref="EnsemblGenomes-Gn:PICST_84802" FT /db_xref="EnsemblGenomes-Tr:ABN67468" FT /db_xref="GOA:A3LXJ2" FT /db_xref="InterPro:IPR012340" FT /db_xref="InterPro:IPR019495" FT /db_xref="InterPro:IPR039771" FT /db_xref="UniProtKB/TrEMBL:A3LXJ2" FT /protein_id="ABN67468.1" FT /translation="MTDIKGKLVVPGQYITSAYKLDGSSQKQIERYIPGKGAIISQIEH FT EDKQIPVVVATILGRVIIREIERDLENDKAKTSSNYNNIKSHVVVVVPKSNSYIDYNIE FT VGSNILEDSNISINLPKENDVVLVKITKITQKQVYCEILSVEGHGNVLSDGGIGANGEL FT AHDSLPAGGGSQNLSNHQTIASSQATALGAQSNDIGENFKGIIRSQDIRSTDRDKVKVI FT DSYKPGDIVRALIISLGDGSNYYLSTARNDLGVIFAKSENGSGNLMYPIDWQNMMDVQS FT GLIEKRKCANPFA" FT gene complement(<736424..>737479) FT /locus_tag="PICST_32834" FT mRNA complement(join(<736424..737408,737442..>737479)) FT /locus_tag="PICST_32834" FT /product="predicted protein" FT CDS_pept complement(join(736424..737408,737442..737479)) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32834" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32834" FT /db_xref="EnsemblGenomes-Tr:ABN67816" FT /db_xref="GOA:A3LXJ3" FT /db_xref="InterPro:IPR001251" FT /db_xref="InterPro:IPR011074" FT /db_xref="InterPro:IPR036273" FT /db_xref="InterPro:IPR036865" FT /db_xref="UniProtKB/TrEMBL:A3LXJ3" FT /protein_id="ABN67816.2" FT /translation="MFSKLKKNDSSKSVYTPFQQPSDKSVIPTEPELSASQKEKYLTVF FT KHFSNPDIAIPVSEDNHKHKDTSQYKPLTESEKSWLTRECFLRYLRATKWDEQEAINRI FT ELTLAWRREFGIDHIFDTDNEVNKDLVSEENETGKEVILGYDNDSRPCLYLKPGRQNTK FT TSQRQVQHLVYMLERVIDYMPSGQDSLALLIDFKAHPVGTQGGKIPPIGIGRQVLHILQ FT THYPERLGRALLTNIPWLGWTFLKIIHPFIDPLTREKLVFDQPFVDYVPVGQLDKDFNG FT EVNFEYDHSKYWERMVEISQEKKKVYYDRFVLFGSKIGLSEVDLRGTHEELIHQIPSLD FT " FT gene <738956..>739399 FT /locus_tag="PICST_32835" FT mRNA <738956..>739399 FT /locus_tag="PICST_32835" FT /product="conserved hypothetical protein" FT CDS_pept 738956..739399 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32835" FT /product="conserved hypothetical protein" FT /note="go_function molecular function unknown" FT /db_xref="EnsemblGenomes-Gn:PICST_32835" FT /db_xref="EnsemblGenomes-Tr:ABN67469" FT /db_xref="InterPro:IPR001602" FT /db_xref="InterPro:IPR035917" FT /db_xref="UniProtKB/TrEMBL:A3LXJ4" FT /protein_id="ABN67469.1" FT /translation="MASWEQVRFTLTPRSKGTYLITDEVLGKLPQIKSYEVGILHLFLQ FT HTSAAISLNENCDPDVRVDMNHALDRVAPEGNYYIHADEGPDDMPGHVKSTVVGVSLSI FT PISNGRLATGTWQGIYLLEFRAYRHARRIVATINGQKKTSTPS" FT gene complement(<739572..>740636) FT /locus_tag="PICST_62870" FT mRNA complement(<739572..>740636) FT /locus_tag="PICST_62870" FT /product="conserved hypothetical protein" FT CDS_pept complement(739572..>740636) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_62870" FT /product="conserved hypothetical protein" FT /note="go_function DNA binding; go_process regulation of FT transcription, DNA-dependent" FT /db_xref="EnsemblGenomes-Gn:PICST_62870" FT /db_xref="EnsemblGenomes-Tr:ABN67817" FT /db_xref="GOA:A3LXJ5" FT /db_xref="InterPro:IPR001965" FT /db_xref="InterPro:IPR011011" FT /db_xref="InterPro:IPR013083" FT /db_xref="InterPro:IPR019786" FT /db_xref="InterPro:IPR019787" FT /db_xref="InterPro:IPR037869" FT /db_xref="UniProtKB/TrEMBL:A3LXJ5" FT /protein_id="ABN67817.2" FT /translation="EESFEELARQYKKFTNAPKFDLNSEELFCICRKPDNGELMVLCDG FT CDEWYHFKCMNLKKENSGLIAKFFCKFCQWKGTGFTLWKRKCRVQWCNEPARVDSNSKY FT CTDAHGKLFIKQLLVDREALIQDLKPEVVNDILTHVGDNYVKLKNLGSEFPELPEVTKL FT KDTGSNLSEFPDDTRTALTKVNGKLDSVNESIEQLQKRIDYLAKLKDKIKLANEKLAQT FT LFPDGKIPDSSKKSKKQTKSKKLDICLYDNSVVGSELASSFLSQLLDSQDLFVEFQESV FT GRRLKDELDDAEWYQNKICIQERRKCIRHNGWLNLVTDESARKMSELQTLLEGLELQKE FT TILRDYSTRVYESK" FT gene <741127..>743370 FT /gene="MGS1" FT /locus_tag="PICST_61628" FT mRNA <741127..>743370 FT /gene="MGS1" FT /locus_tag="PICST_61628" FT /product="DNA-dependent ATPase MGS1 (Maintenance of genome FT stability protein 1) DNA-directed DNA polymerase ATPase" FT /note="related to the helicase subunit of the Holliday FT junction resolvase" FT CDS_pept 741127..743370 FT /codon_start=1 FT /transl_table=12 FT /gene="MGS1" FT /locus_tag="PICST_61628" FT /product="DNA-dependent ATPase MGS1 (Maintenance of genome FT stability protein 1) DNA-directed DNA polymerase ATPase" FT /EC_number="2.7.7.7" FT /note="related to the helicase subunit of the Holliday FT junction resolvase; go_component nucleus; go_function ATP FT binding; nucleic acid binding; zinc ion binding; FT go_component nucleus; go_function ATP binding; nucleic acid FT binding; zinc ion binding" FT /db_xref="EnsemblGenomes-Gn:PICST_61628" FT /db_xref="EnsemblGenomes-Tr:ABN67470" FT /db_xref="GOA:A3LXJ6" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR003959" FT /db_xref="InterPro:IPR008921" FT /db_xref="InterPro:IPR021886" FT /db_xref="InterPro:IPR027417" FT /db_xref="InterPro:IPR032423" FT /db_xref="UniProtKB/TrEMBL:A3LXJ6" FT /protein_id="ABN67470.2" FT /translation="MDSTCPICGKQLSSHLLERHVNTCLDNQESKEVEEVEQPKDVQDL FT DEVVIVEDEIGEIRKRRHGSDAFAALGLKMDSSQKRQKLERSQKSKPTLTRILIEEKRL FT KSESRKTSDELKEQLEKLSSSKSYDESLISTPSDQPKVVPEPQEEPKEAKPPPLQSDIL FT TRAQELNKLKREASIPLAHRLRPKSLDDFFGQEKLLGQDGILRNIINADNIPSFILWGV FT PGVGKTSLARIIAHTTNCKFVELSGAESNAKRLKEVFLQAENEKHLTGRKTILFLDEIH FT RFNKAVQDLLLPVIEKGVLTVIGATTENPSFTLNNALLSRMHTFVMEQLTTAALIKILA FT RALYQVNKLRKHLYNLHYISLKRDSFKYIAELSMGDSRVALNLLEFVNAYLSTDKFSTK FT NGEEQPKKMGVINVSAESLKSILKSRDFHNMYDKQGESHYDTISAFHKSVRGSDADAAM FT FYLVKMLSGGEDPLFIIRRMIVMASEDIGLRDSSCLPFAIAAKEALEFVGMPEGEIILA FT HCAMKMARAPKSTKSYRALRTAQSLLREKPEITKLPIPMHLRNAPTKLMKELGYGDSYK FT YNPGYKNGLVKQTYFPEGMEDVHFLEETHLGVVEDSDTSPEEQARAQAQVVDYENFKKD FT RIKQLKLEYLNRVKATRQETFNKMMARYKKNEITTVPEVPQYIDTNSNGKKEQGKEKIS FT EQDSSSDTDYKDNFEKSYDEFLDPESQPEYFEGDDTGYHYDPEYPLIRDDYEI" FT gene <743748..>745220 FT /locus_tag="PICST_32838" FT mRNA <743748..>745220 FT /locus_tag="PICST_32838" FT /product="putative Nucleolar GTPase/ATPase" FT CDS_pept 743748..745220 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32838" FT /product="putative Nucleolar GTPase/ATPase" FT /db_xref="EnsemblGenomes-Gn:PICST_32838" FT /db_xref="EnsemblGenomes-Tr:ABN67471" FT /db_xref="UniProtKB/TrEMBL:A3LXJ7" FT /protein_id="ABN67471.2" FT /translation="MHRFSLKSSFSSATRLFSKDSQSCKTEFLDRFGLQFDESEGCFYA FT YKCHSRLPYGGLTNLNKIMELFEHGNPETQSAAPNANKLVQRFSEGVRVIQKSLDFASF FT GSYRRGESNRNSTADISNISTTEKSGISVPLNSGESLRSYRLDIAFPDISLWGDCKEVF FT EKYNSKFETKIIIAPTPSDSQCATASSTVVESHDSPTPVTSETKAEFALCEQVCPCESE FT STTDFTEPGATAEVEKNTLSEEVFHSDEASSAEDSFLDSESTASFIEQESAEAQNIVSS FT SVVTRSDESSQSEVSSTEEGNSSPSDYQPNTDSTEHEESAQVADLASPEETDQFQASLS FT SSCEESTCSEDLDRSYDFDCSDQDDGPIVGRELSIKFNTGRLFNDQEEYVDADTGVEYR FT FNQWGDPEELVPYGFKRLSSPSNTREPMRSVIRNLDRRPQTTAQYSTDPVSLEDLRKAN FT LRACKREASILNDCVSSSESIRADIALTSTSP" FT gene <745882..>746799 FT /locus_tag="PICST_48297" FT mRNA <745882..>746799 FT /locus_tag="PICST_48297" FT /product="hypothetical protein" FT CDS_pept <745882..746799 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_48297" FT /product="hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:PICST_48297" FT /db_xref="EnsemblGenomes-Tr:ABN67472" FT /db_xref="InterPro:IPR003738" FT /db_xref="InterPro:IPR036590" FT /db_xref="UniProtKB/TrEMBL:A3LXJ8" FT /protein_id="ABN67472.2" FT /translation="IRVQFDVSRVHNWYPSYNIAPTNAALMIYMVNTSDADYRYVLEPS FT KFGMIPYWAKPTDPEPTKNGVAYSREIQKHQSKYFNCRKETLAQSKSVWSSSRKNKRCV FT VPIQGYFEWLKSKTDKVPHYVHSKSSSIIYLAGLYSHNTNYTENTNVNGEYLSSFAIVT FT GAATKTDEYDISWLHSRKPIMLVPGSQEWFDWLDPNKTWNENLLDTSLNVEHNKAYKDI FT EGYPVSKEVGNPSNKSDNIIKREEKKPQKSITSFFSPTKRIKKEETQSEENSPAKKKIK FT TESNDTSRTKVKTDSSETIVKEEQ" FT gene 746951..747954 FT /gene="RSM24" FT /locus_tag="PICST_84865" FT mRNA 746951..747954 FT /gene="RSM24" FT /locus_tag="PICST_84865" FT /product="mitochondrial ribosome small subunit component" FT /note="Has EST support" FT CDS_pept 746988..747911 FT /codon_start=1 FT /transl_table=12 FT /gene="RSM24" FT /locus_tag="PICST_84865" FT /product="mitochondrial ribosome small subunit component" FT /db_xref="EnsemblGenomes-Gn:PICST_84865" FT /db_xref="EnsemblGenomes-Tr:ABN67473" FT /db_xref="GOA:A3LXJ9" FT /db_xref="InterPro:IPR017081" FT /db_xref="InterPro:IPR019349" FT /db_xref="InterPro:IPR039848" FT /db_xref="UniProtKB/TrEMBL:A3LXJ9" FT /protein_id="ABN67473.1" FT /translation="MKVLRTCLRVQAGRFYSKAVEAGSQPLFLNPHEWKGLPADQIFEL FT HNLRKEYLGDKYNPSDEERNAILSTITALAKNTPELDYTYEIDNFQERFMNNTPMNKRG FT LPQKRSNTYVIEKGETPHQKRRIEQLARVSAYEMPLLAKFRQSYEPKPASETPLKLTYN FT TDFSNESNKFNRQVTLNVNINDLGLSDKQQHKFILLAGNKYNFDTTTLRLKTDQFSEAA FT QNARWLVDTFNKLLAEAKDLSKEDFADIPLDRRHMKLLKTKYEPQFPEAWKRPQDAPVV FT KHNVVNRLVELVKEKKDDQYVSGLSP" FT gene <749704..>751551 FT /gene="NGG1" FT /locus_tag="PICST_36687" FT mRNA <749704..>751551 FT /gene="NGG1" FT /locus_tag="PICST_36687" FT /product="Histone acetyltransferase transcription factor" FT /note="involved in glucose repression of GAL4-regulated FT transcription" FT CDS_pept 749704..751551 FT /codon_start=1 FT /transl_table=12 FT /gene="NGG1" FT /locus_tag="PICST_36687" FT /product="Histone acetyltransferase transcription factor" FT /note="Histone acetyltransferase transcription factor FT involved in glucose repression of GAL4p-regulated FT transcription" FT /db_xref="EnsemblGenomes-Gn:PICST_36687" FT /db_xref="EnsemblGenomes-Tr:ABN67474" FT /db_xref="GOA:A3LXK0" FT /db_xref="InterPro:IPR019340" FT /db_xref="UniProtKB/TrEMBL:A3LXK0" FT /protein_id="ABN67474.2" FT /translation="MSSDKHSASTTLDDIINELKLTYDSSVGLLDGDSLRTIPNTNTLL FT NLSKLLNKLSRELNDVESDDDSILAKINSGLNKNEDEDEEDNEKEIEDENKKRSFSDAV FT SDQDDDDEDSVSLAKRRKVSTGTKIKSEQDEEQTKSSIDESEQVNSKDDPVPPEQSGSF FT TKENDTRLKNPKSEFVSSQTLSAAAIAELGLFSEDNNGLETQGKEYLKKKYGVASYPEN FT DLLNLLPGKIPNIDFSKNKPPSNQVQFTTFQSYIESFFRPFSSEDLELLNERNIIPPGF FT EKQEYDPDVSPFLIPKLGKFYADLWADEDSTLSSKLNSPAYQQAAPDSYKPKGTFDNLT FT DDTLFTEEISCGPLSSRLLSAILSNNDGSDDYEEKEEGSNEEDPSSNLNLDDEVATQLN FT SGEDYKLTAEANDFHSIEERLKRELKYIGIFMNLPLSKEDSKFKGKQNGRPKKAGISII FT DNDEWVKNKEDDEVCAEIRAHQKELREVVSRNRSNRKKLIPIIEEQIAYQEYCTILEDL FT DKQVDQAYMKRLKGKSKKKKVDVTTPQQQAVNSGLRALLEKRQRWINNIGNLFRPGEIM FT KRVPSESILVQEGTVEQETIDDDNTDAVSTAVDILADKS" FT gene <752161..>753945 FT /locus_tag="PICST_32842" FT mRNA <752161..>753945 FT /locus_tag="PICST_32842" FT /product="hypothetical leucine rich repeat protein" FT CDS_pept 752161..753945 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32842" FT /product="hypothetical leucine rich repeat protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32842" FT /db_xref="EnsemblGenomes-Tr:ABN67475" FT /db_xref="InterPro:IPR032675" FT /db_xref="UniProtKB/TrEMBL:A3LXK1" FT /protein_id="ABN67475.2" FT /translation="MSFSIINKVKSFPAEIQCQIIDYLAFDDLESLLRIQTPFQDHVVD FT LLFQYIVLNDCEPNDESIQWKWHTVGMLVDLFQRYPKMTFSEILGDLTSIYELHLARPG FT ILNRSTTVTIRCDCMEGEDAADLLKELCSHSYSINIEECSIESKSMVEAISPTLTGLGM FT FQERFKKGYDLSYELTELGTCSNLRQLELTEMPITSSQIRFLPRCLEKLTFELEVESFS FT SVHVLELPNCLIYLSMKLSQTSSSLKNVEINVECLSNLRILELKYFQIHSLSSWILPKG FT VVQLSVISCGIKDLSGLSNLCNLNKLVLQLNPKTEIDFTVLPSSIRRLWLYCESVPNEI FT CQLSSYIQLNLVVTSLGSDRDFSKIKNLNSLYLNGTSWATSTNFTSLGDLKLPSQLKEI FT SFNMFLGLQNIRDLQSGNCLSSLALNGKFGPMLVKSLLRGNVFPESLVDIRLFIELTSS FT DWVVDSRTYPKEYISFGAEGSQNLRFGNSLCLPNKLQRLAIVCDSLVAEGDLNLPSSIQ FT EVHLKVFAYIQMSKLVIPEAVRRISLPEVLPKADFHSYHFPTSLTDIYVPDESYKVTLR FT NTNNIKWLNVYPPVAKDI" FT gene complement(<753989..>755794) FT /gene="MNN22" FT /locus_tag="PICST_32843" FT mRNA complement(<753989..>755794) FT /gene="MNN22" FT /locus_tag="PICST_32843" FT /product="Golgi alpha-1,2-mannosyltransferase" FT CDS_pept complement(753989..755794) FT /codon_start=1 FT /transl_table=12 FT /gene="MNN22" FT /locus_tag="PICST_32843" FT /product="Golgi alpha-1,2-mannosyltransferase" FT /db_xref="EnsemblGenomes-Gn:PICST_32843" FT /db_xref="EnsemblGenomes-Tr:ABN67818" FT /db_xref="GOA:A3LXK2" FT /db_xref="InterPro:IPR022751" FT /db_xref="InterPro:IPR029044" FT /db_xref="UniProtKB/TrEMBL:A3LXK2" FT /protein_id="ABN67818.2" FT /translation="MFVHKRRKQLLYISSVLLVLLIFHLISVTLSKDGSVRFVHVPFGS FT GKDGGHVSAKFLDPELAHERQPKSSENFNVEAYPNSIMGQSTLGIIPVDQTHDFWYKVF FT NTFKKNKFIFYSNDKNMLHLKDKHEWAYPKEYSERALLDRASMSVHYLNQMKERHSAVL FT DTLPDHIPQSSYVKGSKGIVYVGGRFYSWLTYLSIKMLRENGSKLPVEVVMPTIEDYER FT EYEYCEVTLPQVGAKCIVIPTKLGLAVSNEWKFSNFQFKPMAILCSSFEHVLYLDSDNM FT VVMNPDHLFNSKVYKKHGLVLWSDYWNRTISPYFYQAANIPVDRNRRVRTQQLPLVTPL FT EPSEEVCFHELDGAIPNYSSESGQILFNKRTHTKAMLMSLYYNIYGREIFYNLFSLGAK FT GTGDKETFIAGAFAANVKYYQTKSQTRTFGYFSGRLHEMAMGQADPDVDYQLYNKQLST FT IKSARKSIRKDAFSQENFLNYLDEKYFGQEASIPLFAVHCNLDKIDPISYMNDHRYNDD FT NNRIRYRMFGNFQYKIDGEVIDFELKRWSIVMQALCIDQIQFNYFGSSDLDAVCEYISN FT TVEWLKTPNSTETAIYMSTLPELLV" FT gene complement(<756785..>758182) FT /gene="MAS1" FT /locus_tag="PICST_36688" FT mRNA complement(<756785..>758182) FT /gene="MAS1" FT /locus_tag="PICST_36688" FT /product="mitochondrial processing protease" FT CDS_pept complement(756785..758182) FT /codon_start=1 FT /transl_table=12 FT /gene="MAS1" FT /locus_tag="PICST_36688" FT /product="mitochondrial processing protease" FT /EC_number="3.4.24.64" FT /note="go_function metalloendopeptidase activity; FT go_process proteolysis and peptidolysis" FT /db_xref="EnsemblGenomes-Gn:PICST_36688" FT /db_xref="EnsemblGenomes-Tr:ABN67819" FT /db_xref="GOA:A3LXK3" FT /db_xref="InterPro:IPR001431" FT /db_xref="InterPro:IPR007863" FT /db_xref="InterPro:IPR011249" FT /db_xref="InterPro:IPR011765" FT /db_xref="UniProtKB/TrEMBL:A3LXK3" FT /protein_id="ABN67819.1" FT /translation="MLARASRFSRSTIAGRRLFTTASPVPTFQTSVLPNGLTVASESMP FT GTRTATVGVWINAGSRADNPASSGTAHFLEHLAFKGTNKRSQLNLELEIENIGSQINAY FT TSRENTVYYTKCLETDINQNIDILSDLLTKSKLEERAIENERHVILQESDEVDKMYDEV FT VFDHLHAVAFKSQDLGRTILGPRELIKTIQRDDLVNYITTNYKGDRMALIGVGCVNHED FT LVKQAQKYFGDIKKSEKPFKQSGGDLPVFYGDEIRIQDDSLPTTHVALAVEGVSWSAPD FT FFTASVANGIIGTWDRSIGVGSNSPSPLAVTAAIGGAGNTPIANSYMAYTTSYADTGLM FT GVYFTADKDANLKLFIDAVMKEWARLKSGDITVEEVERSKAQLKASLVLALDDSTAIAE FT DIGRQLVNTGFRLSPEEVFERVEAITKKDVIDWANYRLKDKPIALSAVGNVKTLPSHQY FT LTKGMSL" FT gene <760977..>762266 FT /gene="ARP7" FT /locus_tag="PICST_48682" FT mRNA <760977..>762266 FT /gene="ARP7" FT /locus_tag="PICST_48682" FT /product="general RNA polymerase II transcription factor" FT CDS_pept 760977..762266 FT /codon_start=1 FT /transl_table=12 FT /gene="ARP7" FT /locus_tag="PICST_48682" FT /product="general RNA polymerase II transcription factor" FT /note="general RNA polymerase II transcription factor FT (putative - by similarity); go_function structural FT constituent of cytoskeleton" FT /db_xref="EnsemblGenomes-Gn:PICST_48682" FT /db_xref="EnsemblGenomes-Tr:ABN67476" FT /db_xref="InterPro:IPR004000" FT /db_xref="UniProtKB/TrEMBL:A3LXK4" FT /protein_id="ABN67476.2" FT /translation="MAYTSPAVVIDNGSYTTKAGFASEDLPSLVFSTNYAVDNKTGSVI FT VGDDEICAQPENEVMTLLDNGLIYNFDNIVHNWQYVYDNIDNHNAIDAKEFPLVLTEQS FT WNTSKNRLTATQIAFETLEVPIFSLVKTPIAQLYRAGRSTGLVIDVGASVTSVTPILDG FT IIQHKSCFHSKYAGNFVNLHVLDYLQSQSKQVVNNLLPKQYHGGSDSFKTYYISHNVLQ FT DYKSLALNYQLRNYQLPNNTHIPVGDSTNFLESLFQPTLRKLPDVVIPEPVVDKPHTHG FT LTNLIFLCLKSLEASLLPPTNDSSSHNKLAKFTEIFKELLSNILITGGTSNGSGLPESI FT INDIRAMTQQYYSNYPFSYSIYPIRHSTGDSNETWDRQFGAWMGACNLASMLNDSNEQS FT NSVKIALDNWFVTKADYEELGEDLIVEKFK" FT gene complement(<762575..>764002) FT /gene="EHO3" FT /locus_tag="PICST_32846" FT mRNA complement(<762575..>764002) FT /gene="EHO3" FT /locus_tag="PICST_32846" FT /product="enoyl-CoA hydratase, mitochondrial" FT /note="Has EST support" FT CDS_pept complement(762575..764002) FT /codon_start=1 FT /transl_table=12 FT /gene="EHO3" FT /locus_tag="PICST_32846" FT /product="enoyl-CoA hydratase, mitochondrial" FT /EC_number="4.2.1.17" FT /note="go_function catalytic activity; go_process FT metabolism" FT /db_xref="EnsemblGenomes-Gn:PICST_32846" FT /db_xref="EnsemblGenomes-Tr:ABN67820" FT /db_xref="GOA:A3LXK5" FT /db_xref="InterPro:IPR018376" FT /db_xref="InterPro:IPR029045" FT /db_xref="InterPro:IPR032259" FT /db_xref="UniProtKB/TrEMBL:A3LXK5" FT /protein_id="ABN67820.2" FT /translation="MSPVDTNTGHAEDTVLFSNKNASRIVSLNRPRKLNSLNTEMMELM FT APRLKEYSKSSSNNIVILTSNSPKGLCAGGDVAECASQILKGNAEYASDFFQKEYNLNY FT VISTYPKPFVSLMDGITMGGGVGLSVHAPFRIATEKTKLAMPEMDIGFFPDVGTTFFLP FT KLDDKLGYYYALTGKILSGYEAYFSGFATHFVHSDKLPHLVNRLSNLQPPIINDNKTAS FT ADVITNTSEYFAQVNQAIEEFTENKPPKDYVFPYTAKELKVINEAFSQKSFEDVISYFK FT QEGSQFSKDTLHIFSQKPYSSLKIAFELLNHGSENSIKKQFELELISATNIMNIEPKEN FT DFVKGVSHKLIEKIKNPSHPHWNEVSTITDEYVQKILSPSPKTAALKQPLIDTHFGIDY FT KNYPFHNGLPNNQQVADYITGNDGSNRAYLPTPTEVVKHFVKQTNNKVGVEEKVELILS FT VHGSSSTYDNKYVSWKQ" FT gene complement(<764828..>766609) FT /gene="ATG21" FT /locus_tag="PICST_62474" FT mRNA complement(join(<764828..765310,765332..765845, FT 765879..765997,766031..766359,766396..>766609)) FT /gene="ATG21" FT /locus_tag="PICST_62474" FT /product="Autophagy-related protein 21" FT CDS_pept complement(join(764828..765310,765332..765845, FT 765879..765997,766031..766359,766396..766609)) FT /codon_start=1 FT /transl_table=12 FT /gene="ATG21" FT /locus_tag="PICST_62474" FT /product="Autophagy-related protein 21" FT /db_xref="EnsemblGenomes-Gn:PICST_62474" FT /db_xref="EnsemblGenomes-Tr:ABN67821" FT /db_xref="InterPro:IPR001680" FT /db_xref="InterPro:IPR015943" FT /db_xref="InterPro:IPR036322" FT /db_xref="UniProtKB/TrEMBL:A3LXK6" FT /protein_id="ABN67821.2" FT /translation="MTTINDLTFNQDYSCISISTSNYHRIFNCEPFGQFYSSSHGNIKK FT TLSNSIETNTVNANVDNNTRNSRASLETKCPTAYLKMLFSTSLTIIVPQSQNKLGNRLL FT KIYNLKQNLKICELSFPSNIINIKLNRKRLLVFLEIGHIYIYDLSCVRLIKILEVNSYL FT NETVSTANNLTDSGQTARLIGDLSADDNSFLVLPLSAINDQTDLFNHEHSSASPSRKSD FT STIIANSLDSLIEYTHKDTHHLHKKGSITLDDLKKDSNGWVIVYDTIELRPRLIFKAHN FT SSIGKITVSNDNSKIATASVKGTIIRVFSIDSNSFSSDKLKISQVTNLRRGHNLARINT FT LSFNADNSILGCGSESNTIHFFRLNEKAEATSPGNSDEGNTEDYEANDHDSESSEDLNE FT NLANLLVSNPAPPVDAEENHKQSKSYFSFSNLKSTTKLINNQYTKSIIKKLPYKDYFEN FT LIWEPPRRSFAYIKLPEYTPPHHYGGQHFTSESTSPENRVEIGFSNSLILLASYQTGIF FT YHYQLPKPVGSTRVGSPSEEEKREECYLINQYSLV" FT gene complement(766907..767915) FT /gene="SEC62" FT /locus_tag="PICST_73203" FT mRNA complement(766907..767915) FT /gene="SEC62" FT /locus_tag="PICST_73203" FT /product="subunit of ER protein-translocation complex" FT /note="Has EST support" FT CDS_pept complement(767058..767900) FT /codon_start=1 FT /transl_table=12 FT /gene="SEC62" FT /locus_tag="PICST_73203" FT /product="subunit of ER protein-translocation complex" FT /note="go_component integral to membrane; go_function FT protein transporter activity; go_process protein transport" FT /db_xref="EnsemblGenomes-Gn:PICST_73203" FT /db_xref="EnsemblGenomes-Tr:ABN67822" FT /db_xref="GOA:A3LXK7" FT /db_xref="InterPro:IPR004728" FT /db_xref="InterPro:IPR011553" FT /db_xref="UniProtKB/TrEMBL:A3LXK7" FT /protein_id="ABN67822.1" FT /translation="MPIQTTNERSPAALNLASYLYQNSIMKQRTGLLNNERDIEFFRYK FT RLSRALLSDDYKSKQQNVKNGLIPINNETDVQRVLVLLIQNQLILPVEKLHYAEIKAIK FT GWKPNRTKPTLKRMDKAHVDPDAYFAWIYTKPNPYILLYSILAVAGIFAVILFPLWPSF FT MKRGVWYLSMAALGLIGLFFATAIVRLIIYIISLVAFPKPFWLFPNLFEDCGVLESFQP FT LYGWEEPKKKKSKKKNGNEPVAEVKANGSAANGSVATGAKAGETSTQKRRVTLEEVDE" FT gene 769495..770419 FT /locus_tag="PICST_84532" FT mRNA 769495..770419 FT /locus_tag="PICST_84532" FT /product="predicted protein" FT CDS_pept 770156..770377 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_84532" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_84532" FT /db_xref="EnsemblGenomes-Tr:ABN67477" FT /db_xref="UniProtKB/TrEMBL:A3LXK8" FT /protein_id="ABN67477.2" FT /translation="MVIASNGHFLTQIPQPIHKFSEMKAILDAGVTSIHNFPVLTTGHD FT LRHSCSHFLGLHSSVLTMAILVDLSLIF" FT gene 772013..776677 FT /gene="CHD1" FT /locus_tag="PICST_90641" FT mRNA 772013..776677 FT /gene="CHD1" FT /locus_tag="PICST_90641" FT /product="transcriptional regulator" FT /note="Has EST support" FT CDS_pept 772383..776627 FT /codon_start=1 FT /transl_table=12 FT /gene="CHD1" FT /locus_tag="PICST_90641" FT /product="transcriptional regulator" FT /EC_number="3.6.1.3" FT /note="go_component chromatin; nucleus; go_function DNA FT binding; ATP binding; nucleic acid binding; helicase FT activity; chromatin binding; go_process chromatin assembly FT or disassembly" FT /db_xref="EnsemblGenomes-Gn:PICST_90641" FT /db_xref="EnsemblGenomes-Tr:ABN67478" FT /db_xref="GOA:A3LXK9" FT /db_xref="InterPro:IPR000330" FT /db_xref="InterPro:IPR000953" FT /db_xref="InterPro:IPR001650" FT /db_xref="InterPro:IPR014001" FT /db_xref="InterPro:IPR016197" FT /db_xref="InterPro:IPR023779" FT /db_xref="InterPro:IPR023780" FT /db_xref="InterPro:IPR025260" FT /db_xref="InterPro:IPR027417" FT /db_xref="InterPro:IPR038718" FT /db_xref="InterPro:IPR041150" FT /db_xref="UniProtKB/TrEMBL:A3LXK9" FT /protein_id="ABN67478.2" FT /translation="MVKPVLQEATLFPELYGLRRSHRERRAAIVESESEEEPIPKRRKK FT KAQRTEDYGDENEEDEEDDAEDSEDEDFYDKPLAKKKKKTIIQKKKKKSSVKSEPSVPA FT EIRFSSRNNKQVNYAVDYDDDDDLLESEPELDENDEDVNGDYYYYQQANEDENERGIDL FT VMDHKLNEENPEKTGDPKLDYLFRIKWTDQSHLHNTWEQWNDLKEYKGIRKVENYIKQF FT IIYDQEIRNDPLTTREDIEAMDIDRERKRDEQEEYTRVERIVDSERIETENGETKLQYY FT CKWRRLYYDECSWEDAEEIAKIAPDQVAKYQQRLKSKILPNLSANYPLSQRPRFEKLVK FT QPVFIKNGELRDFQLTGLNWMAFLWSRNENGILADEMGLGKTVQTVSFLSWLIYSRRQN FT GPHIVVVPLSTIPAWQETFEKWSPDVNCVYYLGNTQARKTIRDYEFYGSNNKPKFNILL FT TTYEYILKDRNELGAFKWQFLAVDEAHRLKNADSSLYESLKSFKVANRLLITGTPLQNN FT IKELAALVNFLMPGKFDIEQEIDFETPDEEQELYIKDLQKKIQPFILRRLKKDVEKSLP FT SKTERILRVELSDIQTEYYKNIITKNYSALNAGNKGAQISLLNVMSELKKASNHPYLFD FT GAENRVLAKVGSATRDNILRGMIMSSGKMVLLEQLLTRLKKEGHRVLIFSQMVRILDIL FT GDYLSIKGYQFQRLDGGIPSAQRRISIDHFNAPESKDFIFLLSTRAGGLGINLMTADTV FT IIFDSDWNPQADLQAMARAHRIGQKNHVSVYRFVSKDTVEEQILERARKKMILEYAIIS FT LGITDPNSKKSKTEPSTGELSQILKFGAGNMFKENDNQKKLEDLNLDDVLNHAEDHVTT FT PDLGESNLGSEEFLKQFEVTDYKADVEWDDIIPQEELAKLKDEEKKKADEIYLEEQIAM FT YSRRKAAVRKFENGSVAPSDDEDEDSSSGRQPRSKHAGDHQLSEKEIRGIYRSILRLGD FT LTGRWEQLVEEGSVTNKNPVLVKHAYNEIINTSKQLVKEEEIRRTKALADLERKAIEQR FT EKGAVENPTALWIAKKKEKKAVLFEYQGVKNINAELVLNRPVDMKMLDSMIPKENPTSF FT ELPRPPKSVSAWSCDWSEKDDAMLLVGVFKFGYGSWVQIRDDTVLGLQTKLFLEGSTNP FT KEANTVSTAPAGEAGSGAPVEEKAVKKVPGSVHLGRRVDYLFSLLRGDDDRANGGSTPS FT GVTIKKKVRRPKTETPVPAGKAKAAARSQSPETNLKKSKVRSIAPKASPSSPAGNSPKV FT DSGAHTHSSQHQPHHNNNSKDDDKDLEYDSMDEGYCKDVLKPVAKSLMRLHKGNQGFEK FT HEWANILKTELLTVGDFIGTVVKPLDGKPEGNKLQKHLWSYSRLYWPAKVPSKKIFDMY FT TRLKTKSGQNTK" FT gene 777504..779759 FT /gene="PAB1" FT /locus_tag="PICST_90501" FT mRNA 777504..779759 FT /gene="PAB1" FT /locus_tag="PICST_90501" FT /product="Polyadenylate-binding protein, cytoplasmic and FT nuclear (Poly(A)-binding protein) (PABP) (ARS consensus FT binding protein ACBP-67) (Polyadenylate tail-binding FT protein)" FT /note="Has EST support" FT CDS_pept 777604..779502 FT /codon_start=1 FT /transl_table=12 FT /gene="PAB1" FT /locus_tag="PICST_90501" FT /product="Polyadenylate-binding protein, cytoplasmic and FT nuclear (Poly(A)-binding protein) (PABP) (ARS consensus FT binding protein ACBP-67) (Polyadenylate tail-binding FT protein)" FT /note="go_function RNA binding" FT /db_xref="EnsemblGenomes-Gn:PICST_90501" FT /db_xref="EnsemblGenomes-Tr:ABN67479" FT /db_xref="GOA:A3LXL0" FT /db_xref="InterPro:IPR000504" FT /db_xref="InterPro:IPR002004" FT /db_xref="InterPro:IPR003954" FT /db_xref="InterPro:IPR006515" FT /db_xref="InterPro:IPR012677" FT /db_xref="InterPro:IPR035979" FT /db_xref="InterPro:IPR036053" FT /db_xref="UniProtKB/Swiss-Prot:A3LXL0" FT /protein_id="ABN67479.1" FT /translation="MSAADANQLQESLEKLNLDSAPAAAEEEAVAAESAPAGEEGADSA FT NVAESTASLYVGELNTSVNEATLFEIFSPIGQVSSIRVCRDAVSKKSLGYAYVNYHKME FT DGEKAIEELNYSPIEGRPCRIMWSQRDPSARRSGDGNIFIKNLHPAIDNKALHDTFSTF FT GKILSCKVATDDMGQSKCFGFVHYETAEAAEAAIENVNGMLLNDREVFVGKHISKKDRE FT SKFEEIKANFTNIYVKNIDLEYSEEDLKKLFTPYGAITSIYLEKDAEGKSKGFGFVNYE FT GHEAAVKAVEELNDKEINGQKIYVGRAQKKRERMEELKKQYENTRLEKLSKYQGVNLFI FT KNLDDTIDSEKLEEEFKPFGTITSARVMVDETGKSKGFGFVCFSSPEEATKAITEMNQR FT MFFGKPLYVALAQRKDVRRSQLEQQIQARNQMRMQNAAATGGIPGQFIPPMFYGQQGFF FT PPNGRGNAPFPGPNPQMIMRRGQPFGGPEQWPRPGPNGQPVPVYGIPPQAYSDFNGQNI FT RQQRGYYPNRNQNKGRQQRDLAAIIASAPPDQQKRILGEELYPKIVATGKAQEPEAAGK FT ITGMMLDLDNQEILALLEDDELFTNHFEDALTAFEEYKNSEAAAPVAPAAPAEPQA" FT gene <780801..783569 FT /gene="TPS2" FT /locus_tag="PICST_79118" FT mRNA <780801..783569 FT /gene="TPS2" FT /locus_tag="PICST_79118" FT /product="threalose-6-phosphate phosphatase" FT /note="Has EST support" FT CDS_pept 780801..783434 FT /codon_start=1 FT /transl_table=12 FT /gene="TPS2" FT /locus_tag="PICST_79118" FT /product="threalose-6-phosphate phosphatase" FT /EC_number="3.1.3.12" FT /note="Trehalose-phosphatase (Trehalose 6-phosphate FT phosphatase) (TPP); go_function FT alpha,alpha-trehalose-phosphate synthase (UDP-forming) FT activity; trehalose-phosphatase activity; go_process FT trehalose biosynthesis" FT /db_xref="EnsemblGenomes-Gn:PICST_79118" FT /db_xref="EnsemblGenomes-Tr:ABN67480" FT /db_xref="GOA:A3LXL1" FT /db_xref="InterPro:IPR001830" FT /db_xref="InterPro:IPR003337" FT /db_xref="InterPro:IPR006379" FT /db_xref="InterPro:IPR023214" FT /db_xref="InterPro:IPR036412" FT /db_xref="UniProtKB/TrEMBL:A3LXL1" FT /protein_id="ABN67480.2" FT /translation="METKFAYPSDSTIISPADYANNSKIKLSGRVLNVMTSLPSQIYKC FT HDPKTHEYIWDVEPVRGNSALYSSQYFLDQHTDWETHLIAWTGELINNTNLSANGENIQ FT DDPLYLDDKEKQELEKKLRKANNSDNIHPVWLLRRDQERWRKYAENVLWPVFHYIQGQP FT SNGKAEADAWHDYVKFNEVYCNKIKSVYKPGDIIWIHDYYLLLLPQLLRMEFPDAYIGL FT YVHAPFPSSEYFRCLSKRSQLLDGMLGADKIAFQSDSFQRHFLSCCSRLLGYEVTSNKI FT LAYGTAISVETLPIGIDTKKTENDAFEPGIEVKVKALKEIYTGKKIIVGRDRLDKVRGV FT VQKLQAFEMFLQMYPEWRDKVVLIQVSSPGYSHSANVEKKVTELVNRINSQFGNLNYTP FT VLHYQIRIEKDEYFALLRVADLALVTSVRDGMSTTSLEFVICQKENSSPLILSEFTGTA FT SVLRESILVNPWDSVGIARTINDCLSMSDDAKTDLEGRLYKQVISNTIQSWSSTFLSHL FT IEHVSETHTFHYTPALNRPLLYNSYAKSERRLFLFDYDGTLTPIVKDPAAAIPSSRLNQ FT ILDALSADPKNQIWVISGRDQAFLDKWLGSKNVGFSAEHGCFMKDIDSKEWVNLAESFD FT MSWQQKVDSVYRYYTERTPGSNIERKKVALTWHYRRADPELGRFQAAKCFQQLKDTVAK FT EYDVEIMEGKANIEVRPKFLNKGEIVRRLVLNPHGSKLDTHISSKGSADISVADLPDFI FT LCLGDDLTDEDMFRALKEIEDDWTSKEFPKNQFGSYGVYPVAVGPASKQTIATSHLNEP FT SQVLETLGLLAGQVSLFESAGTVDLDDRGHVANSPSSERSKTAIKEAALRRKVSLSKVI FT ESKEKI" FT gene 783898..785302 FT /gene="EHT1" FT /locus_tag="PICST_84806" FT mRNA 783898..785302 FT /gene="EHT1" FT /locus_tag="PICST_84806" FT /product="alcohol acyl transferase" FT /note="Has EST support" FT CDS_pept 783910..785193 FT /codon_start=1 FT /transl_table=12 FT /gene="EHT1" FT /locus_tag="PICST_84806" FT /product="alcohol acyl transferase" FT /db_xref="EnsemblGenomes-Gn:PICST_84806" FT /db_xref="EnsemblGenomes-Tr:ABN67481" FT /db_xref="GOA:A3LXL2" FT /db_xref="InterPro:IPR000073" FT /db_xref="InterPro:IPR000952" FT /db_xref="InterPro:IPR012020" FT /db_xref="InterPro:IPR029058" FT /db_xref="UniProtKB/TrEMBL:A3LXL2" FT /protein_id="ABN67481.2" FT /translation="MGILNWGFRANVKVHQSSKAYDLPLKSNKEDSISFTDFVRKEIPT FT LDESKKLWLHPLLFNGALQTLYYTSVDSIAKFPVYYGRETFEYKDQGTCSLDWAIPKPE FT SKEEFKKLHDETLPEDSPKLHPRTRFFSEQELAERKKHGQDVGSEKPIAVVLHGLCGGS FT HEPLIRNFVETINSHVNGWDVLVVNNRGCCRTKITSAKLFNALSTDDVKDVLHELKKRY FT PSRPIYAVGFSFGACILANFLGDPNHSEEDHNLIRAAALIGCPWDLVDSCYHLQQSYSG FT NYLFNPALTTYLQKLVKNNYKTLSSFSPDVFTDDLYREFMKPKTTVEFDNVYTCHSAGF FT SNAMDYYREASPVRRIGNIKTPTLILNSTDDPTISVRLPKLEVLENPYLAMIETDLGGH FT LSYAKRSGDFWSVELVEEFFTKFDKVVA" FT gene <785792..>787546 FT /gene="ROD1" FT /locus_tag="PICST_16322" FT mRNA join(<785792..787406,787443..>787546) FT /gene="ROD1" FT /locus_tag="PICST_16322" FT /product="protein for resistance to o-dinitrobenzene, FT calcium, and zinc" FT CDS_pept join(785792..787406,787443..>787546) FT /codon_start=1 FT /transl_table=12 FT /gene="ROD1" FT /locus_tag="PICST_16322" FT /product="protein for resistance to o-dinitrobenzene, FT calcium, and zinc" FT /note="conserved hypothetical protein with similarity to FT ROD1 Resistance to o-dinitrobenzene, calcium, and zinc" FT /db_xref="EnsemblGenomes-Gn:PICST_16322" FT /db_xref="EnsemblGenomes-Tr:ABN67482" FT /db_xref="InterPro:IPR011022" FT /db_xref="UniProtKB/TrEMBL:A3LXL3" FT /protein_id="ABN67482.2" FT /translation="MFSHPFNPALFDIKIKSPHKNLLLLRGNEFECENVLLEGTVKLSI FT SEDTHIKKVKLVFIGEYSVNFFERMNNGSILAEVNERLCVLKVDWYNLLTSPVGVINYG FT SYGDKFVRYNKIGSIKKSRSGSITGVDDGVLPGVLPGVDNGDSPALSRTRSGPAFGDAH FT HRNGEIVLPSSGVDGTPFVGSDQNSYLLPKGNYNLPFRVLLPSNISETVEGLSCGSLLY FT KIGCTIERGKFEKDVTIMKHIRIVRTLHPQNFNLTDSIDIYNTWPEKVDYNVNIAKKGL FT AIGSSIPINIIIVPIAKGLSIRKIHGCIVQHYHVMYEEGTSPEYEQLHGKQNMPIPDQE FT TLPDDKWTISTHYKVPENLARITQSCVLKNNIIQVRHRLRVCVQLNNKEGHTSELRANL FT PVYLYISANAGHVRGKHLVVEPELAQFINIPDQSDTLFKKHHEQNGSQSPMLSANEDGE FT EEPIDENDLDRLDAAPPLYQKHVFDKVYDMNSPKTPLEQFRNQSVSPSPLLSPIETRNN FT IDSCIDSDLPPRRNSDVPSSPQLDVNTLCRVPTYDEAVENDIDDPSIEEPAPLYPD" FT gene <788164..>789087 FT /gene="NIT1" FT /locus_tag="PICST_36697" FT mRNA <788164..>789087 FT /gene="NIT1" FT /locus_tag="PICST_36697" FT /product="nitrilase" FT CDS_pept 788164..789087 FT /codon_start=1 FT /transl_table=12 FT /gene="NIT1" FT /locus_tag="PICST_36697" FT /product="nitrilase" FT /EC_number="3.5.5.1" FT /note="go_function hydrolase activity, acting on FT carbon-nitrogen (but not peptide) bonds; go_process FT nitrogen compound metabolism" FT /db_xref="EnsemblGenomes-Gn:PICST_36697" FT /db_xref="EnsemblGenomes-Tr:ABN67483" FT /db_xref="GOA:A3LXL4" FT /db_xref="InterPro:IPR000132" FT /db_xref="InterPro:IPR003010" FT /db_xref="InterPro:IPR036526" FT /db_xref="UniProtKB/TrEMBL:A3LXL4" FT /protein_id="ABN67483.2" FT /translation="MSKHVVAALQIGADPKGTQATLGKILSYEAELKEKKVELVVIPEA FT TLGGYPKGSHFGTYLGYRLQAGREKFAEYFKGAIDVPGPEIEQLETLSASTGASIVIGV FT IERGGSSLYCTAVYIDSVKGYVGKHRKIMPTATERLIWGQGDGSTLITADFEGLGKVGG FT AICWENFMPLLRASFYAKGLNIYVAPTVDDRDGWTALIRTIGNEGRLFVVSAVAFLPTA FT QAAQLDMPGWPEGKNAIDGGSLIVNPYGDIIAGPLRGKEGLLTAEIDYDIIPQAKYDMD FT PVGHYSRGDIFQLTVDQTPRDAVVFK" FT gene <791645..>794542 FT /gene="AGE1" FT /locus_tag="PICST_48638" FT mRNA <791645..>794542 FT /gene="AGE1" FT /locus_tag="PICST_48638" FT /product="GTPase activating protein" FT CDS_pept 791645..794542 FT /codon_start=1 FT /transl_table=12 FT /gene="AGE1" FT /locus_tag="PICST_48638" FT /product="GTPase activating protein" FT /note="go_function DNA binding" FT /db_xref="EnsemblGenomes-Gn:PICST_48638" FT /db_xref="EnsemblGenomes-Tr:ABN67484" FT /db_xref="GOA:A3LXL5" FT /db_xref="InterPro:IPR001164" FT /db_xref="InterPro:IPR001849" FT /db_xref="InterPro:IPR011993" FT /db_xref="InterPro:IPR027267" FT /db_xref="InterPro:IPR037278" FT /db_xref="InterPro:IPR038508" FT /db_xref="UniProtKB/TrEMBL:A3LXL5" FT /protein_id="ABN67484.2" FT /translation="MSLSKLSFPYFECKDSQVSLLKLILTDEIDSTRYSIVLDNDKGVS FT SISKTLTQTSQVVPELVTYIENPTKTSPTPLLIRVNAEFNKLKLNVAIRPSANFLNQSL FT VIVKSSSNTDSIDELKHVLYEDDQSNFDISKIDYSNLPIDQNKQEPQRVVINDMFDNKR FT INDSKLNVSLWQLDSTTNEYTHILGFSVWINELAKVKHTSSRVKSPVPQENNLRGKHFK FT LADFKREFNFNIEDGPEFRKTLAKYEASLPQYKRAVSNLHEELKSLETSLKRLTSTKVK FT LIELVNSTEFQFNNLIDQFGFAKDFERIFRSIFDPFEKNLRFFLKNVCDQKLITKISQN FT LSYNSLEGSGSSSSNSNHHNELLQRKKVFESNSKEYYSWLNKYLSNEKDRPESKLLTKR FT KTFELSKFDYLNHLNTITNNQYSNQLLESLFKFINMTFDERNPKLLDFEKYNDAKMSQN FT LFGENYQIYLNVLLRFNSEKYQFRQMIEACSTNEELTNLIKFNSLNHTLPPTTQTSSQS FT STSIAQDNSVTDNIDEFIINRDNLDLVFTNNSLSSGEEAIPMSSTSTDDQNAEMSGILY FT TLGGQGKTGWHKEWVVLNRGQLTEYSDWRKGKTPINKPIEVALSSVKPITYEKRQNCFE FT IYTSLRTKHVFQALNEDERNKWIKALYNAGQVVDTSRLKENFGHNVDSSKRKNLSKLII FT DLSEKPIVPNQSLDRSISPISITSRAPPAEEKDYLNLVRSIPNSNNNICLDCGSMESVE FT WISINCLACFCVKCASCHRNIGSHITKIRSLKLDKFENESEMLLKYINNCQVNRFLEEN FT LDPKEKITPSVSDDARLSFIRNKYLLKKYKSIIPDITNQLIKAIQKIHVPEVLKTIICG FT ADINTNIQISIPSKQEYQVISLFEYSLRKFIELEDDGLILTSSKKLFVISELLILNGCK FT IDDIKDLRKDIGLTDAAIEYWKIRSLKLSGGLLTP" FT gene <794839..>796200 FT /gene="SPS1" FT /locus_tag="PICST_62297" FT mRNA join(<794839..795969,796027..>796200) FT /gene="SPS1" FT /locus_tag="PICST_62297" FT /product="Serine/threonine protein kinase" FT CDS_pept join(794839..795969,796027..796200) FT /codon_start=1 FT /transl_table=12 FT /gene="SPS1" FT /locus_tag="PICST_62297" FT /product="Serine/threonine protein kinase" FT /EC_number="2.7.1.-" FT /note="Sporulation-specific protein 1 Serine/threonine FT protein kinase dispensable for mitosis, involved in FT middle/late stage of meiosis, required for spore wall FT formation; go_function protein kinase activity; ATP FT binding; go_process protein amino acid phosphorylation" FT /db_xref="EnsemblGenomes-Gn:PICST_62297" FT /db_xref="EnsemblGenomes-Tr:ABN67485" FT /db_xref="GOA:A3LXL6" FT /db_xref="InterPro:IPR000719" FT /db_xref="InterPro:IPR011009" FT /db_xref="InterPro:IPR017441" FT /db_xref="UniProtKB/TrEMBL:A3LXL6" FT /protein_id="ABN67485.2" FT /translation="MFYQTHTPITIKQYDIFQCIGKGNFGDVYKAKCLTNAQDVAIKVV FT NLDESNEDVKAFTQEIQFLSRLRNPYITSYIETFVKDFNMFIVMEYCGGGSCSDLLRYA FT KKLPEDIVALIIRDVLKGLVYLHNEKKVHRDIKSANILLTEYGEVKLADFGVSGEITLT FT MKKRNTFVGTPFWMAPEVITRGKSSDEGGYNEKADIWSTGITTIELVTGSPPLAQYDPM FT KILFDIPKKRPPVLVGINFSDNIKDFVKYCLIKDPKARPRAKDLLHHQFVSRLTGRNSS FT VKAMLVKMIRDKNMQSLATGKVKKPKYPLERFVDSDSEEQSSAKVQWDFETFKSEFLRR FT RSSTTNKEVYKRYGDNYSSLQVSASSPLSPISPESAVGVKPGQLLFYCVEQVYHRGRTE FT ATQRTVEQLLVNLLEYEHELPGLCEAIVEELSHVL" FT gene 797092..800746 FT /locus_tag="PICST_68092" FT mRNA 797092..800746 FT /locus_tag="PICST_68092" FT /product="hypothetical protein" FT CDS_pept 797303..800617 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_68092" FT /product="hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:PICST_68092" FT /db_xref="EnsemblGenomes-Tr:ABN67486" FT /db_xref="GOA:A3LXL7" FT /db_xref="InterPro:IPR000818" FT /db_xref="UniProtKB/TrEMBL:A3LXL7" FT /protein_id="ABN67486.2" FT /translation="MSNIPHTPRSKASANGITTGGLPKTSVTPSFTFGLSFSPSFQFQS FT PIQSVSPDRFLTFSSHMRRHFNKRNPDLSSPESSSKDDSKTKSLSMNQFAEMFKTRRSS FT VDGSNDHGDTIHTTQEDDVDLWSSLDNDHSSNQHNLTSMTSIYEEDSQLVKEETIASKR FT ENNTFLTPNKLLLPRRIMASSERPASTPTKLQSAPHLISLRAIAEGDSGASPSKLEMTV FT SKSIKRRRLASISSIHDSPNNSIASQIDNTMESPLPRRKQSVDSVTDAGDKVWYPELDD FT ILIKCYLKYRDFRDNHAGYNASVLKHTSQNKVLSRMLLNKTSILRTSKQISSRLFRLSK FT LKKLDKNKSSKTPQSIPTFGSISNDEIEEFISTPLESLMSATMPATRMDSITTNEIIDH FT ELDLLLASPPDINTASDDNVTYSMVPSEFKLAFKNMSPNDDHVFSSLRNITSSSLSTNT FT FQARHGGDDTVHVIDKLRDDAVPIWVVSHDINLCLNSKDIVASTPISPFTNKSQGELLH FT PLNLLNGVFESYLKIDVKGNTENGVSMLAWNCFTKVYKTKSKQIILESVEPINAYWNLS FT DKLYNLQFPFLSNFFAGYLNFLTNGSHSKDDDALRIVQVLYKNTTSDVKFNHETSNIYA FT YLIHEVLFNKTSNASGTEINVIEIVKKDAKLESSPGISSKTSVDVDDDDNETVLADSSP FT YKSSPKSTQSQQSPIRRSSLNIDVSRANGTKGLDLHKGPISAPIYNAAIVQKFNQNLLK FT QSEHLKSNEAKDLHQFGQQSIDDLSTMHKYSELVDGQHIVKDVTSSRSNGTAVEFSASF FT LGDCNQSNGISHKSPHSAPNTVNMASSAQFAPMMGNNFNLAGVVPRVENPVMANFANPN FT PQFVPQGQQMMVNNFAQFNGLPPSVREQFTRQWFQQRQQQQQQQQPHQQQMHQPPSQQI FT EHLQQQQMMFNMNTINSAPASQTQFFIQNTPQMSHPQDQFQQVNLAELQVQVQAQAQAQ FT AQAQAQVKANLQPQMSQIQPQVQRAHSFNNVVPMGVVQRPGIQPALARSRSSASVAKDS FT NKENYKPKEIKFGPILEYDPSKDSKSIQQNRNLKQGNGIHRFPINTPLSIYKPKKK" FT gene 800969..805078 FT /gene="SIP3" FT /locus_tag="PICST_90087" FT mRNA join(800969..803559,803620..805078) FT /gene="SIP3" FT /locus_tag="PICST_90087" FT /product="Snf1p protein-interacting protein" FT /note="Has EST support" FT CDS_pept join(801211..803559,803620..804987) FT /codon_start=1 FT /transl_table=12 FT /gene="SIP3" FT /locus_tag="PICST_90087" FT /product="Snf1p protein-interacting protein" FT /note="interacts with Snf1p protein Putative GTPase FT activating protein" FT /db_xref="EnsemblGenomes-Gn:PICST_90087" FT /db_xref="EnsemblGenomes-Tr:ABN67487" FT /db_xref="GOA:A3LXL8" FT /db_xref="InterPro:IPR001849" FT /db_xref="InterPro:IPR011993" FT /db_xref="InterPro:IPR027267" FT /db_xref="InterPro:IPR031968" FT /db_xref="InterPro:IPR039463" FT /db_xref="InterPro:IPR042067" FT /db_xref="UniProtKB/TrEMBL:A3LXL8" FT /protein_id="ABN67487.2" FT /translation="MQSPLVVPSSTANGNSKNPAKQPTSSDGPEPSKTPKPTVNDGNKQ FT EQTSSQQTSRSGPLAAKPTRQFKLISVNFKEASLDSPSFRATINHLDTQVVNIEKWILA FT LSSSIRKIPSYIKEVQSFCNSFLEHLVPSFIQDGLIDQEYTVQSLNTTLSGLKKLWAIS FT LSSLNVNTYTIDNIRTVVSKNVAYYKELREKFDASQQKYDKYLEIYVSTSKTKDVAMAM FT EDAKQLHVVRKEYLHASLDLIIELSALGNHLDKVLVNLSSDLWKYKFSYITNDALDPFF FT KEQYSKIQKIQSWSDSYSVAIDKLQTDMQAARAHVEESSGIQFTPSSNPNDYSASMINS FT RTLNDIDERGVEKHGYLFMKTWNEKSNKPVWVRRWAFIKGGVFGMLILSSTQTFVQETD FT KMGILLCNVKYAPNEDRRFCFEVKTSNISIVFQAETLIDLKTWLKVFENEKNRILSSGE FT EDQNIFAIASGRYPPIVSEFASTINTVVDKEMTSTRIINSSGQIITSSHLSSHIEKNEK FT FFQKYVYSQIPQIRPPFMTETTKSSIIAYSLASATSLPTALTANIWGSVNWGLYYLHDA FT VVDHLPPSSISIPEAELIEKQLTHKDDSGSFYPVYYPHTLVAMDIQMRALFETAVEPGE FT YCLVSFRCIWSPNSKQELSGRCFITTHHIYFYMQALGFVALFKGYVGNLVSVDHNAQKS FT YDLLKIYSLDGVIKTKLFLDDGKLIKQKTVYLINNLASDKPKKLAEVLKDLERIEVQVK FT TEQDDQSQIKLIQTLAKNLSDSAKAEKVNFDGKLLKFQIDFRREYGFIGEKTYDLVPKA FT IFHALLGDNSVIFKDQTAFTTLECFIKKPWRVAENGNYYRSVNAPANFGNKQVIMRLDQ FT VIDNIHDNQYYTFTHKKSTFKFFMGSKFSITYKFVIVGVAGKQSKVYFYCKRDFQGYHP FT LNLIIDRISIQIANSQINTLDKRLKDVVMQVGNHGMIVKAIYLYGKLSQTTVQDEIEEV FT PVIYFGLFNSLKVVSKKVFHSGISFFIWFVSYLIMSGKYFLRSIRMNQFLTLITICLGL FT FNIFLLGKTSTAYWHSRMATQMAYEFVKKEPVMLQRAIYLKDIQDLLSDHTIFNNSSHP FT YLLDDSSRCLGAFKEKSFVYNLNEPTYWDESYGDEATMDVAKHLKNEFRTIGVKRHELL FT VQLSILRKMEEEIAKAEWKNWLMSEVQRCEFISANVIRKLDGSEREDIDAGVQSIQNYC FT NDCSAHLSAAELL" FT gene complement(805279..>806019) FT /locus_tag="PICST_78871" FT mRNA complement(805279..>806019) FT /locus_tag="PICST_78871" FT /product="predicted protein" FT CDS_pept complement(<805279..805620) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_78871" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_78871" FT /db_xref="EnsemblGenomes-Tr:ABN67823" FT /db_xref="InterPro:IPR007751" FT /db_xref="InterPro:IPR029058" FT /db_xref="UniProtKB/TrEMBL:A3LXL9" FT /protein_id="ABN67823.1" FT /translation="MISHSMGGLDSRYLISKLQKEDSPKPYKVVSLTTIATPHHGSECA FT DFVENLVGNSKILRSMCPEAIFELTTSYAKKFNDEVVDDPSVKYFSYGAKFDPRWFSLF FT NLTWHMLRYE" FT gene complement(<806332..>807735) FT /gene="COQ6" FT /locus_tag="PICST_32861" FT mRNA complement(<806332..>807735) FT /gene="COQ6" FT /locus_tag="PICST_32861" FT /product="COQ6 monooxygenase, coenzyme Q biosynthesis" FT CDS_pept complement(806332..807735) FT /codon_start=1 FT /transl_table=12 FT /gene="COQ6" FT /locus_tag="PICST_32861" FT /product="COQ6 monooxygenase, coenzyme Q biosynthesis" FT /EC_number="1.14.13.-" FT /note="go_function monooxygenase activity; go_process FT aromatic compound metabolism" FT /db_xref="EnsemblGenomes-Gn:PICST_32861" FT /db_xref="EnsemblGenomes-Tr:ABN67824" FT /db_xref="GOA:A3LXM0" FT /db_xref="InterPro:IPR000689" FT /db_xref="InterPro:IPR002938" FT /db_xref="InterPro:IPR010971" FT /db_xref="InterPro:IPR018168" FT /db_xref="InterPro:IPR036188" FT /db_xref="UniProtKB/TrEMBL:A3LXM0" FT /protein_id="ABN67824.2" FT /translation="MQDIVVIGGGPAGLSLLAALKSSPKTRHLSCTLIEGSSLQSVRDF FT LVEPPEEYTNRVVSLTPKSVEFMQQKVGNWDFIKQDRVRFYDNIVAYDSQDNDARIEFD FT ATQIGAGVLAVMCENINIQSSLIGRLNELGMDDSTTILDNTKVIDITSPIHHDLDQHDL FT NEIDVNSGKSDLDWPIVKLSTGESIQARLLVGCDGYNSPVRKFAGIESRGWQYNTFGVV FT ATIKMQYEDHRSIGWQRFLSTGPLAILPLSEDNATIVWSSTPWLSELLLKVNPDIFPHL FT INAGMTLEEVDLKYIYSMLDKDPNDFKVLDEIQWRLSKIDIKSLEENYPLPVVELIQNS FT RARFPLKLSHADTYVAPRVALVGDAAHTIHPLAGQGLNMGQSDVGFLVDALEKGIERGL FT DIGSTMVLDSYVANAWPGNHMMLGVCDKLHKVFTTDFGPVVLLRGLGIKSLNMAESVKD FT LMIKAISGR" FT gene <808136..>808876 FT /locus_tag="PICST_62209" FT mRNA <808136..>808876 FT /locus_tag="PICST_62209" FT /product="hypothetical protein" FT CDS_pept 808136..808876 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_62209" FT /product="hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:PICST_62209" FT /db_xref="EnsemblGenomes-Tr:ABN67488" FT /db_xref="InterPro:IPR023393" FT /db_xref="InterPro:IPR024500" FT /db_xref="UniProtKB/TrEMBL:A3LXM1" FT /protein_id="ABN67488.2" FT /translation="MNLTPVENITTIDKSKLLVESSEIISKIESTWAKDKQFLYMLPKQ FT KRNIGVQTYHANSLNGVHWSARVSDFKDFDSTAKSRYFKLLQKYILGSFTNNDLTHTHY FT EKEYIHELYDYDINKFDTPDNESASYLVQLFYKFQFPLKKRVFYEYVHVFKEDNSNDAY FT VVSLPISPKLLEKSEFNKEYVVGRYTSIEKISYDAESNDLKWIMCTCSTPGGSIPDWLT FT NMTINGAIAKDVPSFLNWVDTLEK" FT gene complement(<808877..>811120) FT /locus_tag="PICST_48163" FT mRNA complement(<808877..>811120) FT /locus_tag="PICST_48163" FT /product="hypothetical protein" FT CDS_pept complement(808877..811120) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_48163" FT /product="hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:PICST_48163" FT /db_xref="EnsemblGenomes-Tr:ABN67825" FT /db_xref="GOA:A3LXM2" FT /db_xref="InterPro:IPR013176" FT /db_xref="UniProtKB/TrEMBL:A3LXM2" FT /protein_id="ABN67825.2" FT /translation="MNNYFSQFIPQIGGYGPNPYLLDDSNSSSHPQIQYISIFNPTLAD FT ERSESNEELYKQIICFISSKYENEHNLNVDQKVEQLRIVGLTRGVSSFASNFCSSKGEN FT KTTIIKSSKSSLILFQLENDFQLACSISSVENKSKSNFVNSQLIKIIDTMHNQFVLSHT FT SLLNALNKYKVEALKDMLTDYWTGFISAYNNQYFNIPPGLVWPNSLNYKGFLGLIPNSH FT TTKRTYKKSSLSFSQSIKAEIDQILQQPYNEETESKIPKGVIVSCFNKSNIKKYGLIYS FT NIAFDKTINTEKFSKDSLIDIYNWLEFHDYHNKLETESLTSSNSKGLFSTNLEFPEVAS FT DATSTMTSEEGTYSALDMLSPRNIASNLVISPLNYTVNSISSLGSQIKTIGIGSTSEES FT NVTERAGWLPVPSIFKSLSLGGGTAENEEQIPSNASLEGEEDDDEDSGHFLIGTKVNEF FT NHQKEIYRKLVYLNTNVSDLQGNYTQRELEYSLVVYGKDDIYITLVYDSSNPELDNVDF FT YEELAEDTLIPSINEINNSILGGSMMGGSVASLKSLKGILTTDDIDSDFFFVAYDGDEG FT SIKSSLPFLPIIKVNLDEPSNKSVVRYQSAIYYLHDQLASIFLMQSNKDFFSNNMMNEY FT FHKFTSNKLNDWMFYFIKHNNKYIIVIKNHNHNAKSAKRKSVTAIRAQSLVSSPATVAS FT DPSNNIANNVNGPGLLNRITDGVADYAHLGFLDNLGDDVKYWLAGFTHGDEAS" FT gene <812141..>813550 FT /gene="SHE3" FT /locus_tag="PICST_62098" FT mRNA join(<812141..813321,813403..>813550) FT /gene="SHE3" FT /locus_tag="PICST_62098" FT /product="mother-specific HO expression" FT CDS_pept join(812141..813321,813403..813550) FT /codon_start=1 FT /transl_table=12 FT /gene="SHE3" FT /locus_tag="PICST_62098" FT /product="mother-specific HO expression" FT /db_xref="EnsemblGenomes-Gn:PICST_62098" FT /db_xref="EnsemblGenomes-Tr:ABN67489" FT /db_xref="GOA:A3LXM3" FT /db_xref="InterPro:IPR031398" FT /db_xref="UniProtKB/Swiss-Prot:A3LXM3" FT /protein_id="ABN67489.2" FT /translation="MEDNTASNKPTSRVIDSLHSQIDDLKTELETVKISHDDYKKKYVL FT VSQKNDSFVDQLANAKHENDMINALLKRKERRIADLEDQYNELSSSNESLQLNNKNMKI FT RCENLQQSSASSTAEYERLKIAYDALIASQVEYKRHYQKELNTLASKLEAYKTENKQRF FT QDLSSKLSSNDKDIDTLLDSMTNKRKALDNLYVNKNKTILELLTSLAKAAKIHGLDTKS FT TLEENTVAISSLLEKYPDLQEKILTHEKVEVDLDELISESNETLSNCSFESEATLVNSP FT ELSDSASQSKNADHLKQDVKASSLSRSNTLQAKKRKNKRNSVRIDSKSGPDFSSITTPT FT TGQFALPKKPTFTSNNDNRGFSSRSPSDSSRNITPPHQDYEINPKFQNQNVHLNNDTNN FT KGGNYNNNNNNRSKRKSLYGGQYNSKRNSQIIDPNALNISMTT" FT gene complement(<813810..>815108) FT /gene="CAF4" FT /locus_tag="PICST_32865" FT mRNA complement(<813810..>815108) FT /gene="CAF4" FT /locus_tag="PICST_32865" FT /product="G-protein beta subunit-like protein containing WD FT repeats" FT CDS_pept complement(813810..815108) FT /codon_start=1 FT /transl_table=12 FT /gene="CAF4" FT /locus_tag="PICST_32865" FT /product="G-protein beta subunit-like protein containing WD FT repeats" FT /db_xref="EnsemblGenomes-Gn:PICST_32865" FT /db_xref="EnsemblGenomes-Tr:ABN67826" FT /db_xref="GOA:A3LXM4" FT /db_xref="InterPro:IPR001680" FT /db_xref="InterPro:IPR017986" FT /db_xref="InterPro:IPR036322" FT /db_xref="UniProtKB/Swiss-Prot:A3LXM4" FT /protein_id="ABN67826.2" FT /translation="MDNTTPQQIFSLRSHENSISNIEEVFLWNKHCLISSDTKGWIIIW FT NINAKRPIRKWQAHDETILTLTLISTNTLLTHGRDASLKIWDISVEHAESSPPELFFLP FT INTLNFCNVQYFNDFLITPASVDSNNFDIYKITNPEYEFKRVLANFSPFDLYSKNKTEI FT NSPNEQGRNDFGIIMKLVYVEHSNQLFLGFESGQIIGLNINLNPDATLVDKTTEAYSKK FT TPSKYGGLSSLIDKTSSRTLINKEPRVNLIYSDSSHIPNPITSLVHLKDNILISGSTNK FT QVIVHHYQMHSIDSSDAHLDVKKVAHSGIQSIVADEKTDTIFIGHWNGVIEGVDYKSNK FT KKLDSQFELKRDLPHLITTSTNSSGGDTNTIAKEAVKLTSLALSIERENTQVTTTKKKS FT YKDLVKARSAYIGNDNRLLFAGYEDGAVVAYRL" FT gene <816666..818157 FT /gene="FTR1" FT /locus_tag="PICST_68095" FT mRNA <816666..818157 FT /gene="FTR1" FT /locus_tag="PICST_68095" FT /product="plasma membrane iron permease" FT /note="Has EST support" FT CDS_pept 816666..817823 FT /codon_start=1 FT /transl_table=12 FT /gene="FTR1" FT /locus_tag="PICST_68095" FT /product="plasma membrane iron permease" FT /note="go_component membrane" FT /db_xref="EnsemblGenomes-Gn:PICST_68095" FT /db_xref="EnsemblGenomes-Tr:ABN67490" FT /db_xref="GOA:A3LXM5" FT /db_xref="InterPro:IPR004923" FT /db_xref="UniProtKB/TrEMBL:A3LXM5" FT /protein_id="ABN67490.2" FT /translation="MVNVFNVQIFFIVFRESLEAVVVVSVLLAFLKQGLGQATQDPVVY FT KKLVRQVWIGAISGVVVCLIIGCAFIGAFYSLGNDVWSKSEDIWEGVFCIIATVLISLM FT GLAMLRINKMKEKWRIKLARALTKTPSNKKDRFKIGYLTKKYCMFILPFITCLREGLEA FT VVFVGGVGLSSPATAFPIPVITGLIAGIAVGTLLYYSGSTVSLQIFLIISTGILYLIAA FT GLFSRGIWYFENHLFSVQTGGDASENGSGPGTYDIAKSVWHVNCCNPETDNGWDVFNAL FT LGWQNSATYGSVISYNIYWLVIIAVILLMLFEEKHGHLPFLKNLTLVQLNPMYHLKGKK FT KNNLTSAEKEELFDKVKNTNFGEDSEHEPLTEIRKEISDVEKVSN" FT gene <818478..>820295 FT /locus_tag="PICST_32867" FT mRNA <818478..>820295 FT /locus_tag="PICST_32867" FT /product="hypothetical protein" FT CDS_pept 818478..820295 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32867" FT /product="hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32867" FT /db_xref="EnsemblGenomes-Tr:ABN67491" FT /db_xref="UniProtKB/TrEMBL:A3LXM6" FT /protein_id="ABN67491.2" FT /translation="MWLREPPCCSKINHPCPSETLLVKAYFHYIFIHHIPIHLLDKLEM FT FSDEIEVSFHIYHKHSLGRSHGIFQHSQQNCKRYLGQGSLTFDGRIATKLNFLGEWFHD FT ADSCIRSETCDTVEQVSPDSEITKLLSNMITSKGTLNVVIDATLQFSYNDLLFGTNMGL FT HLYSLRCAVNNLCQIPYQNRDAHSTSITAITTITTFNSVSTILTQFDSFNVIEDGIESI FT KCTNTSLFEQHKFSESSFPQPVIKKDGQGRSQLTDISEKYATQEVEVNNQDVKIANLFA FT FSDQVVSIIGIDEFEFYSQSAEEQLLRYELCKYATGGDISELVETTEEEVSSEENRTSD FT ESFQILNSPRERQLSIRYNTGCGFNSEYQYPVVVDELSGVEYSCNVWGDPEERVPYGYQ FT RPIPSSITALPSKSILRKKCRDSKATSSTKYSNNQVTLKCLLNANLEGLRQQSLARLTI FT KDSEEHLLRPSESRSGGWLTRRCHVFDNYVPLYRRPLEQYNHTISQTEASTSNPTTTTA FT AAAVTSTNNLSNNPHDLPTSAEFWEQIYSESDIQENKSCPPSSAEFWESICSPPPSAEI FT RFRVAPAEQEENGVTSRSHSSVSNSAGGL" FT gene complement(<820678..>823371) FT /locus_tag="PICST_47572" FT mRNA complement(<820678..>823371) FT /locus_tag="PICST_47572" FT /product="predicted protein" FT CDS_pept complement(820678..823371) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_47572" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_47572" FT /db_xref="EnsemblGenomes-Tr:ABN67827" FT /db_xref="GOA:A3LXM7" FT /db_xref="InterPro:IPR029175" FT /db_xref="InterPro:IPR039481" FT /db_xref="UniProtKB/TrEMBL:A3LXM7" FT /protein_id="ABN67827.2" FT /translation="MYKDGDLEDPLKGRGSNVAKQLISRNIIGGVSDPELKSYLIGSQK FT FNSQKYLTTVHRDTSIDELTSSLGFLEQSIQSQTNELKGVIDANFIKFINCKKAIDTVL FT VDFKNSKTRAQQDRENATVFNPQRHRNTAKQETLSSELEEAVKNLNMATALMIRPIQEN FT KNRENKLNKLIEFVKAHPFFFDLPNKLLKYLSIHDHDSFIDDYNKYLGEKESMLNLNKS FT KYNADLARLTKEKDEEGIRNLDQEYQLYNTALSKVFEEIDSITEQFRAKTYKELLSMDY FT EVPLNGRSKSTSTSKFTSLVDKLYKLDSSMSLSDNNPISKFLSTQLESINTELEHQIAK FT YDTRFRMMQRKLQDYISTLADARKNGSHVRYISEKYNSTKTDLMVSKTKSNEEKEKLVF FT DVFDSGDNLDLSLVNETWLVLLNLMNFLEDLFSKNLTKFVNNYRHYYQFNVDPQGTIRD FT SFVNIVNKVALVLVTLFENESSAEASQLEAQPKDYELFLPHYANSMSSVFYLSSVNQKL FT NHLFTHLGELSGLVGNTSKFAETNKLLKNLKNASVKTNQKMIEAICSVWVNDCSQLFEL FT EDWTVSTLNEDTVKKQGDGSTYTKLMNIIEYYQLFILIKLADLTFNKDETNGDFRIVQS FT YPSKRMLVSIEIQFMRSLNIIVDSVMKKYNMERMNDSDFVVSDNETYKVLTMNNFDKLS FT RITYPRLIKKFDQLFSKDLSTQKLKLFADIDKASFTIFEDVLNREKMWIANQVNKFFHS FT HISNVDGRVTELRIDGFIYEILIHFVRLINKVKPVTGKDIFINIINELQSNLLKNILDN FT LRMCDTFSSLSMINLKLDVNFILEIFENSKTLKFNDSTYKLLQVLLNAIEEKYNGAEER FT YNYSQSDFAYILNQNLANSANEFDCF" FT gene complement(<823411..>823584) FT /locus_tag="PICST_27944" FT mRNA complement(<823411..>823584) FT /locus_tag="PICST_27944" FT /product="predicted protein" FT CDS_pept complement(<823411..823584) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_27944" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_27944" FT /db_xref="EnsemblGenomes-Tr:ABN67828" FT /db_xref="UniProtKB/TrEMBL:A3LXM8" FT /protein_id="ABN67828.2" FT /translation="MINYDYSEQDILSFYNLQAVDPTSISHLNLNKEEDIAPEEINKLS FT KDEQFAILNRLVN" FT gene complement(823937..825898) FT /locus_tag="PICST_68096" FT mRNA complement(join(823937..824102,824223..825898)) FT /locus_tag="PICST_68096" FT /product="predicted protein" FT CDS_pept complement(join(823996..824102,824223..825852)) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_68096" FT /product="Myb, DNA-binding protein" FT /note="go_component nucleus; go_function DNA binding" FT /db_xref="EnsemblGenomes-Gn:PICST_68096" FT /db_xref="EnsemblGenomes-Tr:ABN67829" FT /db_xref="GOA:A3LXM9" FT /db_xref="InterPro:IPR001005" FT /db_xref="InterPro:IPR009057" FT /db_xref="InterPro:IPR017877" FT /db_xref="InterPro:IPR017930" FT /db_xref="UniProtKB/TrEMBL:A3LXM9" FT /protein_id="ABN67829.2" FT /translation="MDEQQEIGGAHALLQLGSKQKDDGIDDSIDAIGNNENSNVNEDVD FT DEGDLSDSKNQQINDAVEAAVMRYVGGTLDSAEHESKRSKRKIHDEIINNIHEFNQWTG FT FLEENISDHGNEDYDAYTSQQQSQPLHSNKRSKGKKRRTQSGTSDIDPELEALGTTEHD FT QLVEAAIIDARELARHINEQGAGTGNLNLSHHQQHAGSDSINAITQLAQAATSLSETKK FT AKLKRKDGESYQMKNIALRPKFNNLTSVETLIEEASAQACEWFNSLPDTTGKGPRMFSA FT EEMSAVDHFVAGYCHLNKWTREDVCNRVWSNERKKDNFWESLVRVLPYRSRASVYKHVR FT RIYHVFDVRAKWTEEDDALLKKLALTHEGKWKQIGEAMGRMPEDCRDRWRNYVKCGDNR FT TSNQWSQDEENALKQIVTDMFQQSGNKEYASINWTVVSERMNGTRSRIQCRYKWNKLVK FT RETALRATYMNSDTKLWMLRKLQSSGWDSVDSVDWTEVARLHREENVKQDENGYQWDAP FT DFKASFEKMRSEVRDHKRLSFVTILMLDPNDPESIATAAVAAVSSGVDGVDAQQQAYSL FT WR" FT gene <826690..>827301 FT /locus_tag="PICST_32870" FT mRNA <826690..>827301 FT /locus_tag="PICST_32870" FT /product="predicted protein" FT CDS_pept 826690..827301 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32870" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32870" FT /db_xref="EnsemblGenomes-Tr:ABN67492" FT /db_xref="UniProtKB/TrEMBL:A3LXN0" FT /protein_id="ABN67492.2" FT /translation="MKNFAAKSSLISFVLFLFFGITASTALPATGYNSQSESFSLGAYK FT PARSLKSNSALFEESVKNLDNFGFQYVVFDPNDLSVKLNSSSDPKQYNITGFINGDLSL FT KVTNLDGKYLTVNNQTNQLQLSDDVELSKQQFAVRRDMIFAQGSSTWSVCGGTGADDFE FT GAYIYHGTLEENSQFCSSGGRELELKAIGDSGAIPDFPLN" FT gene <827573..>828631 FT /locus_tag="PICST_32871" FT mRNA <827573..>828631 FT /locus_tag="PICST_32871" FT /product="predicted protein" FT CDS_pept 827573..828631 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32871" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32871" FT /db_xref="EnsemblGenomes-Tr:ABN67493" FT /db_xref="GOA:A3LXN1" FT /db_xref="InterPro:IPR007477" FT /db_xref="InterPro:IPR033494" FT /db_xref="UniProtKB/TrEMBL:A3LXN1" FT /protein_id="ABN67493.2" FT /translation="MSMSEAGELSREELIERVVELETVLSEFQESSKELEQLLEEELQD FT LERANTTLQSTLDKTNEQLLKSNSRIVELTRELNESQEKAAEKAREQEHRLSEIQQQLV FT TVEISNDSMESNDRILTNKLDLANQLNNVLLEKLALIENDLEREKKAGIEKRLYISNYQ FT NQVKDLQKTIEILEKKTTADVPEADTSLISIGAVLKEGPPDENSSAPISTIKKSNSLQG FT IKSLNEGVQAYILSTSTKSLKSSSSVQLTVPSMVDYSFRRSVSAGNERSSSIPSTQSFN FT RLSLFMDPRDTRPQPLGLSEKENRSRVLQGDAKTRTRNYSHPLRVIPGSPNTAKISNLE FT SKPQSKKKLVYN" FT gene <829742..>836245 FT /locus_tag="PICST_61948" FT mRNA <829742..>836245 FT /locus_tag="PICST_61948" FT /product="predicted protein" FT CDS_pept 829742..836245 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_61948" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_61948" FT /db_xref="EnsemblGenomes-Tr:ABN67494" FT /db_xref="InterPro:IPR016024" FT /db_xref="InterPro:IPR040108" FT /db_xref="UniProtKB/TrEMBL:A3LXN2" FT /protein_id="ABN67494.2" FT /translation="MDAREFAEILSRYDKSEIFNCLTVVNGRLTKATDISIDDYTIYLT FT QLTSLIDKFNVPPVSSKSKQSAKESPEASAAATLQGKLSLNIFRLLSRNLVLILTHLPT FT KVYDVANGLLNHLQLTDASYLRPICQISIVVLIDLYESFPNNLGSLVNYSLNQIYKIIK FT KTPTIDSSLIYLLNSITKNATKADIDEKFQAKLLKIVTKNITSTSISYTLEAAVGIEST FT SILLKKNYVLCLKNLLLLAISTNYEGLLATSASSTGTSKLKPEAIMSQQHQFQINLLNS FT NEKIFYYCLTNYSKEVRIAAIEMLANILTNLVPVGKFNPIDYIVSSFSLPSLNFWNDAL FT TIQYDPEDLEPTDYKRVNNTITGHDSESIIHENTELLVFQTSIVEVLILYIQLEQFQNP FT EYISTNLSYILDIILARFSELNHISNHIQNQQWNKVLTQWCAFIDYIVKESGSNCHEIL FT TNYIYSKFNVRSTSGTFLSEHESSNYNGPSINKGKRETALFNFKSKSSSKTRNKDIKSK FT EVRPYHNTYQVYLLLYIVGLLLPFGVNFNSNAVKEEESTSNTDVHDTTADDDEFEEQVN FT SESSFIRDILMKLVINENSYIRNYALKALLLYAKYNDVETNILILSTFRLVNQEFKSSD FT VEKDTSGDSSKREENICGLASVRLLSYSLLLSSFIKQAEWSLLQNSTVVKILSFCTQNL FT KHNNNNNRSNFLKNTACWVILTSLVTFYNESEYVKLNSSQFLVFWKGLLTSQFISSSSG FT VVSEASQTLEIVDNLKLRNSSLVCLLNYLNSVELTPESLRQIQFLLTKSYNYLSYLESN FT IEIVGSVTNFNGQGFNESDYNPNLINNLQYSNYAYNNKLSYDKSIISLILYGKRVILKS FT FHKLATLLKNDINSNMVIFLLKVFGDTKVFSRLSVVEEKSRSSKKSSSLRLNDFDFSSI FT LLGEDYNYSFGVTSKYHDYFDNIDELSSSQTHANNGLLYSDPFSVSSNPITKGSLESGS FT SKQFKIWIDYFEKQIFSSVDHSIDYDPSVFITQDYSTMEKYSTNLTTSLVDLSIELFQL FT VFPYLSLKIQFSLAEQLRNSLTAKSVDPLRLKAVEVNLSVAIHGALNNIVKKKLELNKQ FT IVEVFIDTISKIESRNVNIVSINTDSIAMATKLTNKEYINEQIEKYVNDIVNNSNPFER FT GYTILSLSKIYQQTHFGFVDIYNIALQLLNDPNPVVYHYALSALIILFQSNIDSLSFIP FT STLDSIFIKYLKDEFSFDIDSKLLVNLKCKYGSIGQTTKLLRLFVTSLGPNLRDWSSEN FT KLQIKNVIMSLSQGIGLATAEDYVDVYRHLLGFFQELIIFDPKLIDGEIPFFADLLNLI FT ISKNMKIGLTSSSPTSLNRESIFPFNTSYDLYRASYECYVELLKIYGSPVLSKESVGML FT WVSMNIKPCSELKEFIQLWMESSLDMNWFVILNSLFKCSSKKLIGPFIELNYQQKLLPL FT SQRQKKKNTNNLDFKDEEIENIVGDGDDDEDKSEPITWEFKLFIYFLLNHLLDLCSKHP FT KLADRLKTKIPDIVKISFLGSTSPITEIRLRGINLLDKVLGLFGHLPDPLYPGVSILEQ FT QQAQIISALTPCFSPGSDAKVIVNTINVCSKFISLPRIKFYSKQRILKTLIYLLEEISS FT NKFLRFGFLEDMSENGRKSIQISILNCWALLKIDASEVPEGIEPELLETLDKYSTLLTS FT LWIFVLREYSSLKYNDINQKELEIYGNYWINFISVLSIELEKDEKFVEKYLADDAQNFF FT FVLFSQCVESLVKNRNVSEILVSLNRLISNPGLVDILFNDEFFGEVVDLFDRLILIDYD FT TEIQIKLLDIVANIFQSYITNHPDTFENGFDKLFELIRIEMLPLFGILPFLRQDFDPNN FT ESQQLQLKHVDSAPHLLVLKKALERLVQMTAGFADIVKVDLYACLLYISAKIYQSRNSL FT LISVILPHLKQIVTESKVSDYDLVDTFRNAIHNYYEISAESTYTVITAIVLVTSGDVKL FT DETDSQKLSAALIQLLSSSETASMSIQCIKTLIQYSSKLDGQVPVIQYLVSDLVKILSQ FT IDDQKKIDDPKVGFEILFLFTKTVNEEKKSMALYSILIPLLLRYNDRSEISKEYLHDRL FT IFLVSHDPHSFKAVVTSALTESQKKLTEELVKSTTKEDSEMTRNQPEIKLKTFGSEN" FT gene <836660..>838918 FT /locus_tag="PICST_48947" FT mRNA join(<836660..836838,836920..>838918) FT /locus_tag="PICST_48947" FT /product="predicted protein" FT CDS_pept join(<836660..836838,836920..838918) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_48947" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_48947" FT /db_xref="EnsemblGenomes-Tr:ABN67495" FT /db_xref="GOA:A3LXN3" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR003959" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A3LXN3" FT /protein_id="ABN67495.2" FT /translation="RTKDVKLFNGRTITLIPKVNVAPEEDTTSSSTSIIDMNKLFSRAE FT LKLKVRENERKIRLESANTTKEISGMWTDKYRPRSFVQLCSAGNDRQYRLILHWLKKWS FT SVVYREDSTRNDGVDSLGRPHRKILLVHGPTGIGKTTAVHLLAKQLGYAVQELNASNSM FT DTLPQADSSEGRWGNVNAALKLKIKNALTSNAITSNGKPSCLVIDEIDSAINSGDIVKV FT LNDLVASDQRSSRSKERDDSEKKKKNKAKNFVLNRPIICIANDIYNTSSTRMGGSPMEK FT LRPLCEMVAFKKPVIAKTGRRGGNSLHSVKDHLQMITEKENWGYSSQDITEIVEVCDGD FT IRACLNHMQFNGAKERGFSNNFSMSSDLLLDKQVSWFTMVDLLFKRDAKLRKEENFLAL FT LDSFMNGTCKSVVSSSNSFDKVVKGCFHRYLDTVHLQDDSLSKPSEFSDWLSYYDQFSN FT SGGYGLDLHQYSGLVGLKAWSLFSEISPKKLQNPFVDKKLDYETFETGRQNSSLIKRLI FT DKTPISAKLALGVDEEIYSCFFIPLLAKILSPDISAKAKSKMVEFEKNTVEKVATIIKE FT FEIRMENERDLETGQVLLQYYPNWDGIVHYDNKFCPVPFVSAVKQNQLKRNLLFPLVTA FT ELERLQMIQRAPKRILEVEKKSEVDEKRRKVKMGNSVDFFKARYDGLNSQLVDMSKPDN FT EFHMARIWVKYHEGFSSAVRKNIGWEDIWMP" FT gene <839135..>840175 FT /gene="ERG27" FT /locus_tag="PICST_61325" FT mRNA <839135..>840175 FT /gene="ERG27" FT /locus_tag="PICST_61325" FT /product="3-keto-steroid reductase" FT CDS_pept 839135..840175 FT /codon_start=1 FT /transl_table=12 FT /gene="ERG27" FT /locus_tag="PICST_61325" FT /product="3-keto-steroid reductase" FT /db_xref="EnsemblGenomes-Gn:PICST_61325" FT /db_xref="EnsemblGenomes-Tr:ABN67496" FT /db_xref="GOA:A3LXN4" FT /db_xref="InterPro:IPR002347" FT /db_xref="InterPro:IPR036291" FT /db_xref="UniProtKB/TrEMBL:A3LXN4" FT /protein_id="ABN67496.2" FT /translation="MSLIKEGQVAVITGTSSNLGLNIAYRLVEQTDPKTNLTLVVTSRT FT LPKVKDIITTIKDYVVEHFPERVSKIEFDYLLVDFVDMVSILSAYYELNKRYRHIDYLF FT VNAAQGVYGGIDWIGATKEILTDPIEGVTHPTYKIQKVGVKSSDGMGLVFQANVFGPYY FT FIHRIKHLLQNGGRIVWISSIMSKPKYLSFNDLQLIKSPESYEGSKRLVDLLHFGTYKT FT LAKDYNIQQSLVHPGIFTSFSFFQYLNFFTYYSMLVLFYIARWSGSPYHNISGYIAANA FT PVKCAVGKEKQDVKVESCSTRYGQEYIRYQEIDSTGSEDVVAYLDKLVQEWDVKLKDQI FT TSTRLP" FT gene complement(840220..>844716) FT /locus_tag="PICST_65933" FT mRNA complement(join(840220..842889,842911..>844716)) FT /locus_tag="PICST_65933" FT /product="predicted protein" FT CDS_pept complement(join(840220..842889,842911..844647)) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_65933" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_65933" FT /db_xref="EnsemblGenomes-Tr:ABN67830" FT /db_xref="InterPro:IPR001680" FT /db_xref="InterPro:IPR001841" FT /db_xref="InterPro:IPR017986" FT /db_xref="InterPro:IPR019775" FT /db_xref="InterPro:IPR036322" FT /db_xref="UniProtKB/TrEMBL:A3LXN5" FT /protein_id="ABN67830.2" FT /translation="MIQRSQNPNDSPTFSNSLSLRVDGAIGAMSLSPNGRDAVLAGRRG FT LFIIDLDDPFTTPRWLHHITSWEVADVQWSPHHFSKPSWCISTSNQKALLWDLARPSNN FT SILNVLHHHARAITDINFHPSDPEILATCSIDTFILSWDMRTPRKPVQKWAEWRAGATQ FT VKWNHENPYEIASSHDNCFYVWDSRKGALPIIKVNKAHNGKINGLDFSNGASNIITCSN FT DNTVKFWNLNSNEARETIKDFDYFAVDDNDAPVLRPSVVIETDFPVARARALPFGKDKA FT CGIMPLRAGGDAIQIVNYDEEYKEALKTDETQISSINPVYTFKGHNGAMKDFLWRTKHQ FT NYEGFESKNKWKEFQLVTWSSQDYDLKLWPADEELYKKVNYNPSYQKFLDAFNPEASDS FT DESTRPLSPSIGEGENVYNYETYCLEPPVTIVDLKRRNNGDVLSSLTLYEIVEKHKQNG FT HDVLKLNHLDWISGVRMGRAGHAAGRKDSSMEVDDGPSNLGEEVSIVGHKFPKARFEKI FT SVSTGEIVLSLRGPVPISNIPDAEKDNENNDEINSSIVNDKDSTTKDVERSMQPTSVVS FT SDANNPISISSVSEDSPEQQLVFIRIQIKFPKNYPFLDDIDLDETVTTKKLTRLQKHNL FT VKFEIEGTHELTTEIKREMLKNLNEIAHFYTNKYNKFCLEPCLRYLLGDKIELNDELMM FT ETGGDKNENLDGEGYIQEVGNEGWADDLINQQPGGDMGYDSSGEDDEVYADLIPAVNDD FT MINSTQSLKPDSTQAKDGKTDEFNNASAGTTFFDSTPVPKGCGAIWSPTGQLVCFFIPK FT ENEEEENNSLQKFNIFKFTDGGFSINTHNSHHHGHHHHKISGDFDTEVSDEGSYSSDSE FT SRVANSDDPDSDSDTSSSGDSFANDWDEILQDDAPSRSRIPGLFKTSVGLGNRYIGNRD FT KSINRFTSHGGTTSNYKSSVPGESRKKRSRNSKKSKNIVGIFDFRHLLPDKYELACEYR FT VLGDSPENLARYNSEVALKYCLKDISDVWRILEMILVKEVRMSNLDSGYPSQMDPISQR FT QAKAMNQFLLNSEFMKKNPNKHTSFYWGTHPFGYSWLIDEIFKYFEIRGNIQMLSMMSC FT ILYENPSNLRKNSSDLFNIPIHTPYQALPPPPSLIAMKKFNESNSQEIFSQSHELSYSF FT HNSPSADGRAELTHRNSNISVFRRDQGSTSGNIYAKSLTSSMDAASIKDDSPERFSYFK FT NNIQPSFNSFTLSNEFSSELVNSNRFNSPKQRIAKAKTIGQLSESRRIKPVQPTSKRQT FT TKATGKNKLRPPPVVTIQNTENLDLFSDDYTPSLLHGQDQEKIKLYREQYADMLYVWGL FT PVNRIKILKFNYPDIDKKLEMGYVSPFDVHKCSIGLRNKTRQNPNQEFHNFVSSITTAK FT SNAWNTSKRNPLKHCNLCGLIVSKSLVVCTNCEHVLHSSCAAEWWSTNENTECPSGCGC FT NCLQHTI" FT gene <845041..>845694 FT /locus_tag="PICST_7934" FT mRNA <845041..>845694 FT /locus_tag="PICST_7934" FT /product="predicted protein" FT CDS_pept <845041..>845694 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_7934" FT /product="predicted protein" FT /note="go_component nucleus; go_function transcription FT factor activity; go_process transcription initiation" FT /db_xref="EnsemblGenomes-Gn:PICST_7934" FT /db_xref="EnsemblGenomes-Tr:ABN67497" FT /db_xref="GOA:A3LXN6" FT /db_xref="InterPro:IPR003923" FT /db_xref="UniProtKB/TrEMBL:A3LXN6" FT /protein_id="ABN67497.2" FT /translation="EMDEEFNDGTIEQSTETTSPADNKTADSASANTNTKKKTNATTTS FT STVTAAMLIPDLPELTRKDISLKKVLNLMDGDFAPIIPDAVTDYYLAKNGFETTDVKIK FT RLLALATQKFVSDIAQDAFEYSRIRNSSAVYNSANPQVRAKQLLQGQQFANQQSLTGAG FT GNNAGVEGAGDQQQPSHSSSSNAGNQQGKIVLTMEDLSSALSEYGMNTSRPDFYR" FT gene complement(845731..847536) FT /gene="SRP54" FT /locus_tag="PICST_73416" FT mRNA complement(845731..847536) FT /gene="SRP54" FT /locus_tag="PICST_73416" FT /product="Signal recognition particle 54 kDa protein" FT CDS_pept complement(845830..847515) FT /codon_start=1 FT /transl_table=12 FT /gene="SRP54" FT /locus_tag="PICST_73416" FT /product="Signal recognition particle 54 kDa protein" FT /note="go_component signal recognition particle (sensu FT Eukaryota); go_function RNA binding; GTP binding; FT go_process SRP-dependent cotranslational protein-membrane FT targeting; protein targeting" FT /db_xref="EnsemblGenomes-Gn:PICST_73416" FT /db_xref="EnsemblGenomes-Tr:ABN67831" FT /db_xref="GOA:A3LXN7" FT /db_xref="InterPro:IPR000897" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR004125" FT /db_xref="InterPro:IPR006325" FT /db_xref="InterPro:IPR013822" FT /db_xref="InterPro:IPR022941" FT /db_xref="InterPro:IPR027417" FT /db_xref="InterPro:IPR036225" FT /db_xref="InterPro:IPR036891" FT /db_xref="InterPro:IPR042101" FT /db_xref="UniProtKB/TrEMBL:A3LXN7" FT /protein_id="ABN67831.2" FT /translation="MVLADLGSRLRGALSSVESASDEEINQMIKDVCTALLESDVNIKL FT VVKLRDNIKQKVKTDVTSEESAINKRKKLQKIIYDELVGLVDSHEEPPKPKKLSTSTKV FT INGKKKKVAKTNSHIIMFVGLQGAGKTTSCTKLAVYYKKRGFKVGLVCADTFRAGAFDQ FT LKQNAIKASIPYYGSYLEQDPVKIAYEGVTKFRSEKFDIIIVDTSGRHRQEHQLFQEMV FT QIGEMIQPTQTIMVMDGSIGQAAESQAKAFKESSNFGSIILTKMDGHAKGGGAISAVAA FT TKTPIVFIGTGEHIGDLEIFKPTTFISKLLGIGDIQSLIEHVQGLNLQNDENHKQTMEN FT IKEGKFTLKDFQNQMNNFLKMGPLTNIASMIPGLSNIMSQVGEEETSKKIKNMVYIMDS FT MTTEELESDGRIFVDQPSRILRVAKGSGCAAVEIEMVLQQHRLMSTMAKSAAAAGAGGS FT GQPGANPMAGNPQMARMMQQAQSNPNFMQQAMSMLGGGGAGGAGGAGGMPNMANMMNNP FT QMMQQAQQMMRQNPQLMQQAQQMMQNPGMMQKLMSQFGGGFGGM" FT gene complement(<848275..>848973) FT /locus_tag="PICST_32878" FT mRNA complement(<848275..>848973) FT /locus_tag="PICST_32878" FT /product="predicted protein" FT CDS_pept complement(848275..848973) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32878" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32878" FT /db_xref="EnsemblGenomes-Tr:ABN67832" FT /db_xref="UniProtKB/TrEMBL:A3LXN8" FT /protein_id="ABN67832.2" FT /translation="MKRSSSASIESSSLYTASNSNKSSKRLKLENEIFSKSIKDIEKMF FT TIDNFKNENNFVNNQAVNQGSIASTTLTSVNSHHHHIKTKQPTPVVVAKHDCNYSYVDS FT DVHQYLTSQHGASNHQHLKYDCINLSFLASASPSVAAHPKYANINDSCYFSKASCFEHK FT GNTQGAIPILPSQSKMVQQPTKSMMDMSIDDVVDDELDDAFDTKLHFITFNKNNLERDL FT NLIDQLILLN" FT gene complement(<852198..>854054) FT /locus_tag="PICST_32879" FT mRNA complement(<852198..>854054) FT /locus_tag="PICST_32879" FT /product="predicted protein" FT CDS_pept complement(852198..854054) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32879" FT /product="predicted protein" FT /note="go_component integral to membrane; go_function FT D-alanyl-D-alanine endopeptidase activity" FT /db_xref="EnsemblGenomes-Gn:PICST_32879" FT /db_xref="EnsemblGenomes-Tr:ABN67833" FT /db_xref="GOA:A3LXN9" FT /db_xref="InterPro:IPR006639" FT /db_xref="InterPro:IPR007369" FT /db_xref="UniProtKB/TrEMBL:A3LXN9" FT /protein_id="ABN67833.2" FT /translation="MDNITDTIAAPSLENITFAFSNLSYIDQLAYIIPHKIYLKDSPII FT PEVINGALILLVSIAIVIVGSYSTVSRPSNSEDPRLDRKSPYWDPSDVDNTEHFVANKM FT QLYTLGGQNLGLVHVLLMPLSTAGTLYFLNYVMNNWNIDDINLWLNRYILAVSLFSIYG FT SLEYVLVASSRKLSKLLGGPLSNSSNLFCRYRLTLTADKDDNFPLGRLENFDEDEFVEK FT ELKKDPKWNEAFQKYLSEEKIEILRPTSVRIIPKVTENTNWIFDLKPAVILPLTIGLIY FT SFYKYNPILNSEYNMNDINWLVLDSMAINFAIFGIQKIKFGQFKYGFLLLSGLFFYDIY FT FVFGTEIMEKVATGLNIPMKILLPHPGSSWGEPLKFSLLGLGDIIVPGTVASLSLRFDV FT YRHHQKNPSTAFHYLTPIAKPYFTAAIVSYFIGLAATLVMLNIFRVGQPALLYIVPSLL FT GGITITGLARREFTELWEFKDEIKQFDEKDFENENENYIEEEDEDYILNEDEASFDDWV FT DQVELERAGSEDETDLDEFRKFAPKRYTAEDFGPDDEEEDDDTFVIGEGSDDELDDDDD FT IEEEEVEYEEDDDEAVIEVLEELQVIREDLNRQPQRWYSDEE" FT gene <856936..>858060 FT /locus_tag="PICST_32880" FT mRNA <856936..>858060 FT /locus_tag="PICST_32880" FT /product="predicted protein" FT CDS_pept 856936..858060 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32880" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32880" FT /db_xref="EnsemblGenomes-Tr:ABN67498" FT /db_xref="UniProtKB/TrEMBL:A3LXP0" FT /protein_id="ABN67498.2" FT /translation="MSRESSSIAKADHEISENSIDQAVKDESYKPEVVDSQPQPNIADV FT APPLAEAFAISTHFKHATTLRTGNPISYAYNNYDHYHHKIHKFIKRTFHRLYYPNEEAT FT PGGVTSPTKSIGSTSMLPKEQSSSNSSSYIFERSLESNASRTILNNPETPSHYLLENYT FT NPILDTTTEIISNPNLDFYNDVKLNCYCEDDCAEDHVGEPRPRSRSIISSSLISSFDHH FT NNSSKSKILSDEDGEVQEEEEGEEDEEDEEYNDDDSKSRHSHHQSKSKRSSFSAPSIAS FT SRTASGAVSPLTKRSISFVKTSLPAPMTPAGNPNASRTGSNGQTIDFYSFADMINNEDF FT EEGEIAANKVSETNSQFRKGSFTTMSVKDYIGVL" FT gene <859625..>860806 FT /locus_tag="PICST_62156" FT mRNA join(<859625..859688,859761..860473,860552..>860806) FT /locus_tag="PICST_62156" FT /product="predicted protein" FT CDS_pept join(859625..859688,859761..860473,860552..860806) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_62156" FT /product="predicted protein" FT /note="go_function nucleic acid binding" FT /db_xref="EnsemblGenomes-Gn:PICST_62156" FT /db_xref="EnsemblGenomes-Tr:ABN67499" FT /db_xref="GOA:A3LXP1" FT /db_xref="InterPro:IPR004087" FT /db_xref="InterPro:IPR004088" FT /db_xref="InterPro:IPR036612" FT /db_xref="UniProtKB/TrEMBL:A3LXP1" FT /protein_id="ABN67499.1" FT /translation="MTESLFDTKFSEPTLAKVADSASSATSASSDGQPAVSSSSSNGRS FT DPQDQSTTLPSLQSKVNASALINYRVLVSAKESGCLIGQNGQVIDSIRAETNTKAGISR FT LQPGSHERILTVSGTLDDCAKALSYFAQALCNSTIETYNFFPLKQLSSNPCIEHQTTIL FT RLLIPNSQMGTLIGSKGLRIQQIQNKYNISMIASKSFLPGSNERLVELQGSVNDLYDAL FT RIISRCLIEDFSSIVGTNYYIPRGHHYNNSSSPRGANPITTASISFPNDIVGALIGKNG FT SRIQGVRKISGATIGISEEVEGKPERIFTLSGSAHAVEKAKELLYHNLEREEQRRSEAE FT EKN" FT gene complement(<861118..>861651) FT /locus_tag="PICST_48539" FT mRNA complement(<861118..>861651) FT /locus_tag="PICST_48539" FT /product="predicted protein" FT CDS_pept complement(861118..861651) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_48539" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_48539" FT /db_xref="EnsemblGenomes-Tr:ABN67834" FT /db_xref="InterPro:IPR000614" FT /db_xref="InterPro:IPR003018" FT /db_xref="InterPro:IPR029016" FT /db_xref="UniProtKB/TrEMBL:A3LXP2" FT /protein_id="ABN67834.2" FT /translation="MGEEGKHHADYSNVTGLSKEETLQHIIDSYEALASDTTNWVANLS FT NCSSLVWHAYHSLNVPVNWAGFYVKNGEKNELILGPFQGKVACQIIQIGKGVCGTAAHS FT KETQLVPDVEKFPGHIACDGETKSEIVVPLVKEGKILAVLDIDCLALDGFDESDKKFLE FT ELAVLIVRTCEWQF" FT gene <861897..>864575 FT /locus_tag="PICST_62838" FT mRNA join(<861897..862188,862327..862436,862491..862508, FT 862578..863872,863894..864032,864111..>864575) FT /locus_tag="PICST_62838" FT /product="predicted protein" FT CDS_pept join(861897..862188,862327..862436,862491..862508, FT 862578..863872,863894..864032,864111..864575) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_62838" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_62838" FT /db_xref="EnsemblGenomes-Tr:ABN67500" FT /db_xref="GOA:A3LXP3" FT /db_xref="InterPro:IPR014839" FT /db_xref="UniProtKB/TrEMBL:A3LXP3" FT /protein_id="ABN67500.2" FT /translation="MFNCDNIRSQGERFQDFLVLRGIHRKGKSADPPILPDKHSDGNRR FT TSSGRSHSIVPTIVSNERDTVSFANDIVLEFDADDNDSDWDEEDEMLPIPRLRNDDNQD FT ADVFYDERRESFSSNRRTDLTSTNSGANDTDRYFEYPKSNSYPTNSESAYTNWELRQRV FT SQDKRNLDSKFIDAFSKDYTTIENTDPSRILRKPLAEMYKDGLRLKHIGIRKLHALENI FT RRFKNNISTIINDSDGRDYLVLASNSELIIFDFDDVVALPNKKSVLRFDTRPPFTSTTD FT RLISTWPYFPHTVNFIRTFNNFCGRQVLGACIDDGSLMLWYTDTIIKYIKSMKIREKVG FT RQDDADSLYRDTNRFHGLRVNPDFKFKLEASVWGLDFLNYNDTFGNSHNLIVASDNSQS FT VTLFYYHQQDSRFYHVKSHQILHNIPEVSFVSHEVSNEGCHLVKVSCACISGELLIFQF FT EFRIKSGPLDQDEYEYFKKETIYYIDSTMEIHNRDPNLENSDEIKLKKFKRISFLLPRV FT LTRTVFGEDCWTTKPISSTYFNEVDSLAVAIGDPFLREEKIVKSIMNESAALDLDHLGF FT GANWQFFQSRVVSISSETTADLYKAGRITGIDDEYRRIHKGIQDLESENFLVVSTTKKL FT ALFRADTLFCTCATKRVFDLAIPFNEEVKFSNRMSITCVIPKLSCIIAVSQLGLATIMR FT LCCSRGVYAMRQEHIFPNALGLALGYNGYRTISGLAVREKSILPRVTRYFVYLSYTDGI FT VVAYDLQLGANDELFVSSV" FT gene <864869..>866407 FT /locus_tag="PICST_25346" FT mRNA join(<864869..865234,865274..>866407) FT /locus_tag="PICST_25346" FT /product="predicted protein" FT CDS_pept join(864869..865234,865274..>866407) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_25346" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_25346" FT /db_xref="EnsemblGenomes-Tr:ABN67501" FT /db_xref="GOA:A3LXP4" FT /db_xref="InterPro:IPR011051" FT /db_xref="InterPro:IPR014710" FT /db_xref="InterPro:IPR025974" FT /db_xref="InterPro:IPR028386" FT /db_xref="InterPro:IPR028929" FT /db_xref="UniProtKB/TrEMBL:A3LXP4" FT /protein_id="ABN67501.2" FT /translation="MDLLNLGAQSRKTGIKPRQNLTKDKYDMEDIDEFFADDDELSRIH FT RRSNTSRSRKSTSAQSSTPKDNFDNVARFLNFTDAEAENFNLSPISSSSKLVPNKDNKK FT SPLLSPLAVRRDNKEYDRNDISEVDDDLYDYEPDFYDDHNDNGQSFEEHSSLSPVPLSP FT VLPISGNGKKTSSTPKSKSTSSKLSSALTKRMALGKSSKSSVPKVLEQEESDEGVLEAK FT SNNESSELLSPPPTNKRSSKEKPAKSTSTISKPSPLPSPPPDGLRRSKRTRVRPVAFWR FT NEKVRYRRANENSQDPNTTLGSDIKNIPLQEIQEVVHIPEPASNNTLAPSRKRSRSKSR FT TTPPKFKKATKKEVYDYESDPEISGSEWFKNDTLQLEVFENEKKVRTLVAYTPDGADLR FT DPPAPQEGDENFKVATLFEHDKDFSASGLLEFDFGGYKQFRNSGEFVYSFHVVKGLIEV FT TLNNTKFVVTRGCSFQVPDGNSYGFKNIGQDSARLFFVQCKI" FT gene complement(866549..867359) FT /locus_tag="PICST_90212" FT mRNA complement(866549..867359) FT /locus_tag="PICST_90212" FT /product="predicted protein" FT CDS_pept complement(866658..867356) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_90212" FT /product="predicted protein" FT /note="go_component intracellular; ribosome; go_function FT structural constituent of ribosome; go_process protein FT biosynthesis" FT /db_xref="EnsemblGenomes-Gn:PICST_90212" FT /db_xref="EnsemblGenomes-Tr:ABN67835" FT /db_xref="GOA:A3LXP5" FT /db_xref="InterPro:IPR001790" FT /db_xref="InterPro:IPR033867" FT /db_xref="InterPro:IPR040637" FT /db_xref="UniProtKB/TrEMBL:A3LXP5" FT /protein_id="ABN67835.1" FT /translation="MPRSKRSKLVTLAQTDKKGKENKTRIFDDVRSALDEFQFVWVLQL FT DDVRTPVLQDIRSDWSGSKLILGKRRVLEKALGDTPEEEYKDNLHKLSKTCTGLPGLLF FT TNETPETVQAYFTAYSKADYSRAKSKAPIDFTIPEGIVYSRGGQVPIEEDVPMSHSLEE FT TLRNKLKVPTKIKAGKITMNEPYVVCHKGETLDVRQALILKQFGVAASEFKVNVVAYYN FT NENSEVTKLN" FT gene complement(<867452..869706) FT /locus_tag="PICST_68100" FT mRNA complement(<867452..869706) FT /locus_tag="PICST_68100" FT /product="predicted protein" FT CDS_pept complement(867493..869706) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_68100" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_68100" FT /db_xref="EnsemblGenomes-Tr:ABN67836" FT /db_xref="GOA:A3LXP6" FT /db_xref="UniProtKB/TrEMBL:A3LXP6" FT /protein_id="ABN67836.2" FT /translation="MSLADVVTYIWLQLSEFARYVSELQAYKKISSLKLLDAGFGRQYK FT HEPLLIDSPHAFEKQEPTFQKSVSSIISKSPKPIFNLQLLTQTVSHLYQRVSFELQTIT FT PGNGFALSIAIFIIIYLILIGSVIYICYDADEECTRSSSSSREEVCETGCNRDEPLEVI FT TQEPMPENPDVHYILQDLDFVARVNLKSVNNKVQIINPNYRRNSTKALLLDYTDDLEVE FT RQSSVKDSETPSSAFSDQKDNLITLDNESEVKLPRKGTTYTVESITGHSSSIYPKGTKG FT SINSNIVKADSNFVFNLLHPNSNRHKSSASLQATTIASAHGTIDNQIKESILLLDPRTS FT TPFKIMTSPGIINPGTDSLGNVGFASSASKLLAPVESNISICGDISNTSISLSVADSLD FT IPNFTVQPQYQELLDDTDDQISLFDYFDTSMSLLEHCFDFESEYEKWVELSRNKTELRK FT ECRKIFDDQSTIADKVKSIEILRFLVANDHDIRVSSLHKKKKKFERLIEEHISEFINVL FT YTGNYIVMRYVILLLRDYITNCKSNQIEIEDYNRIMTGLIEENYYNKALNEIIESSLFS FT IMVALHPSMLSATIFFIFNELLVDPILDLRKVKLMLQGIKFYICFNKDILIEQLNNAPE FT EEKIKTGVYQIMRCLCNTTRIISVDKQFKGGVSSITENSLQKEIIDFYLLILEVFIDSK FT SISKVQKIEFLDHFVTRAYSELQPLIHGDPRQLRKPSMQDSTK" FT gene complement(869957..870679) FT /locus_tag="PICST_79236" FT mRNA complement(869957..870679) FT /locus_tag="PICST_79236" FT /product="predicted protein" FT CDS_pept complement(870312..870635) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_79236" FT /product="NADH dehydrogenase I beta subcomplex 9" FT /db_xref="EnsemblGenomes-Gn:PICST_79236" FT /db_xref="EnsemblGenomes-Tr:ABN67837" FT /db_xref="GOA:A3LXP7" FT /db_xref="InterPro:IPR008011" FT /db_xref="InterPro:IPR033034" FT /db_xref="UniProtKB/TrEMBL:A3LXP7" FT /protein_id="ABN67837.1" FT /translation="MSRAILPFTEANSKRVASLFRQALRTAFDSSLKFDAYRAETIKIR FT AQFEANKHISDPTELESVIAATRAKLAEYAHPDPYFPPCRPGGTKYQRNIPVAREPLVP FT GDW" FT gene complement(<870999..>872936) FT /locus_tag="PICST_32888" FT mRNA complement(<870999..>872936) FT /locus_tag="PICST_32888" FT /product="predicted protein" FT CDS_pept complement(870999..872936) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32888" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32888" FT /db_xref="EnsemblGenomes-Tr:ABN67838" FT /db_xref="GOA:A3LXP8" FT /db_xref="InterPro:IPR001589" FT /db_xref="InterPro:IPR001715" FT /db_xref="InterPro:IPR002048" FT /db_xref="InterPro:IPR011992" FT /db_xref="InterPro:IPR036872" FT /db_xref="InterPro:IPR039959" FT /db_xref="UniProtKB/TrEMBL:A3LXP8" FT /protein_id="ABN67838.2" FT /translation="MNVLKLQKKFPVLGQSDLFSIIEDFRGIDGEDKGWVEKKDAINSV FT SKKGPYSYDQARETLKHVNVDASGHVELEDYVELIAKLKESTLSDESDTVAIPSESSFS FT PRRVNKPAPPVPTANPSKKTYLTGKTSGTTHTINDEERTEFTRHINAVLAGDVDIGERL FT PFDTETFQIFDECRDGLVLSKLINDSVPDTIDTRVLNLQKGKKVLNNFQMSENANIVIN FT SAKAIGCIVVNVHSEDIIDGKEHLILGLIWQIIRRGLLSKVDIKYHPELYRLLEDDETL FT EQFLRLPPEQILLRWFNYHLKNAGSERRVGNFSKDISDGVAYTVLLNQLQPEHCDLLPL FT KTPDLLQRAEKVLDNAEKIGCRKYLTPTSLVSGNPKLNLAFVAHLFNTYPGLDPIEEHE FT NIDIEEFDAEGEREARVFTLWLNSLDVDPPIVSLFEDLKDGLVLLQAYDKVLPGSVSFK FT HVNKKPANGGEVSRFKALENTNYAVEIGKANSFSLVGIEGSDIVDGNKLLTLGLVWQLM FT RRNIVSTLSELGKGANLTDADILRWASSQVAKGGKSSNVRSFKDPSLSSGVFLLDVLNG FT LKPGYVDYDLVYQGANLSDEEKYANARLAISIARKLGALIWLVPEDINEVRSRLILSFV FT GSLMAVSETL" FT gene <873622..>877107 FT /locus_tag="PICST_32889" FT mRNA <873622..>877107 FT /locus_tag="PICST_32889" FT /product="predicted protein" FT CDS_pept 873622..877107 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32889" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32889" FT /db_xref="EnsemblGenomes-Tr:ABN67502" FT /db_xref="InterPro:IPR007810" FT /db_xref="InterPro:IPR011044" FT /db_xref="UniProtKB/TrEMBL:A3LXP9" FT /protein_id="ABN67502.2" FT /translation="MNSNGRDTSTSTYSGSERSNNSSTNNYSSTLADATLGDNEHPTFA FT VEQVQLGFELDNALIQLCVQNNIMFLILQTHVLRIDLDNPSTVGRYSVPSMSSAVGSTI FT TNAWLHPSGNHFIIQTNGVNYYYLNESYSKFKALPKFKNLNISQIAFPHDQSTASDKST FT GDFLIGTNEGHIYLAQLKPHDPETQDSKRDEKYIKLVFKYQHAEVPVLSGLTFTNNNSQ FT INAFLNNNLYVWDCFDTSYSELTKVFKTNPKVVSFQSDLTGKSTPIFASNGHSYVYIFS FT KSNEILTNDEEILLSQAEKLDTSKINENISLSSNSIIVTPHHLVTFNDAHDKLISFNKL FT SLSNASSPPVELNLKSFCNPGEYLFGITADFKNNTYWIFSNNSIYELIIRNEAVSVWYN FT YYKMGKFEEALKCLEENNNNGSNSSDLYKIDLILIKQGYNYLQRGGFGLDYAGDGEEKN FT SENDFHNDLIELQIKGVRILANSSEPFEKVCLMLLNLQDHLKIETTSKQQLPTSSLDIS FT TLSIVSQKLLLEYLLEKFRIARDLEKNKIRMVVLSSWIVELMLRMINKLETDVSIKTAS FT PVLGLANGGLKHNSLFQSHKKNFATGLNNSFQEFLTTNYKYLDRGTIYQIMKISHCPDK FT LIYYAELIEDYEFILQYYLDISDFSNSLRIMTKIYTSSSDESKEIIYRASTVMLANDPM FT QTIETWLKFNEDINHERLLPAILTYNKNNESIPIYENYSLQFLSKIVYEKSIRSEQINN FT HYLSLLITYPENDKTSKKQATKQILKLLNFLSQEATKKRPTYNANFILRLCLTYKQFQP FT AVWILINDMNLYDIALSLALDNDLTDLGEYVLRAYDNSLSKKERISIESSDRSYGSDEY FT EKEEDINFIGKVRLEEESYNTRKKLWLMFAKYLVQLVCEGKMPNIHFDDEVDVEESKSV FT NSQAEVKKTVQDVTNDLVESITNEKKDKTVPDVDSKQLNKVLKYIISLSNSGHSSGVIG FT LKDLLPLFPESIMINNFKEEIVKSLNQYNNKINQLTLEMKESLNISSNLKSQIRDSNKI FT SEKAKIYSIIEPGESCQICKKLLINKNFIYFPNCHHGHHKDCLIRAYIKSKGNYRFKKI FT FLHFKKNPSAVNKRELDDMITRECLLCNDGNILVVDNSLIDSDRDQSELIEWEL" FT gene 877241..879795 FT /gene="SPB1" FT /locus_tag="PICST_90578" FT mRNA 877241..879795 FT /gene="SPB1" FT /locus_tag="PICST_90578" FT /product="AdoMet-dependent rRNA methyltransferase SPB1 FT (2'-O-ribose RNA methyltransferase) FT (S-adenosyl-L-methionine-dependent methyltransferase)" FT /note="Has EST support" FT CDS_pept 877254..879749 FT /codon_start=1 FT /transl_table=12 FT /gene="SPB1" FT /locus_tag="PICST_90578" FT /product="AdoMet-dependent rRNA methyltransferase SPB1 FT (2'-O-ribose RNA methyltransferase) FT (S-adenosyl-L-methionine-dependent methyltransferase)" FT /EC_number="2.1.1.-" FT /db_xref="EnsemblGenomes-Gn:PICST_90578" FT /db_xref="EnsemblGenomes-Tr:ABN67503" FT /db_xref="GOA:A3LXQ0" FT /db_xref="InterPro:IPR002877" FT /db_xref="InterPro:IPR012920" FT /db_xref="InterPro:IPR015507" FT /db_xref="InterPro:IPR024576" FT /db_xref="InterPro:IPR028589" FT /db_xref="InterPro:IPR029063" FT /db_xref="UniProtKB/TrEMBL:A3LXQ0" FT /protein_id="ABN67503.1" FT /translation="MGKTQKKNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKYGHFLE FT KSKVVIDLCAAPGSWCQVASQLCPINSLIIGVDIVPIKPLPNCITFQSDITTEDCRSRL FT RGHMKTWKADTVLHDGAPNVGLGWVQDAFTQSQLTLQALKLAVENLAAGGTFVTKIFRS FT RDYNNLMWVFQQLFDKVEATKPPASRTVSAEIFVVCKGFKAPKKLDPRLLDPKEVFEEL FT AAGPENSEAKIFRPEKKTRHRTGYEEGDYLLYHEIPILEFIRSEDPITLLSSNNKLVEP FT SKEDHEWKILKKLRHCTPELLECIKDLKVLGRKEFKLILKFRKEARDLLGLEDKEDLNK FT SDLVEVEPLTEEQQIDKELEELSSKQKQKAKRAKKNANESKQKEIVRNQMNMLTDMNIG FT IEAAQIGSESLFNLKTAEKTGQLDKLAKGKKRMVFNDEEIAKGNDIHVDEDAENVATDD FT ELDELEAQLDDMYNSYQERKAERDANYRAKKARGDVDDEAWDGIRSEDEDEDANLEERD FT YEMDSESESDSDDDEHIRLIADKKKEGLSKNAKVFFASDSIFGELTDDTLLKEIENKKL FT SSNVSSNGSARIFKSQDGQESEDSEDSESDESDFEIMPAEKEHEEVEDDSDSEQESIAR FT QYSRAKSQQQRIDLATVEAMTLAHQVALGQKNKHDLIDEGINRNSFRDVDNLPEWFIDD FT EKRHSKIIKPITKEAAMAIKEKQKQLNARPIKKVLEAQGRKKMRALRRLEKLKKKSDLI FT NEDSGKSERDKAEEIQKLMKKLTKKQKQKPKTTLVVARGSNRGLSGRPKGVKGKYKMVD FT GVMKNEQRALRRIAKKHKK" FT gene <881101..>883440 FT /locus_tag="PICST_32891" FT mRNA <881101..>883440 FT /locus_tag="PICST_32891" FT /product="hypothetical protein" FT CDS_pept 881101..883440 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32891" FT /product="hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32891" FT /db_xref="EnsemblGenomes-Tr:ABN67504" FT /db_xref="UniProtKB/TrEMBL:A3LXQ1" FT /protein_id="ABN67504.2" FT /translation="MSSLPTTSSFLTSSANKRAHRHKRSAAISGDFDASGLFCSPTHQS FT SISLTSHSPRQSFADDNADLERNYHFNNEEDFSNNGSNDIFSYPSKNSDIFQRPALSPR FT HLNSLSPVRKPNIQSSSFGLNSPIRLNRSRSGSTSNSLLNKSRLFLTEETTINSENIPE FT AVIDLDVILNANLHIGVEEAISDSPRNYHTHKRTESAPAEFAQNDDFLGSPFSNQTNSK FT LISSSLHNSHSMFSSGVNSGVPLFSQPIQEQMTDSIIEEGDNDEFDFDGSKLESSELVS FT DTDSTHDIFANPPPMMGNVFYTNASANSSTSSLRSGGNTSKHLVIEKTFSNSSKDSCCS FT FNGSNGNLTSNKRSGAKANRYKLFYDKSSRISNALKENSSDSINIVRSNSSGHSMSTAN FT TAYKDLKLLGHSSSLPSLKSGPKRINSQAPSSLRYSDKRSNSENRRAVSPPARVSEKVY FT SASSPSLISERKESSTGCRFSDEIAYDFESRDRIVIGQAKKPEDPKISSTSPISTKSIN FT SSAVISNSGTLHSTDNSSFLSHHEVLSKEHAKSDYNELSRDAEVVVHDRLQNITPSIVI FT SAESESSSPSTNSTFQQIESVIRSNSKIKPPHIEPSLNSRSASIDIENASKEDLNTKKE FT RKQDDQSCFLQTLPVQAKLTSPDYTNVTLSSKVARNSCIVSPMKAGIRNSQTDSEKKKS FT THSKRKSIYNYSENTISGRKGKPTAHVENEENELMAVGRGRHSKSKSMSFTLSDLNPKV FT SNTEADNVDFSKTKRRERLLNWFRKR" FT gene <883574..>884527 FT /gene="APA2" FT /locus_tag="PICST_48616" FT mRNA <883574..>884527 FT /gene="APA2" FT /locus_tag="PICST_48616" FT /product="5',5'''-P-1,P-4-tetraphosphate phosphorylase II FT (Diadenosine 5',5'''-P1,P4-tetraphosphate phosphorylase) FT (AP-4-A phosphorylase) (AP,A phosphorylase) (ATP FT adenylyltransferase)" FT CDS_pept 883574..884527 FT /codon_start=1 FT /transl_table=12 FT /gene="APA2" FT /locus_tag="PICST_48616" FT /product="5',5'''-P-1,P-4-tetraphosphate phosphorylase II FT (Diadenosine 5',5'''-P1,P4-tetraphosphate phosphorylase) FT (AP-4-A phosphorylase) (AP,A phosphorylase) (ATP FT adenylyltransferase)" FT /EC_number="2.7.7.53" FT /db_xref="EnsemblGenomes-Gn:PICST_48616" FT /db_xref="EnsemblGenomes-Tr:ABN67505" FT /db_xref="GOA:A3LXQ2" FT /db_xref="InterPro:IPR009163" FT /db_xref="InterPro:IPR019200" FT /db_xref="InterPro:IPR036265" FT /db_xref="UniProtKB/TrEMBL:A3LXQ2" FT /protein_id="ABN67505.1" FT /translation="MSFETPTNFFHILGDKYNEAVSNSKIFFNGSSATNEVVHQLLGDS FT TVDFQYTLLHSLQHRPETGSIEKNPFAKPEPELTVLDSYGPNEEFKIVLNKFPVVAQHF FT MIVTKEFKSQDSPLSPSELQGTYIILQSLKASDKQNDWFAFYNCGPQSGASQPHKHIQF FT MSLPNKEDFVPFAEQLIMRSAAFLPNSQQEPLQNADIPFAHFVARLPEQHQLQEGELAL FT YFASLLQRALTVSRRNEAEHISYNFICTTKYMMIVPRSNGKYKNSLGINSCGVLGLFLC FT KNEEILDLVKKDGPETILQHCGFPNTAGQGSDEYHY" FT gene 884783..885458 FT /gene="UCR7" FT /locus_tag="PICST_73333" FT mRNA join(884783..884923,884980..885458) FT /gene="UCR7" FT /locus_tag="PICST_73333" FT /product="Ubiquinol-cytochrome c reductase complex 14 kDa FT protein (Complex III subunit VII)" FT /note="Has EST support" FT CDS_pept join(884796..884923,884980..885226) FT /codon_start=1 FT /transl_table=12 FT /gene="UCR7" FT /locus_tag="PICST_73333" FT /product="Ubiquinol-cytochrome c reductase complex 14 kDa FT protein (Complex III subunit VII)" FT /EC_number="1.10.2.2" FT /note="Ubiquinol-cytochrome c reductase complex 14 kDa FT protein (Complex III subunit VII) (QCR7); go_function FT ubiquinol-cytochrome-c reductase activity; go_process FT electron transport; mitochondrial electron transport, FT ubiquinol to cytochrome c" FT /db_xref="EnsemblGenomes-Gn:PICST_73333" FT /db_xref="EnsemblGenomes-Tr:ABN67506" FT /db_xref="GOA:A3LXQ3" FT /db_xref="InterPro:IPR003197" FT /db_xref="InterPro:IPR036544" FT /db_xref="UniProtKB/TrEMBL:A3LXQ3" FT /protein_id="ABN67506.1" FT /translation="MASLTSVVKAADFILSRPTLSKIVNPVAKAFVAYAGYREMGLKFD FT DLISEESPIGQKAISRLPEGEIYARNYRFITAHQCALSHQLLPANKAVKPEEDTHYLIP FT YILEAEKEAFEKVELDNIQV" FT gene complement(885489..886493) FT /gene="DIC1" FT /locus_tag="PICST_78946" FT mRNA complement(join(885489..886405,886464..886493)) FT /gene="DIC1" FT /locus_tag="PICST_78946" FT /product="mitochondrial dicarboxylate transport protein" FT CDS_pept complement(885568..886380) FT /codon_start=1 FT /transl_table=12 FT /gene="DIC1" FT /locus_tag="PICST_78946" FT /product="mitochondrial dicarboxylate transport protein" FT /note="go_component membrane; go_function binding; FT go_process transport" FT /db_xref="EnsemblGenomes-Gn:PICST_78946" FT /db_xref="EnsemblGenomes-Tr:ABN67839" FT /db_xref="GOA:A3LXQ4" FT /db_xref="InterPro:IPR018108" FT /db_xref="InterPro:IPR023395" FT /db_xref="UniProtKB/TrEMBL:A3LXQ4" FT /protein_id="ABN67839.1" FT /translation="MIACLVTHPLDLAKVRLQTATIPGQSLISMIYQIISKEGFFKIYS FT GLTASLLRQATYSTTRFGVYEFLKEKYVDMTDNPKPSTAVLLPMSMTAGALGGLVGNPS FT DVVNIRMQNDSTLPVEQRRNYRNAFDGIYRICKEENPGSLFRGLAPNLVRGVLMTASQV FT VTYDIAKNLLVDHVHLDPTKKSTHFSASLLAGLVATTVCSPADVVKTRIMNAKGTDGNP FT ITILTSAVKNEGVGFMFRGWLPSFIRLGPHTIVTFLALEQLRKYKLGM" FT gene complement(<916531..>923923) FT /locus_tag="PICST_32901" FT mRNA complement(join(<916531..916894,916952..919352, FT 921537..921566,922750..922754,923734..923735, FT 923837..>923923)) FT /locus_tag="PICST_32901" FT /product="predicted protein" FT CDS_pept complement(join(916531..916894,916952..919352, FT 921537..921566,922750..922754,923734..923735, FT 923837..923923)) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32901" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32901" FT /db_xref="EnsemblGenomes-Tr:ABN67840" FT /db_xref="GOA:A3LXQ5" FT /db_xref="InterPro:IPR002013" FT /db_xref="UniProtKB/TrEMBL:A3LXQ5" FT /protein_id="ABN67840.2" FT /translation="MIPSSAVDKPFEKTPSTATSSTSESNDSDTLGELSYAGQLPSNEE FT DVIPNQDEDDESSNEEEENTSNSLPEFNNKRIILQRFTIYNSLTTMYIVGSNAKESLFR FT ILEIGKDQSNEDQLVILEDKSYFYTRKDMVELLNGLDESIEAGIHKIAQGYGLLGFIKF FT TKGYYLSIITKCSQVAVLGGHYMYHIDETKLIPLDFNYRRPEKYSDEERLLSIFKYLDL FT GKTFYFSYAYDITNSLQTNFMRNKRAATEYKFAKDNIKLKNNENFNTFEHNERFVWNNM FT LLKPVLQNSDTAAYEWFQPIIHGFIDQAKISVYGKKFYITIIARRSHHFAGARFLKRGV FT NDRGNVANEIETEQIVSDMLTSSFHDPKFGFYNNARYTSFIQHRGSIPLYWTQDLNKLP FT KPPIEINLSDPFYQSSALHFNNLFQRYGPPIIILNLIKTKEKQPRESRLNQHFANCIKY FT LNQFLSEEHKLRFHSFDMSRHSKKNLDVIGPLQKIASHSIREIGYFHNGHNLASTKLQK FT GIIRTNCIDCLDRTNAAQFIICKEALTHQLEGLGLIPKDKTLNYDSDLINILTEIFHDH FT GDTIAVQYGGSNLVNTMDSYRRINQWSSHTRDILNSVKRIYSNSFIDSIRQEAINLFLG FT NYVYAPDKPKLWELENDFYLHNEMTIDNIRIKTSYVQWFNKFYLSNSRFSFKDDLFINH FT NMYWDPEWRLEPFPDCNDNWFNECYVPRKFQSLSEVFSYNMNSNARYFPSNSNQPGNVF FT DYSPFESRKSKQEEQYAFSKPKSGESNIRYLDGCFEDDVNHFQGEKNYEEKKIGARIEN FT RDFMHESAYLQMTNPNKLKRFLTNKIEKFALQILKIGEGFELRSLKPMFEPIFSEQDYE FT LYQSQIEIPRLITTISKSSYDKKPNDYALSSDNEEIYKYFSAVITNTISSEDITSSQLP FT YLRTEDFKLYSKYTRMEEDRYLHLNTEDDYFK" FT gene <924779..>926044 FT /locus_tag="PICST_32903" FT mRNA <924779..>926044 FT /locus_tag="PICST_32903" FT /product="predicted protein" FT CDS_pept 924779..926044 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32903" FT /product="predicted protein" FT /note="go_component intracellular; ribosome; go_function FT structural constituent of ribosome; go_process protein FT biosynthesis" FT /db_xref="EnsemblGenomes-Gn:PICST_32903" FT /db_xref="EnsemblGenomes-Tr:ABN67507" FT /db_xref="GOA:A3LXQ6" FT /db_xref="InterPro:IPR001865" FT /db_xref="InterPro:IPR005706" FT /db_xref="InterPro:IPR018130" FT /db_xref="InterPro:IPR023591" FT /db_xref="UniProtKB/TrEMBL:A3LXQ6" FT /protein_id="ABN67507.2" FT /translation="MSQKELREKAIADALAREEEEYAKIKAMRELNNQTSELITSLNKI FT PSNLINSRLQKLQQDLQNLPEYKVKELDEELEEFMFSHMKLPYGEVYNRPWSGISNEES FT SSISSNKDEVIQQRLVSTTSSSYSTQFPNLKPTPDYRGYSEQELFLRQLAHSRHSGSLG FT SKLSNVYRPQDDIKNPTKLKDVSIATLMAAGCHLGHSKSNWRPTTQPFIYGEYDGIHLI FT DLNETAAALKRASNVIKGVSKKGGIILYVGTSKNVFQNRALEEAAIRSNGYYVTKRWIP FT GTITNYTEVTKQIQGTQKIEVDMENKPTGRNLGVEQGQLVKPDLVVILNPVENRNCINE FT CILSRVPTIGLCDTDMEPSLLTYPIPCNDDSVRSVTFMTGILSKSAEEGLLERLEEVNK FT YNQSKVKGSIQKRELKHSRRSS" FT gene complement(<926736..>927989) FT /gene="LAG1.1" FT /locus_tag="PICST_32904" FT mRNA complement(<926736..>927989) FT /gene="LAG1.1" FT /locus_tag="PICST_32904" FT /product="Acyl-CoA-dependent ceramide synthase" FT CDS_pept complement(926736..927989) FT /codon_start=1 FT /transl_table=12 FT /gene="LAG1.1" FT /locus_tag="PICST_32904" FT /product="Acyl-CoA-dependent ceramide synthase" FT /EC_number="2.3.1.24" FT /note="longevity-assurance protein Acyl-CoA-dependent FT ceramide synthase; go_component integral to membrane" FT /db_xref="EnsemblGenomes-Gn:PICST_32904" FT /db_xref="EnsemblGenomes-Tr:ABN67841" FT /db_xref="GOA:A3LXQ7" FT /db_xref="InterPro:IPR006634" FT /db_xref="InterPro:IPR013599" FT /db_xref="InterPro:IPR016439" FT /db_xref="UniProtKB/TrEMBL:A3LXQ7" FT /protein_id="ABN67841.2" FT /translation="MSKPDPVSHLSPQISGSDTHIHRRRGSSVGEINIGDTASPGLSTM FT HTSKRQRKMSDARIIALSRESSSDTAILKKIVIASRELCYRHTWIVPLLVLIASYSTYW FT LSGVDTPVHRFLEALVVPSYKIPGTDQYGKGENDFYFVGFYAIFFTFLREFVMVCALRP FT LAHILGVKKEAKVKRFMEQAYAIFYYGISGPAGLWIMSTLPLWFFEITPFYVNYPHKTH FT DFYFKIYYLGQAAFWVQQSVVLILQLEKPRKDFKELVLHHIITIALIWCSYRFHFTWMG FT LEIFVTMDVSDFFLATSKTLNYLDYAIAGPFFIGFVFIWIYLRHYVNIRILWSVLTEFR FT TVGEWELNWDTQQYKCYISQPIVFFLIGALQIVNLYWLFLIFRILWRYAVGGVAKDERS FT DDESETEESSEEESKKYE" FT gene <928695..>930122 FT /locus_tag="PICST_32905" FT mRNA <928695..>930122 FT /locus_tag="PICST_32905" FT /product="predicted protein" FT CDS_pept 928695..930122 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32905" FT /product="predicted protein" FT /note="go_process intracellular protein transport" FT /db_xref="EnsemblGenomes-Gn:PICST_32905" FT /db_xref="EnsemblGenomes-Tr:ABN67508" FT /db_xref="GOA:A3LXQ8" FT /db_xref="InterPro:IPR001452" FT /db_xref="InterPro:IPR002014" FT /db_xref="InterPro:IPR003903" FT /db_xref="InterPro:IPR008942" FT /db_xref="InterPro:IPR036028" FT /db_xref="UniProtKB/Swiss-Prot:A3LXQ8" FT /protein_id="ABN67508.2" FT /translation="MYKAKKTTDSSLESLIKRATDETLTTNNWEYIIAVCDKVKSDPEV FT ATKKAITILTTRLQSKDANVLLRTLSLIIALGENCGSRMQQEIASEAFLKPLTKKLKEK FT KLHETVKVEIAKLIEQLHQSFKSDPSLKPMSDAYNKIKQEHPRYLERNVPAKPEKHDVS FT SKTQSEEDELQRVINLSLQEYEREQFSKSLQKPLPDPKKTSPRNANIAQEDSDDKKPEI FT SKVRAMFDLVSHEKDELSFRKGDLINVIEVVYRDWWRGSLPTGEVGIFPLNYVAPVYAK FT SSDQIEKELQIENRLLNVESKKIDKVLAMLSAATNGNENIDDEELENLYGQVSGLRSQL FT GHLIMKHTQREKELKLLNEQLAIEDKAFHDLLDKSISSFSNRNSYISSDVVPYPTGGNG FT SVNSGYPAVPNAYSGYNTYNGNGTPLAMQPTSLGFGNSIYASQPQQQPPRQVSQQMPPQ FT DYQSYSNINSFPEVDRM" FT gene <930276..>930572 FT /locus_tag="PICST_48995" FT mRNA <930276..>930572 FT /locus_tag="PICST_48995" FT /product="predicted protein" FT CDS_pept 930276..930572 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_48995" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_48995" FT /db_xref="EnsemblGenomes-Tr:ABN67509" FT /db_xref="GOA:A3LXQ9" FT /db_xref="InterPro:IPR039897" FT /db_xref="UniProtKB/TrEMBL:A3LXQ9" FT /protein_id="ABN67509.2" FT /translation="MSDSLYAHREDQNNQRFEQLAQTLHQFRNTVNNDIHGSIQQENSI FT LDSLNDSFGSLMQQVKRTSGDLRSVINRNASLSRIVGMILLGFFVIWMLYKLR" FT gene complement(<930683..>931483) FT /locus_tag="PICST_48821" FT mRNA complement(<930683..>931483) FT /locus_tag="PICST_48821" FT /product="predicted protein" FT CDS_pept complement(930683..931483) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_48821" FT /product="predicted protein" FT /note="go_component F-actin capping protein complex; FT go_function actin binding; go_process actin cytoskeleton FT organization and biogenesis" FT /db_xref="EnsemblGenomes-Gn:PICST_48821" FT /db_xref="EnsemblGenomes-Tr:ABN67842" FT /db_xref="GOA:A3LXR0" FT /db_xref="InterPro:IPR002189" FT /db_xref="InterPro:IPR017865" FT /db_xref="InterPro:IPR037282" FT /db_xref="InterPro:IPR042276" FT /db_xref="UniProtKB/TrEMBL:A3LXR0" FT /protein_id="ABN67842.1" FT /translation="MSSAIKLDSLVNSLVESAAPTELPYVSKDLSILLSGSNSSTVVDS FT IEEFVNEKAAVFSSAYIASKHNKDSSSSKYIDFISKKKFNIDINTQRAIDFEPFSPLVE FT YPEYYNDLVEKLGQYGEDHYPSTFVFTVVPKSSDEVEIIIIGQRLNHENFFTGQWKSIY FT TISNTSISGEVSLDIHYYEDGNVRLNFNKAVKENLSSANASAIINAINDLENKITMQIV FT ENFNDLNQKYFKNLRRLLPVTRSKINWGSAIGNYRLGSDVVHKK" FT gene complement(<931859..>936967) FT /gene="UFD4" FT /locus_tag="PICST_32908" FT mRNA complement(<931859..>936967) FT /gene="UFD4" FT /locus_tag="PICST_32908" FT /product="ubiquitin--protein ligase" FT CDS_pept complement(931859..936967) FT /codon_start=1 FT /transl_table=12 FT /gene="UFD4" FT /locus_tag="PICST_32908" FT /product="ubiquitin--protein ligase" FT /note="Ubiquitin fusion degradation protein 4; go_component FT intracellular; go_function ubiquitin-protein ligase FT activity; go_process protein modification; ubiquitin cycle" FT /db_xref="EnsemblGenomes-Gn:PICST_32908" FT /db_xref="EnsemblGenomes-Tr:ABN67843" FT /db_xref="GOA:A3LXR1" FT /db_xref="InterPro:IPR000569" FT /db_xref="InterPro:IPR011989" FT /db_xref="InterPro:IPR016024" FT /db_xref="InterPro:IPR035983" FT /db_xref="UniProtKB/TrEMBL:A3LXR1" FT /protein_id="ABN67843.2" FT /translation="MANTKPSQIGAEDSGNQRENSPDVAYHSANEEQDDNGIDDDEDDS FT LQRLSEQAQRRRSSQRGFHDEHVRDTYEDTDEHDDDDAEGVSGGNDDMSDVDAMEPGDF FT LRRLIQPRLSRSASSRNEQDHSSTGSAGDEDEAMDEDDPRAEFLRAIGSLSSSGSGSHL FT SSGSGQVFVDVVQRLMGGGIMFGGGMNRESSEIDGLINNLNQREDSYIILETLNELSER FT LLMMNGITAERLIPANKLAKSLVNIMEDTNLSEELEIQLVTCRCLYNFLEVNQDFVHDA FT LNNHAIEALCTKLMEVSYIDLTEQALQTLEMISRDPISHNSIIANNGLRACLQYMDFLT FT IHAQRKCLSVVSNSCTNITVANFQKVKDIMDNISEVVRSHTDSVVVENAWLTISRIIIS FT FKTKPELLEELFSNKELLLKDFTQVIYISCNKSSNTSSENDSSKVALNYSSCLSLIKSL FT IILSSTGVEISRILLSECSIGEVIVKSLNKYSKFKSNTSQSENANLDQSFIKTTNESIS FT IEALMAAPKELLSQFLNLIGYLLPISYSPSETPFLRNNHDDFEEKQKLNKSRVELCKDI FT IPRQYCDFVNDIWHLLMCSFQATMDYEIRRKVFIDIFRIVSFSSESNLSKIKDVNLITN FT ILASVANQSKASIGRNFSNTARLAKLFSKEEDLDMLSSDDETFEGNLDEHDAIVNEDEE FT EIAGIEEEIDEGLLQEDADNIEEEDSFDDNDNEDEEDHDENDDREDDEDEDEYEEVGGL FT PYPQTENSADDISKLNSNVLLLSGLLIARLLIEKAPQTFLPDFEREGLISDVLSIVKSL FT TGNVEEEEATGSSTRVHSISASYSNKYIDTEFTKEYEYKLTNSSILYKIYNVCSIIEKS FT YLKLKFSGNSSIPEHMQILNEIDSKLRDHKYLKTLSFDEWKLIWDKLEFALNGASSNIQ FT ISSFELISSGIIESLSQVFNSESYDFGFEFSDCYKAFISVFFVDKARGSSSFLASLQEA FT LTRTESFQIISSGSSSIVSLGSFFQNDNSQTAIMAKQIKLKLVASENETDSKLPSNMEN FT MILSVHAIATFKSVDTYLKQRFKFIEELSGRRDRSNGDLGNDDEDVSKRNPFNIEFLIN FT GESVPNEITIYGAIYRSLQNKPDEIVDPSRIWSTVHNISYRRISSAVTKESKLMNYSFH FT IKDNELDIYDKTTIYILKLLKVLFEMNAFVKINIPNTVAIPASNFMNWKLTVKLNRQLE FT EPLVVASGTLPGWSIHVTKQFPFIFPLETRIFFLQSTSFGYSRLIHQWQIRTNQGNDEN FT NTNNNNNQRAQLGRPTRHKVRISRKFILQSAIKVLGLYGSTPRILEIEYFDEVGSGLGP FT TLEFYATVSKEFSKKKLKLWRDNDPSEVDDEAYVSNALGLFPSPLDKHQISTENGRKVL FT SFFSSLGKFVARALLDSRIVDFNFNPVFLKLVQYFNLHGVQRINHRNLKKMTNISSLRM FT VDPALADSVEHLLKYVKQFPQVGEIERDSIVIDGSTIKDLSLYFELPGYPEFELIAGGS FT EIQVTATNLELYINRILESTLFTGIVHQAKSFMDGFSNVFPVNTLIIFSSEELAGLFGG FT AEEDWSIDTITSAVYANHGFTKESDAIKSLITILVQFNEEERRAFLQFLTGAPKLPIGG FT FKALRPELTVVRKHAEEGLKDDDYLPSVMTCANYLKLPNYSSEDLMRKRLLQAINEGAG FT AFLLS" FT gene complement(<937466..>939037) FT /gene="TNA13" FT /locus_tag="PICST_61879" FT mRNA complement(<937466..>939037) FT /gene="TNA13" FT /locus_tag="PICST_61879" FT /product="Transporter of Nicotinic Acid" FT CDS_pept complement(937466..939037) FT /codon_start=1 FT /transl_table=12 FT /gene="TNA13" FT /locus_tag="PICST_61879" FT /product="Transporter of Nicotinic Acid" FT /db_xref="EnsemblGenomes-Gn:PICST_61879" FT /db_xref="EnsemblGenomes-Tr:ABN67844" FT /db_xref="GOA:A3LXR2" FT /db_xref="InterPro:IPR011701" FT /db_xref="InterPro:IPR020846" FT /db_xref="InterPro:IPR036259" FT /db_xref="UniProtKB/TrEMBL:A3LXR2" FT /protein_id="ABN67844.1" FT /translation="MSISKSQTSQIEIEPVPSKVNIVHVESKVDDYIEVNGAEDHDGLE FT YYDLPESLQGLTQEELKDLDKKTTRKVDLRLMPMLIYIYILNYLDRNNIAAARLGGLED FT DLGLVGSQYQTCISVLFVGYILFQIPSNMLLNKIGKPSLYITSIMTVWGVISTCTGAVQ FT SYQGLLAIRIILGVVESGFFAAALSTLSNWYDKKSLSFRNSILYSGSLMSSAWSGLIAA FT GILDNMDGVRGLRSWRYLFLIEGAITVASVPFAYFILPDNPSNTKFLSQQEKDIIQWKL FT RQDVGTNDSDKDSQESTLSGFYLAIKDSKVWLVTLILTFLVAACGVTNFFPSVVQTLNF FT NKTTTLCLTAPPYCIAVVATFLWARHADKTGERFFHVTIPLVIALVSFIISASTLNTGA FT RYFAMCIMIPSLYCSFTTILSWMSNCCPRPPAKRAVALALMNCISNSTSIWNAYLYPAS FT ASPRYLTAFVCNCAFILCAILTAVLLRFRLRTLNKRIASGTMNWSRELGKGNDYSNISP FT DFRYLY" FT gene <940708..>942162 FT /gene="PRP40" FT /locus_tag="PICST_62786" FT mRNA join(<940708..940938,940960..>942162) FT /gene="PRP40" FT /locus_tag="PICST_62786" FT /product="pre-mRNA processing protein" FT CDS_pept join(940708..940938,940960..>942162) FT /codon_start=1 FT /transl_table=12 FT /gene="PRP40" FT /locus_tag="PICST_62786" FT /product="pre-mRNA processing protein" FT /note="Splicing component that associates with the yeast U1 FT small nuclear ribonucleoprotein particle" FT /db_xref="EnsemblGenomes-Gn:PICST_62786" FT /db_xref="EnsemblGenomes-Tr:ABN67510" FT /db_xref="GOA:A3LXR3" FT /db_xref="InterPro:IPR001202" FT /db_xref="InterPro:IPR002713" FT /db_xref="InterPro:IPR036020" FT /db_xref="InterPro:IPR036517" FT /db_xref="InterPro:IPR039726" FT /db_xref="UniProtKB/TrEMBL:A3LXR3" FT /protein_id="ABN67510.2" FT /translation="MSEWEKVTDNEGRVYYYNSKTKETSWTLPQSESSVSSGSKWQEYA FT TDDGRKYYYNESTGETTWEMPQEMEKAEDKRNDEQVASKSTEESQLDLRLASEPIKKSD FT LVNPPKDDSYPESEAFVEMLRSNKVDSTWSFQAVMSKFIDDPKYWAIPDALERKKLYDE FT YLVTRFKEDLSNKSLLVETFKKNFVETLKKYEENGRLSRNSRWISVKKLLIAEDNPIFK FT HSILSDAEIAEIYYEYISRLKKQYEEELSKNKDRALSELESYLTQINPNIVSSTSNWQE FT LLENLKADARFRANKHFNVLSDVDLLEMYETKIYPTIIQKIKSEIDDVQKKNYRSDRKA FT RQKYKALLKTLDINANSNFKDFLYILENDDSFIELCGRNGSTALELFWDIVDEKSQVLK FT LKMYLVESVLLDLKKEDSTLTKSKILSSENNFIEFLSNSSDQRIENLDIDLNDANETEV FT LYGALKREFEAQQEKRRVRF" FT gene <943130..>943645 FT /gene="ARC19" FT /locus_tag="PICST_49017" FT mRNA <943130..>943645 FT /gene="ARC19" FT /locus_tag="PICST_49017" FT /product="Arp complex subunit" FT CDS_pept <943130..943645 FT /codon_start=1 FT /transl_table=12 FT /gene="ARC19" FT /locus_tag="PICST_49017" FT /product="Arp complex subunit" FT /note="go_component cytoskeleton; go_process actin filament FT polymerization" FT /db_xref="EnsemblGenomes-Gn:PICST_49017" FT /db_xref="EnsemblGenomes-Tr:ABN67511" FT /db_xref="GOA:A3LXR4" FT /db_xref="InterPro:IPR008384" FT /db_xref="InterPro:IPR034666" FT /db_xref="UniProtKB/TrEMBL:A3LXR4" FT /protein_id="ABN67511.1" FT /translation="QSQSLKPYLTAVRSSLTAAICLEDFSSQLVERHNRPEIEVDNTHN FT PELILNPMVIARNENEKILIEPSINSVRVSIKIKQADEIEQILVHKFTRFLTSRAENFF FT ILRRVPIKGYDISFLITNFHTEQMLKDKLVDFIIEFMEDVDKEISEMKLFLNARARVIA FT ESFLTPFD" FT gene complement(<944174..>946942) FT /gene="DAL81" FT /locus_tag="PICST_24259" FT mRNA complement(join(<944174..944329,944369..946557, FT 946651..>946942)) FT /gene="DAL81" FT /locus_tag="PICST_24259" FT /product="Fungal specific transcription factor" FT CDS_pept complement(join(<944174..944329,944369..946557, FT 946651..>946942)) FT /codon_start=1 FT /transl_table=12 FT /gene="DAL81" FT /locus_tag="PICST_24259" FT /product="Fungal specific transcription factor" FT /note="transcriptional activator for allantoin and GABA FT catabolic genes; go_component nucleus; go_function FT transcription factor activity; zinc ion binding; DNA FT binding; go_process regulation of transcription, FT DNA-dependent; transcription" FT /db_xref="EnsemblGenomes-Gn:PICST_24259" FT /db_xref="EnsemblGenomes-Tr:ABN67845" FT /db_xref="GOA:A3LXR5" FT /db_xref="InterPro:IPR001138" FT /db_xref="InterPro:IPR007219" FT /db_xref="InterPro:IPR036864" FT /db_xref="UniProtKB/TrEMBL:A3LXR5" FT /protein_id="ABN67845.2" FT /translation="NNNTGNNNKNSSNLASLDEQYASTKPSDFDHSPNNYLDSNWASSL FT LMDPGSDILYNFDLPHNNNTNNNTTTASTNSIIHNIQFQNNIHSGAIPSSSGRDFSVNR FT VGASFQAQSQSQTISSSASTPTTAVSKPTKQRRPCDNCRRRKTKCVLLPDTNNCVQCES FT KSLQCTYTSSAIKRKPTDIDDGPSKRKMDVKGANDITNPNLSLLQGDQSIIVAPNVPIR FT DVAPVQDYSVMNNSLLKKTLSLQFPRSSFYVGPTSYLYDINLLNLIIDSQNNANNSGDS FT PSRGPSPNSSSVGKIGQINLNSAISLRKVSDKAQFVLKDDQSPQSYQTMSNDVDTIEKF FT IAPHGQILIDLYFRIIHPSYPILHKKVFLEKYSRTHREFSAPLLAAVYVLAIQWWDYDP FT QLNKFPKPNVEMILKIGLNNYFLEILKRPKLSAVQAGLLLLQCKHIIQSKKLSNNNVGT FT GPNASVGPSAIGDTDYSEWVLCSQVVALAEELGLGLDCNNWKLPKWERGLRKRLAWAVY FT MEDKWLSLKHSRPTHINDLNWVVVQLLEEDFPEKHGDGDLKEGSSDIDNGKKIFINLIQ FT LTMILSDIINQFYSMRAMLEITDVNQVLKLAKPLQLRLRTWYHSLPVELQMSSVQPRKL FT CSNGYLQLAYFATELTLHRKITTVIYQQTLAGTPPPKELISVCRTAAKTRLLASIEFVR FT DLKPEHIHSFWHSSSSSNFTLIGTFAAILFMSAPGKEEADFYRDQIYNYRWILKISSKG FT FDQVGEALAKLDLVLNHIPELLNDGVDMPMVVPNVPTVDYQRVNQQRQQGSGQPTTSYN FT PPQVPSQSQYSGQVPYNNGGVNSNPRMRAPAQQQYRLNSQHSAKGVGGLSPYTSPQNFT FT TPTYGQGG" FT gene complement(948261..950328) FT /gene="HBZ1" FT /locus_tag="PICST_90672" FT mRNA complement(948261..950328) FT /gene="HBZ1" FT /locus_tag="PICST_90672" FT /product="Heme Binding Zinc finger protein" FT /note="Has EST support" FT CDS_pept complement(949064..950155) FT /codon_start=1 FT /transl_table=12 FT /gene="HBZ1" FT /locus_tag="PICST_90672" FT /product="Heme Binding Zinc finger protein" FT /note="DHHC-type heme binding zing finger protein; FT go_function metal ion binding" FT /db_xref="EnsemblGenomes-Gn:PICST_90672" FT /db_xref="EnsemblGenomes-Tr:ABN67846" FT /db_xref="GOA:A3LXR6" FT /db_xref="InterPro:IPR001594" FT /db_xref="UniProtKB/TrEMBL:A3LXR6" FT /protein_id="ABN67846.2" FT /translation="MISLFSWLVTLSVISGVLSTIVIFGDLPTFRNTPLQRARSAILSV FT GKLYRFLNERYFKERLSSYMGYFVPLGYLAVVTFCIQQFLKKTLTILFTINNSKLMTYY FT IAFTIALVYVATILAVFSDPGRVTSNSDTSHFKNNQLIFFDHKVCSTCHITKPARSKHC FT STCGHCYMLFDHHCVWVNNCIGYYNYRWFLLFLVANINFLAYGDYLCWKVISSQKVRWG FT KSFWMLIRTTNDVNRITGIFVLLCSIFFCITVLFTGLHLRYIYLGVTTNELDKWSDVEY FT LVTLGSLYHIENGFIDNESYVEKVILQSREEVFISLKNNEILINRDNLPRFDLRKVESV FT ERDLINIYDRGFWNNLMERLFPQ" FT gene <951345..>952484 FT /locus_tag="PICST_36727" FT mRNA join(<951345..951678,951721..>952484) FT /locus_tag="PICST_36727" FT /product="predicted protein" FT CDS_pept join(951345..951678,951721..952484) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_36727" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_36727" FT /db_xref="EnsemblGenomes-Tr:ABN67512" FT /db_xref="UniProtKB/TrEMBL:A3LXR7" FT /protein_id="ABN67512.2" FT /translation="MQTINGLLSSIPFTAKSNDTLTYFLNVYKLNYRALMKLNEQSFKF FT PIESSKVLKLSISLGNLLKTLHNDEENYLEQSQSQRSFLTNLQNSSSNNVNNNNHHSNN FT NINTNSHQDYNPFNVASPVSPKHIINSPISAISGGVGTAGGAGSTGPGVQPLYQIKFVS FT NLLSILKNFDIGTPTNVVNSGSSQHSDLNSVNLKLHEMTSSNSTSTLTSHTTNGTASSS FT NASPIKLNSKQLLIEKLEINIKLDNLFIYRVLLQLLLQILSTLQGFIAVAAENASHSSG FT ILASPASSGSSNDYAENSSIFSSNSLRSSESRNSAMTIDECIRTVQSIVARVSTGIVEP FT FIRLLIVELVENNVSRDFNKLVNSL" FT gene 953215..954993 FT /gene="TRM3" FT /locus_tag="PICST_65944" FT mRNA join(953215..953384,953526..954993) FT /gene="TRM3" FT /locus_tag="PICST_65944" FT /product="tRNA (guanine-N2-)-methyltransferase" FT CDS_pept join(953230..953384,953526..954933) FT /codon_start=1 FT /transl_table=12 FT /gene="TRM3" FT /locus_tag="PICST_65944" FT /product="tRNA (guanine-N2-)-methyltransferase" FT /note="N2,N2-dimethylguanosine-specific
tRNA FT methyltransferase [; go_function RNA binding; tRNA FT (guanine-N2-)-methyltransferase activity; go_process tRNA FT processing" FT /db_xref="EnsemblGenomes-Gn:PICST_65944" FT /db_xref="EnsemblGenomes-Tr:ABN67513" FT /db_xref="GOA:A3LXR8" FT /db_xref="InterPro:IPR002905" FT /db_xref="InterPro:IPR029063" FT /db_xref="InterPro:IPR042296" FT /db_xref="UniProtKB/TrEMBL:A3LXR8" FT /protein_id="ABN67513.2" FT /translation="MINVDDYAIIKEGKAEILTPKEDKVFYNPIQQFNRDLSVMAINAY FT VQLRNENKEEQNSKRRKVDLRAPKINILEALSATGLRAIRYGHEIAQVNKIVANDLLAE FT AVKSIDRNIEYNKLNHVLHSNQGDAIKYMNSSGEKFHVIDLDPYGTATPFLDSAIQAIE FT EDGMLLVTCTDAGVLAGAGYPEKCFALYGGNNFGSAFINSEANHEAGIRLILQMIASTA FT AKYKKSIEPMLSLSIDFYFRLFIKVRTRPIEVKQLSSRTMITYGCNGCGHKVLQPLGRV FT KGNKFQYPKLETVSSECRYCSSYYTVAGPMFLPPLHNHEFIDRILKINSASDKNVYGTT FT ERIKGMLTLAKNELDAPFYFNLSSLASIFKSNPIPIQEFARAIGNAGYKLSLTHAKKNS FT VKTDAPWETVLAIQRAWLIDSNKKYLEENKDKPDLTDKQKDKVNHLQEDIAYNGNLGDH FT STGRKLLEYFASAGSTTSSDEINFKDDNDQSEQLHKLRKVKMVRYQENPTKNWGPKARP FT SSK" FT gene <958530..>959552 FT /gene="CCE1" FT /locus_tag="PICST_32916" FT mRNA <958530..>959552 FT /gene="CCE1" FT /locus_tag="PICST_32916" FT /product="cruciform cutting endonuclease" FT CDS_pept 958530..959552 FT /codon_start=1 FT /transl_table=12 FT /gene="CCE1" FT /locus_tag="PICST_32916" FT /product="cruciform cutting endonuclease" FT /EC_number="3.1.-.-" FT /note="Cruciform cutting endonuclease 1, mitochondrial FT precursor" FT /db_xref="EnsemblGenomes-Gn:PICST_32916" FT /db_xref="EnsemblGenomes-Tr:ABN67514" FT /db_xref="GOA:A3LXR9" FT /db_xref="InterPro:IPR012337" FT /db_xref="InterPro:IPR015242" FT /db_xref="InterPro:IPR036397" FT /db_xref="InterPro:IPR039197" FT /db_xref="UniProtKB/TrEMBL:A3LXR9" FT /protein_id="ABN67514.2" FT /translation="MYHDTLLKYKSTSLNQLALLCGLPTKTNKRARVDCLVQGLNMVSK FT LHPKSPTILSVDIGIKNFSYCKVKLADLAEISEPSIVDKWAKVNLHDTYGSDYVPLLDL FT DTLIDSKRYINYICKRLVSDIVDTPDIVVMETQRTRSNNNAITLPNVLLNYTFENILYA FT NLYNSLPKCVIVPMTSTSMINFWINRFVSKESLRKHSKSSKKIRSQLFFHWLGSSDGPF FT KLPAEVQDKKSLLKYLDLQKSDKIDDLVDSLLYNLTIRTQVSNQINLLRWIDKDLNEFI FT IRRNLSQLNHIYPLIQDLGLRWHEEFELYIDYFFRANNTLPKIIDENSICEFKKLSKLQ FT " FT gene complement(<960019..>961626) FT /gene="PCD1.1" FT /locus_tag="PICST_62046" FT mRNA complement(<960019..>961626) FT /gene="PCD1.1" FT /locus_tag="PICST_62046" FT /product="phosphopantothenoylcysteine decarboxylase" FT /note="Has EST support" FT CDS_pept complement(<960019..>961626) FT /codon_start=1 FT /transl_table=12 FT /gene="PCD1.1" FT /locus_tag="PICST_62046" FT /product="phosphopantothenoylcysteine decarboxylase" FT /db_xref="EnsemblGenomes-Gn:PICST_62046" FT /db_xref="EnsemblGenomes-Tr:ABN67847" FT /db_xref="GOA:A3LXS0" FT /db_xref="InterPro:IPR003382" FT /db_xref="InterPro:IPR036551" FT /db_xref="UniProtKB/TrEMBL:A3LXS0" FT /protein_id="ABN67847.2" FT /translation="LKPSQSVSFGDLDSQERSRRFTISAQPSVVNVTTQVPSRKTSMTT FT SSRKNSTNDVLSFLTTHLHGSNQHPMTSVSSANGAPVSVHGNTSSNNSSRVNSPTTVDP FT SSSALKSSFSFESGKENDSFRQKSPSPPPYARTLGPSGLASPASTTLNSQTQPIKITNS FT GNNSANVSRKGSMKKSNKTVVASPVGPPVPFQQYLSKEYDGKFHILLACTGSVATIKVP FT LIIDKLFQTFGASKISIQLVVTKSSVHFLRGLKIHNDVKIWRDEDEWVNYGEGTLNTTT FT ASTSEANPANKKPKSPYDKLILHNELRRWADIMLIAPLSANTLAKIANGIADNLLTSIV FT RSWGPSTSGQIKKPILVAPAMNTFMYTHPITAKQLALIASPDYGIEVLKPVEKVLVCGD FT IGMGGMREWSELVDLLRRKASIIRAERKTRDEKLLAEEDEDGDEDEDEDEEDDDDGDDG FT DDDDDEDDEDEDEDEDEEDDEDEDDDDDDEVDEKYKDNTEREKTGKVTEESKKQDTDKF FT DDTNDNDEMIFEITDQEGE" FT gene <963262..>963762 FT /gene="SEC11" FT /locus_tag="PICST_36729" FT mRNA <963262..>963762 FT /gene="SEC11" FT /locus_tag="PICST_36729" FT /product="Signal sequence processing protein" FT CDS_pept 963262..963762 FT /codon_start=1 FT /transl_table=12 FT /gene="SEC11" FT /locus_tag="PICST_36729" FT /product="Signal sequence processing protein" FT /EC_number="3.4.21.89" FT /note="signal peptidase subunit; go_function serine-type FT peptidase activity; go_process proteolysis and FT peptidolysis" FT /db_xref="EnsemblGenomes-Gn:PICST_36729" FT /db_xref="EnsemblGenomes-Tr:ABN67515" FT /db_xref="GOA:A3LXS1" FT /db_xref="InterPro:IPR001733" FT /db_xref="InterPro:IPR015927" FT /db_xref="InterPro:IPR019756" FT /db_xref="InterPro:IPR036286" FT /db_xref="UniProtKB/Swiss-Prot:A3LXS1" FT /protein_id="ABN67515.1" FT /translation="MNIRQQLTQFLSLAYVFTSAFVIWKSLGIITNSHSPIVVVLSGSM FT EPAFQRGDILFLWNRDQEAKVGDIVVYEIQGRNIPIVHRVLREHHNSDKQLLLTKGDNN FT AVDDLGLYAKKQKYLNQKTDLVGSVKAYLPKLGYVTILITENVYFKYGMLGLMCISTLL FT TNE" FT gene <965331..>966101 FT /gene="OAR1" FT /locus_tag="PICST_49034" FT mRNA <965331..>966101 FT /gene="OAR1" FT /locus_tag="PICST_49034" FT /product="3-oxoacyl-[acyl-carrier-protein] reductase" FT CDS_pept 965331..966101 FT /codon_start=1 FT /transl_table=12 FT /gene="OAR1" FT /locus_tag="PICST_49034" FT /product="3-oxoacyl-[acyl-carrier-protein] reductase" FT /EC_number="1.1.1.100" FT /note="go_function oxidoreductase activity; go_process FT metabolism" FT /db_xref="EnsemblGenomes-Gn:PICST_49034" FT /db_xref="EnsemblGenomes-Tr:ABN67516" FT /db_xref="GOA:A3LXS2" FT /db_xref="InterPro:IPR002347" FT /db_xref="InterPro:IPR020904" FT /db_xref="InterPro:IPR036291" FT /db_xref="UniProtKB/TrEMBL:A3LXS2" FT /protein_id="ABN67516.2" FT /translation="MYRFRGHKAVITGGSKGLGKAISQKLASQGCSVVLLARSRDLLEQ FT NVKELPKVTDSQQHSYLLVDLQSLSRESPSSKIYSQLANCFENTSILVNCAGITTRNLL FT SKSTSEEINTVIDLNLIAPIILSKLAYKPMLKKSRKLSRDTTEEINSPTILNISSVLSM FT TNISIPGTSIYAASKAGLLGFTRSLAAELGGRVRVNALMPGLIPDTEMGAATDLADKIQ FT TVAMSAVVDQAVSIIGDNTLNGKCLLCDSTVQEM" FT gene complement(<966179..>968080) FT /locus_tag="PICST_62836" FT mRNA complement(<966179..>968080) FT /locus_tag="PICST_62836" FT /product="MCP-domain signal transduction protein" FT CDS_pept complement(966179..968080) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_62836" FT /product="MCP-domain signal transduction protein" FT /db_xref="EnsemblGenomes-Gn:PICST_62836" FT /db_xref="EnsemblGenomes-Tr:ABN67848" FT /db_xref="UniProtKB/TrEMBL:A3LXS3" FT /protein_id="ABN67848.2" FT /translation="MAPRRTPSHSDSLSLSRCKRAVRPFISKVHSLYDLNQKYSSLLVH FT NFPLKEALSCFRPDSTAYSENEQSRKAYNEIKGDKRRKKADYIVPKSNIGIDSDNLDYS FT YEETDSEERASVSPIMQSTLLSRQVDAFVSPKDSFARLLSMKPFITVELYDSYVEVFQI FT FRNIVTSFISSNHPLDQNSSKIPRLSTLSSLKIGKMIALSTKSSFYKLNQALLFDPNTL FT PIYLKEVHNNLNDDIDYWFEVEPTIVIESYRLEFILGYFVHLVVFYSKSVLYCLMPVLI FT HWLFEQAQTDGPNSQVLFTIMNTMFSEYWSITSQDHSDIDCDTTVLLNGNDFRRTNTRS FT FWILFKIGYWSKFVHALGLQSNFSSSCNSSLILETMPVDDKINLEVINEIDSDLSERET FT LIHDIYGVIKANPQHPILNSVLVKLFTELLSETRSRVGRCTNIEDIEESLSDSYLQLND FT FLNIWLGLSNESSLIFNSLYPGNELIFEATSMLLSFIKSKATRTHNRLVRLIDGPYSVD FT AEKVNQLVTDINTICKNSDMLMKCVDILRGYFLDNGKFTPYFPYSENEISRTILQILLC FT ESCYASNRELNDFLLWLYERGELASLELAQSIFKRAYDDHDEFDDDDIEEIGCLLFP" FT gene <968531..>969979 FT /locus_tag="PICST_48346" FT mRNA <968531..>969979 FT /locus_tag="PICST_48346" FT /product="predicted protein" FT CDS_pept <968531..969979 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_48346" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_48346" FT /db_xref="EnsemblGenomes-Tr:ABN67517" FT /db_xref="GOA:A3LXS4" FT /db_xref="InterPro:IPR009011" FT /db_xref="InterPro:IPR026874" FT /db_xref="InterPro:IPR028146" FT /db_xref="InterPro:IPR036607" FT /db_xref="InterPro:IPR039794" FT /db_xref="UniProtKB/TrEMBL:A3LXS4" FT /protein_id="ABN67517.2" FT /translation="IIGVSPEDQHLYNPIIEAGSGKRTWKCLGNPEIVLSYDQINDNYC FT DCPDGSDEPGTNACPYNEKAKFYCANNGHIPGYIENYKLNDGVCDYDICCDGSDEYQTG FT KCENKCPQIHQQYVEYSERVKKDIEKSLQIKTKLIEIAQIRKTEDQNKLKELKEALAKK FT TNDLEQLQQATVDQTEDNKDIGSVFDKLSPHINELTHQVTKHHDNLLKQENKILHLEKI FT LAALTKNYNPNFNDAAVKESVNKFQEYVSNKEDELVEQIEDTHRLLEALAQKSKKITCT FT PHDQPDVIETPSLARLIHHYVSYIAENYLNRFLDKRVDASDYSPLFTEETPSMPSSEAI FT EKLEKEIKSLQMDVSILEDDLKTDYGPNDILRSLVSSRVAGKIGEYNYNLGFVDTITQD FT DVLIGRFSEFKDNTLVYKNGAKCWNGPSRSAVVELICGPHNKLLTVSEPEKCEYLFELV FT TPIICEPFTEDEIFANFKIDHSRL" FT gene complement(<970044..>971468) FT /gene="BUD22" FT /locus_tag="PICST_36730" FT mRNA complement(<970044..>971468) FT /gene="BUD22" FT /locus_tag="PICST_36730" FT /product="protein involved in bud site selection" FT CDS_pept complement(970044..971468) FT /codon_start=1 FT /transl_table=12 FT /gene="BUD22" FT /locus_tag="PICST_36730" FT /product="protein involved in bud site selection" FT /db_xref="EnsemblGenomes-Gn:PICST_36730" FT /db_xref="EnsemblGenomes-Tr:ABN67849" FT /db_xref="InterPro:IPR015158" FT /db_xref="InterPro:IPR037393" FT /db_xref="UniProtKB/TrEMBL:A3LXS5" FT /protein_id="ABN67849.2" FT /translation="MWRLDLLEVKFHNCPARFPHTKKLLNARNNEKLLKRLPTSVKDAD FT NEILALKKEYFDKKYYGSYKKLEKEINKVVKTEISKLKQDKTKNQSTINFLESGENVKL FT LITSKLVKSLTTSILINKDLKLNPPNYISEDVREIILDKSNIANPSKFFIQFCQNDKNL FT NNYFSNLWNNKSIKSIISEIEWSFKIVRGNLTTQEKDARRKATGREISDDEKEASIGDS FT EVSEDDDDEDHHEQEEEDMEELDTEGVYEKFAIYDKLVGDSDNEDEEQAPDLDPSINYN FT EVTDEEPSDESEEDEELDSDSSSDDGFFEQDESSKKSTKKEKKDYNLPQLASGYFSGGS FT DDEGEDVDNDKVVKDITTQRKNRRGQRARQKIWAQKYGREAKHVKSEIEKAASDRERRR FT LEYEERCRKREEKNNLAPTGSNTAPLGDRKVRNGVSPAPGPPSDTTKMHPSWEAKKLAE FT EKLKNVKFQGKKITFD" FT gene <971788..>973050 FT /locus_tag="PICST_32922" FT mRNA <971788..>973050 FT /locus_tag="PICST_32922" FT /product="predicted protein" FT CDS_pept 971788..973050 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32922" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32922" FT /db_xref="EnsemblGenomes-Tr:ABN67518" FT /db_xref="GOA:A3LXS6" FT /db_xref="InterPro:IPR007871" FT /db_xref="InterPro:IPR021721" FT /db_xref="InterPro:IPR022776" FT /db_xref="InterPro:IPR039044" FT /db_xref="UniProtKB/Swiss-Prot:A3LXS6" FT /protein_id="ABN67518.2" FT /translation="MIKKNRRCAMRRKGSQKYCSEHIIYNESSSIVNTDTKLSEDERVP FT CPLDGKHTVWKKNLAVHLKKCNAKPVERTEEWFSKDINVKLKNSLGETEDITRSEDKTL FT DEKDLYSKYIPIIEGINFEPLQYRISEHSGLQQRLNEVLIQKHALQQSSLIGNIKDAKL FT LSPNNTFVEFGCGKAELSRFVNLCLLDDLKQKVNNEVTLENYGYGFIDRGVNRMKMDKK FT ILKDCLDSPIEITPRIQRTRIDIKDLDLDKFINKLQPSKIVAISKHLCGAATDLTLKSL FT LNSSLLSDNRDKFGGLLIAMCCRHVCSYDQLLPKSREYLAEKGFKTPDSFRILKKMVSW FT AVCSKKEHAKNVERLEAEHISQLDYSSRERLGFVARRLIDESRVYALKSMLSGFEVKMF FT WYVEKDVTLENVCLYVGQEPM" FT gene complement(973173..973792) FT /gene="TCT1" FT /locus_tag="PICST_79049" FT mRNA complement(973173..973792) FT /gene="TCT1" FT /locus_tag="PICST_79049" FT /product="Translationally controlled tumor protein homolog FT (TCTP)" FT CDS_pept complement(973255..973758) FT /codon_start=1 FT /transl_table=12 FT /gene="TCT1" FT /locus_tag="PICST_79049" FT /product="Translationally controlled tumor protein homolog FT (TCTP)" FT /note="go_component cytoplasm; go_function molecular FT function unknown" FT /db_xref="EnsemblGenomes-Gn:PICST_79049" FT /db_xref="EnsemblGenomes-Tr:ABN67850" FT /db_xref="InterPro:IPR011057" FT /db_xref="InterPro:IPR011323" FT /db_xref="InterPro:IPR018103" FT /db_xref="InterPro:IPR018105" FT /db_xref="InterPro:IPR034737" FT /db_xref="UniProtKB/TrEMBL:A3LXS7" FT /protein_id="ABN67850.1" FT /translation="MIIYTDVISGDELLSDAYDVKEVGGVIYEADCAMVTVGNGDIDIG FT ANPSAEDGDEDVEDGAETVNNVVYSFRLQQTQFDKKSFLTYIKGYMKAVKAHLAEKNPE FT EVEVFEKGATAYVKKIVGSFNDWDFYTGESMDPDAMIVLLNYREDGTTPYVAIWKHGVK FT AEKI" FT gene complement(974207..976980) FT /gene="DAP2" FT /locus_tag="PICST_84390" FT mRNA complement(974207..976980) FT /gene="DAP2" FT /locus_tag="PICST_84390" FT /product="dipeptidyl aminopeptidase B" FT CDS_pept complement(974280..976838) FT /codon_start=1 FT /transl_table=12 FT /gene="DAP2" FT /locus_tag="PICST_84390" FT /product="dipeptidyl aminopeptidase B" FT /EC_number="3.4.14.11" FT /note="go_component membrane; go_function serine-type FT peptidase activity; dipeptidyl-peptidase IV activity; FT go_process proteolysis and peptidolysis" FT /db_xref="EnsemblGenomes-Gn:PICST_84390" FT /db_xref="EnsemblGenomes-Tr:ABN67851" FT /db_xref="GOA:A3LXS8" FT /db_xref="InterPro:IPR001375" FT /db_xref="InterPro:IPR002469" FT /db_xref="InterPro:IPR002471" FT /db_xref="InterPro:IPR029058" FT /db_xref="InterPro:IPR038554" FT /db_xref="UniProtKB/TrEMBL:A3LXS8" FT /protein_id="ABN67851.2" FT /translation="MTNKYDSDAHVPEVKKKDFRRSYESELDNEFSSRVNHYNYKNFFI FT SGVLLSILIWGSSFLITAITNLRTTEILHHEYEQLLKANSPPLLQSRPAVAWDGSGKIP FT LNFSAVRDGKFRPNYKSLQWIHEPSSIESDKGTYVLKDDSNGHLEYTIKSIVDDDYSFT FT LYNGSTFNYSDTEYKIESLIASPDLTKAILKTNATHNWRHSSFALYWLLDISESSITPI FT LDTTSKLAVTSWSPKSTDIAFIFDNNVYVKNIASGEVKQVTFDGSSQVFNGKPDWVYEE FT EVFAGDIVLWWSPSGDKFTFLKSNDTEVPEFTIPYYVQNGHEDYPEVVQIKYPKAGYPN FT PSVELVIYDLDTEKDQLLELKSEKIVSSDRLITEVVWVGSSVLVKTSNRASDLLEIFLV FT DSVQNESKIVRSLTADDSWFEVTSNTLFVPKNESLGRLEDGYVDTVVSGGFNHLAYFSP FT PSASEGVLLTNGQWEVVGGVEAFDFNKNKVYFVSTMKSSVERHIHSVSLFDKSNNGLPK FT VENITSGEGWFAGSFSSGSRYLLLTYEGPEVPYQKLIDLSSLKDVKTIESNQEVIDNLD FT DYLIPEVKYEVIELQDEETGEIFKANAIETLPLHFDSRHKYPVLFFVYGGPGSQLVTKN FT FAVSFSSVVAAELNAIVVTVDGRGTGYNNYNDDLGSQYKFIVRDKLGKYEPLDQIAAAR FT LWSEKSYVDSDRIAIWGWSYGGFLTLKTLETDVKHKVFSYGVSIAPVTKWKLYDSIYTE FT RYMRTPQENPAGYEIASIHNITNFEHVKKFFIGHGSGDDNVHVQNTLKLIDEFNLGNIE FT NFDFMIFPDSDHSIRYHNGNKVVYDRILTFLRRAFNGEFA" FT gene complement(977559..981853) FT /gene="SLN1" FT /locus_tag="PICST_84973" FT mRNA complement(join(977559..978944,979158..980762, FT 980787..981853)) FT /gene="SLN1" FT /locus_tag="PICST_84973" FT /product="histidine kinase osmosensor Osmolarity FT two-component system protein SLN1" FT CDS_pept complement(join(977761..978944,979158..980762, FT 980787..981504)) FT /codon_start=1 FT /transl_table=12 FT /gene="SLN1" FT /locus_tag="PICST_84973" FT /product="histidine kinase osmosensor Osmolarity FT two-component system protein SLN1" FT /EC_number="2.7.3.-" FT /note="Sensory transduction histidine kinase; go_component FT membrane; go_function two-component response regulator FT activity; DNA binding; two-component sensor molecule FT activity; ATP binding; go_process two-component signal FT transduction system (phosphorelay); regulation of FT transcription, DNA-dependent; signal transduction" FT /db_xref="EnsemblGenomes-Gn:PICST_84973" FT /db_xref="EnsemblGenomes-Tr:ABN67852" FT /db_xref="GOA:A3LXS9" FT /db_xref="InterPro:IPR001789" FT /db_xref="InterPro:IPR003594" FT /db_xref="InterPro:IPR003661" FT /db_xref="InterPro:IPR004358" FT /db_xref="InterPro:IPR005467" FT /db_xref="InterPro:IPR011006" FT /db_xref="InterPro:IPR036097" FT /db_xref="InterPro:IPR036890" FT /db_xref="UniProtKB/TrEMBL:A3LXS9" FT /protein_id="ABN67852.2" FT /translation="MRRLKIGIRPQLIILVGFASLFSLLILAIVTAVYFSSNLSDLRAE FT RLEVISQLKTTQVRQAVEYIYYQVYWLTTKDSIYAPLSSYRAGNITTSIFSEAQNTLDQ FT FLISSELFAAARLYNLNLEIVAESYNNATSISQPAMDFLYPLAQNATIPQSLLQQSSNN FT VEPYFTGPIGNSTDPNSAFYMGITLPIYSNSSIILDDPSLSGYLTVIASAQSIQAAIND FT TTGFSNNSSADYIVIALHGATTFNSDETGQVIGFQTVFPVKDNILSPNNVYNINDSSSV FT KEAFSRTYGSATNVRSITGKYVAIGFNQILLDSTTRWAVIIEQARSKFLQPVNNLRKII FT IGVVIGIGVFMCLITFPLAVFFIRPITKLKEATEAITKSKKQFKQQKDRDSSAASPIPS FT SNPPPPYTTLNHRHKRNSVKSTSNTSTSGSLYSTAIRLPGRIPNSKKFFKDEFTELSEA FT FNIMTEELDKQYTHLEDRVKLRTKELEASKIEAESANEAKTVFIANISHELRTPLNGIL FT GMTSIAMDEEDQTRIQDSLKLIHRSGELLLHILTELLTYSKNTLNRSKLEKSNFQILEV FT VYQVKSIFSKLAMDQRVNFKIWVRPNIFRKLILYGDSNRIIQVVMNLVSNSLKFTPIDG FT SVEVTFKLLGEYDKERSQQDGYKQVHVLKGTKTSPNSSTSNEATGMAKSTSSSTLAIMS FT SYYKTKPIPKIGKPTPALPEERSNDIELSPVKSNSSDSTDLSKNLDSDRVSLSTISTTE FT YENKIFESQFNHMKALPKLPVTFRIRNMYKPKTWVVQIEVRDTGPGIEPALQEKVFEPF FT VQGDQTLSRSYGGTGLGLSICRQLATMMKGTLTLKSAIGVGSIFTFTVPLPQTGEILVD FT ESEMGEFCEDEFNPKARVNRKVAFKNSTMDVDNPTHHEYENDELSEKDDFVEMSPLRPQ FT PPPSRVRTDSVPRSDSSGDSPRQENSDSPGSSGSFQLLGKVDPPRTTYEKPHLITRSST FT GTANSANASDRSDLHHNILDDLSDLKILVAEDNSVNQEVIKRMLKLEGFTNITLACNGA FT EAVELTKESIEKDEIFDLIFMDVQMPKIDGLLATRMIRTNLRFENPIIALTAFADESNV FT KECLNSGMSGFLSKPIRRTNLRKIIVEFSPVLLSEIVTTPQTHQSDEKRLGYPPTNLGS FT SA" FT gene complement(<990088..>994134) FT /gene="HYR5.1" FT /locus_tag="PICST_17474" FT mRNA complement(join(<990088..990216,990258..990269, FT 990481..990926,992982..>994134)) FT /gene="HYR5.1" FT /locus_tag="PICST_17474" FT /product="hyphally regulated cell wall protein" FT /note="Has EST support; similar to cell surface flocculin FT similar to HYR1" FT CDS_pept complement(join(<990088..990216,990258..990269, FT 990481..990926,992982..994134)) FT /codon_start=1 FT /transl_table=12 FT /gene="HYR5.1" FT /locus_tag="PICST_17474" FT /product="hyphally regulated cell wall protein" FT /db_xref="EnsemblGenomes-Gn:PICST_17474" FT /db_xref="EnsemblGenomes-Tr:ABN67853" FT /db_xref="GOA:A3LXT0" FT /db_xref="InterPro:IPR008440" FT /db_xref="InterPro:IPR021031" FT /db_xref="UniProtKB/TrEMBL:A3LXT0" FT /protein_id="ABN67853.2" FT /translation="MLFRNYFAAAFCLISGVVARTITQDTVSRGTISLGLGDTIINDGV FT YWSIIDNVVTAFAGNVDVGTGSGLYITGLNPLLSLQVTLLSGSLTNDGVIAFNAIQSLL FT APTYNLVGISFTNNGEMYLGADGSVGIPSISITTPVWNNNGLLVFYQNTRTTGPVNLGT FT IGSTINNNGQICFYNELYTQTTNIAGTGCITLVEDSSIFFSNTLLNIDTNQVFYLEDSA FT SSIRATAISAPKTYTVAGFGNGNKIGLDIPLVNIPPLLTGYTYSTTTGILTLKGAGVLA FT MNFNIGKGYNPSLFSIVTDDDVGLASVLFGAVSYSGPPPNPVPSICKQCKTLPPAPGTS FT PTVTTTTVATTNTAGFTCSEVDQILVSTDTNYSWFTSTSTITVSCGTDTVVVEVPSNAQ FT TTVTSTWTGTEITTVTISDTVGGTDTVIVEVPSTANIQTTLTSTWTGSDITTTTVTDTP FT GGTDTVIIEVPTTANSQTTLTSTWTGTETTTVTLTDTLGGTDTVIVEVPSTPNSQTTLT FT STWTGTETTTVTISDTTPKVTTLTSTWTGTETTTVTLTDTQGGTDTVIVEVPSNEQTTL FT TSTW" FT gene complement(<998074..999638) FT /locus_tag="PICST_68115" FT mRNA complement(<998074..999638) FT /locus_tag="PICST_68115" FT /product="predicted protein" FT CDS_pept complement(998091..999638) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_68115" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_68115" FT /db_xref="EnsemblGenomes-Tr:ABN67854" FT /db_xref="GOA:A3LXT1" FT /db_xref="InterPro:IPR003788" FT /db_xref="InterPro:IPR029063" FT /db_xref="InterPro:IPR038375" FT /db_xref="UniProtKB/TrEMBL:A3LXT1" FT /protein_id="ABN67854.1" FT /translation="MLTNFRLLASKPIVRSGKTVLRGFVSSCRNLEGKKSGPPIDENNL FT YYGQFTKEEYETASKYVKEQLAKMEGEIKGDFNIRENLGKVPQFPSRDSKGSTSVNNLT FT DLFTQTIKTTGPISLSAYMRQCLTHPDFGYYTTRDPLDHRSGDFITSPEISSVFGEMIG FT IWLYTVWQNQNFPGKIRIIEFGPGKGTLMHDVLNTFNKFVFKSRKAVKIEINLIEASKV FT LRQEQWKLLCGEKNEFQTDNEGFNLSKTIWSNDIKWLDTEKDIIQDPDVANYVLAHEFF FT DALPIKGFERTEHGWRELLVEHTESVVNTQPKLPGTSIDEDDSLLNTEFHLTLSKKETP FT SSIIPTLHRRFKDLPVGSRIEICSEAELYIMKMAQLVNNEKKLGAVLVIDYGLVNQIPE FT NSLRGIYQHKFVSPFIKPGDVDLSVDVDFDNLVNLTSTHCSVFGPIDQGDWLHNIGVGY FT RVDQLIKQNDHDHEKQEKIYNSYRRLTDKDEKSMGKIYKFLCLGPHDSPIPAGFGDN" FT gene complement(<999986..>1000897) FT /locus_tag="PICST_48184" FT mRNA complement(<999986..>1000897) FT /locus_tag="PICST_48184" FT /product="predicted protein" FT CDS_pept complement(999986..>1000897) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_48184" FT /product="predicted protein" FT /note="go_function N-acetyltransferase activity" FT /db_xref="EnsemblGenomes-Gn:PICST_48184" FT /db_xref="EnsemblGenomes-Tr:ABN67855" FT /db_xref="GOA:A3LXT2" FT /db_xref="InterPro:IPR000182" FT /db_xref="InterPro:IPR016181" FT /db_xref="UniProtKB/TrEMBL:A3LXT2" FT /protein_id="ABN67855.2" FT /translation="STSSKSDVTSFSIPSNLDISIGIASVKDYRRVAKTLLLSFEDDPF FT MNYILNTSQITKENTPKSAYKKKKLDLMQAYFEYDAYECISLGGTIFIVKDNSFEATLD FT DLGVKKYKFPYLGVALWNQIYGADCSSSGSDSDDDSGEIFASSNLRFFDNIHPSYFKFN FT VYSILGNCRSKVLNDKLPFLTKVRKEVLVNKLIKKPELNRNGSIDIWYLNDIATLPSMR FT GKGLGKILIHHSLEEFKKQNPYTYAYLESSNPNNRKFYLKLGYKVMTSFSIKYNKIVDS FT DKIAEIDPKNEAINMDSMLFFP" FT gene <1004090..>1005073 FT /locus_tag="PICST_61419" FT mRNA <1004090..>1005073 FT /locus_tag="PICST_61419" FT /product="predicted protein" FT CDS_pept 1004090..1005073 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_61419" FT /product="predicted protein" FT /note="go_function hydrolase activity" FT /db_xref="EnsemblGenomes-Gn:PICST_61419" FT /db_xref="EnsemblGenomes-Tr:ABN67519" FT /db_xref="GOA:A3LXT3" FT /db_xref="InterPro:IPR004843" FT /db_xref="InterPro:IPR006186" FT /db_xref="InterPro:IPR011159" FT /db_xref="InterPro:IPR029052" FT /db_xref="InterPro:IPR031675" FT /db_xref="UniProtKB/TrEMBL:A3LXT3" FT /protein_id="ABN67519.2" FT /translation="MSGNTIDIEDLIQRLLDAGYSGKRTKNVCLKNNEIQLICSTAREI FT FLSQPSLLELSPPVKVVGDVHGQYGDLIRIFTKCGFPPSTNYLFLGDYVDRGKQSLETI FT LLLLCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRCNIKTWKLFIDTFNTLPIAA FT IVAGKIFCVHGGLSPVLNSMDEIRNIARPTDVPDFGLLNDLLWSDPADTLNEWEDNERG FT VSYVFSKVAINKFLSKFGFDLVCRAHMVVEDGYEFFNDRTLVTVFSAPNYCGEFDNWGA FT VMSVSEELLCSFELLDPLDSVALKQVMKKGKQERKSAQLQRVSSQR" FT gene <1005397..>1006272 FT /locus_tag="PICST_32931" FT mRNA <1005397..>1006272 FT /locus_tag="PICST_32931" FT /product="predicted protein" FT CDS_pept 1005397..1006272 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32931" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32931" FT /db_xref="EnsemblGenomes-Tr:ABN67520" FT /db_xref="UniProtKB/TrEMBL:A3LXT4" FT /protein_id="ABN67520.2" FT /translation="MTESGSSNSVVQASNYYFILKTENLQPLLEITYQLTEQIESNQTV FT IDKLCYIADNKIRYPETTINFEKFGLTLAEDGESDSKSTESGGKDDSIHEKDHEITKLM FT ASINEEDEKERDQDEDVTQGEDDPIRYLLVQKYSLDKIELDSTPDLGVFASNARIAQLV FT EDNMKLTKIRQIKKYKNQELLKLIYDYERFIVEDILPSLRSELIKLTSTTTCTSADDKS FT LQDYVELKFELLGKMYQRYTMNVKYLSKLLSYSHALLRYSSDKEDLLYKLSHQFEALEF FT LQKNMSKLLK" FT gene complement(<1007799..1009644) FT /gene="USV1" FT /locus_tag="PICST_68117" FT mRNA complement(<1007799..1009644) FT /gene="USV1" FT /locus_tag="PICST_68117" FT /product="Up in starvation" FT CDS_pept complement(1007893..1009644) FT /codon_start=1 FT /transl_table=12 FT /gene="USV1" FT /locus_tag="PICST_68117" FT /product="Up in starvation" FT /note="Up in StarVation Zn-finger strongly conserved FT (RGM1); go_component nucleus; go_function nucleic acid FT binding; zinc ion binding; go_component nucleus; FT go_function nucleic acid binding; zinc ion binding" FT /db_xref="EnsemblGenomes-Gn:PICST_68117" FT /db_xref="EnsemblGenomes-Tr:ABN67856" FT /db_xref="GOA:A3LXT5" FT /db_xref="InterPro:IPR013087" FT /db_xref="InterPro:IPR036236" FT /db_xref="UniProtKB/TrEMBL:A3LXT5" FT /protein_id="ABN67856.2" FT /translation="MLNNTHGDVISQQKDSPKSVESDSSTSSKPKSKRSSKGRVFLCTG FT YPGCNMSFTRSEHLARHKRKHTGERPFTCPYCSKNFSRLDNLRQHKQTVHAYETYLQRN FT GNSNDVYSGSQRGESEDKFQLDRTNASSSSSISSSSSKGRNDDHSLHHHHHYHPATPNN FT PLFSLNETGAFKSAAGIPQVGYSGVPGTMMSPPNSQSPHYHNQAYYMNGPSANHPHHPI FT QHGHQHLYPYQGQSQSHTAPQHQPSHSAPLYGQQYESQAPAHYPSQPPPVPPKPHQDNT FT LRIPKHQFKPKRRPRPLSLQHSFVNDPESESTSPVSMSSSLANNSGYRTAPANSTTFST FT ISKTSTSTTTTVISYPPAPKSASSVASLTPNLVSPLSPLFHQSFSQTTSRNNDRSSFGA FT RSLHSLTMPSTTNFTIHSGGSRSSLPSIQHLPLNGNGDEDNNSIVGPISTISHNSLDGI FT LKTRTDFANKMLPPLPQAAGDNTKTWLKGVLNDDGTVSTTSISPSTSDASCNDMDIKME FT EVPSGQIPPNTTTTDILNAETTTATNPTDSSTMATSKNETANKILYSSKKPTINSLLSP FT TEHRKFS" FT gene complement(<1013902..>1014684) FT /locus_tag="PICST_61694" FT mRNA complement(join(<1013902..1014482,1014591..>1014684)) FT /locus_tag="PICST_61694" FT /product="predicted protein" FT CDS_pept complement(join(1013902..1014482,1014591..1014684)) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_61694" FT /product="predicted protein" FT /note="go_function GTP binding; go_process small GTPase FT mediated signal transduction" FT /db_xref="EnsemblGenomes-Gn:PICST_61694" FT /db_xref="EnsemblGenomes-Tr:ABN67857" FT /db_xref="GOA:A3LXT6" FT /db_xref="InterPro:IPR001806" FT /db_xref="InterPro:IPR005225" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A3LXT6" FT /protein_id="ABN67857.2" FT /translation="MSTNNNPTPSGTSDKSNILRKYKIVFLGDQSVGKTSLITRFMYDT FT FDETYAATIGIDFLSKTMYLDDNRTIRLQLWDTAGQERFRSLIPSYIRDSHVAVICYDI FT TNKKSFNNLDKWIKDVKLERGDDVIIVLVGNKSDLANDKRQVTLEDVEALHRKVGSKFF FT IETSTKANHNVKLLFKKIAQSLPEFNTSVNDELAMENRANKPETIDISIENNAAPSNSS FT CC" FT gene <1015250..>1015645 FT /locus_tag="PICST_47586" FT mRNA <1015250..>1015645 FT /locus_tag="PICST_47586" FT /product="predicted protein" FT CDS_pept 1015250..1015645 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_47586" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_47586" FT /db_xref="EnsemblGenomes-Tr:ABN67521" FT /db_xref="GOA:A3LXT7" FT /db_xref="InterPro:IPR002836" FT /db_xref="InterPro:IPR036883" FT /db_xref="UniProtKB/TrEMBL:A3LXT7" FT /protein_id="ABN67521.1" FT /translation="MDDSELNAIRAARLAELQKQTGGSSDSGQSSPQDEARASALSRVL FT EPSARERLSRVRMVRPERAQQVEQYILRLFQTGSINRKLSEKDIVEILDGISRDSNKQA FT STKIIYDRKQNTIDDEEEEEEEDDFFD" FT gene 1016118..1018998 FT /locus_tag="PICST_73373" FT mRNA join(1016118..1016283,1016353..1018998) FT /locus_tag="PICST_73373" FT /product="predicted protein" FT CDS_pept join(1016123..1016283,1016353..1018915) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_73373" FT /product="predicted protein" FT /note="go_component microtubule associated complex; FT go_function motor activity; ATP binding" FT /db_xref="EnsemblGenomes-Gn:PICST_73373" FT /db_xref="EnsemblGenomes-Tr:ABN67522" FT /db_xref="GOA:A3LXT8" FT /db_xref="InterPro:IPR001752" FT /db_xref="InterPro:IPR019821" FT /db_xref="InterPro:IPR027417" FT /db_xref="InterPro:IPR027640" FT /db_xref="InterPro:IPR036961" FT /db_xref="UniProtKB/TrEMBL:A3LXT8" FT /protein_id="ABN67522.2" FT /translation="MSNIQVAVRCRGRNDKEVAAKSPIVIDLPNDTFSVTDPYVSINHN FT YTTQTVSSFNYKTYKVDQVYGSQADQNLIFEKVALPLFNDFLQGSNVTILAYGQTGTGK FT TFTMCGGEQKNSNVDYKHSETAGIIPRVLIELFNKLEPEGAASDYVVKCSFLELYNEDL FT KDLLNDDEKPAKLRIYESTVAANGNKKEAGKASKTISIQNLREESISSCQDGFQILQKG FT LLKRKTASTKLNDVSSRSHTLFTINLYRNQPGSDGTGSQLFKVSKMNLVDLAGSENIYR FT SGAQNQRAKEAGSINQSLLTLGRVINSLSELANSSNADNTFHIPYRESKLTRLLQDSIG FT GCTKTSLIATISPAKINIDETISTLDYACKAKNIKNLPQSGHDSDLIMKRVLVKNLSQE FT IAKLNFDLIATRNKNGIWLNEDNYNAIMEENESLKASLKESNLQNESLNSKISQFEVFK FT ANNENNIKKLREQINKQVGINEELSNESTSLKSYIVSKDEEIKQLSEQLVKANEKFSST FT TNQLVKVIYRNLDTSINSIQDILSQYNNSANGETLFTFNTQLTGNIENFRKSLEEKIAE FT INDNLANSLLQDLPYFLEKYNENYDKLSTLISSLNSQLMQNLSDLKVANDKLSGYIIED FT HLNYNAQELISQLIETKVSSQLTKLHEKMDKSIATILRDSKQNYKKLFETSISQISQEL FT IESERNEISKREKNWSTETSRVLNVIDSQMYEARQEEVEQSKAIFDSLSMSTTERLTDL FT KNKTTENLSKLTELVSNEENPKVSLLQRNLPCLEDISKNIQLNDIKIRDSLTTIDKSLQ FT DIKQFDAKQAFKLSPVRGSKQIEIDGLKRSPSRSPSYSNPPSRTASRQISPIKTAGTLA FT RTKIPQLNRSLDNKENQGPSQKRRRVLQQVDNFLHG" FT gene 1019557..1021736 FT /locus_tag="PICST_84817" FT mRNA join(1019557..1020854,1021011..1021130,1021230..1021736) FT /locus_tag="PICST_84817" FT /product="predicted protein" FT CDS_pept join(1019673..1020854,1021011..1021130,1021230..1021634) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_84817" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_84817" FT /db_xref="EnsemblGenomes-Tr:ABN67523" FT /db_xref="GOA:A3LXT9" FT /db_xref="InterPro:IPR001841" FT /db_xref="InterPro:IPR013083" FT /db_xref="InterPro:IPR024766" FT /db_xref="UniProtKB/TrEMBL:A3LXT9" FT /protein_id="ABN67523.2" FT /translation="MIPKGMQYLLGYTIISMASLAWASYDSLTKAVNFEVFLMEMTDGV FT KLGILINSVALNFVMVGKILQLSLFGELRLLEADHLMEKLPFYAGNLLFNLATTDNFLL FT NSFLLVTAVGFKAFHIILIDRADYVNLRIANNSNNETYTRAIIIKKYVFNLYFWLVFFF FT IFLDFSIAKLLVYDVFQGINSVVCLLFGFEFAIQGVEALTYCAKMFINIYELAVYRINE FT HHDNSEDDDDFLDEDIDIIWETKAFYSKGIDIASSSLMAVSYLAFIYLLTFHSVLSLPI FT SMLQGTYSSLKQTYTEVRQLFAFIESSKRLDNQLRTATKEDLEATDNLCIICREDMNSV FT EDYETNFKKSLPARRRPKALPCGHILHMGCLKEWLERSDSCPLCRKKVFDPPDQNIQRE FT EANHPQEQNQEEAQQHQLEENENQAQREIPANPEDNQEEIEDQQQSEGSESQTKSDVKE FT SSSLQIDNSSGADVVEGSSNNIPDSSVATPSNPSGERQTIKLPPNSLLPPGWAVLPLKR FT TTFIESGGRVDYYVSFSRFQKGALKIRQVEPINNRIIYPFTQVKQDGEPEE" FT gene complement(<1021745..>1023229) FT /locus_tag="PICST_32937" FT mRNA complement(<1021745..>1023229) FT /locus_tag="PICST_32937" FT /product="predicted protein" FT CDS_pept complement(1021745..1023229) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32937" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32937" FT /db_xref="EnsemblGenomes-Tr:ABN67858" FT /db_xref="GOA:A3LXU0" FT /db_xref="InterPro:IPR007224" FT /db_xref="UniProtKB/TrEMBL:A3LXU0" FT /protein_id="ABN67858.2" FT /translation="MFEDIVYRNAGNEGGNQNLGRLLSKYIEIKKFEEIYKQDHSHKTR FT SKLRKSKYIKKALKVIHRELKKRLKPEETYEIWHGLDHLNANVEKKKQNNTKSKIRDED FT NPSEFAKKIIERIEAGSENEHTSAYDDYDEYNHKIQSTLAKFTGAFDSSNHWVKSSFLI FT RTNGLEVLPTIKQENKDYVQRQHIGNLKVLLHLNVLRQNWDLAYKIFCLLIRLPSVDIR FT AIWPIGIEILIRQQEKLTHEGAERITSKDERFYDWLSSFFTIAYVNAAHSDGPSKVSLA FT PIWRSGSKSHTPLYIVSSLWNLLSKGKYQTLEQRLGELVLEPPYNSDGVFYFLMVLCNI FT VEATEIVNRFLKDRTDYIDGVVSRAIDSDGVVISLERLVASIEKNLKMCDTLHFVYSKE FT TIDNQIALLFHLVRADIRAKSIEDEDESEESSADEIADFPEDNELPRYGSRRASNVSDD FT LESPEFNEEFESNRYPDAQAQKKESTNDMDMDFDFD" FT gene complement(1023276..1025332) FT /locus_tag="PICST_90190" FT mRNA complement(1023276..1025332) FT /locus_tag="PICST_90190" FT /product="predicted protein" FT CDS_pept complement(1023543..1025252) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_90190" FT /product="mitochondrial groEL-type heat shock protein" FT /db_xref="EnsemblGenomes-Gn:PICST_90190" FT /db_xref="EnsemblGenomes-Tr:ABN67859" FT /db_xref="GOA:A3LXU1" FT /db_xref="InterPro:IPR001844" FT /db_xref="InterPro:IPR002423" FT /db_xref="InterPro:IPR018370" FT /db_xref="InterPro:IPR027409" FT /db_xref="InterPro:IPR027410" FT /db_xref="InterPro:IPR027413" FT /db_xref="UniProtKB/TrEMBL:A3LXU1" FT /protein_id="ABN67859.1" FT /translation="MLRASRPTVRNATVSFVRHLSHKELKFGVEGRAALLKGVNTLADA FT VSVTLGPKGRNVLIEQQFGAPKITKDGVTVARSITLQDKFEDMGAKLLQEVASKTNESA FT GDGTTSATILGRSIFTESVKNVAAGCNPMDLRRGSQAAVEAVVNFLQQNKKEITTSEEI FT AQVATISANGDEHIGNLLASAMEKVGKEGVITVKEGKTLEDELEVTEGMRFDRGFISPY FT FITNTKSGKVEFENPLILLSEKKISSIQDILPSLELSNQTRRPLLILAEDVDGEALAAC FT ILNKLRGQVQVCAVKAPGFGDNRKNTLGDIAILTGGTVFTEELDIKPENATVDLLGSAG FT SITVTKEDTVVLNGEGSKDNIAARCEQIRVSVEDALTTEYEKEKLQERLAKLSGGVAVI FT KVGGSSEVEVGEKKDRYDDALNATRAAVQEGILPGGGTALIKASRILDEVKANSANFDQ FT KLGVEAIKAAITKPAKRIIENAGEESAVIVGKIYDDLSFNNGYDSAKGEFTDMIAAGII FT DPFKVVKNGLVDASGVASLLATTECAIVDAPEPKGAPAAPPAGGMGGMPGMF" FT gene complement(<1027665..>1028411) FT /gene="CRZ2" FT /locus_tag="PICST_61434" FT mRNA complement(join(<1027665..1027765,1027796..1028252, FT 1028292..>1028411)) FT /gene="CRZ2" FT /locus_tag="PICST_61434" FT /product="calcineurin responsive zinc-finger" FT CDS_pept complement(join(1027665..1027765,1027796..1028252, FT 1028292..>1028411)) FT /codon_start=1 FT /transl_table=12 FT /gene="CRZ2" FT /locus_tag="PICST_61434" FT /product="calcineurin responsive zinc-finger" FT /note="zf-C2H2 Zinc finger, C2H2 type calcineurin FT responsive zinc-finger; go_component nucleus; go_function FT nucleic acid binding; zinc ion binding" FT /db_xref="EnsemblGenomes-Gn:PICST_61434" FT /db_xref="EnsemblGenomes-Tr:ABN67860" FT /db_xref="GOA:A3LXU2" FT /db_xref="InterPro:IPR013087" FT /db_xref="InterPro:IPR036236" FT /db_xref="UniProtKB/TrEMBL:A3LXU2" FT /protein_id="ABN67860.2" FT /translation="PILPSTQAPHGRNGYPISPVSIHDITRDATSSASSTSSSSGSSNL FT PIDYSSIVSYTISPSLKRKRRRRKQSLEVDPATGAAGSETYPCEVCDKVFLKPYNLKSH FT MKTHSSDKPFKCSHCFKTFARSHDKKRHELLHNGVKNFKCEGYLQDGVTKWGCGKKFAR FT SDALSRHFRTETGWLCIRPLMDEAKRLEENPNNPRAVLSQGEMTPGEFLDSSSFIRRLI FT QSK" FT gene complement(<1031111..>1031772) FT /locus_tag="PICST_32941" FT mRNA complement(join(<1031111..1031171,1031235..1031352, FT 1031649..>1031772)) FT /locus_tag="PICST_32941" FT /product="predicted protein" FT CDS_pept complement(join(1031111..1031171,1031235..1031352, FT 1031649..1031772)) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32941" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32941" FT /db_xref="EnsemblGenomes-Tr:ABN67861" FT /db_xref="UniProtKB/TrEMBL:A3LXU3" FT /protein_id="ABN67861.2" FT /translation="MTYWDDYGILSAVAKDLWYWLPWNIEVLIDRLLQYLEKIGSDAHA FT CFIVPNQGMVQMPSFWFDLRVIEIKRGYPEFQFRTCSSPLAPESKSCLALQFGGF" FT gene <1031893..>1033407 FT /gene="DAL1" FT /locus_tag="PICST_62778" FT mRNA <1031893..>1033407 FT /gene="DAL1" FT /locus_tag="PICST_62778" FT /product="putative allantoate permease" FT CDS_pept 1031893..1033407 FT /codon_start=1 FT /transl_table=12 FT /gene="DAL1" FT /locus_tag="PICST_62778" FT /product="putative allantoate permease" FT /note="Permease of the major facilitator superfamily" FT /db_xref="EnsemblGenomes-Gn:PICST_62778" FT /db_xref="EnsemblGenomes-Tr:ABN67524" FT /db_xref="GOA:A3LXU4" FT /db_xref="InterPro:IPR011701" FT /db_xref="InterPro:IPR020846" FT /db_xref="InterPro:IPR036259" FT /db_xref="UniProtKB/TrEMBL:A3LXU4" FT /protein_id="ABN67524.2" FT /translation="MSIDLEKKSESAFDSHSLEGATTKEEDTYDAAFHFVKQNHLDTLE FT LSQQDSAKVVRKVDFHILPLLCGIYFLQFLDKSLLNYAAAMGIKKNLVGNEFANLSTIF FT YAAYIFGEPIVAYCLQRFPLSKILGLFIVCWGIVVACHAACDTYASLMVVRTLLGLFES FT SSAVGLIFISGMFYTKPQQAARMGIWSVMAGTATIVGGLLSFGFQHVRTERFLSWQILF FT LFMGIITSLFGVFVSFYLPDNVTSARFLDHDEKLIILENVRSNQTGTKSKKFKKSQIKE FT LLFHDKLTWPFFLLTITSQIVTGAIGTFSVTITLSFGFDSYESALLQLPVGALIIIIIL FT AATQLVARYGHITYFMASMFVPTIVGCIVLLSTNLTSQRVGNLLAMYLLYSGSSCITLI FT YTWISANTAGTSKKLFRSVMTMIAFSVACIIGPQLFQAYSAPGYRPAKITLLVTQIACI FT PISFWVGYICKKENEKRDSEPKSDAPENYEFLDLTDIQNRNFRYTY" FT gene complement(<1033427..1034371) FT /locus_tag="PICST_84906" FT mRNA complement(<1033427..1034371) FT /locus_tag="PICST_84906" FT /product="predicted protein" FT CDS_pept complement(1033613..1034371) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_84906" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_84906" FT /db_xref="EnsemblGenomes-Tr:ABN67862" FT /db_xref="GOA:A3LXU5" FT /db_xref="InterPro:IPR006214" FT /db_xref="UniProtKB/TrEMBL:A3LXU5" FT /protein_id="ABN67862.1" FT /translation="MSQEYARVPTEEPPSYDTPRVAGDNIPDDFKYSVDVASCELPIRQ FT LFIRKVYSLLAIQILGTVLVGFIIRSSPSIKEWCFSNMWLFAITMIGSIGFLVATHFKA FT RSYPTNLFLLGGFTLCEAYLIGLCCAFVESDILIQALLLTFFIFIGLTLFAFQTKYDFT FT SWQGIVGMGLWALIGWGLVMIFFPGHSKTIELIYSGLGALIFSVYIIIDTQQIMKTAHL FT DDEIVSTIQLYLDVVNLFLFILRILNNRND" FT gene complement(<1037634..>1038623) FT /locus_tag="PICST_32944" FT mRNA complement(<1037634..>1038623) FT /locus_tag="PICST_32944" FT /product="predicted protein" FT CDS_pept complement(1037634..1038623) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32944" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32944" FT /db_xref="EnsemblGenomes-Tr:ABN67863" FT /db_xref="InterPro:IPR016137" FT /db_xref="InterPro:IPR036305" FT /db_xref="UniProtKB/TrEMBL:A3LXU6" FT /protein_id="ABN67863.2" FT /translation="MTSPFASSGEPVHVSSNSSGSTVIATHPPIIDGDLSNELNQQGPI FT FNYSINNNQSIHIIPSLDDLLDDSKSKDNYYTKQNFIEFLSNIHCVENLEFVMEVNELI FT RHLGSDLALVKWQSMYENFISINSISEINLPCMFRQQFNYNDIPSHHLLAKCKRIIYDD FT ILINLYNEFIKATKSRMDNELKNSNIVYRRKSEIISPESSAVIDYSSNSSPVSNATIKK FT ARSPSYLDPAFYPDLFARNCNTDTTYMILDESIINGDDEDDEDDEDMEGNSRATFSHDS FT TRNNSSSSQTSNSRGSSIGSIMDSFKNVDYIKFAKVKKFKFRRASNDE" FT gene <1041748..>1042710 FT /locus_tag="PICST_48085" FT mRNA <1041748..>1042710 FT /locus_tag="PICST_48085" FT /product="predicted protein" FT CDS_pept 1041748..>1042710 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_48085" FT /product="fungal pheromone mating factor FT STE2G-protein-coupled receptor" FT /note="go_component membrane; go_function mating-type FT factor pheromone receptor activity" FT /db_xref="EnsemblGenomes-Gn:PICST_48085" FT /db_xref="EnsemblGenomes-Tr:ABN67525" FT /db_xref="GOA:A3LXU7" FT /db_xref="InterPro:IPR000366" FT /db_xref="InterPro:IPR027458" FT /db_xref="UniProtKB/TrEMBL:A3LXU7" FT /protein_id="ABN67525.2" FT /translation="MDTSINTLNPANIIVNYTLPNDPRVISVPFGAFDEYVNQSMQKAI FT IHGVSIGSCTIMLLIILIFNVKRKKSPAFYLNSVTLTAMIIRSALNLAYLLGPLAGLSF FT TFSGLVTPETNFSVSEATNAFQVIVVALIEASMTFQVFVVFQSPEVKKLGIALTSISAF FT TGAAAVGFTINSTIQQSRIYHSVVNGTPTPTVATWSWVRDVPTILFSTSVNIMSFILIL FT KLGFAIKTRRYLGLRQFGSLHILLMMATQTLLAPSILILVHYGYGTSSNSQLILISYLL FT VVLSLPVSSIWAATANNSPQLPSSATLSFMNKTTSHFSES" FT gene <1044134..>1045414 FT /locus_tag="PICST_32946" FT mRNA <1044134..>1045414 FT /locus_tag="PICST_32946" FT /product="predicted protein" FT CDS_pept 1044134..1045414 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32946" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32946" FT /db_xref="EnsemblGenomes-Tr:ABN67526" FT /db_xref="InterPro:IPR013952" FT /db_xref="UniProtKB/TrEMBL:A3LXU8" FT /protein_id="ABN67526.2" FT /translation="MVAEPVQATLETLSYFYRKSSDFLSSSQEKLFEGNSLDKLTSLYP FT FDIANDDSLVSITRGRSQTSWLSRCFDQKWKSLTILTIGLGTVGSIWYYHKNYGSQSIS FT SRTHKQNHSSVNTRRVPKLSNGARRDIVLVVGSPTEPLTRLIALDFEKRGFIVYLTILD FT EKDFKYVESNPITDDINYLNLNDTLSYESQLSKFQQLLELPVIPFPGAEPHNLRLVGVV FT FAPSLFFPIGPIENITVATWTKFTDRELLYLKLFSSGLISLIRNQQSKTILISTNIVSS FT LEIPYHAPETLFQNHLKHLFTTLTREVRQHGLSVTQVRLGNLHLSNQRSNSGSRIANLV FT NSEIRSWDEDMRSLYADSFSKAQYKANPIKSTGGRGTSLRELYHILFDLLYSKGRSPGI FT VYCGTGARAYAIISKLLPESWLEWILR" FT gene complement(<1046593..>1048047) FT /locus_tag="PICST_62788" FT mRNA complement(<1046593..>1048047) FT /locus_tag="PICST_62788" FT /product="predicted protein" FT CDS_pept complement(1046593..1048047) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_62788" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_62788" FT /db_xref="EnsemblGenomes-Tr:ABN67864" FT /db_xref="GOA:A3LXU9" FT /db_xref="InterPro:IPR013635" FT /db_xref="UniProtKB/TrEMBL:A3LXU9" FT /protein_id="ABN67864.2" FT /translation="MASVLSRIIRSVRAFLGTLYLVLVILTIPLAFDVGGVTCGLAFSL FT TTFLLYFSLMTIRLVTRRSKYFRWISILYYSQHFVIPSLLTFFLSYYRTENKVVYKYIN FT PVDIWRFLLINATPVFTILEGFCSLLLIQAIGQTINWLTIYKSDTWLIISLVGSGSTIT FT AAFYFLYRIYVFPFTIDIVSASLLGSLLTLTVGIGGYGIVSGKGSMIESSLLFAYVVRC FT IYETFPILSEGATRTLTSLFTQATNNLRNEIPKLPHQIINPISQLIPFLASNLPGSFKT FT IWEFLLMAIQKLTLPLLLNLAYRIGVFYAATKIIPLLYQNAAYPNTPPRTPPQATRSRQ FT ASNKSLSELASSIPTTEDTNLEESISFKEVTKPITPLRDRKSFRLKPPHHQPPSAIISL FT IYAYSPCIVIAVYTHLMLSYSGELGTELKIWGFFSSSAVSIVVHPWQFWNWVNMATTIL FT LYAAELSGNDSSSNGGTSLTSHWKVE" FT gene complement(<1049155..>1049838) FT /locus_tag="PICST_32948" FT mRNA complement(join(<1049155..1049595,1049776..>1049838)) FT /locus_tag="PICST_32948" FT /product="predicted protein" FT CDS_pept complement(join(1049155..1049595,1049776..1049838)) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32948" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32948" FT /db_xref="EnsemblGenomes-Tr:ABN67865" FT /db_xref="UniProtKB/TrEMBL:A3LXV0" FT /protein_id="ABN67865.2" FT /translation="MPSIVMALLGNLFEFAQIGCRLSSGIRIYSSSTSVEVWSDKVLPG FT RKPIGQPYFDYRLCLFCSFFSSIPSQSRESGAHLQLKRSRILDKLFSQTQDESQNGSEF FT AIGLFRSYKLRRERTISSFASNVIVGTESLRQHLPPTDLELVFTAGVWFVRCRSLRSED FT PTPV" FT gene 1050121..1052410 FT /locus_tag="PICST_84833" FT mRNA join(1050121..1050593,1050618..1052410) FT /locus_tag="PICST_84833" FT /product="predicted protein" FT CDS_pept join(1050174..1050593,1050618..1052366) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_84833" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_84833" FT /db_xref="EnsemblGenomes-Tr:ABN67527" FT /db_xref="GOA:A3LXV1" FT /db_xref="InterPro:IPR010678" FT /db_xref="UniProtKB/Swiss-Prot:A3LXV1" FT /protein_id="ABN67527.2" FT /translation="MARQVKRRPHASARPESSSDSKKPKLKHGRHQMRTVTRTARRPGQ FT QDFEEESQDTYDNQQLGEDGQNDEESEDEQEIEQESGKAYEALLTLLKSDHKESKPARK FT SDKVEENQDEEEEDDEEIAGANVQNEEDQDNEDDNEDDEDSARGLAQDPLEAHFNRVED FT SYIDNQERLVIKEREKWTTVEKKTYDNLGYSSLTQSPPGRAISIPSKTKVKISDFFIKK FT RVLDAFEATYPSDFEKLSPLDLALLEPMMKYQDINFPYKTFSNTSYRKLYALHALNHIY FT KTRDRIIKNTTKLNNYREALKNGTANLDSQEPEFRDQGFTRPKVLILLPTRNSCYELVE FT LLIKLSGCEQQENKKKFMNQFYAKELPPDTKPLDFRDSFKGNNNDFFCLGLKLTRKSLK FT LYSSFYSSDIIIASPIGLSMILENPDKKKRQYDFVSSIEVLIVDRANQIEMQNWENVAT FT VMRYVNKIPKDFHDADFSRIRMWSINDQSKLLRQNLIFSEYLTPNINNLITSKSFNIGN FT KTKFKPIINSNNCIMNSIGLKLKQIFQRFDSPSPVSDPEVRFKFFINTVLPSLMKSSSY FT SDGIMIFVPSYFDYLRIKHHLKSSTKFNFGSIDEYSSQSKSTKARQQFMAGKINIMLYT FT ERLHYFRRFEISGVKTMLMYGLPSNPVFYKELVRFIGKSVFREQCDLDLAFVKILFSKW FT DAVTLERVVGNERAHALCNSPNELFEFR" FT gene complement(<1052482..>1052694) FT /locus_tag="PICST_62576" FT mRNA complement(<1052482..>1052694) FT /locus_tag="PICST_62576" FT /product="predicted protein" FT CDS_pept complement(1052482..>1052694) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_62576" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_62576" FT /db_xref="EnsemblGenomes-Tr:ABN67866" FT /db_xref="GOA:A3LXV2" FT /db_xref="InterPro:IPR009653" FT /db_xref="UniProtKB/TrEMBL:A3LXV2" FT /protein_id="ABN67866.1" FT /translation="TALFNFQSLLQVILLLICTCTYVHATAPALLDSRKTGILGVFWKF FT ARVGERLSPYVAIGCFIMAFNTLSS" FT gene complement(<1053281..>1055152) FT /gene="ARO10" FT /locus_tag="PICST_62095" FT mRNA complement(<1053281..>1055152) FT /gene="ARO10" FT /locus_tag="PICST_62095" FT /product="pyruvate decarboxylase (PDC6) (PDC3)" FT CDS_pept complement(1053281..1055152) FT /codon_start=1 FT /transl_table=12 FT /gene="ARO10" FT /locus_tag="PICST_62095" FT /product="pyruvate decarboxylase (PDC6) (PDC3)" FT /note="pyruvate decarboxylase [EC:4.1.1.1] [KO:K01568]" FT /db_xref="EnsemblGenomes-Gn:PICST_62095" FT /db_xref="EnsemblGenomes-Tr:ABN67867" FT /db_xref="GOA:A3LXV3" FT /db_xref="InterPro:IPR011766" FT /db_xref="InterPro:IPR012001" FT /db_xref="InterPro:IPR012110" FT /db_xref="InterPro:IPR029035" FT /db_xref="InterPro:IPR029061" FT /db_xref="UniProtKB/TrEMBL:A3LXV3" FT /protein_id="ABN67867.1" FT /translation="MTPVQETIRLPGTSSPTVPENVTLGEYLFLRISQANPKLRSIFGI FT PGDFNVDLLEHLYSPVVAGRDIKFIGLCNELNGAYTADGYSRAIGGLSTFISTFGVGEL FT SAINGIAGSFAEFSPVLHIVGTTSLPQRDHAINGSDVRNHHHLIQNKNPLCQPNHDVYK FT KMIEPISVIQESLDSDLQRNMEKIDRVLVKILQESRPGYLFIPCDITNLIVPSYRLYET FT PLPLEIQLTTSGVEVLEDVVDAILFRLYKSKNPSLLSDCLTTRFNLQDKLNTLVAKLPS FT NFVKLFSTNMARNIDESLSNFVGLYFGIGSSSKEVSRQLERNTDFLINLGYFNAETTTA FT GYSNDFSNIEEYIEINPDYIKVNEHIINIKNPESGKRLFSMGQLLDALLFKLDLNKIEN FT INNNNISYKFFPPTLYEQDNNTDYIPQTKLVDYLNENLQPGDLLVMDTMSFCFALPDIM FT LPQGVQLLTQNYYGSIGYALPSTFGATMAVNDLGSDRRIILIEGDGAAQMTIQELSSFL FT KYKEFLPNMPKIFLINNDGYTVERMIKGPTRSYNDINGEWSWTQLLGVFGDKEQKYHST FT ALLRNVNEFNKYFEFQRQTDNSKLEFIELIAGKYDCPLRFSEMFCKK" FT gene <1057153..>1057917 FT /gene="SIW14" FT /locus_tag="PICST_61269" FT mRNA join(<1057153..1057267,1057304..>1057917) FT /gene="SIW14" FT /locus_tag="PICST_61269" FT /product="tyrosine phosphatase" FT CDS_pept join(<1057153..1057267,1057304..1057917) FT /codon_start=1 FT /transl_table=12 FT /gene="SIW14" FT /locus_tag="PICST_61269" FT /product="tyrosine phosphatase" FT /db_xref="EnsemblGenomes-Gn:PICST_61269" FT /db_xref="EnsemblGenomes-Tr:ABN67528" FT /db_xref="GOA:A3LXV4" FT /db_xref="InterPro:IPR000387" FT /db_xref="InterPro:IPR004861" FT /db_xref="InterPro:IPR016130" FT /db_xref="InterPro:IPR020428" FT /db_xref="InterPro:IPR029021" FT /db_xref="UniProtKB/TrEMBL:A3LXV4" FT /protein_id="ABN67528.2" FT /translation="DITPRYADILDSQRLYDDNRFIRTKLEQLKLEEGAFTGVDEERAY FT EEDLDDKLDMKLQRKLQKEYESNLKFHISQPLTPPENFAPIINKIYRSSFPQPNNFTFL FT RKLKLKSVLCLIPEEYPQLHLEFLEHENIKLFQLGMSGNKEPFVKISSDLITEAAKIVL FT NPENQPILIHCNRGKHRTGCLVGVLRRLQKWSLTIIFDEYRKFAAPKERPMDQQFIELY FT DETPIIRYAEENNLLPLQWD" FT gene complement(<1058212..>1058670) FT /locus_tag="PICST_32952" FT mRNA complement(<1058212..>1058670) FT /locus_tag="PICST_32952" FT /product="predicted protein" FT CDS_pept complement(1058212..1058670) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32952" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32952" FT /db_xref="EnsemblGenomes-Tr:ABN67868" FT /db_xref="GOA:A3LXV5" FT /db_xref="InterPro:IPR019419" FT /db_xref="UniProtKB/TrEMBL:A3LXV5" FT /protein_id="ABN67868.2" FT /translation="MSAPLNSVPQSSSSSLKLLDDLSVSPYPAVLLGSSLILKGAASSK FT PSPVGVESGSSVKISRALAVKPSRASCFTFGAANLLGAWVIYDGEPINGAGFNFAWSSL FT YLIVNGTASFKSLFRGKVSPLALSVLALGNAGLYGKKFFWPSNSLAQF" FT gene complement(1058927..1059397) FT /locus_tag="PICST_73330" FT mRNA complement(1058927..1059397) FT /locus_tag="PICST_73330" FT /product="predicted protein" FT CDS_pept complement(1058973..1059383) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_73330" FT /product="histone H3" FT /note="go_function DNA binding" FT /db_xref="EnsemblGenomes-Gn:PICST_73330" FT /db_xref="EnsemblGenomes-Tr:ABN67869" FT /db_xref="GOA:A3LXD5" FT /db_xref="InterPro:IPR000164" FT /db_xref="InterPro:IPR007125" FT /db_xref="InterPro:IPR009072" FT /db_xref="UniProtKB/Swiss-Prot:A3LXD5" FT /protein_id="ABN67869.1" FT /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPG FT TVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSL FT FEDTNLCAIHAKRVTIQKKDIQLARRLRGERS" FT gene 1060449..1060889 FT /locus_tag="PICST_90470" FT mRNA 1060449..1060889 FT /locus_tag="PICST_90470" FT /product="predicted protein" FT CDS_pept 1060485..1060796 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_90470" FT /product="histone H4" FT /note="go_function DNA binding" FT /db_xref="EnsemblGenomes-Gn:PICST_90470" FT /db_xref="EnsemblGenomes-Tr:ABN67529" FT /db_xref="GOA:A3LXD4" FT /db_xref="InterPro:IPR001951" FT /db_xref="InterPro:IPR004823" FT /db_xref="InterPro:IPR009072" FT /db_xref="InterPro:IPR019809" FT /db_xref="InterPro:IPR035425" FT /db_xref="UniProtKB/TrEMBL:A3LXD4" FT /protein_id="ABN67529.1" FT /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVK FT RISALIYEEVRVVLKSFLENVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG" FT gene complement(<1060982..>1062421) FT /gene="KTR5" FT /locus_tag="PICST_47835" FT mRNA complement(<1060982..>1062421) FT /gene="KTR5" FT /locus_tag="PICST_47835" FT /product="mannosyltransferase of the KRE2 family" FT CDS_pept complement(1060982..>1062421) FT /codon_start=1 FT /transl_table=12 FT /gene="KTR5" FT /locus_tag="PICST_47835" FT /product="mannosyltransferase of the KRE2 family" FT /EC_number="2.4.1.-" FT /note="Putative mannosyltransferase of the KRE2 family; FT go_component membrane; go_function glycolipid FT 2-alpha-mannosyltransferase activity; go_process protein FT amino acid glycosylation" FT /db_xref="EnsemblGenomes-Gn:PICST_47835" FT /db_xref="EnsemblGenomes-Tr:ABN67870" FT /db_xref="GOA:A3LXV8" FT /db_xref="InterPro:IPR002685" FT /db_xref="InterPro:IPR029044" FT /db_xref="UniProtKB/TrEMBL:A3LXV8" FT /protein_id="ABN67870.2" FT /translation="ISSGIDAPFQYGCNIPDVTAPRADAALVVLARNSELEGVIKSMKS FT LERHFNQWYNYPWVFLNNEEFTEEFKETVQMYTSSEVEFGSIPEKEWEFNESVDTDEFK FT ESVDSQGDRTILYGNLPSYHKMCRFYSGFFYKHELVVKRKWYWRVEPDVEFFCDITYDP FT FIQLEEHNKKYGFNVMIRELYYTVPGLFRETMAYIKKNGIQVRGAWNLFIKDSKWTRGG FT DQLAYDGISQKRDILRELEDNIALKKFRAIKKKKERHVQKLPERLLKKLAHVAEVMPRL FT HEDRMNREDYNLCHFWSNFEIARTDLFTDKVYEDYFRHLDDSGGFYKERWGDAPVHSLA FT VGMMLELKEIHYFRDIGYRHSTLGHCPGNARKNQLRYVPSEKYYKTDLEEDSKWLEPDK FT PTKYGVGCRCRCPPEQKEIENSGASCIRDWVEVTANDYRAFRPVDLDYWGHEMEVRMDE FT YLLNGGKLGYSNLADAMLKEV" FT gene complement(<1063330..>1064325) FT /gene="SDS3" FT /locus_tag="PICST_47597" FT mRNA complement(<1063330..>1064325) FT /gene="SDS3" FT /locus_tag="PICST_47597" FT /product="histone deacetylase and transcriptional FT regulator" FT /note="Has EST support" FT CDS_pept complement(1063330..>1064325) FT /codon_start=1 FT /transl_table=12 FT /gene="SDS3" FT /locus_tag="PICST_47597" FT /product="histone deacetylase and transcriptional FT regulator" FT /note="Suppressor of Defective Silencing 3Functions are FT similar to those of SIN3 and RPD3" FT /db_xref="EnsemblGenomes-Gn:PICST_47597" FT /db_xref="EnsemblGenomes-Tr:ABN67871" FT /db_xref="InterPro:IPR013907" FT /db_xref="UniProtKB/TrEMBL:A3LXV9" FT /protein_id="ABN67871.2" FT /translation="ISKRDKKRQQVGVRLNKLEVMFRNDRDNFYRSSLHELQTKLAMLQ FT QGTNEELVAKKIRLEEERDYELTKLRLWEEYRVKRIESEYNEDLSKAKDNHDKMIKLIK FT EKLYDKLQNQIKQLKEDKLLLNLVNGNSWSNSPTQNASTAAALSAAAAAAGSLSLNDRR FT SLRKRELSSRFTAGEADDLSDGGLGAGSTTGNASSIPSGYVSATGKRRRLYATRYSSNE FT ELSSGITSNGAAGNPPGSSYRNGNSVAVSSGYDSNLSDKDYDALNSLIMHNDDGGASLV FT LLDKNSSSSNNNKPNTRGSHKQFVGVQGLKPEELNEDLSLLRNAIVKKEK" FT gene <1065085..>1065807 FT /locus_tag="PICST_47700" FT mRNA <1065085..>1065807 FT /locus_tag="PICST_47700" FT /product="predicted protein" FT CDS_pept 1065085..1065807 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_47700" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_47700" FT /db_xref="EnsemblGenomes-Tr:ABN67530" FT /db_xref="GOA:A3LXW0" FT /db_xref="InterPro:IPR000182" FT /db_xref="InterPro:IPR016181" FT /db_xref="UniProtKB/TrEMBL:A3LXW0" FT /protein_id="ABN67530.2" FT /translation="MSISGEKFDFLEQLPFADGKFEATGRITTPITFTLEKDSTKTVTL FT LPVHEYTEIPDNLVQVVQDEFNYIVEEGQTYPHHQTLTHDDFVKYWFSGFVAILIEGEH FT QSALDDDLKSLSVSQWRDIFLGNFYIKPNYIGRCSHVCNAGFVVNHEKRGLGLGKELGR FT KYLVWAPQLGYVYSVFNLVFETNIASLKIWDGLGFERIGYVKNVAVLKGHKHLVGAHMF FT GKDLVSEKGIEAAENGKV" FT gene <1066540..>1067469 FT /locus_tag="PICST_62621" FT mRNA <1066540..>1067469 FT /locus_tag="PICST_62621" FT /product="predicted protein" FT CDS_pept <1066540..>1067469 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_62621" FT /product="predicted protein" FT /note="go_function N-acetyltransferase activity" FT /db_xref="EnsemblGenomes-Gn:PICST_62621" FT /db_xref="EnsemblGenomes-Tr:ABN67531" FT /db_xref="GOA:A3LXW1" FT /db_xref="InterPro:IPR000182" FT /db_xref="InterPro:IPR015416" FT /db_xref="InterPro:IPR016181" FT /db_xref="UniProtKB/TrEMBL:A3LXW1" FT /protein_id="ABN67531.2" FT /translation="VAVIDRYTVLLKDGETTATIYPIHTTNELPPGLLAFLCDEFNMEI FT ERGETSSFFDTLHIEQFQNYWFGAFAAVMVLGDSPALEGSRQWEKECLGTFFIKPNYPG FT RCSHICTGNFLVNAGIRGKGIGRTLTDCYLQWAPRLGYTYSIFNLVFETNVAARSIWES FT LNFKRIGRVKSAGILKGHEQAVDAIMYGRELINTSDPAVGAYRFDKIKFYLETGRYPAM FT ADRQEKSRLRSSASHYRLENGKLMLKGREVVSNPVRQLQICTEVHLSNHGGINKTTSIV FT TEKYHWTRIKDTVATAIKNCAECRDPSRD" FT gene complement(1068194..1075893) FT /gene="URA2" FT /locus_tag="PICST_90563" FT mRNA complement(join(1068194..1075294,1075868..1075893)) FT /gene="URA2" FT /locus_tag="PICST_90563" FT /product="multifunctional pyrimidine biosynthesis protein FT (PYR1)" FT CDS_pept complement(1068565..1075200) FT /codon_start=1 FT /transl_table=12 FT /gene="URA2" FT /locus_tag="PICST_90563" FT /product="multifunctional pyrimidine biosynthesis protein FT (PYR1)" FT /note="Carbamoyl-phosphate synthase; go_component FT cytoplasm; go_function catalytic activity; amino acid FT binding; carboxyl- and carbamoyltransferase activity; FT ligase activity; carbamoyl-phosphate synthase activity; ATP FT binding; go_process amino acid metabolism; metabolism; FT nitrogen compound metabolism; arginine biosynthesis; FT pyrimidine base biosynthesis" FT /db_xref="EnsemblGenomes-Gn:PICST_90563" FT /db_xref="EnsemblGenomes-Tr:ABN67872" FT /db_xref="GOA:A3LXW2" FT /db_xref="InterPro:IPR002082" FT /db_xref="InterPro:IPR002474" FT /db_xref="InterPro:IPR005479" FT /db_xref="InterPro:IPR005480" FT /db_xref="InterPro:IPR005483" FT /db_xref="InterPro:IPR006130" FT /db_xref="InterPro:IPR006131" FT /db_xref="InterPro:IPR006132" FT /db_xref="InterPro:IPR006274" FT /db_xref="InterPro:IPR006275" FT /db_xref="InterPro:IPR011607" FT /db_xref="InterPro:IPR011761" FT /db_xref="InterPro:IPR013815" FT /db_xref="InterPro:IPR016185" FT /db_xref="InterPro:IPR017926" FT /db_xref="InterPro:IPR029062" FT /db_xref="InterPro:IPR032466" FT /db_xref="InterPro:IPR035686" FT /db_xref="InterPro:IPR036480" FT /db_xref="InterPro:IPR036897" FT /db_xref="InterPro:IPR036901" FT /db_xref="InterPro:IPR036914" FT /db_xref="UniProtKB/TrEMBL:A3LXW2" FT /protein_id="ABN67872.2" FT /translation="MVAQLSAPISPPMESTGDRLMTLETYDGIALQGYSFGAPVAASGE FT LVFQTGMVGYPESLTDPSYEGQILVITYPLVGNYGVPDRELLDDDYSPALPKYFESSKI FT HIAGLVVAHYTEDYSHFLAKSSLGQWLQKEGIPAVYGVDTRALTKNLRDKGSTLGRLAL FT SNDSVKSETILASPADWEQHFEIPEWDDPNVKNLVAKVSTDKPVLYTPKSGIKTGKNGK FT PIRIVAVDVGMKYNQIRCFVRRGVELLVVPWDYDYTTEEYDGLFISNGPGDPSVMTETV FT KRLQGVISEGKTPIFGICLGHQLMARATGASTLKLKFGNRGHNIPCTSTISGRCYITSQ FT NHGFAVDANTLASGWKELFVNANDGSNEGVYHESKPFFSVQFHPESTPGPRDTEFLFDV FT FINSVVDFNKNGVYKQVAFPGGLLADNRAAHPKVDVKKVLVLGSGGLSIGQAGEFDYSG FT SQAIKALKEEGIYTILINPNIATIQTSKGLADKVYFLPVTPEFVRKVIKHERPDGIYCT FT FGGQTALSVGIDLKDEFADLGVKVLGTPIDTIITTEDRELFASAMADINEKCAKSEAVS FT TVAEAVIAANNIGYPLIVRAAYALGGLGSGFADNEEELVELCNKAFATSPQVLVERSMK FT GWKEVEYEVVRDAFDNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVN FT VIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLNI FT PLNEIKNSVTKKTCACFEPSLDYVVVKIPRWDLKKFTRVSSLLSSSMKSVGEVMSIGRT FT FEEAIQKAIRSTDYQNLGFNKTSALMSIDIDSELQTPSDQRLFAIANALSDGYSVEKVW FT SLTKIDKWFLNKLDGLIKFGNKISSYVSKENLPTSVLRQAKQLGFEDRQIAKFLSSNEV FT AIRRLRKEAGVIPFVKQIDTVAAEFPAFTNYLYITYNADSSDVTFDEHGVIVLGSGVYR FT IGSSVEFDWCAVRAIRTLRENGHKTIMINYNPETVSTDYDEADRLYFETINLERVLDIY FT ELEQSNGVIISMGGQTSNNIALPLHRQNVKILGTSPEMIDSAENRYKFSRMLDKIGVDQ FT PAWKELTSIAEAEEFAEKVTYPVLVRPSYVLSGAAMNTVYSRDDLASYLTQAVDVSPDY FT PVVITKYIENAKEIEMDAVARDGKMIMHVVSEHVENAGVHSGDATLIVPPQDLDPETVR FT RIVEATAKIGKALDITGPYNIQFIAKDNDIKVIECNVRASRSFPFISKVVGTDLIEMAT FT KAIMDLPLTPYPGEKLPEDYCAVKVPQFSFSRLAGADPVLGVEMASTGEVATFGRNKYE FT AYLKSLISTGFKLPKNNVLFSIGSYKEKQELLPSIAKLHELGYKIFATAGTADFIKEHN FT IPVHYLEVLGKSEDQKSEYSLTQHLANNLIDLYVNLPSSNRFRRPASYMSKGYESRRMA FT VDYSVPLVTNVKCAKLLVEAIARNIPLEVSNRDAQTSHRTTVLPGLVNITSFATSFDDF FT EATTKESLAAGFTFNAFLPQTLAGSVVTDFDSLLEAIDFAGSAAYTDYSFSIAANDANA FT NEVLEAAQNAGALFLPFNDLANSKVSAISTHFASWPENKPIISDAKTTDLASVLLLASL FT HNRSIHITNVSSREDLELIKMAKSKELRVTCDVAVYSLFLSRDELDVPFLPTKEDQDYL FT WDNIADVDCFSIGVLPYLVAKATGKKVVPGLGINEALPLLLSAVKDGRLTLDDIVERFH FT NNPVKIFNIPKQDATSEIDLDRFVSSTTKNVASIFQHKKLQGSVDRVLLHGETVCLDGT FT VSAEALGKNEVEPRARFSSITNIPASPVPRKARASFTADLRRPSLIKDLQTQPLPTDFE FT KFGKELVSQPPAGSLSEGNALVNYIRHHNTFLRNSVLSVKDLTRSDMHSLFTVAQEMRL FT AVERQGVLDILKGRVLATMFYEPSTRTSSSFDAAMQRLGGRVVAVESGSSSVKKGETLQ FT DTIRSLACYADAIVLRHPSEESADIAAKYSPVPIINGGNGSKEHPTQALLDLFTIREEL FT GTVNGITVTFMGDLKYGRPVHSLIYLLRHYQVRIQLVAPKELALPESIKNILIESGIRV FT TESEELTKDIIARSDILYCTRVQEERFSDREQYLRLKDTYIVDNKILSYAKQHMAVMHP FT LPRTSEIREEVDFDQRAAYFRQMRYGLFVRMALLAMVVGVDF" FT gene <1077577..>1080984 FT /gene="TRK1" FT /locus_tag="PICST_61578" FT mRNA join(<1077577..1078217,1078245..1078492,1078568..1080577, FT 1080608..1080703,1080905..>1080984) FT /gene="TRK1" FT /locus_tag="PICST_61578" FT /product="low affinity potassium transporter" FT CDS_pept join(1077577..1078217,1078245..1078492,1078568..1080577, FT 1080608..1080703,1080905..1080984) FT /codon_start=1 FT /transl_table=12 FT /gene="TRK1" FT /locus_tag="PICST_61578" FT /product="low affinity potassium transporter" FT /note="go_function cation transporter activity; go_process FT cation transport" FT /db_xref="EnsemblGenomes-Gn:PICST_61578" FT /db_xref="EnsemblGenomes-Tr:ABN67532" FT /db_xref="GOA:A3LXW3" FT /db_xref="InterPro:IPR003445" FT /db_xref="InterPro:IPR004773" FT /db_xref="InterPro:IPR015958" FT /db_xref="InterPro:IPR020846" FT /db_xref="UniProtKB/TrEMBL:A3LXW3" FT /protein_id="ABN67532.2" FT /translation="MLDTIKKYYATYRRKRLESEVGLRVRNQIHRLSSVLGPTVKVLVP FT NFRAAHYCYIIFWVFFGSVLVYPVRNLRYIDALFFTGGASTQAGLNTVDTNTIALYQQI FT ILYIIATFTTPIFIHGSMLFVRLYFFERHFDNIKEKSKLNFKMRRQATIAARTQSMDAT FT RLNTFTNQNLGFDKSKRNNNRGDNVDKEQKDNGLHTVDVEMANNSSPQSSSTFHGDVEH FT IDEPSDSDEERGRRAPDDIRLNDLNPDSPHDAVRFGNLPQPSKRARSKELDPSDMYRSI FT ALLQDSHNNSTRNLDDDDEVLVIKSPNEIEKTGGRIYTKRKPKSHRPSGSSGSKPWKKG FT SKWSNRLRKTFSNSGSSSTPKTKRSYSTASEEIVDDDASIDSENEVVTTDVADDDDEND FT HDYNHNDNNDDDDDDEEAVDDEDSVNDGDVEDDANPESPRKEGPTTHFAEPANDPRRKR FT PNLLDVPNGSRKHSFVSSPTYEKFEKFKKNIKKGKLKRIKTPGVSQTSSRLFGYNSSIN FT VDDDSYVDEDAYDEDDEEASYEENEIGPTITKVMSTNYLSWEPTVGRNSTFIHMTEAQK FT EELGGVEYRAVKLLIKILVLYYIGFHVLAVVLLLPWILMRESYIEVVRTQGVSPTWWAF FT FTASSAFNDLGFTLTADSMVSFGRSVYVMIVVSFFIVIGNTGFPVFLRFIIWILFKTAK FT PLSLYKESLGFLLDHPRRCFTLLFPSVPTWWLFIILVVLNGVDLVLFIILDLNNNYLKE FT IPVGYRIVDGLFQAFSTRTAGFAVVDLSQLHPAVQVSYMIMMYISVLPLAISIRRTNVY FT EEQSLGVYLKEENHEDDEKTPHTFIGAHLRNQLSFDLWFIFLGLFIMCIAEGGKLNNND FT IRFTVFSILFEIISAYGTVGLSLGYTGVNASLSSQFSVISKLVIVAMMVRGRHRGLPYT FT LDRAIMLPDADMQRRDHLQENHAIRRHTTMERENTLGIGGDNILRRVITREGGILFGRR FT RSSAFAMPSLSENPSYIITSTSQEEQELEAIRNQV" FT gene complement(1081245..>1082098) FT /locus_tag="PICST_90419" FT mRNA complement(1081245..>1082098) FT /locus_tag="PICST_90419" FT /product="predicted protein" FT CDS_pept complement(1081245..1082096) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_90419" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_90419" FT /db_xref="EnsemblGenomes-Tr:ABN67873" FT /db_xref="InterPro:IPR007109" FT /db_xref="UniProtKB/TrEMBL:A3LXW4" FT /protein_id="ABN67873.2" FT /translation="MIRKQARERREYLYRKSLQLKEAALTEKRQQLKAALASGKPLSKD FT LAEDDQLQKDFIYDESEQTEVDDEYSTLSGIADPKVIITTSRDPSVKLLQFSKEVKLMF FT PNSLKLNRGNYVIPELVKTCSRVQISDLIILHEHRGVPTSLTVSHFPHGPSAIFTLHNV FT KLRHDLPQLGNVSESYPHLIFENFTTGLGKRVETILKHLFPPGVKKDSSRVITFVNNDD FT YISVRHHVYVKTKDGVELSEIGPRFEMRLYEIRLGLPDNKNADVEWQLRRFIRTANRKN FT YL" FT gene complement(1083488..1085477) FT /gene="VHS2" FT /locus_tag="PICST_68130" FT mRNA complement(1083488..1085477) FT /gene="VHS2" FT /locus_tag="PICST_68130" FT /product="hypothetical FT beta-1,6-N-acetylglucosaminyltransferase" FT /note="Has EST support; contains WSC domain similar to FT Protein VHS2 (Viable in a HAL3 SIT4 background protein 2)" FT CDS_pept complement(1083778..1085094) FT /codon_start=1 FT /transl_table=12 FT /gene="VHS2" FT /locus_tag="PICST_68130" FT /product="hypothetical FT beta-1,6-N-acetylglucosaminyltransferase" FT /db_xref="EnsemblGenomes-Gn:PICST_68130" FT /db_xref="EnsemblGenomes-Tr:ABN67874" FT /db_xref="GOA:A3LXW5" FT /db_xref="UniProtKB/TrEMBL:A3LXW5" FT /protein_id="ABN67874.2" FT /translation="MASSTSTTTQPKKRLSLFSFHSSSSSESKDNVAADSVAPDSKSVA FT SVDDTISGKQAGSGSLAAVPVHGHEHEDHVHFNHELPAGLVDNPECQIFERSVQESCIF FT EPVLLNRQHSNSIVSSTSSAGKGPSSRSRSHTHNSITTFKPEDYIPPALDATTSLLNDK FT DANLDDVEMIYSNRRNSSVIGLNMALGRPISPSRKNSVYSMHNQSHMASPMLSVNTEPS FT AHITQIHSPVSPTKLSTSKSSLSFYSFADMINADEFARRPSFKSSYSQGIIPTSNTYNS FT VPPTFNRNPSFAKHRNPSTSSQLSSQLSSKDKVLKRIGSKKAGSSSTANNLNKFLISPE FT SSDSEDPERDTEHDRDYTSSKPIKSVSKSPTTTSPHNGPVSHVPQTGANRKSVSSASSS FT TSGFIPPLASTAVFNDNESLISTSIGDCLRQTTTEINGQ" FT gene 1088093..1092189 FT /locus_tag="PICST_84674" FT mRNA join(1088093..1088579,1088631..1092189) FT /locus_tag="PICST_84674" FT /product="predicted protein" FT CDS_pept join(1088152..1088579,1088631..1092162) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_84674" FT /product="TOR binding protein" FT /db_xref="EnsemblGenomes-Gn:PICST_84674" FT /db_xref="EnsemblGenomes-Tr:ABN67533" FT /db_xref="GOA:A3LXW6" FT /db_xref="InterPro:IPR016024" FT /db_xref="InterPro:IPR028267" FT /db_xref="InterPro:IPR028268" FT /db_xref="InterPro:IPR029451" FT /db_xref="InterPro:IPR029452" FT /db_xref="InterPro:IPR029453" FT /db_xref="UniProtKB/TrEMBL:A3LXW6" FT /protein_id="ABN67533.2" FT /translation="MKTTKSSSNLEGLNAVLVKSKQTHQQLQAQQVQNVQVNGTEYPLS FT AADFDELRRQRASTLDSMSIPPIESIKFYQSGIVDSEGEDEQSSQSQIQNHHHRHHRRT FT LSRTSAQSADERVSFNSGIAKDATPDSSRIRSATTSAIESTGQSAQSNGNDNTESPTWL FT FSDLLSNLGSFKDKDEYYIVAKGNDLVLLLQQYPALKNDILLKNFINKIQFMFCHNVSE FT VRSTGYRILRHVISSYETLMIIVQSKILIFIIATMSTTRSTIGEKEQALKLVREFLNIE FT NGTDNLSIGVIKSLISLIESSNEHIYDENELNVGPMKLDMEQYSSHDAIPEPFKNICVE FT TICEIALLNPELVFHSGGFKVFINIIIDGSFEMASSCSLVILNILDLPNSRKFLRNGYD FT LNSLIAVFSNITDEVGDSSTSSKKRINNLKLQKVSFLIASLLKNFNGLIAFSVCNFKSL FT KNLISNLKKRNIRVRDYIMDILQDILRLKSLPWLASSPIGEIIRKYNSYTDNEKYGFQY FT QQLDAIENEFAYNIITHYQGLLALILIKNDIFTYLIDIVEQNLNESNTKKATGLITHLY FT SMANNILPPELVQTNLALTNLSSFSSFEIEKVTRQKFKATEDYNANLKSYLKNINIQSK FT YNIDDNEFKMMINNTKILTIKEFEDWNWQLLLTLIQGPLTNPKRFDEVLEKNPKFFKRL FT MSFYRPFKFRFCNIAITKSNSQRYINIGCQLLELFLSLENGTRYLSTSKLLPQLSEIFA FT QVDKYSGISTNDAVLSRRRLDSTASIGYLRFIGVFSSYPAGLKILEQWQFYNLFLNIIE FT GSSFSESTNSLLLTLFKYVDFTGDNQFRILLSQCFKVSNFKLRSYLLRHLLPRLIIIKE FT CELFVIRLLVNNLYDPSPEIVSKSIDILSDHYSTNKCKNLNYLIDLHPSIQILSRTIKG FT RNLLINFLNIPSGFRFLEDSGFIEEEFDKWSNMNDLSYLNRIEKLISASFFPTTTTSSP FT TNDHLYIFNFFKYLLSTEEGLNYFAHMKQKTYLENLINEVETVSDKLLHDGEFIDVDSP FT DEKLTSILNRLKQNLWIIGNIASGQYGIQLLDPMYNINLEKSVIAIILELFDNCPIWNI FT RGACFYVLGMVATTIEGIEILDESNWVSVLDQYSNSKCLTYPKLGVSQIFNIGLANPYR FT DVKYYSLFSGGAVTSIMWDDDDDEDNGKANGGEDISSAQPDGTLSVTGVPASAGSEEES FT TSVETKIRDRVINLIQHLNSVLSKIERKAVKELLKMKRNTPEVFEELPLFLEVIKTIDK FT GNFRYHKRKFIFDLFLDTRVFENLIKKERKNSIKV" FT gene complement(<1092399..>1092974) FT /locus_tag="PICST_7220" FT mRNA complement(join(<1092399..1092583,1092668..>1092974)) FT /locus_tag="PICST_7220" FT /product="predicted protein" FT CDS_pept complement(join(<1092399..1092583,1092668..>1092974)) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_7220" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_7220" FT /db_xref="EnsemblGenomes-Tr:ABN67875" FT /db_xref="UniProtKB/TrEMBL:A3LXW7" FT /protein_id="ABN67875.2" FT /translation="SSSKDYHKIYEKYHDKFKKVYAQSIRLFESEKSQRQTLAYYQRKN FT QALLRVLEEFETANGYKEEPDSVEQIFAGGDRSRLEKIVQQAPHLASSLGPIFQLIAEN FT SISVQKRHYINLYINETVPDLINDDLISIETNPQDPESWTRRHYPNLTTSKFKPVHFPA FT N" FT gene 1093693..1094742 FT /locus_tag="PICST_84607" FT mRNA 1093693..1094742 FT /locus_tag="PICST_84607" FT /product="predicted protein" FT CDS_pept 1093760..1094569 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_84607" FT /product="anti-silencing protein 1" FT /db_xref="EnsemblGenomes-Gn:PICST_84607" FT /db_xref="EnsemblGenomes-Tr:ABN67534" FT /db_xref="GOA:A3LXW8" FT /db_xref="InterPro:IPR006818" FT /db_xref="InterPro:IPR017282" FT /db_xref="InterPro:IPR036747" FT /db_xref="UniProtKB/TrEMBL:A3LXW8" FT /protein_id="ABN67534.1" FT /translation="MSIVSLLGIEVLNNPAKFSDPYEFEITFECLEPLKEDLEWKLTYV FT GSSRSLDHDQELDSILVGPVPVGINKFLFQADPPSPELIPASELVSVTVILLSCSYADR FT EFVRVGYYVNNEYDSEELRENPPAKVQVDHVVRNILAEKPRVTRFNIVWDNEDDNANEY FT PPEQQEVDEEDEDEDEEEEEEEEGEEEGEEEDDDEQEEENENETEERPKKKQKTKQSKD FT DPEEEEDIGENEEEDLEEDLEEDIEDEEEDLEKDNDGAETPRDAVQS" FT gene complement(<1094725..>1096476) FT /gene="RBP4" FT /locus_tag="PICST_32966" FT mRNA complement(<1094725..>1096476) FT /gene="RBP4" FT /locus_tag="PICST_32966" FT /product="DNA-binding proteins Bright/BRCAA1/RBP1 and FT related proteins containing BRIGHT domain" FT CDS_pept complement(1094725..1096476) FT /codon_start=1 FT /transl_table=12 FT /gene="RBP4" FT /locus_tag="PICST_32966" FT /product="DNA-binding proteins Bright/BRCAA1/RBP1 and FT related proteins containing BRIGHT domain" FT /db_xref="EnsemblGenomes-Gn:PICST_32966" FT /db_xref="EnsemblGenomes-Tr:ABN67876" FT /db_xref="GOA:A3LXW9" FT /db_xref="UniProtKB/TrEMBL:A3LXW9" FT /protein_id="ABN67876.2" FT /translation="MAAPHGESRPGLASIPNLQHPSSTNNSDLISITNSNINSTSITSN FT SNDGSTSKKVRASWYNSRDNNKGKDQDNNDSSSDEDDEDHHNKTPSPKRRFDLDLVGAS FT TPLHVLQGRAANDSISFLSPMNKLNNLHLESDVIEESFQLPEATKDYYTEDEEDEHEDD FT FSLGDKTITNDTDSDIEFHEIDGIDNDHPGLESSSFASPKFISHRKRLHIDSPSDMVIT FT PNHSDSMRASSFRNSHTHDSNDMSICTNSSLKLGFSSSDSTPCPTQPKRKKLKFKRSSG FT ENAPSVTKTLRNKPMLNLSHSVKTTVSDIAANAVQPPVSSLDESDEFSSSPPRVVFTSS FT APGQNNNSTPISQSTPSNSRASTPPCLYQEFGESVNGYKFVKPVGKPQQFSYETPVNNN FT RTTTVNKLRESYNRREFTPMEVQVEQGTYEIIGEFPMASAGVMDESEPEIHIGDKRIND FT PYLTTPSATGSDSVKDYRPKRDYRSEYFNQLRLPLPPPNFDNQESLAKEQLQVLVNDKE FT KVLEFLNLISLEGEDIKELVKNERIRWHPDRWASRFKNNHERVFFDRDIVGNVCQVMNS FT IIEELFS" FT gene <1097745..>1099494 FT /locus_tag="PICST_32967" FT mRNA join(<1097745..1097780,1098055..>1099494) FT /locus_tag="PICST_32967" FT /product="predicted protein" FT CDS_pept join(1097745..1097780,1098055..1099494) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32967" FT /product="predicted protein" FT /note="go_component integral to membrane; go_function FT molecular function unknown" FT /db_xref="EnsemblGenomes-Gn:PICST_32967" FT /db_xref="EnsemblGenomes-Tr:ABN67535" FT /db_xref="GOA:A3LXX0" FT /db_xref="InterPro:IPR004776" FT /db_xref="UniProtKB/TrEMBL:A3LXX0" FT /protein_id="ABN67535.2" FT /translation="MTYCFCTALGTSHFSQTHLMLFHILSQLNVITTGNDVSSANPDLS FT FQDITFLTFEAIIEVVIICFAGFVAAKSGLLNTNGQKVISQLNVDLFTPCLVFIKLAPS FT LSFQKMADIIIIPIFYAVSTGIAFLCSRVVSSFMQLNDPESDFVTAMAVFGNSNSLPVS FT LTMSLAYTLPDLLWEDIDDDSSDGVASRGILYLLIFQQLGQILRWSWGFNKLLRKRSHQ FT ELNTYYTKNGVIQHYHEEELGPDETSSLISAGDRSSSTGSLYINEDSVHAEAPSAAEAA FT MAALASAKAPEYSKRSKIGHWWYSFVTSTPVASFLSFMNPPLYAMMISVLVASVPFLQN FT LFFNNKDSFVRNTITNSISQLGSVSIPLILIVLGSNLYPSQDIPPPSKHYKRIVFGSLL FT SRMILPSFILLPVITLCVKFVKISILDDPIFLIVAFILTISPPAIQLSQISQLNGIYQK FT EMAGVLFWGYVVLTLPTTIFIVVTSLEVLKWAA" FT gene <1101545..>1103935 FT /locus_tag="PICST_32968" FT mRNA <1101545..>1103935 FT /locus_tag="PICST_32968" FT /product="predicted protein" FT CDS_pept 1101545..1103935 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32968" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32968" FT /db_xref="EnsemblGenomes-Tr:ABN67536" FT /db_xref="UniProtKB/TrEMBL:A3LXX1" FT /protein_id="ABN67536.2" FT /translation="MSTYNPRKKADSASNDLPTTGPPSHRAIYNAIHLPTTFNLLRYKH FT FSSKSFSSRPENPTRSGLPSDPASNSSNTSSNSNSSSQFGSSKYARSMDLMEKQLLNRL FT NFRTFNSDSILVINAVLALTAYYMRSNCLKAFSNFGSNDPQQIQNYQQFRNFLIKISAK FT YYGIAIHKLRTMLSRKDYNVTIAIIVSSFMNKISIYEDADLNQSVTFSKGVIGIFNDIL FT SNFKQSNARFLRLFNISNESSYTSANDVSWIINFLVFASKSIFFPTYDPTILLEYNQTL FT IEYRDILHELNRQGIQPSQHVIFNFNHLFSYTQQLLLFIQSHNTNNINQYPILLYKLLR FT HWLIILPSKVHVLEYLSDPLEKTLMYLFRTLTKILDNLFPSVIFYFLHTFSGGLSLWYE FT PNYELDPKIVTPQEMSSFPTPIQHHLIRITIYSVRVCTFFQKRSNILSIFFGDQRLKQE FT LSPQIIQANINEVMIKAFKKTKIRLYHYIHLPNVVQFTKTNVIFDNIQQRFGAKMLYYY FT NQGHYDHFMSKNSDKSYNNVFKKDSIDPIINFHMNNISQSGFETANDNKRFGSMDGSSS FT FSSSTTASPPDTGRSVPVSLPFTTTMGSSAPINYYTIFEDNFSSILTKKLSQEYEDLFR FT SGDNSLFVNPDSAPFLDLQLNPQNRLFFGDNDPLRIAEISTDIIFKRRLQNLFTNTEIY FT NLIVNLHNTRNRRLSAIMSEPASTISISRQPSVTSTNVQLMESIHHEIEVEHRENIKNV FT RKRSGSKSKKKISPEESPVEKVQEKLSDVDNFYDDLNEKYFAL" FT gene 1106780..>1109900 FT /gene="NAF2.2" FT /locus_tag="PICST_84956" FT mRNA join(1106780..1107524,1107621..1107814,1107977..1108652, FT 1108707..>1109900) FT /gene="NAF2.2" FT /locus_tag="PICST_84956" FT /product="Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster FT domain" FT /note="Has EST support" FT CDS_pept join(1107123..1107524,1107621..1107814,1107977..1108652, FT 1108707..1109900) FT /codon_start=1 FT /transl_table=12 FT /gene="NAF2.2" FT /locus_tag="PICST_84956" FT /product="Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster FT domain" FT /note="Zn-finger domain highly conserved has 105 hits in FT genome; go_component nucleus; go_function transcription FT factor activity; zinc ion binding; go_process regulation of FT transcription, DNA-dependent" FT /db_xref="EnsemblGenomes-Gn:PICST_84956" FT /db_xref="EnsemblGenomes-Tr:ABN67537" FT /db_xref="GOA:A3LXX2" FT /db_xref="InterPro:IPR001138" FT /db_xref="InterPro:IPR036864" FT /db_xref="UniProtKB/TrEMBL:A3LXX2" FT /protein_id="ABN67537.2" FT /translation="MVSPISSQSSTTPLAQEALSNSPDSINSEDSNENPVQRNELENAS FT ANSTSSITQSSLAAAAAEKHLIRRRKHKNSKLGCPNCKKRRVKCTENLPACSNCIKHKV FT KCGYLDYTEEQLNELRQAKLAQDFDELTTSNVKKSKPKTKSLSAPNKATTVVVPKKAAS FT FATPSIPHSGTGSGAGSINAPESVVTGTGFEGNEFDNDDSNNNNVNNFNNVGVNINNMN FT NINNNINGNNSSFLRDGYADNMMMVDPTAVDFSNSASSFTMSENSIDFSNPAALNPDSY FT VAFSNVSTIPPSRVTPAPYASALPNAIRSNTTFTVINGEQIDYQEKLLEVVGILGPSID FT NGTCPLPQIRHLYYVWLNSFIYRSYTSEMMFSCLINLTTNYLITNCFINSDSYKKHLPP FT QGSSTTSSELPWDESHQSQFGDKLSHYARVIKDMRYFLNKNEDPDLCSSVSYILSLMSI FT YDPEATLNSSNCFRDGLFSILSYNINLTLKRKGDIGIIITTHLKLMKNIARSVYLPGYD FT PALLIEFQSVLNNFSELIRPVINRVKNYVLSNNLAPVEKLRFVEEKLVDLIDFTDDCIN FT KYIPAIYDNFSDIDKQQELLFDMIYRWVRFFPSRLTVITPASDPLEKVLYLFYKVLKKS FT LYAIFPQVKFFFLRDFDSPLMLDVFVVIKDVDIFFEYLEHPKTNVLPWELYGQILPELK FT NMSSYLIRLVTFLQIRVGLLYRYVVYEQVAKEKFPIKDSRAWRDSITDIEGTRQEFNKV FT IGLKEVPIKSFLKTYIKVENYPRLLQNGEDPSTQGHECIEAEVDFSTLQQSGLLRDDFN FT IMAAMMKGS" FT gene 1110843..1111789 FT /locus_tag="PICST_68134" FT mRNA 1110843..1111789 FT /locus_tag="PICST_68134" FT /product="predicted protein" FT CDS_pept 1110912..1111574 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_68134" FT /product="predicted protein" FT /note="go_function GTP binding; go_process small GTPase FT mediated signal transduction" FT /db_xref="EnsemblGenomes-Gn:PICST_68134" FT /db_xref="EnsemblGenomes-Tr:ABN67538" FT /db_xref="GOA:A3LXX3" FT /db_xref="InterPro:IPR001806" FT /db_xref="InterPro:IPR005225" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A3LXX3" FT /protein_id="ABN67538.1" FT /translation="MADNTDDYSYDYEYLYKIVLIGDSGVGKSNLLSRFTRDEFNLESR FT STIGVEFATRTLEIDGKRVKAQIWDTAGQERYRAITSAYYRGAVGALIVYDIAKTETYE FT SVSRWLKELKEHADANIVIELVGNKSDLDHLRAVPTEEARNFANENNLLFTEASALSSD FT NVDLSFHQLLKNIYEMISKHQLDTNDGGSNKPTTGGPTISLTPAPQEKRSKNNSNCC" FT gene complement(<1111897..>1112469) FT /locus_tag="PICST_32971" FT mRNA complement(join(<1111897..1112322,1112467..>1112469)) FT /locus_tag="PICST_32971" FT /product="predicted protein" FT CDS_pept complement(join(1111897..1112322,1112467..1112469)) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32971" FT /product="predicted protein" FT /note="go_component nucleus; small nucleolar FT ribonucleoprotein complex" FT /db_xref="EnsemblGenomes-Gn:PICST_32971" FT /db_xref="EnsemblGenomes-Tr:ABN67877" FT /db_xref="GOA:A3LXX4" FT /db_xref="InterPro:IPR001163" FT /db_xref="InterPro:IPR010920" FT /db_xref="UniProtKB/TrEMBL:A3LXX4" FT /protein_id="ABN67877.1" FT /translation="MSSLPITKTTKMSDLIHYRLKISTIDNRFFIGSLLAFDKHLNLVL FT SDTEETRITKKSIVSMKKSAGSDGKHDPTFDKRSLGLIILRGEQIVSLSIESPPPLDPK FT KRLGLERGKGISKPLKTPVSVKARVPAIRKPQGGFRRQ" FT gene <1112681..>1113124 FT /gene="MTR1" FT /locus_tag="PICST_32972" FT mRNA <1112681..>1113124 FT /gene="MTR1" FT /locus_tag="PICST_32972" FT /product="Predicted mutarotase" FT CDS_pept 1112681..1113124 FT /codon_start=1 FT /transl_table=12 FT /gene="MTR1" FT /locus_tag="PICST_32972" FT /product="Predicted mutarotase" FT /db_xref="EnsemblGenomes-Gn:PICST_32972" FT /db_xref="EnsemblGenomes-Tr:ABN67539" FT /db_xref="GOA:A3LXX5" FT /db_xref="InterPro:IPR019098" FT /db_xref="UniProtKB/Swiss-Prot:A3LXX5" FT /protein_id="ABN67539.1" FT /translation="MSEEKKEAVVEPKAEEVKEKEQIEEKEVEEEEGTNKRTSEEKDKK FT KHKKRRRRQYDDDVPKDSETKEAAEDDEEEEDGEFDENNLENEEDVEDDLAEIDTANII FT TTGRRTRRKVIDFAKAAKELDAENGVVREDDEEEEDGEFEVKE" FT gene complement(1113434..1115988) FT /gene="CLG1" FT /locus_tag="PICST_68135" FT mRNA complement(1113434..1115988) FT /gene="CLG1" FT /locus_tag="PICST_68135" FT /product="cyclin-like protein" FT CDS_pept complement(1113898..1115181) FT /codon_start=1 FT /transl_table=12 FT /gene="CLG1" FT /locus_tag="PICST_68135" FT /product="cyclin-like protein" FT /db_xref="EnsemblGenomes-Gn:PICST_68135" FT /db_xref="EnsemblGenomes-Tr:ABN67878" FT /db_xref="InterPro:IPR006671" FT /db_xref="UniProtKB/TrEMBL:A3LXX6" FT /protein_id="ABN67878.2" FT /translation="MYQVHSQQQQPLNYYHHNLGTAGHRATSSYSFLPSYATPNSYCQP FT PVGQAACHNHSRSMYSTYQAPYLQQPIMVGGSSMPHIVNPGPVSYGIPTPSASVHAPAP FT VAGAVEEQPQVNGGINPVLEYDLNNMSTFLSWCAFGMLKQQRNPTKEFEGLVVSVLFAT FT RLPKSTIIIALEYMNQRFSSKKSLEHSNLNEHEIFIYLIVALILANKFNDDNTFTNKSW FT CGATGLQLSLLNKYEKTWLEECKWSLNVVNFESNILTLEECWKTWLEKYGKPEALHAGA FT VPVSEPSPVVASPSSTYYPTSSPMLSHQYSHNSLSSIPSSPVYQNESKYYYPSSPVVTS FT PVKYGHESAMMWSGSQQHPSSTNIWSYAQPNVYAPSNINNDPAIQYVGNAVPHHHPLAF FT QAPNSGVFLSHHPNSFVGYANPYFLASC" FT gene complement(<1121610..>1122077) FT /locus_tag="PICST_61268" FT mRNA complement(<1121610..>1122077) FT /locus_tag="PICST_61268" FT /product="predicted protein" FT CDS_pept complement(1121610..1122077) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_61268" FT /product="predicted protein" FT /note="go_component cytoskeleton; go_process regulation of FT actin filament polymerization" FT /db_xref="EnsemblGenomes-Gn:PICST_61268" FT /db_xref="EnsemblGenomes-Tr:ABN67879" FT /db_xref="GOA:A3LXX7" FT /db_xref="InterPro:IPR006789" FT /db_xref="InterPro:IPR036743" FT /db_xref="UniProtKB/TrEMBL:A3LXX7" FT /protein_id="ABN67879.1" FT /translation="MEDWRRIDIDAYEPENHLSKEELIPDLPSTSQEEIVTISKQVRSA FT LSSGQFIEALQLALDHAPYIADEKTKTLHSETIFEILCSIKNNHNLNDLSSFVKKLDSS FT QQDTLVKYLYKTMDTSYGQKQGALLLSWFEKTVEVTGLGPIVRFMSDRRTV" FT gene complement(<1122885..>1123199) FT /locus_tag="PICST_9444" FT mRNA complement(<1122885..>1123199) FT /locus_tag="PICST_9444" FT /product="predicted protein" FT CDS_pept complement(<1122885..1123199) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_9444" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_9444" FT /db_xref="EnsemblGenomes-Tr:ABN67880" FT /db_xref="InterPro:IPR015080" FT /db_xref="InterPro:IPR035946" FT /db_xref="UniProtKB/TrEMBL:A3LXX8" FT /protein_id="ABN67880.1" FT /translation="MSDGEDFPAHLEHPDEDLDNPLRIIIVVNSPEHPEGEMEERLLDS FT IQSMEDVNTFFDTFDEKVAIPNEGHIKYEVGSDGLVVIVVDTLQLRNDVLKFLDEHVAE FT V" FT gene complement(1123413..1125283) FT /gene="PGI1" FT /locus_tag="PICST_84923" FT mRNA complement(1123413..1125283) FT /gene="PGI1" FT /locus_tag="PICST_84923" FT /product="phosphoglucoisomerase" FT CDS_pept complement(1123581..1125242) FT /codon_start=1 FT /transl_table=12 FT /gene="PGI1" FT /locus_tag="PICST_84923" FT /product="phosphoglucoisomerase" FT /EC_number="5.3.1.9" FT /note="phosphoglucoisomerase upregulated 2-3 fold on XOL FT relative to XA; go_function glucose-6-phosphate isomerase FT activity; go_process gluconeogenesis; glycolysis" FT /db_xref="EnsemblGenomes-Gn:PICST_84923" FT /db_xref="EnsemblGenomes-Tr:ABN67881" FT /db_xref="GOA:A3LXX9" FT /db_xref="InterPro:IPR001672" FT /db_xref="InterPro:IPR018189" FT /db_xref="InterPro:IPR023096" FT /db_xref="InterPro:IPR035476" FT /db_xref="InterPro:IPR035482" FT /db_xref="UniProtKB/TrEMBL:A3LXX9" FT /protein_id="ABN67881.1" FT /translation="MSFSNFSLASELPAWKTLEATYKTTGEKFQVKEAFDKDASRFDKF FT SKTFTNYDGSKILFDFSKNLVDDEILAQLVQLAKEANVEGLRDAMFKGEKINETEDRAV FT YHVALRNRALKVMEVDGKNTATEVDDVLQHMKEFSEEIRSGSWTGYTGKAITDVVNIGI FT GGSDLGPVMVTEALKAYSKPGLNVHFVSNIDGTHLAETLKNLNQETTLFLIASKTFTTA FT ETTTNANSAKKWFLEAAKDQAHIAKHFAALSTNADEVSKFGIDTKNMFGFENWVGGRYS FT VWSAIGLSVAIFIGFENFNNFLKGAEALDKHFTETPLAENIPVLGGLLSVWYNNFFGAQ FT THLVAPFDQYLHRFPAYLQQLSMESNGKSVTRGNDFTNYQTGTILFGEPATNAQHSFFQ FT LVHQGTKVIPSDFILAAQSHNPIENNLHQKMLASNFFAQAEALMVGKDENQVKAEGATG FT GLVPHKVFSGNRPTTSILAQKITPAALGALIAYYEHLTFVEGAIWNINSFDQWGVELGK FT VLAKVIGKELEDNSKKVTTHDQSTKGLINQFKEWAE" FT gene <1126373..>1127338 FT /locus_tag="PICST_32978" FT mRNA <1126373..>1127338 FT /locus_tag="PICST_32978" FT /product="predicted protein" FT CDS_pept 1126373..1127338 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32978" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32978" FT /db_xref="EnsemblGenomes-Tr:ABN67540" FT /db_xref="UniProtKB/TrEMBL:A3LXY0" FT /protein_id="ABN67540.2" FT /translation="MTGLASKWATDDSLVEEAKKQDEIKNTPVEQKTTSIESKWSKPVT FT VGKKQTLVSKWADSPAEETSKPPVAKESHHQEHSTHKPSRSKEPNRSKETNRPKEPKSY FT RDHSKENQHADSGAHTRSGRSHGRTKSRDVQYSAPEIPVQERGPMTNAADAFAARIGVP FT SKPVNRVVEEHVEEGDGFVTTDEEDEEEENEEELEEVPVLSAAQLKSANVLASRLGGIS FT LKENTISKKNTPGRQTPTTKNKPDTRGDSRDKNRKDERGTKSKYETPRQKKERDQRTSQ FT NEERRRAQLNKEAEEKKAEQEMLKMLDKLDAKEIDWVDFE" FT gene <1128647..>1129840 FT /locus_tag="PICST_32979" FT mRNA <1128647..>1129840 FT /locus_tag="PICST_32979" FT /product="predicted protein" FT CDS_pept 1128647..1129840 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32979" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32979" FT /db_xref="EnsemblGenomes-Tr:ABN67541" FT /db_xref="GOA:A3LXY1" FT /db_xref="UniProtKB/TrEMBL:A3LXY1" FT /protein_id="ABN67541.2" FT /translation="MPILSSSIAISTRLGYSLIPTNSLLARATSIHISRSRPVLSKKTD FT AKIQIRKYYNSSSHSYKQEYEKQKYDQLIRDQIIQSSLAGSSLGSGGHGIKDNRRLSLK FT TIFLLIATSSSLSMVIYVAIQLLKFQDEDANQPVSRKRIFLPFWVNSNLLYQKTFSFPA FT GLSYLDKEYKAYLETEMAQLNKFKTKSDYDNYIEIFENDNIRFKVLEQVSSNLKVKQVF FT GLPLVVEKPADSKLQIWLETKYPSVSGLEITIEKTKATEQSKKSTSISASWTVKSINIV FT SIINGALVSMGLKLDRLDNSEAQLKTSERGSGKIHEVPVVDRKDNSIVNKNRDYNVIFS FT GELIIKDKNQFESGVLKYEGLFDFDHLMINRGVKIHKMELYMRHKSNPNELVKYKIM" FT gene <1130691..>1132886 FT /locus_tag="PICST_47947" FT mRNA join(<1130691..1131060,1131283..>1132886) FT /locus_tag="PICST_47947" FT /product="predicted protein" FT CDS_pept join(<1130691..1131060,1131283..1132886) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_47947" FT /product="predicted protein" FT /note="go_component nucleus; go_function transcription FT factor activity; zinc ion binding; go_process regulation of FT transcription, DNA-dependent" FT /db_xref="EnsemblGenomes-Gn:PICST_47947" FT /db_xref="EnsemblGenomes-Tr:ABN67542" FT /db_xref="GOA:A3LXY2" FT /db_xref="InterPro:IPR001138" FT /db_xref="InterPro:IPR036864" FT /db_xref="UniProtKB/TrEMBL:A3LXY2" FT /protein_id="ABN67542.2" FT /translation="RNRKAGQATRTLKACELCRKQKTRCFRSPENKACLRCTFLSKSCS FT FEVTLESLPLTPSNSSSINTLLSDQAETNRKLDLIYSGLREVLHHIKGPEKSDSNSNSH FT SHSHPHLHSTPGLINNDDAPSSKMSPFSIVNNQLKPVDVPRPILNLLNLSTITGNRGRN FT SYFESTDDLLTLGILSESETVDLMNDFRRNYGRWVSFPSNLSTSVLIDRIRHKSSLLLT FT TCCCISLRYSLNSNNSNDKENLQRMKKSYRDLVKQLIRDLDRSLIKFGAFQGASDLGGD FT IEFLQAMVILSIYSFSISSIVPSTINEASLIEDESDLNLRDFNLDPWFLSSIGLTTFIT FT KSTFGTLFKSNKKGIPSKSTVGKKSFPFTILYDELDSDEYQTLTTLRIYNHMCLVHLIQ FT CVFSGRMCVLDEIRINYCTATLSLPSATNFDGRMVSEIGILLIAYNYMQILSMTDSGSL FT SECESNFLSVKEEIGQWYEQWEYLFSQPALQFVELNYNFCNLIIHYGYTYQKMSIMKPL FT NKENSPDNGGDLLATAPMYEERNISYILENSDRNSLSKMFHHSYNVVKFVNDIESDSYF FT AYLSDQLHFCFYFSGICLVNILRYVIDNGQLNVLGGSEVSEIVKDIRNLIDKFSRVGQD FT NQDDIITKYKIGLENHLSEYLS" FT gene complement(<1132952..>1134421) FT /gene="CEF1" FT /locus_tag="PICST_61569" FT mRNA complement(<1132952..>1134421) FT /gene="CEF1" FT /locus_tag="PICST_61569" FT /product="cation efflux family protein" FT CDS_pept complement(1132952..>1134421) FT /codon_start=1 FT /transl_table=12 FT /gene="CEF1" FT /locus_tag="PICST_61569" FT /product="cation efflux family protein" FT /note="go_component membrane; go_function cation FT transporter activity; go_process cation transport" FT /db_xref="EnsemblGenomes-Gn:PICST_61569" FT /db_xref="EnsemblGenomes-Tr:ABN67882" FT /db_xref="GOA:A3LXY3" FT /db_xref="InterPro:IPR002524" FT /db_xref="InterPro:IPR027469" FT /db_xref="InterPro:IPR036837" FT /db_xref="UniProtKB/TrEMBL:A3LXY3" FT /protein_id="ABN67882.1" FT /translation="RPLFQRLLSNHFTVTNPNSPHENILLQNPSLTNLPHNGSTVFYDN FT SSVYSLEVEQQQRRLSVINMLRPQRLIGTYKRLANWYDYYVDLKDVKKKQRKYYQDQNY FT LIEKFQEIDNFLDAGKIHYNMLSNYEDSRILATHMEIVEEESPAHSPTEMQKTDSRNSN FT YSRFYDVPGNVDNDGSKFLGYNEEEDNAQVLTAILVNFFINFILLLGKGVVAFLTNSIS FT MVASLVDSILDFLSTFIIYIVNRLATSSDWKVQYAYPIGRSRLEPLGVLIFSVIIILSF FT FQVGQESFKRLFMSTPEERHVARIGIDAIVIMTITIVSKVGCWAWCASSKSSSVRALAQ FT DAMTDIVFNTVSLLMPTIGFYCNIWWFDPLGALLLSVYIIVSWCKTAFEHIDNLTGAAA FT DPMHYKVVLYLAYRFAEPIKQITSLKVYHVGDNLNVEIDVVFSNEEFELSFKDCHDIAE FT ALQYSIESLPMVERAFVHIDYMEGNFKGHLK" FT gene complement(<1136774..>1137916) FT /locus_tag="PICST_62437" FT mRNA complement(<1136774..>1137916) FT /locus_tag="PICST_62437" FT /product="predicted protein" FT CDS_pept complement(1136774..1137916) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_62437" FT /product="component of the ARP2-3 complex" FT /db_xref="EnsemblGenomes-Gn:PICST_62437" FT /db_xref="EnsemblGenomes-Tr:ABN67883" FT /db_xref="GOA:A3LXY4" FT /db_xref="InterPro:IPR001680" FT /db_xref="InterPro:IPR011659" FT /db_xref="InterPro:IPR015943" FT /db_xref="InterPro:IPR017383" FT /db_xref="InterPro:IPR017986" FT /db_xref="InterPro:IPR024977" FT /db_xref="InterPro:IPR036322" FT /db_xref="UniProtKB/TrEMBL:A3LXY4" FT /protein_id="ABN67883.2" FT /translation="MSAPIQYQLGHLPIKDHVFSPDHSLLAVTKDTKVEIYSINTANLA FT AKPKLFTVLAGHDKTVTSVDISPDGSRILTCSQDRNALVWEYDGAANEYKPTLVLLRIN FT RAATVCKWSPDGQKFAVGSSDRIIAVCYYEAENNWWVSKHLKKPLKSTITCLSWHQNGV FT LLASGSTDGHVRVFSAFIKGLDEKPEPSPWGSKLPFQTLCGDFINDTGAWIHGVAFSPD FT GNSLAFASHDSSIGVIYPEGEGLPPKSIINVKTNYLPFKSLAYLTNNKIVVGGHNCNLI FT VFEGDETEWRESRVIESQKDLTKEAPSTGDDEDEEISSHQALNMFKQMDLKGRVNKPSA FT NSGGNRLSTTHQNTISSVKVFSGNQVSTSGIDGKIVIFNV" FT gene complement(1138279..1139343) FT /locus_tag="PICST_78999" FT mRNA complement(1138279..1139343) FT /locus_tag="PICST_78999" FT /product="predicted protein" FT CDS_pept complement(1138463..1139227) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_78999" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_78999" FT /db_xref="EnsemblGenomes-Tr:ABN67884" FT /db_xref="GOA:A3LXY5" FT /db_xref="InterPro:IPR005344" FT /db_xref="UniProtKB/TrEMBL:A3LXY5" FT /protein_id="ABN67884.1" FT /translation="MSSTAVQQPLSTDSGIPSTEPTHDVSGTTTIKRKKLVKKVAQPNK FT LKFLIWQAGHASTLVFGTISLLFQVLWLPNKYYINSISYRLALAGSIAALTATFSHKFG FT LHYLPSTSTLISYQNFQYLILAVVWLFTFKSIFKIIPFFLISLLHLAKQKNIEPVLKES FT GLLASIIAYDELVLIVYLLLRTLLFRRSAGFQLTLFLLFYWLRILYNKETQNLFSAVIE FT RLDGKLSQVKNPKVQHYWQKTKAFLEQKRAHD" FT gene <1139664..>1140089 FT /locus_tag="PICST_32984" FT mRNA <1139664..>1140089 FT /locus_tag="PICST_32984" FT /product="predicted protein" FT CDS_pept 1139664..1140089 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32984" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32984" FT /db_xref="EnsemblGenomes-Tr:ABN67543" FT /db_xref="GOA:A3LXY6" FT /db_xref="InterPro:IPR013965" FT /db_xref="UniProtKB/TrEMBL:A3LXY6" FT /protein_id="ABN67543.1" FT /translation="MQSNIDYSKSSLLSPLESQVLTQYQFLNSQLITLNNEISKLTHKS FT KPEDTDEDTEEWSQTRSTGVGHLLLDNLRNLEMKIGLIHTLFKGAVYALFLEQDNADLG FT KQEDEDEEQEEEEEQEDSEGEVLDVDADVTRDHIEVE" FT gene <1141080..1142639 FT /gene="ADE13" FT /locus_tag="PICST_84718" FT mRNA <1141080..1142639 FT /gene="ADE13" FT /locus_tag="PICST_84718" FT /product="3-isopropylmalate dehydratase" FT CDS_pept 1141080..1142531 FT /codon_start=1 FT /transl_table=12 FT /gene="ADE13" FT /locus_tag="PICST_84718" FT /product="3-isopropylmalate dehydratase" FT /note="go_function catalytic activity" FT /db_xref="EnsemblGenomes-Gn:PICST_84718" FT /db_xref="EnsemblGenomes-Tr:ABN67544" FT /db_xref="GOA:A3LXY7" FT /db_xref="InterPro:IPR000362" FT /db_xref="InterPro:IPR004769" FT /db_xref="InterPro:IPR008948" FT /db_xref="InterPro:IPR019468" FT /db_xref="InterPro:IPR020557" FT /db_xref="InterPro:IPR022761" FT /db_xref="InterPro:IPR024083" FT /db_xref="UniProtKB/TrEMBL:A3LXY7" FT /protein_id="ABN67544.1" FT /translation="MSSNYDSYSTPLSSRYASEEMSKIFSLRNRFSTWRKLWYNLAIAE FT KEVGLTVISDEAIAQMRQHLDITDEEIAAASKEEAIVRHDVMAHVHVFGNTCPEAAGII FT HLGATSCFVTDNADLIFLRDAYDVIIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQL FT TTVGKRATLWIQELLWDLRNMERARNDIGLRGVKGTTGTQASFLSLFHGDHDKVEALDQ FT RVVELLGFDHVYPVTGQTYSRKIDIDVLSPLASFGASAHKFATDIRLLANLKEIEEPFE FT KSQIGSSAMAYKRNPMRCERVCSLARHMGGLLNDAIQTASVQWFERTLDDSAIRRISLP FT SAFLTADILLSTMLNITSGLVVYPKVIERRVNSELPFMATENIIMAMVEKGGSRQDCHE FT EIRVLSHQASAVVKQEGGDNDLIDRVKKTEYFKPIWADLESLLDPKTFVGRAPEQTEKF FT VKVDVAKAIKPYEKYITNEAVSLSV" FT gene complement(<1142681..>1143544) FT /locus_tag="PICST_62698" FT mRNA complement(<1142681..>1143544) FT /locus_tag="PICST_62698" FT /product="predicted protein" FT CDS_pept complement(1142681..1143544) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_62698" FT /product="predicted protein" FT /note="go_component intracellular; ribosome; go_function FT structural constituent of ribosome; go_process protein FT biosynthesis" FT /db_xref="EnsemblGenomes-Gn:PICST_62698" FT /db_xref="EnsemblGenomes-Tr:ABN67885" FT /db_xref="GOA:A3LXY8" FT /db_xref="InterPro:IPR016082" FT /db_xref="InterPro:IPR018038" FT /db_xref="InterPro:IPR023106" FT /db_xref="InterPro:IPR035808" FT /db_xref="InterPro:IPR036919" FT /db_xref="InterPro:IPR039699" FT /db_xref="UniProtKB/TrEMBL:A3LXY8" FT /protein_id="ABN67885.2" FT /translation="MAVLNSNPEVLLRKRKDADRKRLEKQEQAREKLVKQKTLRKKVAQ FT NKFIRAETLVSNHKSNELEKKRIRNLTKKTARSRISASSEDAEEEEEDSEYRLLFIIRV FT PNHTKGVKIPSKANKVLNVLKLTQVNTGVFVRANNSTYALLNLIAPYVIVGKPTLSSIR FT KLFQKRACILTYDESEETTTEQGKIAKVTKLDNNQLVEDKFGDSLGLICIEDLIHEITN FT LSDNFISITSWLLPFKLNQPVNGWGPQAKLAKLIHSEENKKSISLSQDFKLQEVEDIDS FT IIDQQN" FT gene 1145282..1148418 FT /locus_tag="PICST_78645" FT mRNA join(1145282..1145690,1145787..1147611,1147636..1148418) FT /locus_tag="PICST_78645" FT /product="predicted protein" FT CDS_pept join(1145508..1145690,1145787..1147611,1147636..1148255) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_78645" FT /product="DNA binding protein" FT /note="go_function DNA binding; go_process regulation of FT transcription, DNA-dependent" FT /db_xref="EnsemblGenomes-Gn:PICST_78645" FT /db_xref="EnsemblGenomes-Tr:ABN67545" FT /db_xref="GOA:A3LXY9" FT /db_xref="InterPro:IPR003150" FT /db_xref="InterPro:IPR036388" FT /db_xref="InterPro:IPR036390" FT /db_xref="InterPro:IPR039779" FT /db_xref="UniProtKB/TrEMBL:A3LXY9" FT /protein_id="ABN67545.2" FT /translation="MDHSQHQLHQKLDDSYLLQSGSSGDSQQQSQQQQQQQQQQQHQQS FT LQHQQSLQHQNIQHQNQHIAYKQPQQSPSFPYNQHQHLQLQQQQQKQYHYDFNAQLQHQ FT HDPQHELHQQQLQQQQYAQYYQQQPQNQQNQEQHTQAQQHQQLQQNQQAQQVQQAQQVQ FT QAHQQSQSFLEPSNPILVGSSSLDLESMKGPASKKKKTRKSDHGSHGDDGDSELKQLAF FT QTAEVPLDQLAARIKQLEADEPAPSSIQGQPTSPRSVESHKVRENKERQRQLFGMVWLL FT NSCESSPTAVVPRNRIYARYVQVCADNSLTPLSPASFGKLVRILFPNLTTRRLGMRGQS FT KYHYCGIKLNGERLMPSSLQVPQPMSQSQLVGNMAMSGSGSQQIQSPISSSNSSVSFED FT SPRSSSHLHTPSYTPIQSPSITSANSIADQLPSVSHLKYIPNLLALLNENSQTTSNPYS FT PIQLPSIYPFLPRDNDYDIADTLYSLYKVHINSIFESLRFMQLKKLFSSFNSFNSILTA FT PVFKLYTSDTVLEWVKQCDIIMYKRMIRMLNKLSLQFMIPQEVISQLKQISSGYIRALT FT NNLLNNKVSKNFVIMKLKVAKSFINLLNRLIKIIETGQSASRILCDVNEKNGMNHDWMK FT LDIQDIISREIPCGDKNIDVLSTILKSDVVNLLNTKQSERPVIDNAIMNQFANYISELP FT GKFQDVNPRLFILLTSNLLTTCLREISLTGGQGFGAWWIVRCWVDEYLAWCFEIGGFLQ FT DDFKKPEDSPQDQDTSKENAGNEEGKNSSADNSTALASGSGDNSDANFSGMNNPESFDL FT SNIDLGSSAINPNSSLGAVDLLDGTYGTDPQNPAVVSSNVSSVAAATNEILIKYETNVE FT SILG" FT gene <1148790..>1150658 FT /locus_tag="PICST_32988" FT mRNA join(<1148790..1150413,1150483..>1150658) FT /locus_tag="PICST_32988" FT /product="predicted protein" FT CDS_pept join(1148790..1150413,1150483..>1150658) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32988" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32988" FT /db_xref="EnsemblGenomes-Tr:ABN67546" FT /db_xref="UniProtKB/TrEMBL:A3LXZ0" FT /protein_id="ABN67546.2" FT /translation="MNESPTQERYLSSPREVLVYQIEKFLQARQKFTCSGLEILFNNNK FT HVQLINSDKGPDKRGLAFTSKPPPLKPILQLDPLVRSYPHGGVPTESNIDPKNVSARTL FT KILRSQILERSIIRATESSAARSGPSNWNGETYKLAIKLFLACVLDPNYSNMVYSLTSH FT TSNIHKTSHLGQELELYVENLLLAIDIIDADSVLSKKGTLLEDSIRTLVHIMAVNYATV FT IIGDSPAQFFDITFALINHSCFPNVLPVVSDDCDKIQLVYFNNFVANKTKQLFTNYCYT FT AIPKELRNADLRNRFFFTCNCWLCKQPHDIFFSYNCNNCNQMICSLNSSNWYLPVSQLD FT YVNDNKDTCLSCRADFDKRELAKNHSLNGYLLLAMLDPEQDKDDNEALLVFNHRMKLLL FT QSIISGAISKEEIVRLLLLRVYNFRIPPKKRSIFRKITNDLRNGRYVPGYGFPLSFFLR FT DLDIDNPQIDGIRTFVASKVVAANQFTRLKEVLQLKFGTELPCRLVESRLIANEHFKEI FT AQALSQVFSYVVRLRYSGCIPVKIETYMAYSKNTVDSLVDSIKRLISLADNNKIDNICF FT KRYNMTDHYFQSHLKALYDFAEVQ" FT gene complement(<1150767..>1151780) FT /gene="LST8" FT /locus_tag="PICST_36759" FT mRNA complement(join(<1150767..1151530,1151588..>1151780)) FT /gene="LST8" FT /locus_tag="PICST_36759" FT /product="protein required for amino acid permease FT transport from the Golgi to the cell surface" FT CDS_pept complement(join(1150767..1151530,1151588..1151780)) FT /codon_start=1 FT /transl_table=12 FT /gene="LST8" FT /locus_tag="PICST_36759" FT /product="protein required for amino acid permease FT transport from the Golgi to the cell surface" FT /db_xref="EnsemblGenomes-Gn:PICST_36759" FT /db_xref="EnsemblGenomes-Tr:ABN67886" FT /db_xref="GOA:A3LXZ1" FT /db_xref="InterPro:IPR001680" FT /db_xref="InterPro:IPR015943" FT /db_xref="InterPro:IPR017986" FT /db_xref="InterPro:IPR019775" FT /db_xref="InterPro:IPR020472" FT /db_xref="InterPro:IPR036322" FT /db_xref="InterPro:IPR037588" FT /db_xref="UniProtKB/TrEMBL:A3LXZ1" FT /protein_id="ABN67886.2" FT /translation="MSVILASAGYDHTIRFWDALTGVCSRTIQHTDSQVNRLEITSDKR FT FLAAAGNLYVRLYDIRQAGTTHGNSNNNSNNNNNNNPVMTFEGHTNNVTSLAFQIENKW FT MVTSSEDGTVKVWDVRAPSVQRSYKHHSPVNEVVIHPNQGELISCDQDGNIRIWDLGEN FT QCTHHLIPEDDVPINSLSVASDGSMLVAGNNKGNCYVWKMQNQRDITSLTPVTKFRSHS FT KYITRVLLSTDMKHLATCSADHTARIWSTEQNFNLETTLQGHQRWVWDCAFSADSAYLV FT TACSDHYVRLWDLSNSETVRQYNGHHKGAVCVALNDV" FT gene complement(1152177..1153446) FT /gene="SIS1" FT /locus_tag="PICST_84519" FT mRNA complement(1152177..1153446) FT /gene="SIS1" FT /locus_tag="PICST_84519" FT /product="Molecular chaperone (DnaJ superfamily)" FT CDS_pept complement(1152400..1153434) FT /codon_start=1 FT /transl_table=12 FT /gene="SIS1" FT /locus_tag="PICST_84519" FT /product="Molecular chaperone (DnaJ superfamily)" FT /note="go_process protein folding" FT /db_xref="EnsemblGenomes-Gn:PICST_84519" FT /db_xref="EnsemblGenomes-Tr:ABN67887" FT /db_xref="GOA:A3LXZ2" FT /db_xref="InterPro:IPR001623" FT /db_xref="InterPro:IPR002939" FT /db_xref="InterPro:IPR008971" FT /db_xref="InterPro:IPR018253" FT /db_xref="InterPro:IPR036869" FT /db_xref="UniProtKB/TrEMBL:A3LXZ2" FT /protein_id="ABN67887.2" FT /translation="MVKETKLYDLLEVSPSASETEIKKAYRKAALKYHPDKPTGDTEKF FT KEVSEAFDILSNGDKRQVYDDYGLEAARGNAPAGGNPFAGAGSGNPFGGAGGYGGGHHG FT FSQADAFNIFSQMGGFGMGDDGFSFSSSGPGGFGGGHPFGGGAGGMPGGFGGQGFGGRS FT ARRPEPDTVSMPLPVSLEDLFHGGVKKMKLNRKGLHGERESKVLEVNIKPGWKAGTKIN FT FTNEGDYQPECQARQTLQFVLEEKPHPVFKRDGTSNNLIVNLPITFKESLCGFDKDITT FT IDGKRLPFSKTQPVQPNSSALYPGLGMPISKSPGQRGDMEVIFKVDYPISLTPQQKQAI FT QTNF" FT gene complement(1154099..1155272) FT /gene="YBO9" FT /locus_tag="PICST_79198" FT mRNA complement(1154099..1155272) FT /gene="YBO9" FT /locus_tag="PICST_79198" FT /product="beta-hydroxysteroid dehydrogenase type 3" FT /note="Has EST support" FT CDS_pept complement(1154223..1155263) FT /codon_start=1 FT /transl_table=12 FT /gene="YBO9" FT /locus_tag="PICST_79198" FT /product="beta-hydroxysteroid dehydrogenase type 3" FT /EC_number="1.1.1.62" FT /note="go_function oxidoreductase activity; go_process FT metabolism" FT /db_xref="EnsemblGenomes-Gn:PICST_79198" FT /db_xref="EnsemblGenomes-Tr:ABN67888" FT /db_xref="GOA:A3LXZ3" FT /db_xref="InterPro:IPR002347" FT /db_xref="InterPro:IPR020904" FT /db_xref="InterPro:IPR027533" FT /db_xref="InterPro:IPR036291" FT /db_xref="UniProtKB/Swiss-Prot:A3LXZ3" FT /protein_id="ABN67888.1" FT /translation="MSVVDFIQAITENKFGEYVLLGALLVGVFKLTVFILSVTSLLVDL FT FVLPATNLKTYGAKKGKWAVITGASDGIGKEYAFQLASKGFNVVLVSRTQAKLETLASE FT IEAKYKVETKVVAFDASTDAEDNYKSLGDAISGLPVTVLINNVGQSHSIPVPFLETENK FT ELQDIITINVTATLKITQTVAPVIAETVSKEKKKVRGLILTMGSFGGLLPTPYLATYSG FT SKSFLQAWSAALAGELQSQGVDVELVISYLVTSAMSKIRRASLSIPSPKNFVRATLNGI FT GRRNGAQERYATSTPYWAHALMHFGIDQTVGVYSKLANSLNLNMHKSIRARALKKAARL FT AAEKKD" FT gene complement(<1155619..>1156455) FT /locus_tag="PICST_32992" FT mRNA complement(<1155619..>1156455) FT /locus_tag="PICST_32992" FT /product="predicted protein" FT CDS_pept complement(1155619..1156455) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32992" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32992" FT /db_xref="EnsemblGenomes-Tr:ABN67889" FT /db_xref="UniProtKB/TrEMBL:A3LXZ4" FT /protein_id="ABN67889.2" FT /translation="MSDPNGYRDDPEDQYYANTYGQKYVSYGEDSSSSYYGSGYRGRGR FT GRGRGSSYRGRGSYDHYGYNGSSHSRYGGDRSRRTEYQSNNSYENPEETSVYNDVSGPG FT AHDSYRGSSYRGSGSSYRGSGYRDGSYRGSRNSIDRNERSDRDREWGSREGERENGRHY FT SGHHSAYSGGHGGSRASVSVKDKSISGPSSSVRNNSKVKTFNNPWIEIMEINDETTQET FT LETRYNELGYVNSDIRQLQLAKRKLEGSVLNLERQAEREALHVQITNDKLEEFTYL" FT gene <1157016..>1158337 FT /locus_tag="PICST_32993" FT mRNA join(<1157016..1158252,1158324..>1158337) FT /locus_tag="PICST_32993" FT /product="predicted protein" FT CDS_pept join(1157016..1158252,1158324..1158337) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32993" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32993" FT /db_xref="EnsemblGenomes-Tr:ABN67547" FT /db_xref="UniProtKB/TrEMBL:A3LXZ5" FT /protein_id="ABN67547.2" FT /translation="MTANVVPEKHQSIFDRIWLEVDNETHGEVTVEDLNTLVSHLESVL FT DQQPSLNHTTSSGIFSNDALVKARINQYKNAMGSSSTISKSQALEYLSSVIDESEILGF FT QDFSGYKINNPSKTSSAFVDSPEHVDNFHNLLHKPSGNMRMLAGSPSIRSQKSEDTDID FT DYDETASLMGTSPHKQYHHRSPSLDEADPIGLESAPDNSPQTLIRKSLEDMQKFHSTIN FT GNFDSFSKQISDLEAENVHDLENLSTVKDTNHRVLEQLDSLKSELKEISNQIDTHKQLQ FT CTPPVTPKKLVIQSNSPSPKVNITSTVMNERDRAVFEKLTHKSHSSFIYSGYGKKRVLS FT DGQPSSSNVGVRLDFKHPMGHRRAASEVPESPRKLPSTPNNRTVEAAAEKDLEAASNKK FT DSIRSITSIEKEKRRIY" FT gene complement(1158676..>1159622) FT /gene="CDC28" FT /locus_tag="PICST_90135" FT mRNA complement(1158676..>1159622) FT /gene="CDC28" FT /locus_tag="PICST_90135" FT /product="cell division control protein" FT /note="Has EST support" FT CDS_pept complement(1158676..1159608) FT /codon_start=1 FT /transl_table=12 FT /gene="CDC28" FT /locus_tag="PICST_90135" FT /product="cell division control protein" FT /note="Catalytic subunit of the main cell cycle FT cyclin-dependent kinase; go_function protein kinase FT activity; ATP binding; go_process protein amino acid FT phosphorylation" FT /db_xref="EnsemblGenomes-Gn:PICST_90135" FT /db_xref="EnsemblGenomes-Tr:ABN67890" FT /db_xref="GOA:A3LXZ6" FT /db_xref="InterPro:IPR000719" FT /db_xref="InterPro:IPR008271" FT /db_xref="InterPro:IPR011009" FT /db_xref="InterPro:IPR017441" FT /db_xref="UniProtKB/TrEMBL:A3LXZ6" FT /protein_id="ABN67890.1" FT /translation="MVELSDFQRQEKVGEGTYGVVYKALDTKHNNRVVALKKIRLESED FT EGVPSTAIREISLLKEMRDENIVRLYDIIHSDSHKLYLVFEFLDLDLKKYMESIPQGAG FT LGANMVKRFMNQLVKGIKHCHSHRVLHRDLKPQNLLINKEGNLKLADFGLARAFGVPLR FT AYTHEVVTLWYRAPEILLGGKQYSTGVDMWSVGCIFAEMCNRKPLFPGDSEIDEIFRIF FT RILGTPTEEIWPDVSYLPDFKPTFPKWSKKNLAEFVPTLDADGVDLLEQMLVYDPSGRI FT SAKRALVHPYFQEEDGDNYDSFPRSVNMG" FT gene complement(1160295..1161718) FT /gene="SAT4" FT /locus_tag="PICST_73399" FT mRNA complement(1160295..1161718) FT /gene="SAT4" FT /locus_tag="PICST_73399" FT /product="serine/threonine protein kinase" FT /note="Has EST support" FT CDS_pept complement(1160438..1161688) FT /codon_start=1 FT /transl_table=12 FT /gene="SAT4" FT /locus_tag="PICST_73399" FT /product="serine/threonine protein kinase" FT /EC_number="2.7.11.17" FT /note="go_function protein kinase activity; ATP binding; FT go_process protein amino acid phosphorylation" FT /db_xref="EnsemblGenomes-Gn:PICST_73399" FT /db_xref="EnsemblGenomes-Tr:ABN67891" FT /db_xref="GOA:A3LXZ7" FT /db_xref="InterPro:IPR000719" FT /db_xref="InterPro:IPR008271" FT /db_xref="InterPro:IPR011009" FT /db_xref="InterPro:IPR017441" FT /db_xref="UniProtKB/TrEMBL:A3LXZ7" FT /protein_id="ABN67891.1" FT /translation="MTSSSPAVAKPRFRMLQDGNHEHSLRSAKRQEKLSNMLKDLLGAK FT KLRDEAKSAVPNILQGAGAAPSPVPGKEKPPTLFAGLVTHIKNNTSPYHTSAGEIVGEV FT VQQNGYSPNLGDCRSFVEKYGRCQEVVGRGAFGVVRISHKKLNGTETNGGGDGEMLYAV FT KEFKRRPNESEKKYNRRLTSEFCISSSLKHLNIIDTLDLLKDAKGDYCEVMEFCSGGDL FT YTLIIAAGKLEYAEADCFFKQIIRGVNYMHDMGVCHRDLKPENLLLTQNGVIKITDFGN FT GECFRVAWENEIQLSEGICGSSPYIAPEEFTQESFDPRCVDIWACGVIYMAMRTGRQLW FT KLADPDKDEFFEEYLVKRKESSGYEPIESLKRARCRNVIYSILDPKPERRITGKQILNS FT EWGREIKVCAAGEGHSS" FT gene 1165565..>1166413 FT /gene="SPS22" FT /locus_tag="PICST_65964" FT mRNA 1165565..>1166413 FT /gene="SPS22" FT /locus_tag="PICST_65964" FT /product="short-chain dehydrogenase/reductase (SDR) family FT protein" FT CDS_pept 1165640..1166413 FT /codon_start=1 FT /transl_table=12 FT /gene="SPS22" FT /locus_tag="PICST_65964" FT /product="short-chain dehydrogenase/reductase (SDR) family FT protein" FT /note="go_function oxidoreductase activity; go_process FT metabolism" FT /db_xref="EnsemblGenomes-Gn:PICST_65964" FT /db_xref="EnsemblGenomes-Tr:ABN67548" FT /db_xref="InterPro:IPR002347" FT /db_xref="InterPro:IPR036291" FT /db_xref="UniProtKB/TrEMBL:A3LXZ8" FT /protein_id="ABN67548.1" FT /translation="MAGNFKSEKDISGKVAVITGGTTNLGGETAKELASLGVNLFLHYR FT SSSEVAKKFQEELKAKYPKLQIEIYQAPLKAAADLTKLFEAAKKAFPQGIDIAINNIGK FT VVKKPLVEVTEEEFDELDLVNHKVAFFFLKEAALNLNNNGRIVTIVTSLLAAYTPFYSP FT YQGTKAPVEFYTKALSKELGEKGITVNNVAPGPMDTSFLHTSETPEAVQYLASVGLNGR FT LTELPDIVPIVRFLVSEGAWITGQTIFASGGFTAR" FT gene complement(<1167599..>1168588) FT /locus_tag="PICST_32997" FT mRNA complement(<1167599..>1168588) FT /locus_tag="PICST_32997" FT /product="predicted protein" FT CDS_pept complement(1167599..1168588) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_32997" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_32997" FT /db_xref="EnsemblGenomes-Tr:ABN67892" FT /db_xref="GOA:A3LXZ9" FT /db_xref="UniProtKB/TrEMBL:A3LXZ9" FT /protein_id="ABN67892.2" FT /translation="MYAIVVNSFMVVFRGIWSVFNLVVITPIYYFVYIQYMLVLHLLLI FT PIQLLVSITIYTALIKIPIVIPLSYVLELNDSNPERADNAWLAAQLHLFFVNFTHFAMV FT SVFLGICAGTILGWNIIGIRYLLTWGKRKTKKGSRSLYKSYQGSKVSTRNANISSPDRK FT RFVTPVSSAKSSPRRDASAQSTPLLSRLLNTVVVDDHTETRATGSNIHTSGNLRGRSTN FT KTKQELVYEDDDGYSYSMYSKRSKEQLPQIVSPSKQNKRSSEKGTDSKKTTFAQPVEAE FT LPLADPIEEEIGTIAEESETESMNDGATLFSNVRNDATLASSVREEPK" FT gene complement(1169100..1172368) FT /locus_tag="PICST_84858" FT mRNA complement(join(1169100..1169695,1169750..1171092, FT 1171204..1171418,1171494..1172368)) FT /locus_tag="PICST_84858" FT /product="predicted protein" FT CDS_pept complement(join(1169355..1169695,1169750..1171092, FT 1171204..1171418,1171494..1171748)) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_84858" FT /product="high copy suppressor of a cyclic AMP-dependent FT protein kinase mutant" FT /db_xref="EnsemblGenomes-Gn:PICST_84858" FT /db_xref="EnsemblGenomes-Tr:ABN67893" FT /db_xref="GOA:A3LY00" FT /db_xref="InterPro:IPR008862" FT /db_xref="UniProtKB/TrEMBL:A3LY00" FT /protein_id="ABN67893.2" FT /translation="MMNSQLNNPDNQDQIFQEDQFRQVCFDPQQPQTSGSTAGSASSAS FT TSASTNSASTSDGSSSSSSTKRNSSSAGTATCSLADSSKRKSTPSSNGLGADMSSSASS FT KAAALKSKAPFIIRRFRSRSLPIINYNSQRPHHFHHHHHNNSGNSSSINTSTTSSSSSS FT SSSIPPLPPINLQSLKEIDLHEILKNPQLRHDILFDPQLQFRPNLDGERGKRKKSIIDK FT YWLEIQKECAQFFNNTNSINNNSSSSDNNSSIKIKINRLPILFGTLRDILLSLLPTKDR FT QQVNEIMDIDLLVQQLNHGSFDFVEMSKWLGDVFKSHCAPMRDQWVVEMNQKFVDAYNF FT NSVELLVGGLRMIFQILEAMKLDVANHQIRILRPVLIETAVDFERDYFQTLISHQKINI FT NDSLNWFYKKFIKKASSMEDCSEPTEDRHINDSNLKPVIISSIIDLLSCRQMATEFPST FT LAFDHTRLVLLRADVRQLVCVQLCIVLYKQLVINAKKPTSLLAAANISKVQQEILAIVT FT DDNGNIKWTKNISSISLQLVKNLSAGSNSNANLSLPQDLVEFSYNWLSKHIQPNSEVYG FT LMEAKIFKELLNEIMTIINTEDTTIAPVSPATPDASNTELKNIAMRISTLVKFHWNVFG FT NYYIDHIKSQHHKLQQDKKKFNVTKKLMNYNDNDSNSNNSNNNNSNNDSNNDNAMHPSS FT SSTSNKNNDDSSNTTTNAAILTT" FT gene 1176157..1179570 FT /gene="SFL1" FT /locus_tag="PICST_68146" FT mRNA 1176157..1179570 FT /gene="SFL1" FT /locus_tag="PICST_68146" FT /product="putative transcription factor" FT /note="Has EST support; similar to SFL1" FT CDS_pept 1176726..1179491 FT /codon_start=1 FT /transl_table=12 FT /gene="SFL1" FT /locus_tag="PICST_68146" FT /product="putative transcription factor" FT /note="similar to SFL1; go_component nucleus; go_function FT transcription factor activity; go_process regulation of FT transcription, DNA-dependent; go_component nucleus; FT go_function transcription factor activity; go_process FT regulation of transcription, DNA-dependent" FT /db_xref="EnsemblGenomes-Gn:PICST_68146" FT /db_xref="EnsemblGenomes-Tr:ABN67549" FT /db_xref="GOA:A3LY01" FT /db_xref="InterPro:IPR000232" FT /db_xref="InterPro:IPR027725" FT /db_xref="InterPro:IPR036388" FT /db_xref="InterPro:IPR036390" FT /db_xref="UniProtKB/TrEMBL:A3LY01" FT /protein_id="ABN67549.2" FT /translation="MSAVIPSTKIKLSPEALEASHESAPANPTSGQTNVANNSAVNSTA FT NLTTATGSNAGSNSGSNSGSNSGSNSGSVSGPASSANSSGKTQTVFIHKLYDMLHDETI FT SHLIWWSPSNDSFCLLPGEEFSKVLAQYFKHTNIASFIRQLNMYGFHKVNDTFQNNEDG FT SGSNANANSVNSSGTSTNSTNNSNPNKWEFRHSTNQFRKGDIESLKLIKRRSSKNINSH FT KEIVNLKSLPPTSNPIMDPNSGYGPAHGHYYGYSDDETSSIASARSPHGSSDNLHQQYH FT QSLRIHQQSLLINNEGRTTPNGQIQHPPQQQQQIQQPQAQQLHGLGLSAPQSPAHTPIH FT QPLSPRLQPPPLVTNPSFENSINFKFIELNNQLSSLKNELNVMHQKYDSAHSELVRNQS FT DTLQLVEMLERFVQATEAAPEKPTINSNIFNNSNSNAIPTVTVNSNVARKDVPDRVSNN FT KTPINNTGRLADEEGNTSPMSGALFKSTSSSSNSATSASVTSTSATSVSGTGSSTTSAA FT RTLSGEIGSLKSILLQRLRASTQHQQPPLRVQQASTSSSYHLSNAPHTTNNSRNPSNSN FT IQIVPQHYPLNPHYTIYPQSEYRGPDLNQNQSQNQNQHSKSITEESASANRHLSILMDP FT LQPMPTRNPILDEQSTNFRLRAESKSYSPLTVGGASGQLPTSSGNANQAQQAHVTQLQP FT PAHLHSQPPTANGPGGSQQNSQSSSRSSIVEKKTSSRSSSLINTPAGHDSSKPSYQQYP FT FPHVNSHSTHLHSYHNGSTRTNSLPNPPIDHSVTTPLTPPEPPSTNPSYFNQRNSFTSM FT YDSHQQQGHNYRVPPYSQQPTSMPKPTGPITSSPISTTSPSRLQESSEFATSMSKNQLP FT SVSELDKSIKGASSNVPKSATTLPPLHSSPMFALLNKDNDDDKILKKRKT" FT gene complement(<1179780..>1183574) FT /locus_tag="PICST_48002" FT mRNA complement(join(<1179780..1180883,1180959..>1183574)) FT /locus_tag="PICST_48002" FT /product="predicted protein" FT CDS_pept complement(join(1179780..1180883,1180959..>1183574)) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_48002" FT /product="ubiquitin-specific protease" FT /note="go_function cysteine-type endopeptidase activity; FT ubiquitin thiolesterase activity; go_process FT ubiquitin-dependent protein catabolism" FT /db_xref="EnsemblGenomes-Gn:PICST_48002" FT /db_xref="EnsemblGenomes-Tr:ABN67894" FT /db_xref="GOA:A3LY02" FT /db_xref="InterPro:IPR001394" FT /db_xref="InterPro:IPR018200" FT /db_xref="InterPro:IPR025305" FT /db_xref="InterPro:IPR028889" FT /db_xref="InterPro:IPR038765" FT /db_xref="UniProtKB/TrEMBL:A3LY02" FT /protein_id="ABN67894.2" FT /translation="SNVNSISNNNDNTVSNAESVSTPTTSTSPSGTSVDGSSGRVYERT FT VLPPSELVEYPFKTLNRILDDMKWTIPMKQKFNISLLNSIPFDYSTELSKLAGSPLFVY FT EALTLNNSLNYSPSLETVDYEDRNQTLSTIRGLLVNTSSSSSAKAVFHFRISILETNTN FT PFISSALDKHEYHIIPKSRISSDDLEALHVLPKEDPQIIDDAFFKSSNSPSNQILRVTI FT YSQEFSQQDLLPLVDQETIKARYLAGVDKHPSLSPETIPNVTHCFKTLIKVLRGPILMK FT PEDSFKTISLAHTVMDAQIDVNLLFHKLSFTLNEQESDVVPPNLTELPELKESYIRMIQ FT ELIYLGRIYGSSIENNEYKTSYSYSDNLSLVFKTISEYDKHINQVHFRNHNSNQLAFLI FT NLSICSYFQDELIIKCFENTIKSDPANKLHYVDSLRSTINFRNGSSTNNKLNTYLKNLT FT ASGDLIGFHEYMESMNILGIDVRDPADIDNIDDGIIIAMYKTNFKNDPKNYQYYNNHLQ FT TVAKVRKSSNLWKFINNEIIPLNIALDELNIEEITEDDVVITAYEFKLDDTLQANGFRN FT DASEILFLHKALLSVAVNRKSYLLLNYIETKLADIIKLPKEDFTYQKALELFGADESTS FT DFEIITRFQNRLILKSKNDIDSDIRILRYCLKLIAEEKKSQILFSFLKNGKVVSSLLPA FT ENWPAGLDNIGNTCYLNSLLQYYFCIKPLRDLILSFDENDVNQEKMGQKRKIGGRKVEE FT LELTRSNQFVYHLRYLFDEMIHTNKRCVQPSKDLAYLSFLPLSNPVDFKTEGEPEVIEI FT LDEDDDYVISGKDSTRTNAILVSSQSPVPEEDVEMLPSSDDYVEISNEQEESGLRSHNS FT ILNYVEVQNGPKLLPISTDQMESTIEVGRQQDVTECIENVTFQIETALEPERLDDDGEQ FT YDLIKRLFYGKTKQTITPIDDKHNPIGKPRVSIERFFSLIINVSDHPKSMYDTLDNFFN FT EDIVNLEEGLAKKSITVSELPDILQFHVQRVMFDRERLMAYKSLEPIPFSEKIYFDRYL FT DTDDPMILRRRSEVFKWKSEIQELTEQKNEILNIDDETKLSIIDALVTTKKYLESKIIP FT HETMGIKPDTIFAIQEQIDNLRQRLLDIDSRLEVLRASVANQFTSYTKIGYTIFAIFIH FT RGEASYGHYWVYIRDPQRNIFRKYNDETVSEVPFSEVFNFAEGNTATPYYIVYVKDELE FT NDYVDPLKRVINKC" FT gene <1185240..>1186571 FT /locus_tag="PICST_47614" FT mRNA <1185240..>1186571 FT /locus_tag="PICST_47614" FT /product="predicted protein" FT CDS_pept 1185240..1186571 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_47614" FT /product="mitochondrial protein of the CDC48/PAS1/SEC18 FT ATPase family" FT /note="go_function ATP binding" FT /db_xref="EnsemblGenomes-Gn:PICST_47614" FT /db_xref="EnsemblGenomes-Tr:ABN67550" FT /db_xref="GOA:A3LY03" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR003959" FT /db_xref="InterPro:IPR014851" FT /db_xref="InterPro:IPR027243" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A3LY03" FT /protein_id="ABN67550.2" FT /translation="MASPPPIDFDKIRENSDGSLGSMIKSGFTEVISNNPYFAAGGGLM FT VLGTGLALARQGIVKSSGFIYRQLLVDLEIPSKDKSYLWFLEWMSQYKHRTSRHLSVET FT NFVQHDNGSVSTRFSLVPGPGKHLIKYKGAYMLVNRERSGKLLDMTSGTPFETVTLTTL FT YSDRKLFSDLLGEAKQLALKAREGKTVLYTSWGPEWRPFGQPRKKRMIGSVILDKSIAE FT GIISDVKDFLDSGEWYHKRGIPYRRGYLLYGPPGSGKTSFIQALAGELDYNICILNLSE FT SNLTDDRLNHLMNHIPERSILLLEDIDAAFNKRAQTEDKGYTSGVTFSGLLNALDGVAS FT AEECITFMTTNHPEKLDPALMRPGRVDYKVLVDNATEYQVRQMFLRFYENENELCEVFM FT NKYRHLQLTKVSTAQLQGLFVYNKSNPQSAIDMIETLQNPNTVF" FT gene <1187668..>1190769 FT /locus_tag="PICST_33002" FT mRNA <1187668..>1190769 FT /locus_tag="PICST_33002" FT /product="predicted protein" FT CDS_pept 1187668..1190769 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_33002" FT /product="ATP dependent permease" FT /note="go_component membrane; go_function ATP binding; FT go_process transport" FT /db_xref="EnsemblGenomes-Gn:PICST_33002" FT /db_xref="EnsemblGenomes-Tr:ABN67551" FT /db_xref="GOA:A3LY04" FT /db_xref="InterPro:IPR003439" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR013032" FT /db_xref="InterPro:IPR013525" FT /db_xref="InterPro:IPR017871" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A3LY04" FT /protein_id="ABN67551.2" FT /translation="MKPWGTLALATTLVLPWFPVVSGAVRVDSEAELYNSFDRIKRGAV FT INDVFEIKQALIDQQKEKNGDKDECPPCFNCNLPNFECVQFSECNIFTGNCGCRDGFGG FT VDCSEPLCGALSDGNNNRPVRKKATCECKEGWKGINCNMCTDDSVCDAFMPDGLKGTCY FT KTGIIVNKFHQMCDVTNPKIISILGGKKPQATFSCNKTAENCNFQFWIDERESFYCDLN FT KCVLDYDLVANTTKYNCEEVACKCLPDRMLCGEAGSIDISDFLTETIRGPGDFTCDVAD FT RKCRFSEPSMNDLIQSVFGDPYITLKCKSGECVHKSEIPGYEVPDRNKLTLNNILLLAG FT VVLVTALLVATTIHNIRQSPLFKAGIGSFEPLDGDSSALNNNFTPTNIAFEGISYRVRS FT GQQVLNNVSGKIEPGECLAIMGGSGAGKTTLLDILAGKNKGGEVYGSIYVNGNILNPDD FT YKKIVGFVDQEDHLIPTLTVYETVLNSALLRLPRNMTLRQKESRVIEVLNELRILSIKD FT RVIGSNFKRGISGGEKRRVSIACEMVTSPSILFLDEPTSGLDSYNARNVVECLVKLSRD FT FNRTIVFTIHQPRSNIVSLFDKLILLSEGDLIYSGDMIKCNDFFAKYGYQCPLGYNIAD FT YLIDITIDHKKIVRVPSEDEIAEEGSSEGHEDIHQAFVEDTAGEVDTTREWEHFAVHRD FT EYNYAPLTKKGSKDQSKYIQIKNKLPQIFADSVLAIELQTEIDEAKNNPVPLDLKNHMM FT KKASFLNQILILSSRTFKNLYRNPRLLLTNYVLSLVVGAFCGYLYYSVANDISGFQNRL FT GLFFFVLAFFGFSALTGLHSFSSERIIFIRERANNYYHPFAYYISKIVCDILPLRVLPP FT ILLISIAYPLVGLTMEHNGFLKAMVVLILFNVAVAVEMLIVGILIKEPGTSTMIGVLIL FT LLSLLFAGLFINSEDLKVQIKWLEWISLFHYAYEALSINEVKDLILKEKKYGLSIEVPG FT AVILSTFGFDVGAFWKDVAFLGGLSGAFLVLGYLFLHNFTIEKR" FT gene complement(<1190871..>1191971) FT /locus_tag="PICST_33003" FT mRNA complement(<1190871..>1191971) FT /locus_tag="PICST_33003" FT /product="predicted protein" FT CDS_pept complement(1190871..1191971) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_33003" FT /product="serine/threonine protein kinase" FT /note="go_function protein kinase activity; ATP binding; FT go_process protein amino acid phosphorylation" FT /db_xref="EnsemblGenomes-Gn:PICST_33003" FT /db_xref="EnsemblGenomes-Tr:ABN67895" FT /db_xref="GOA:A3LY05" FT /db_xref="InterPro:IPR000719" FT /db_xref="InterPro:IPR003527" FT /db_xref="InterPro:IPR008271" FT /db_xref="InterPro:IPR011009" FT /db_xref="InterPro:IPR017441" FT /db_xref="UniProtKB/TrEMBL:A3LY05" FT /protein_id="ABN67895.2" FT /translation="MVVFNVSQSFKVVRVLGEGAYGIVSLAIHVPTGTQVAIKKIEPFD FT KPLFCLRTLREIKLLSRLSNHENIVQLYDVQQPQDFNSFKEVYIIQEYMPTDLVNVIES FT QILSEEHVQYFTYQILRGLKLIHSAGVIHRDLKPSNILINENCDLKICDFGLARLDVSH FT PNSSKIPKKGGISALTEYVATRWYRAPEIMLNSAQYSSEIDVWSVGCILAEMLTYRPLF FT PGKDYQNQLQLILQVLGTPMGEDFHSIKSARARSFIKSLKHQVRLDFADLCNNHPSRLQ FT RHGRRKISPQGIDLLERMLAFNPDKRISVDEALSHPFVSRYHDPNDEPTTTPIAAEEFD FT FDVEKDKLDTMELKRQLYREIKQLRG" FT gene complement(<1194625..>1195386) FT /locus_tag="PICST_26987" FT mRNA complement(<1194625..>1195386) FT /locus_tag="PICST_26987" FT /product="predicted protein" FT CDS_pept complement(<1194625..>1195386) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_26987" FT /product="putative vacuolar sorting protein" FT /note="go_component nucleus; go_function DNA binding; FT go_process nucleosome assembly" FT /db_xref="EnsemblGenomes-Gn:PICST_26987" FT /db_xref="EnsemblGenomes-Tr:ABN67896" FT /db_xref="GOA:A3LY06" FT /db_xref="InterPro:IPR002164" FT /db_xref="InterPro:IPR037231" FT /db_xref="UniProtKB/TrEMBL:A3LY06" FT /protein_id="ABN67896.2" FT /translation="SEAQNLQKSLDQLAQWEKEMSVAEKDAEIYRIKRTQQSYATRRDI FT LKSVKMFWYIVLAENDDFAEYVNVEDLKYLESIENLYVYYPVADSDDTSGDNYKDFSIT FT ITFADSDDSLVPPQEVTKNFRTIVKDGEETIVSDPVDIEWPEELQSINPILIKKENKGK FT ELTKDQKKNYRLGMKSFFSWFAWTGEKSGKEFRSGEDLTRLIVDDLFLNALKYYVLALP FT NEDEDDQSDEEDSSEGEELDLSEEEDVDTGKR" FT gene 1195775..1197819 FT /locus_tag="PICST_90139" FT mRNA 1195775..1197819 FT /locus_tag="PICST_90139" FT /product="predicted protein" FT CDS_pept 1196235..1197767 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_90139" FT /product="TBC domain protein" FT /db_xref="EnsemblGenomes-Gn:PICST_90139" FT /db_xref="EnsemblGenomes-Tr:ABN67552" FT /db_xref="InterPro:IPR000195" FT /db_xref="InterPro:IPR035969" FT /db_xref="UniProtKB/TrEMBL:A3LY07" FT /protein_id="ABN67552.2" FT /translation="MLKENDIISKVLLTIDHCKANMASFKTAITSNEYTPLNSSCFSRT FT LVWKACLITDSLKIHTWESKLSDSRVVYHQLTKRDDMAVPWWHLESDSSFYSSREMSRK FT PSLKNSNSAAKRSRSLGKVPLTRVSNVEDPLSSHSRSRSSTPTIPYEYTEEDLELLQTI FT ILDIDRLFPGEEFFHSSNATSVVAKKQMIEILYVWAKCNPQVGYKQGIHEILGLLYINL FT SKEAVTIPISNTISADDLKILTMFDIHYLSHDLFTIFNKLMLQSGVVTRFYENENVLWQ FT SIEKFNVYLMKVDQLIHYNLIQKLRLESQLWIIRYLRLLLLRELGNDLETTILLWDKLV FT ASQFSHHNGNTITAIPELIMFMIITLLIQLKTPLITCDFSEGLSLLLHYPVPSGLKSSA FT SRSDFIAALYKDAARLYERRDNDLKLYEYGLKLNNTYNRNLKITMSYSGSARNSTDSAG FT SGRGTSISPSPTPPTSQLPPAPPGGSKEEQMRFEKMRLEMRLKKKAQSMLRN" FT gene <1198005..>1198352 FT /locus_tag="PICST_62378" FT mRNA <1198005..>1198352 FT /locus_tag="PICST_62378" FT /product="predicted protein" FT CDS_pept 1198005..1198352 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_62378" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_62378" FT /db_xref="EnsemblGenomes-Tr:ABN67553" FT /db_xref="GOA:A3LY08" FT /db_xref="InterPro:IPR007808" FT /db_xref="InterPro:IPR038567" FT /db_xref="UniProtKB/TrEMBL:A3LY08" FT /protein_id="ABN67553.1" FT /translation="MGKRKSSAKPQKKIKQTLDVTFTCLFCNHEKSVICTLDKKNSLGE FT LHCKICGQSFQTAIHSLSQPVDIYSDWIDACEDLAEEAEKNGGGEEKEEYSDDEYETNR FT SRPVDSGDDEY" FT gene complement(1198651..1202914) FT /locus_tag="PICST_68148" FT mRNA complement(join(1198651..1198819,1199006..1201581, FT 1201675..1202142,1202212..1202914)) FT /locus_tag="PICST_68148" FT /product="predicted protein" FT CDS_pept complement(join(1198739..1198819,1199006..1201581, FT 1201675..1202142,1202212..1202761)) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_68148" FT /product="microtubule-associated protein" FT /db_xref="EnsemblGenomes-Gn:PICST_68148" FT /db_xref="EnsemblGenomes-Tr:ABN67897" FT /db_xref="InterPro:IPR032675" FT /db_xref="UniProtKB/TrEMBL:A3LY09" FT /protein_id="ABN67897.2" FT /translation="MSSKDVEASDSTSAFDLCKIRDILEKQASNLKGVQTSDVDWFLRD FT YSISAVGDRPDDQKSHSSNSKHRSNSTSASNASNVTETNSNASNISSNDTKKTVSNNSL FT SPVSSHLNTNISNTNGNNLHKTKPSIAPVQEENVLPIVAPESPVQRRDSTRRKSSVSSL FT GSTSSSSGGFFSKLKVKLGHNKPAKQPVFKSNYDMRMKKGTNDTNVNVGSSSPSFGPSV FT PSAKMNGTAESSFELARSSPNVEMASTDSFEESVDPRLEEYIKFYQQKDIRRSSVASRR FT SSVASASSASTTASIPSHPAISPLPSALVNGYDNVTYNKNVAESEPPSTTSKFSSFLRP FT PSVLDSDSNFKNLKPFKRVAFHSSTFLIDPPQQIPSRTPRKGNVEIIGTTVKINPLTDE FT DKLAMEKSQMGQGGGIVVGGTGALGLIKKDKDEEDEEDEEEVNGEPGSPESPKDGLIKN FT DSISSTEDEPAVDKKARALNIDKPMIHHQPAPAGYSIPVKKMALDLMYTRCCHLREILP FT IPAILKQIPKGSMAPLPVLQLRNPTPTMVEIQTFADFLRIAPVICVSLDGVSLSLEQFK FT ILLAAMSAKKQLEKISLRNTPMDQEGWAMLCWFLSRNTVLNRLDITQCPSLSVNVLKKR FT KKRNSDAKKDEEVKRMTCNADNRSDMDWSLFVATLVARGGIEELILTGCCITDLDNFEK FT LMKLAVSKKTNRLGLAYNQLTPKHVKIVVDNWLFRDFARGLDLGYNDFSSIQMLKIFLD FT FKNEHKDFEELISKSMLAFLSLNSTNSMFNEYFKEVFESILLKLPNLKYLDFSNNQRLF FT GTFSKSPSVDSNSGIELHSDNSSISSSTSSSSSKDLGLSESAITQYFTSKLPLFPKLIR FT LHLENINFSQSSLLSIAKVMPFCKNLGYFSLLGNRIELTAASALINALKNSKTLIALDC FT DNDNFPDLFKERIGLYCMRNMERLLYASKSVDLDLNDSGNENAGESLTESMNKILSMKA FT KQKLDLTSPEVSKFIRRALKIRQELKATIDELLQLQLRNELDLEGKETLIRFIFIDSSI FT EKGLQLIDPSLTDVDNNILEQLANSAEDEKNLKKALFIQYDDQNLGVPKSNDIPPSISP FT LGMSRSTSRTNLSNLDRQEGSVLKLSRLHDFHHQHEEGYMGDVSGEDLRKKLRGVEFAD FT LEKIISYLEELKNKGISLGKVYNMHGKNPHRQTLEPVSADGDRINEAYDKVLSTFAHK" FT gene <1207231..>1208931 FT /gene="XUT1" FT /locus_tag="PICST_33008" FT mRNA <1207231..>1208931 FT /gene="XUT1" FT /locus_tag="PICST_33008" FT /product="sugar transporter, high affinity, putative" FT CDS_pept 1207231..1208931 FT /codon_start=1 FT /transl_table=12 FT /gene="XUT1" FT /locus_tag="PICST_33008" FT /product="sugar transporter, high affinity, putative" FT /note="Xylose UpTake (tentative); go_component integral to FT membrane; go_function transporter activity; go_process FT transport" FT /db_xref="EnsemblGenomes-Gn:PICST_33008" FT /db_xref="EnsemblGenomes-Tr:ABN67554" FT /db_xref="GOA:A3LY10" FT /db_xref="InterPro:IPR003663" FT /db_xref="InterPro:IPR005828" FT /db_xref="InterPro:IPR005829" FT /db_xref="InterPro:IPR020846" FT /db_xref="InterPro:IPR036259" FT /db_xref="UniProtKB/TrEMBL:A3LY10" FT /protein_id="ABN67554.1" FT /translation="MHGGGDGNDITEIIAARRLQIAGKSGVAGLVANSRSFFIAVFASL FT GGLVYGYNQGMFGQISGMYSFSKAIGVEKIQDNPTLQGLLTSILELGAWVGVLMNGYIA FT DRLGRKKSVVVGVFFFFIGVIVQAVARGGNYDYILGGRFVVGIGVGILSMVVPLYNAEV FT SPPEIRGSLVALQQLAITFGIMISYWITYGTNYIGGTGSGQSKASWLVPICIQLVPALL FT LGVGIFFMPESPRWLMNEDREDECLSVLSNLRSLSKEDTLVQMEFLEMKAQKLFERELS FT AKYFPHLQDGSAKSNFLIGFNQYKSMITHYPTFKRVAVACLIMTFQQWTGVNFILYYAP FT FIFSSLGLSGNTISLLASGVVGIVMFLATIPAVLWVDRLGRKPVLISGAIIMGICHFVV FT AAILGQFGGNFVNHSGAGWVAVVFVWIFAIGFGYSWGPCAWVLVAEVFPLGLRAKGVSI FT GASSNWLNNFAVAMSTPDFVAKAKFGAYIFLGLMCIFGAAYVQFFCPETKGRTLEEIDE FT LFGDTSGTSKMEKEIHEQKLKEVGLLQLLGEENASESENSKADVYHVEK" FT gene complement(1211163..1212638) FT /locus_tag="PICST_68149" FT mRNA complement(1211163..1212638) FT /locus_tag="PICST_68149" FT /product="predicted protein" FT CDS_pept complement(1211830..1212576) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_68149" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_68149" FT /db_xref="EnsemblGenomes-Tr:ABN67898" FT /db_xref="UniProtKB/TrEMBL:A3LY11" FT /protein_id="ABN67898.2" FT /translation="MMFYPHQFPNNDRNFEPNMPSKHESPRKKHIDHTKEDLIHKNRSN FT FEITVEVKDELSYLRFYSNIRANVRNSPEVAKYLVLDYLPLDYDAQLEYTQKVRDAEDC FT CLDDHHGNLYLNQQLMQAVAPELLHLVSFNYTFNCNFEALKQYFNARINAFFLLSLENK FT LDFDSSRVLQFLIDLDTISKVYKFIFREDPNHQLKLQWIMNAISKDKSNAGILLDIQSK FT WEKINLDPMYIRRLLTSYSNSRWKKK" FT gene 1214239..1215019 FT /locus_tag="PICST_84758" FT mRNA 1214239..1215019 FT /locus_tag="PICST_84758" FT /product="predicted protein" FT CDS_pept 1214242..1214919 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_84758" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_84758" FT /db_xref="EnsemblGenomes-Tr:ABN67555" FT /db_xref="InterPro:IPR019595" FT /db_xref="InterPro:IPR037119" FT /db_xref="UniProtKB/TrEMBL:A3LY12" FT /protein_id="ABN67555.2" FT /translation="MSDRIRGHMNADHQLALKDYLVVYGNLSLSEFDESSVLITDVTEK FT SITIGYVSTKTSNPESFTINWDDASEKENVTVSGFGDIKNKLIAMANFAAEKQGYSSKQ FT IKKALGPSKFGEYVMYAAFLYLLANVYDKNLVRSVFAKDALFSGYIAPYVPALVAKVSG FT LIQDHAGLILSITESIHILEILLVTVPNIKKYRVPLVPSLQWIFMHFIEGFFVIKRWKT FT LTN" FT gene complement(<1215149..>1215607) FT /locus_tag="PICST_62165" FT mRNA complement(<1215149..>1215607) FT /locus_tag="PICST_62165" FT /product="predicted protein" FT CDS_pept complement(1215149..>1215607) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_62165" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_62165" FT /db_xref="EnsemblGenomes-Tr:ABN67899" FT /db_xref="InterPro:IPR001763" FT /db_xref="InterPro:IPR036873" FT /db_xref="UniProtKB/TrEMBL:A3LY13" FT /protein_id="ABN67899.1" FT /translation="PLNMSTVAELIEKWLEEYPAEKAEASYSTPEEVLDLINKSPETTT FT VVDLRNDREPSVLKTSVHIPATGIAGYDDLKARVIDVVTEQKPEVKNIVIHCNSSRKRA FT VRVAGWIQDYINENDVKDYKVTILKGGIAGWFNLDEPYQKVLIPVKDE" FT gene complement(<1216011..>1216694) FT /locus_tag="PICST_33011" FT mRNA complement(<1216011..>1216694) FT /locus_tag="PICST_33011" FT /product="predicted protein" FT CDS_pept complement(1216011..1216694) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_33011" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_33011" FT /db_xref="EnsemblGenomes-Tr:ABN67900" FT /db_xref="InterPro:IPR013255" FT /db_xref="UniProtKB/TrEMBL:A3LY14" FT /protein_id="ABN67900.2" FT /translation="MSSALDQFDALQNQMREFSANVDRRLAEKRANIISARQDHFSRIN FT ELKNQETALSAQIESLQSKESKTKHNLKQALEAIQSQRVKVDELTRKQNELTDEKNELQ FT AQIDELSRTVEYSTAELSRSHDNLEKQLRKNYPELIKYEMYLGLKIEAVSFDLMKFVFT FT NLDPNNYDRRFWIDLAIDKETYSVGQSDPQLSTETTNSLETELNNHKEIVKFLKSARNS FT FKELV" FT gene <1217354..>1218682 FT /gene="ISC1" FT /locus_tag="PICST_33012" FT mRNA <1217354..>1218682 FT /gene="ISC1" FT /locus_tag="PICST_33012" FT /product="phospholipase C type enzyme" FT /note="hydrolyzes inositolphosphosphingolipids (IPC, MIPC, FT M(IP)2C) as well as sphingomyelin" FT CDS_pept 1217354..1218682 FT /codon_start=1 FT /transl_table=12 FT /gene="ISC1" FT /locus_tag="PICST_33012" FT /product="phospholipase C type enzyme" FT /EC_number="3.1.4.-" FT /note="hydrolyzes inositolphosphosphingolipids (IPC, MIPC, FT M(IP)2C) as well as sphingomyelin" FT /db_xref="EnsemblGenomes-Gn:PICST_33012" FT /db_xref="EnsemblGenomes-Tr:ABN67556" FT /db_xref="GOA:A3LY15" FT /db_xref="InterPro:IPR005135" FT /db_xref="InterPro:IPR036691" FT /db_xref="InterPro:IPR038772" FT /db_xref="UniProtKB/TrEMBL:A3LY15" FT /protein_id="ABN67556.2" FT /translation="MTQLFASSASKNSTNSNSTTPSVPVRLLTLNCWGLKYISKFRRQR FT LRAIANKLAYPATKDDEYDIVALQEVWCEDDWKYLDGTCKKVYPYRRVFKSGIVTGPGL FT VLLSKIPIDESFLYRFPINGRASAFFRGDWLVGKSIAITLLKPHQPGAMPIALLNSHMH FT APYAQSGENSYSTHRACQAWDFAKLVKMLRRSGYAVIQVGDLNSKPGSLPYKLFTVEGG FT LSDSWDLCYDKESQLTIEDLAAMQPLEQIHKAGTTVNNQLNTWRAHSDIRDACRLDYAL FT IDAHNIKPISAAVKFTEKLPPPYNCSFSDHFGYTAELQIRSDGEELDSVRTITSVDRLE FT LYEELLDEISEYRKHNVSWQATWRKYHFFLSILVVVLLHIGITFVSQEQAWLSVVFMML FT NSIIGITGVVNGLIWYCGIRSESRALQEVQLEVEDAYVSMKLD" FT gene <1220640..>1225016 FT /locus_tag="PICST_49071" FT mRNA <1220640..>1225016 FT /locus_tag="PICST_49071" FT /product="predicted protein" FT CDS_pept 1220640..1225016 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_49071" FT /product="oligomycin resistance ATP-dependent permease" FT /note="go_component membrane; integral to membrane; FT go_function ATP binding; go_process transport" FT /db_xref="EnsemblGenomes-Gn:PICST_49071" FT /db_xref="EnsemblGenomes-Tr:ABN67557" FT /db_xref="GOA:A3LY16" FT /db_xref="InterPro:IPR003439" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR011527" FT /db_xref="InterPro:IPR017871" FT /db_xref="InterPro:IPR027417" FT /db_xref="InterPro:IPR030244" FT /db_xref="InterPro:IPR036640" FT /db_xref="UniProtKB/TrEMBL:A3LY16" FT /protein_id="ABN67557.2" FT /translation="MSDYDLEENHLVRQNRLLSSLFSKELPPIPEDDERPEHPERDANF FT FSKIFFWWMIPVMNTGYKRTLTPKDLFTLSDDIKVETMAARFMAIFTSDVERAKLKHVK FT KKCKKRGETLESSSVDFDTDVEDFKVSPIMFFFTIWKTYKYQYFAASVCLAIANSAQAV FT NPLLFKKLITYVGLKAYGIEQGVGKGVGYAIGSCLIEFLGAVLFNHFFYKAMMTGAETK FT GVLTKALLEKSFRLSAESKHKFPVGKITSMMGTDLSRIDLALGLQPFIFVFPIPIVISI FT AILIVNIGAVALIGIGVMLLFMAVIGGTTAKLYSYRTKANKYTDIRVSYMKEVLNNLKM FT IKFYSWEPPYYENISSTRTKEMDIIYNMQTLRSIVTALAMSLTGFASLVAFLVLFAVDN FT DRKNPASIFSSISLFNVLLTQVFMLPMALATSADAFAGVGRVSTFLTTGEVDPKELETD FT ISADVLQRMDKEDVVIEVNNASFEWEIFEDIEEKDPKKEKEEKKKAKKAAKETKKLAKQ FT AKNSQTITPSEEELSKIDSPKFTEKELSTESKSVEEKVFAGLNNINLSIKKNEFVVITG FT MIGSGKTSLLNALSGFMKKTSGEVLVSSSLLLCGYPWIQNTTVRENIVFGSEWDEEKYN FT RVIFACSLESDIEILPGGDLTEIGERGITLSGGQKARINLARAVYGGREIILMDDVLSA FT VDARVGKHIMNNCILDLLKDSTRILATHQLSLIDSADRVIFLNGDGSISVGTNEELQKS FT NPGFAALMAHNAKTEEDDEDEKIDVDLDKQKFEEHHEVEKELIQRQVTRASAVDEEAIR FT KDYNKNVEEDGHLIEDEDRGVNAIALDVYLTYVKLGSGKYTAWGIVPPMLVFMALATFC FT QIFTNTWLSFWTENKFSGKDDNFYIGIYVMFTVLSFVFLALEFMSLVYMTNTAAVKLNI FT AAVQKVLKVPMAFMDTTPMGRILNRFTKDTDVLDNEIGEQINFALFMLSNVVGIIILCI FT IYLPWFAIAVPFLGFMFIAVSNYYQASAREIKRLEAVSRSFVYNNFNEVLNGINTINAY FT KAESRFVAKNDRLINGMNESYYLTIGNQRWLGIQMNIIAVLFSLLIALLCVNRVFKISP FT ASVGLLLSYVFSIGGTLSMLIRTFTQVENEMNSVERISYYSFSLPQEAPSYITENSPPP FT EWPAKGEIHFKDTSLAYRPGLPLVLKNLNFSIKGSEKIGICGRTGAGKSSIMTALYRLS FT ELDGGSIVIDDIDISTLGLHDLRSKLSIIPQDPVMFRGTIRKNLDPFDQSTDDQLWGAL FT VRTGLVEADRLDVVKAQVKVQKEDKSDHGDNNNGADKKGAEEGSILHKFHLDQMVEDEG FT VNFSLGERQLIAFARALVRNSKILILDEATSSVDYETDAKIQNSIVNEFADCTILCIAH FT RLKTIINYDKILVLDKGEIKEFNTPWNLFKTKDSIFQQMCIKSNIVEEDFHRVSKF" FT gene complement(<1225479..>1228472) FT /locus_tag="PICST_61283" FT mRNA complement(<1225479..>1228472) FT /locus_tag="PICST_61283" FT /product="predicted protein" FT CDS_pept complement(1225479..1228472) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_61283" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_61283" FT /db_xref="EnsemblGenomes-Tr:ABN67901" FT /db_xref="InterPro:IPR029018" FT /db_xref="InterPro:IPR031924" FT /db_xref="InterPro:IPR041437" FT /db_xref="InterPro:IPR042301" FT /db_xref="UniProtKB/TrEMBL:A3LY17" FT /protein_id="ABN67901.2" FT /translation="MLFSYFPALVALCSTVSALGGLQNIVFKNSKDDLQLAAHKKSATL FT FLDTEDWPGVVRAGLDLSDDFKKVTGEALPVVNFTGSGICTKVHGKVESAIIIGTVGNS FT SIIDTLVSAKKLDVSEIEGKWESYVMKVIENPAPCISSALVIAGSDKRGSIFGAYDISE FT QIGVSPWYWFADVVPATHSEIYVSKSIVKVQGEPSVKYRGIFLNDEQPALAAWVAEFFP FT EGKYNSYFVHQFYVKLFELLLRMRANFLWPAMWASMFGEDDPENQYWADYYGIVMSTSH FT TEPLMRATNEWTTFGNGSWDYSTNKDNIVEFWKEGIARSKPYENMWTTGMRGFGDTPIT FT GGVEISLLEDVIKTQRELLTEYFNNTDITDIPQVWCLYKEVQAYFQEGMQVPEDITLLW FT VDDNWGNNRRLPLANETDRAGGAGVYYHFDYVGSPVDFKWINTVSLEKTWEQMHLAKQK FT QADQIWVVNVGDMKPLEIPIEYFISLGYDFDTWGPINKVMTWATAWAQREFGAYLKEDD FT VKEVADIIDLYGFYANRKKYEALNTTTFHLYNYNEAETVLSEWADLADRAWAVYKKLPK FT NVQPSFFQLVLHPAVAGYTVYDILISAGKNNLYAEQRRNQANALSTHVLDRFQYDNTWK FT GEYDSLLGGKWKHMMDQTHLGYFYWQQPMRNVAPPLAYVQLEENSLAGSLGVTVEQSRG FT SVPGDDAYNAVAYSNNTLVLPTLDPYTDSRHITIFNKGIEDFYFEVSPYADYVKVNPSS FT GSVSATNNSIWNSVDVEVTVDWDQAPEGYNIVFMNITSNTTYEFFGMPTVNLPINKTQA FT PDDFKGFVETNQHISIEAEHFSNNQSTNDTYYVTIDRYGRTLSGVTLFPVTADSQEATE FT DYSYLEYNLYSFSAPQYGSNITVYTGSSLNIDPSRPLKYAIAIDDQEPQVVQIVVDPTD FT PTAMPAHWEDAASDGVWIHNTTHTFDAGEHTLKLWALEPAVVFEKVVVDFGGVVPSFLG FT PPETYIKK" FT gene <1230277..>1230678 FT /locus_tag="PICST_48963" FT mRNA <1230277..>1230678 FT /locus_tag="PICST_48963" FT /product="predicted protein" FT CDS_pept 1230277..1230678 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_48963" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_48963" FT /db_xref="EnsemblGenomes-Tr:ABN67558" FT /db_xref="InterPro:IPR034543" FT /db_xref="UniProtKB/Swiss-Prot:A3LY18" FT /protein_id="ABN67558.1" FT /translation="MIRVISLFLVFVSLASANIFDFLNNNFAGRGQQQGGQVQTPEQYE FT NAILNTNCGKYVCPDTGMCVEAPKFCPCPYPSSQLRCFLPDGRYLCISKPAGDISAKYD FT DPKSNWKVDAKDDNIRDCGWVSRAWRGLV" FT gene 1232228..>1233129 FT /locus_tag="PICST_84962" FT mRNA join(1232228..1232395,1232423..>1233129) FT /locus_tag="PICST_84962" FT /product="predicted protein" FT CDS_pept join(1232233..1232395,1232423..1233129) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_84962" FT /product="ribonuclease H" FT /note="go_function nucleic acid binding; ribonuclease H FT activity" FT /db_xref="EnsemblGenomes-Gn:PICST_84962" FT /db_xref="EnsemblGenomes-Tr:ABN67559" FT /db_xref="GOA:A3LY19" FT /db_xref="InterPro:IPR002156" FT /db_xref="InterPro:IPR009027" FT /db_xref="InterPro:IPR011320" FT /db_xref="InterPro:IPR012337" FT /db_xref="InterPro:IPR017067" FT /db_xref="InterPro:IPR036397" FT /db_xref="InterPro:IPR037056" FT /db_xref="UniProtKB/TrEMBL:A3LY19" FT /protein_id="ABN67559.2" FT /translation="MPYYAVARGNKTGVYTSWDSAKSNVLNVSNSCYKKFNTAAEAQAF FT VSDNGSGSGSGSSYSSGGSQSSSYGGSTSSYGGSSSSYGGYSGGYSGGYSGGYSSGTSK FT QNGSSSHSNASSSSKPATGKIYVDGAARGNGQDRHVAGGYGVYYGPGHSKNAAVAMDTV FT DNQKTTNQRAELHALKHALNDIANDDSSNTKYSIHSDSKYAINSVSEWSKGWNENNWTN FT SKGQPVANRDIIESCLPILDKVNDKYSEKGWGKVEFHHVKGHAGDPGNEAADRLANEGA FT NQMESRYR" FT gene <1234016..1236530 FT /gene="ACO2" FT /locus_tag="PICST_90724" FT mRNA <1234016..1236530 FT /gene="ACO2" FT /locus_tag="PICST_90724" FT /product="aconitate hydratase" FT CDS_pept 1234016..1236418 FT /codon_start=1 FT /transl_table=12 FT /gene="ACO2" FT /locus_tag="PICST_90724" FT /product="aconitate hydratase" FT /EC_number="4.2.1.3" FT /note="go_function lyase activity; hydro-lyase activity; FT go_process metabolism" FT /db_xref="EnsemblGenomes-Gn:PICST_90724" FT /db_xref="EnsemblGenomes-Tr:ABN67560" FT /db_xref="GOA:A3LY20" FT /db_xref="InterPro:IPR000573" FT /db_xref="InterPro:IPR001030" FT /db_xref="InterPro:IPR006248" FT /db_xref="InterPro:IPR015928" FT /db_xref="InterPro:IPR015931" FT /db_xref="InterPro:IPR015932" FT /db_xref="InterPro:IPR018136" FT /db_xref="InterPro:IPR036008" FT /db_xref="UniProtKB/TrEMBL:A3LY20" FT /protein_id="ABN67560.2" FT /translation="MLRARTAVNSGAARAVRTLATSASSPVFNFPVPEEYVSRTPPYSK FT LVSNLNKVNQIFNHQPLTLAEKILYSHLVDPEESLAAANGSTANIRGEQYLKLNPDRVA FT MQDASAQMALLQFMTCGMASTAVPASIHCDHLIVGKDGAEEDLVKSIATNKEVFDFLQS FT CGEKYGIQFWGPGSGIIHQIVLENFSVPGLMMLGTDSHTPNAGGLGAIAIGVGGADAVD FT ALTGTPWELKAPKILGVKLTGQLSGWSSPKDVITKLAGILTVRGGTGYIVEYFGEGVQT FT LSCTGMATICNMGAEIGATTSTFPYQDAHRRYLVETNRAPIAEAADAVNKQVGFLQADK FT GAEYDKVVEINLSDLEPHVNGPFTPDLSTPISQFGAVAQKEGWPSTVSAGLIGSCTNSS FT YQDMSRAVSIIKQAEAVGLKPKIPFFVTPGSEQIRATIERDGLIDTFEKNGAIVLANAC FT GPCIGQWDRTDVPKTSTETNAIFTSFNRNFRARNDGNRNTMNFLTSPDMVTAMIYSGDV FT NYNPITDSIKLENGEEFKFQPPQGEELPSHGFIKGREQFYPEASPKPKPEVSVNVSPES FT DRLQLLEPFLPWSGEELSTNVLLKVEGKCTTDHISAAGAWLKYKGHLENISYNTLIGAV FT NKETGEVNKAYDLNGDSYSIPELMIKWKEEARPWVVVAEHNYGEGSAREHAALSPKFLG FT GSIILVKSFARIHETNLKKQGMLPLTFADEADYDKISSGDLLTTVDLKDMIAKNGNNGG FT VLTVKVTKKDGSTFDILCKHTMSKDQVDFFKAGSAINHIGNLKRAQA" FT gene complement(<1236837..>1238363) FT /gene="VMA2" FT /locus_tag="PICST_48891" FT mRNA complement(<1236837..>1238363) FT /gene="VMA2" FT /locus_tag="PICST_48891" FT /product="Vacuolar ATP synthase subunit B (V-ATPase B FT subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa FT subunit)" FT CDS_pept complement(1236837..1238363) FT /codon_start=1 FT /transl_table=12 FT /gene="VMA2" FT /locus_tag="PICST_48891" FT /product="Vacuolar ATP synthase subunit B (V-ATPase B FT subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa FT subunit)" FT /EC_number="3.6.3.6" FT /note="go_component proton-transporting two-sector ATPase FT complex; go_function ATP binding; hydrogen-transporting ATP FT synthase activity, rotational mechanism; FT hydrogen-transporting ATPase activity, rotational FT mechanism; go_process ATP synthesis coupled proton FT transport; ATP biosynthesis" FT /db_xref="EnsemblGenomes-Gn:PICST_48891" FT /db_xref="EnsemblGenomes-Tr:ABN67902" FT /db_xref="GOA:A3LY21" FT /db_xref="InterPro:IPR000194" FT /db_xref="InterPro:IPR004100" FT /db_xref="InterPro:IPR005723" FT /db_xref="InterPro:IPR020003" FT /db_xref="InterPro:IPR022879" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A3LY21" FT /protein_id="ABN67902.1" FT /translation="MSLTDQELFELNKRAVTQGFKIKPRIKYNTVGGVNGPLVILDNVK FT FPRYNEIVNLTLPDGSIRQGQVLEVRGSKAIVQVFEGTSGIDVKKTRVEFTGENLKIAV FT SEDMLGRIFDGSGRPIDKGPKIFAEDYLDINGSPINPFARIYPEEMISTGISAIDTMNS FT IARGQKIPIFSASGLPHNEIAAQICRQAGLVRPTKDVHDGHEENFSIVFAAMGVNLETS FT RFFKQDFEENGSLERTSLFLNLANDPTIERIITPRLALTTAEYLAYQTERHVLTILTDM FT SSYADALREVSAAREEVPGRRGYPGYMYTDLSTIYERAGRVEGRNGSITQVPILTMPND FT DITHPIPDLTGYITEGQISIDRQLHNRGIYPPINVLPSLSRLMKSAIGEGMTRKDHGDV FT SNQLYAKYAIGRDAAAMKAVVGEEALSNEDKLSLEFLEKFEKNFISQGAYENRSIFESL FT DLAWSLLRIYPKELLNRISPKILNEFYEREREQEDDEEEDADKSHDLIDA" FT gene complement(<1239082..>1240677) FT /locus_tag="PICST_33019" FT mRNA complement(<1239082..>1240677) FT /locus_tag="PICST_33019" FT /product="predicted protein" FT CDS_pept complement(1239082..1240677) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_33019" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_33019" FT /db_xref="EnsemblGenomes-Tr:ABN67903" FT /db_xref="UniProtKB/TrEMBL:A3LY22" FT /protein_id="ABN67903.2" FT /translation="MSSYFYKTRYETIPKSQPSQPTSYLDKEIDGEIQYWQKRVSQTET FT TSEAARDQINDIFELADVLHDVQEDSLQIAAKLYDDMVMASEGSTPPTMNSIAALSLQL FT NKLAMMNLAMKNNALKRSTQFLTLKKVRVAEEIEKTVAKKTHVQQILAEKKSHLEVMFA FT EAQRESESAIAEYRTNKISQVRRQALKLQFKNFKVLKEVTFSRSSHRDLLFHFQPILKM FT ETFLSLGVLSINQFLENLIVLQKNLSELFNTRLPYLAELAIYLPSSDFFDSIKHKENQM FT IGIDEKDFDDPPDPIERRVSVEPTADENGNIERIIKLGAEIKLPLSSKTINSQRRASLK FT RTPEPTSDIPVFKERSISPSKTSGKSSSSKRFIIIPHRILNKPFKKVTIPEFLKFVLVV FT AKIVANFQFFFYSMTLERQTEEDDSVCSFEAILEKVYGLDKLFESKLSQLETDERNVIA FT ETSPTDSEEENLDVVELKKLSDKVYKQLIKTGPRSKKSGINPPSILMDMNLSDLIANQA FT KMQLDDWDVVSKMF" FT gene <1241794..>1243005 FT /locus_tag="PICST_6302" FT mRNA join(<1241794..1242105,1242220..1242517,1242584..>1243005) FT /locus_tag="PICST_6302" FT /product="predicted protein" FT CDS_pept join(<1241794..1242105,1242220..1242517,1242584..>1243005) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_6302" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_6302" FT /db_xref="EnsemblGenomes-Tr:ABN67561" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:A3LY23" FT /protein_id="ABN67561.2" FT /translation="PLNDCAPVRIALLGGPRSGKTSTISKLTADTFNDTYYPTHSINPV FT LFHYKASSFLPRLILDETEPENSLSYFSKQSRVLLSPVLYQTYLKSNKKKTDISHNSEI FT AYIPPQTTPVLVELIDTPSFNPQQVVPFLEASIYHKLDKDILRNLANEPRKPVSTNPLL FT VASGASELNGNIDGYFFVYSAVPSYNPPSYEETIDPIRIERDETFKLLSIMKGALDEAW FT KEYNSFKKRWNLGKEHDIFSFKNAMKSIWKDKNIHDVANLREQLSKEVHLYDNSVDPAD FT PDCPPPIWIICTHTKSQLASPKLISNGKKVSKFWKCGFVAIDNEDNNVDEVLALMLREI FT VERK" FT gene complement(<1243227..>1244255) FT /locus_tag="PICST_33021" FT mRNA complement(<1243227..>1244255) FT /locus_tag="PICST_33021" FT /product="predicted protein" FT CDS_pept complement(1243227..1244255) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_33021" FT /product="glycosidase" FT /db_xref="EnsemblGenomes-Gn:PICST_33021" FT /db_xref="EnsemblGenomes-Tr:ABN67904" FT /db_xref="GOA:A3LY24" FT /db_xref="InterPro:IPR007184" FT /db_xref="InterPro:IPR023296" FT /db_xref="UniProtKB/TrEMBL:A3LY24" FT /protein_id="ABN67904.2" FT /translation="MMLPVVSRASTLGDRNYKAPTKFPIGPFQKYENNPILTPNPDNEF FT ESAYIYNATAIVVDDKVYLLYRAQNAAKLSSVGLAWSTDGVNFVRYHKPIITATEPWEQ FT GGGVEDPRIVRDPVSKLFIVTYTAYDKHFARLCVATSEDLFNWNKLPSFIPPTWHDVSY FT DGNGNPSIRRQWSKSGAIFTERAPDGKYYMIWGDSALYLAESDDLVHWKLPTQDFRQDT FT FAGVQYDFESKLIESGPAPVKMGNGTNQWIFVYNADTTGTDDLPANTYTISQMLVDYDN FT IKAGPVKRLSEPILKPEKDNEKNGQVNKVVFCEGMVQFKGKWFLYFGQADSELGVAIAP FT VD" FT gene <1244515..>1245131 FT /locus_tag="PICST_33022" FT mRNA join(<1244515..1244562,1244637..>1245131) FT /locus_tag="PICST_33022" FT /product="predicted protein" FT CDS_pept join(1244515..1244562,1244637..1245131) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_33022" FT /product="predicted protein" FT /db_xref="EnsemblGenomes-Gn:PICST_33022" FT /db_xref="EnsemblGenomes-Tr:ABN67562" FT /db_xref="UniProtKB/TrEMBL:A3LY25" FT /protein_id="ABN67562.2" FT /translation="MAETADRYKMLEMLYSLSPNRGFPKASNGDYNFCYGVFHKIISPS FT FKTEPLGGALSEPKVNWSLTPPFLSGFVLIRKTAFRRSSLHQNGRTSFNRHVSLAEHIS FT QSSYIQMEADFENGGPTTFDQILSKQLMLSYTLRKSQPQCADFSTVLIFRSNFKDFFFA FT GSMERSSNLSDEMGIIN" FT gene <1246082..>1247098 FT /locus_tag="PICST_36779" FT mRNA <1246082..>1247098 FT /locus_tag="PICST_36779" FT /product="predicted protein" FT CDS_pept 1246082..1247098 FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_36779" FT /product="ser/thr protein phosphatase" FT /note="go_function catalytic activity" FT /db_xref="EnsemblGenomes-Gn:PICST_36779" FT /db_xref="EnsemblGenomes-Tr:ABN67563" FT /db_xref="GOA:A3LY26" FT /db_xref="InterPro:IPR000222" FT /db_xref="InterPro:IPR001932" FT /db_xref="InterPro:IPR015655" FT /db_xref="InterPro:IPR036457" FT /db_xref="UniProtKB/TrEMBL:A3LY26" FT /protein_id="ABN67563.2" FT /translation="MGQLLSHPIEDKELDYQSHDTLSYCIGSMQGYRMTMEDAHDVRIN FT EDESLAVFGVFDGHGGKTCSDYLADHLVKYIFKHLNCRPDKSPLVLADYLRIIKDSFFK FT IDHDLSSMPNLVNCGSTGIVSTIVRDKYIVVANTGDSRCILSIDGHAKTLSYDHKPVIM FT NERIRVENSNGYILNNRINEILALSRAFGDFKFKLSFIETSRNKYINQNKSHFKNHLVH FT LPPELFQVTVEPDLLVYDLQNAEGVPEFIVVACDGIWDCYKNSQLIKVIRDKLALGWKL FT NKIIEFVLHECLLMANNYTGIGFDNMTIIIVALHSNSNMDEWYENMKQKILTEKNLV" FT gene <1248227..1253783 FT /locus_tag="PICST_68153" FT mRNA join(<1248227..1248612,1248632..1248669,1248699..1253783) FT /locus_tag="PICST_68153" FT /product="predicted protein" FT CDS_pept join(1248227..1248612,1248632..1248669,1248699..1252969) FT /codon_start=1 FT /transl_table=12 FT /locus_tag="PICST_68153" FT /product="ras GTPase-activating-like protein" FT /note="go_function Ras GTPase activator activity; FT go_process small GTPase mediated signal transduction" FT /db_xref="EnsemblGenomes-Gn:PICST_68153" FT /db_xref="EnsemblGenomes-Tr:ABN67564" FT /db_xref="GOA:A3LY27" FT /db_xref="InterPro:IPR000048" FT /db_xref="InterPro:IPR000593" FT /db_xref="InterPro:IPR001715" FT /db_xref="InterPro:IPR001936" FT /db_xref="InterPro:IPR008936" FT /db_xref="InterPro:IPR036872" FT /db_xref="UniProtKB/TrEMBL:A3LY27" FT /protein_id="ABN67564.2" FT /translation="MMLQSPTRSNVAARYLESIGDSASSTPNRLPLQPTLKYNQTSKES FT TDLDVLAKQLNVPTSPTKTAFLRTKFESPSATVSSFKTPRTKTSSNNSSRNSTPLKNST FT NLNLEAKPNLSKNGDHSNLKHPTSFWKLRPDLKPDLFYSPGYEYLCRIQAIKNWLELVL FT QEEISQSPVELISYIRNGIFLAKLANVILPTKRRVFTEDSKLQFKHTENINRFFHLLDF FT MNVPDLFTFELTDLYDAKNVPKVWFCLHALSYLMNMSNSGYPKIENLVDKLDFSEDDIR FT SANRALVGAGLPNFASADNGNDSTSSDNTYMNRVAADSPIKVTTFSASKGSQSSFTKKQ FT DSHPNPFEDTTKSSASLNSFHKELTKKSVPSTTKTPSTFKTPIASQSRISNFYTPELDS FT HIENIVKLQSLARGANFRYSMFVDKIMIKSYSDEFTYFFSIARGKLSRDKTIHRHRGEL FT IPFKEEIVQLQSIVRRKLYSQGKPKMDGNTERIVKFQSKIRGLLERRRISTLKLQMIAQ FT KDNVSELQAIMKMKKIHYRVSTVCQSRYQIEPSVLELQSICRRRLQERRAARHLIDEDS FT IVEFQSAIRSLRIRNHIRSIRSTITKQIEPLEELQSIARGGLARSRLCNSVLITLLYED FT EVLNNLYAVFRGNKVRKEMAAKKSALQSVRKSSIIPLQSAFRGLYCRFEKDIKLDDVYC FT EVDSIIQLQAILRGARVRNDSRYMKEYYQKNINSVIKAQSLIKKTLVQNAYKTLLNKKN FT PPLSVIRRFAYLLSDSDLDYQDEMELSEAKDQIIDRSRSNEELENRIENLDIKLNLLDR FT NKITVEEFLKHKSKFKNNKVKDTKGGATTMKCLERLNKSSRERVELYQSMFYFLQTKPI FT YFVRLYKTMSVEKNGSKFNKDLQNFVMSLFPIKDSSVKHHCREEYYFVKLISELMKNDV FT ENNSRSISDLTKTSTTFWIDYFLLFNNHTYQRQHLKHLVGKFVYSVIESDMLDFESDPS FT EIYEAIVEREHRVNGFSERPRGISPQHAIKEEDVSAKFVNNLMNLREVATEFLNTLELS FT ADRVPLHVKVICKQAYELSQLQFPEKSDQQHLAVAGVVFIKHYIAPILQFPENFGFQNK FT DFYNPKA