(data stored in ACNUC6288 zone)

EMBL: CP000501

ID   CP000501; SV 1; linear; genomic DNA; STD; FUN; 1114415 BP.
XX
AC   CP000501;
XX
PR   Project:PRJNA16843;
XX
DT   27-FEB-2007 (Rel. 90, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Scheffersomyces stipitis CBS 6054 chromosome 7, complete sequence.
XX
KW   .
XX
OS   Scheffersomyces stipitis CBS 6054
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Debaryomycetaceae; Scheffersomyces.
XX
RN   [1]
RP   1-1114415
RX   DOI; 10.1038/nbt1290.
RX   PUBMED; 17334359.
RA   Jeffries T.W., Grigoriev I.V., Grimwood J., Laplaza J.M., Aerts A.,
RA   Salamov A., Schmutz J., Lindquist E., Dehal P., Shapiro H., Jin Y.S.,
RA   Passoth V., Richardson P.M.;
RT   "Genome sequence of the lignocellulose-bioconverting and xylose-fermenting
RT   yeast Pichia stipitis";
RL   Nat. Biotechnol. 25(3):319-326(2007).
XX
RN   [2]
RP   1-1114415
RG   US DOE Joint Genome Institute
RA   Grigoriev I., Grimwood J., Aerts A., Salamov A., Zhou K., Lou Y.,
RA   Pitluck S., Schmutz J., Myers R.M., Lucas S., Detter J.C.,
RA   Glavina del Rio T., Jin Y.-S., Passoth V., Laplaza J.M., Jeffries T.W.,
RA   Richardson P.;
RT   ;
RL   Submitted (12-DEC-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; fbab1904ccd4cb87563179bfb782d22e.
DR   BioSample; SAMN02746101.
DR   CABRI; CBS 6054.
DR   EnsemblGenomes-Gn; ENSRNA049611768.
DR   EnsemblGenomes-Gn; ENSRNA049611815.
DR   EnsemblGenomes-Gn; ENSRNA049611853.
DR   EnsemblGenomes-Gn; ENSRNA049611927.
DR   EnsemblGenomes-Gn; ENSRNA049611998.
DR   EnsemblGenomes-Gn; ENSRNA049612064.
DR   EnsemblGenomes-Gn; ENSRNA049612170.
DR   EnsemblGenomes-Gn; ENSRNA049612251.
DR   EnsemblGenomes-Gn; ENSRNA049612325.
DR   EnsemblGenomes-Gn; ENSRNA049672740.
DR   EnsemblGenomes-Tr; EFT00001981034.
DR   EnsemblGenomes-Tr; EFT00001981035.
DR   EnsemblGenomes-Tr; EFT00001981036.
DR   EnsemblGenomes-Tr; EFT00001981037.
DR   EnsemblGenomes-Tr; EFT00001981038.
DR   EnsemblGenomes-Tr; EFT00001981039.
DR   EnsemblGenomes-Tr; EFT00001981040.
DR   EuropePMC; PMC6250768; 30505317.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00016; SNORD14.
DR   RFAM; RF01249; snR190.
DR   StrainInfo; 362616; 0.
XX
CC   URL -- http://www.jgi.doe.gov/pichia
CC   JGI Project ID: 3634480
CC   Source DNA was provided by Jose Laplaza and Thomas Jeffries
CC   (twjeffri@wisc.edu)
CC   Stock culture is available from Cletus P Kurtzman
CC   (kurtsman@ncaur.usda.gov)
CC   Contacts: Thomas Jeffries (twjeffri@wisc.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Annotation done by JGI-PGF
CC   Manual curation done by the P. stipitis User Community
CC   Finishing done by JGI-Stanford Human Genome Center
CC   (www-shgc.stanford.edu)
CC   Unsure number of repeat copies 254580-295210 and 468090-479400.
CC   The finished chromosome has no gaps. The sequence has less than one
CC   error in 100,000 bp.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1114415
FT                   /organism="Scheffersomyces stipitis CBS 6054"
FT                   /chromosome="7"
FT                   /strain="CBS 6054"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:322104"
FT   gene            <1855..>8187
FT                   /gene="ADD2.2"
FT                   /locus_tag="PICST_33212"
FT   mRNA            <1855..>8187
FT                   /gene="ADD2.2"
FT                   /locus_tag="PICST_33212"
FT                   /product="ATP-dependent DNA helicase"
FT   CDS_pept        1855..8187
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ADD2.2"
FT                   /locus_tag="PICST_33212"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33212"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67992"
FT                   /db_xref="GOA:A3LYK7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYK7"
FT                   /protein_id="ABN67992.2"
FT                   /translation="MNTQAPGYSSHNPITLDSGSDSDSDQNFEDALDDFSQVDIKCENS
FT                   NLVSTDEHIWSSPQSFRRSSPCSSMQSTPARTNVKDELDYLAKNYFVFVESLGYFYSEK
FT                   RHYFISSDSKYASSKLYIKSKQRFLDLISKLTKQSPYYNQIERESNIVNVATIPSPIPG
FT                   IEAEEFAFCDSCKYTRNIGHLPVKCASHGYMRRGEGYRVESGGFFLLKEFPRMPSLPAT
FT                   PPPSTPNVTASSPTIPCSSPIHRRSRFTNRDLEVEYKGPLITKICVRESENMTADAFLQ
FT                   KYANIIYIPDMGLYWHEHERVFLDRNSEIVHNSLSSIIDKCKFLETHMHAVMSNSYYWF
FT                   LLASPNTSSEVQICLEWLKEPLHGLSPSKIQYCPNCINSAIIDDHCDVDNLNVLTGMGY
FT                   RMESGTIFLLASGGGMTDILEDQREEAPDLEYYASDSGAVFSSDEQEAEGSVDYASDME
FT                   NLTVDGQEGDELTAVNGESESDTLLEDEVQEGDFRSFDDSSDSDNLFVDDAQEDDEEMI
FT                   DIAIDNDTESDNDESDISAYDTSDDGLDNEYEPEADLLYDEETVRISTVSGWSQLKKKG
FT                   ICQINNLLWSRGQQHFLDITSRAFRSFLMGTVSNAQYTQMLEDVEEWVDLMPQYYRIPI
FT                   DTKGRTFEILRPFPRLPPNIHTYCSECGFVIGFNENNENLRSSARHAKNTGHDRFISRE
FT                   GYAIRAATGFNLLVILGSSESISTCESEDGDYDDEDIVIPSFDDGSGSPVTHPEFIVEP
FT                   YSTDEEASDYEQEPESLPPPSKEEEIEVSELLRYSHGLVYDPIFYLYYYITEERYVDVN
FT                   SKFFKNTLEDIGDHKSRIRNLVDRVISTQIIDSSKFEKKVTRGHIHWAKELSKVAYSKK
FT                   LCFCKQCYQIFKTKTAFSRHRRDYASMVGREHAGHDTSADFKGYLLERPKGLYYAIGIP
FT                   DDVAEAEAAATVEEITGSSSQWVMGGPGWTAEEYESKVKWLEVKLGMLPDQFLAKHNYL
FT                   LVKELGLYYDFTQKWFRSITHRLSRKVFFADLVSSVRSELISYMLHNMDRKYEYMLAPR
FT                   HQQQVATLQAAVKYDGPVVAVENGNGEHLDFELVDNCIQPTKYYMCHVCKFIAHHSSVT
FT                   AHIKQAKHQREEGPEKHVVYGYSVRNVEAKTNYFRIQSNLAAGFHEPTDSSAELQIVDP
FT                   FLSRYKAHEYTKFRSFLNMANDKRWPRLVQLCKKYVTKKRLALSTGSSLSALIDNPRFC
FT                   STPNSASRYGLALARFLYVAMKMCELKEHKAMEAFDQVFCANKEQGLRRFFGQMKIFGA
FT                   FWLLSPVLVLQEDDLNYMDDIFMSSLMVCLLDEGGIGFKIKSYRCDFCSGLSFAFKCIA
FT                   VDVMKKDKSYVHPFVEDCNKSASISLNFGRFRKFSADVHSLSPRTFGRTMNVLRVGDII
FT                   RINTFEVGLNDIKKWVYDAIQQYVLEVEELFVDINITPTMAMHEMSAAQKPRVVGMPQT
FT                   SYNWDQRDIDRCLEINSVDKYDVKSLQCFRRRLSRLNNYFFCMILLTCGSPYRLTELYS
FT                   VLIRNEERLGSNVFVADGMLGLFTNNGKNSMKYSRERPILKMLPEEVSECLAHYIYFVR
FT                   PFEYTLVEYQEQTGSLSLTEFKKLSDKYKLHLFMGEKGIKSSTTLGKSFRKFINKTTPK
FT                   LRGIMYGEIRQVLSYFVGANVSGMIGLQIKIDNTLAEQAGHSFSRFVESYATNRDGYNH
FT                   VMLQRMRDCSAAWHTCLEMRTLQIFTPSIFTRNEPPKLTGEELLEAGRKIFGQQFRFKE
FT                   GQQQATSDVANCFSMMVAINSGKTTCCIIAMLAERTNSLRRTNRGKKTHCVTIFVVPYI
FT                   STLNSTIRQLTENFKVHTYDGSVGQVNNYDVLLMSLEDGHLRHLDSVVRHIQSTNYRGK
FT                   TYLRRVVVDDAHILQMKQYVIEGNKNVPIVFLTSFLSQKEDDTLSTLFNLESLVRVSSQ
FT                   EPLLPHKEFTLFKKPSTTSICQTVIDKVRSLGSAIVIAESSDKVSYLLNRMAVEVPSIG
FT                   IYGSPDARAAALNKIASENIRVVVTTAEAMVGLHMFKHTTVLFAYSINNPIELLVGSQL
FT                   SSGKVEMVLLNFYSTEFQRDLLDTCVNLMIMRHMRLTEQTCYEAGKERCHACVNKRRHA
FT                   "
FT   gene            <8418..>9097
FT                   /locus_tag="PICST_33213"
FT   mRNA            join(<8418..8470,8501..8512,8560..>9097)
FT                   /locus_tag="PICST_33213"
FT                   /product="predicted protein"
FT   CDS_pept        join(8418..8470,8501..8512,8560..9097)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33213"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33213"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67993"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYK8"
FT                   /protein_id="ABN67993.1"
FT                   /translation="MSNRRKRDCATSPIATNFVQASSEVRTFACHDSKNTTFRDIHNIN
FT                   VVSHPLFSAYLTSLPQTSMKTWPVRSIPQDVKRSIPQDVKRSIPQDVKRSIPQDVKRSM
FT                   PQDVKRSIPQDVKRSIPQDVKRSIPQDVKRSIPQDVKRSIPQGPCRYYTSVPQLLTHTP
FT                   LVTLYPIWVASLNFRASTKILHIWSRYVMPVQTTSIS"
FT   gene            <10475..>11830
FT                   /locus_tag="PICST_33214"
FT   mRNA            <10475..>11830
FT                   /locus_tag="PICST_33214"
FT                   /product="predicted protein"
FT   CDS_pept        10475..11830
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33214"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33214"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYK9"
FT                   /protein_id="ABN67994.2"
FT                   /translation="MVGLQNIIDKTLAEQSGHSFRRFVESYATDRNGYNNVMLQRMRDC
FT                   SAAWHTCLEMRTLQIFSPSIWIEDELPKFTGQELIDAGRQMFGPHFKFKRDQQQATSDV
FT                   ANCFSTTVAINSGKTTCCLIAMLAELNFSRRQSDRHRKIYLVTILVVPYVSTLNSTIRQ
FT                   LTDLGFKVRTFHGADGSVTDYDVLLMSLEDGHLRYLNQVVRHFESVAHQGRTYLRRVVV
FT                   DDAHILQMKDFVVDGNRNVPVVFLTSFLPQVSDNSMRTLFSLNRLGRVSSQDPILPHKE
FT                   FTLVKKPNAASINQTISYRVRSLGSALVLVQSYENVLYLEHRLAEEGVPCIGVCGIPQR
FT                   RTAALEKMASENIKVVVTTAEAMVGLHQFEATTVLFAYSIRNPIELLVASQFSSGKVEM
FT                   VLYNTCSSAFQRELSNNCVNLILMRHMRMTEETCYDAGKEQCHICANKRRRG"
FT   gene            complement(<12367..>18837)
FT                   /locus_tag="PICST_33215"
FT   mRNA            complement(<12367..>18837)
FT                   /locus_tag="PICST_33215"
FT                   /product="hypothetical serine rich protein"
FT   CDS_pept        complement(12367..18837)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33215"
FT                   /product="hypothetical serine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33215"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68188"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYL0"
FT                   /protein_id="ABN68188.2"
FT                   /translation="MLFRKFITAVVLSLAGLVTPATISESTIYRGEFDFTILGPLTIDG
FT                   TGGTYLSIVDVSSVSLGSLTVDSANSFYVTVVNALSSIVNISGSLANTGTVSFLTGVTY
FT                   TLGSITNNAGGTMYFAGSGSGATMGAITNSGQMCFYNSVTFSSTISGSGGCVSANRGST
FT                   IIIPYTTSGQTYYLDSLSMINVTAPSGSGYVTPNPIPIQGFGNSNTITMSQLSSTAPYY
FT                   YSTASDGAAAGAAAGTLRVYYLTTHYVDFIIGTGYGNTGTITNPNWSYSTKSGIKFIGT
FT                   LKWPTSSSCQCQALPVAPGINPAEYTTTFTSDGSTVTGEVIVTTDDSGSWYTTTSIYTE
FT                   TEYNTLVIQDDGSTVTGEVIVTTDDSGSWYTTTSIYTETEYNTLVIQDDGSTVTGEVIV
FT                   TTDDSGSWYTTTSIYTETEYNTLVIQDDGSTVTGEVIVTTDDSGSWYTTTSIYTETEYN
FT                   TLVIQDDGSTVTGEVIVTTDDSGSWYTTTSIYTETEYNTLVIQDDGSTVTGEVIVTTDD
FT                   SGSWYTTTSIYTETEYNTLVIQDDGSTVTGEVIVTTDDSGSWYTTTSIYTETEYNTLVI
FT                   QDDGSTVTGEVIVTTDDSGSWYTTTSIYTETEYNTLVIQDDGSTVTGEVIVTTDDSGSW
FT                   YTTTSIYTETEYNTLVIQDDGSTVTGEVIVTTDDSGSWYTTTSIYTETEYNTLVIQDDG
FT                   STVTGEVIVATDDSGSWYTTTSIYTETEYNTLVIQDDGSTVTGEVIVTTDDSGSWYTTT
FT                   SIYTETEYNTLVIQDDGSTVTGEVIVTTDDSGSWYTTTSIYTETEYNTLVIQDDGSTVT
FT                   GEVIVTTDDSGSWYTTTSIYTETEYNTLVIQDDGSTVTGEVIVTTDDSGSWYTTTSIYT
FT                   ETEYNTLVIQDDGSTVTGEVIVTTDDSGSWYTTTSIYTETEYNTLVIQDDGSTVTGEVI
FT                   VTTDDSGSWYTTTSIYTETEYNTLVIQDDGSTVTGEVIVTTDDSGSWYTTTSIYTETEY
FT                   NTLVIQDDGSTVTGEVIVTTDDSGSWYTTTSIYTETEYNTLVIQDDGSTVTGEVIVTTD
FT                   DSGSWYTTTSIYTETEYNTLVIQDDGSTVTGEVIVTTDDSGSWYTTTSIYTETEYNTLV
FT                   IQDDGSTVTGEVIVTTDDSGSWYTTTSIYTETEYNTLVIQDDGSTVTGEVIVTTDDSGS
FT                   WYTTTSIYTETEYNTLVIQDDGSTVTGEVIVTTDDSGSWYTTTSIYTETEYNTLVIQDD
FT                   GSTVTGEVIVTTDDSGSWYTTTSIYTETEYNTLVIQDDGSTVTGEVIVTTDDSGSWYTT
FT                   TSIYTETEYNTLVIQDDGSTVTGEVIVTTDDSGSWYTTTSIYTETEYNTLVIQDDGSTV
FT                   TGEVIVTTDDSGSWYTTTSIYTETSPTYTLPVPSGDGFMIEIKDEDTGLDVFLTHNGNV
FT                   ITVAEHAGSTFYLNVPEGHLIVDGLYVHADHSGIYLSEIPFGGWSISSISNIFIKRADL
FT                   GTLSINGTTTFFYCPDQSSPLSLTNTIGCEEVELLIDGIEPSQSSSSELSSTISTSIES
FT                   SSSLSTTESVTSKSSEVSASSVSESSIASAVSSPTTSVSEVSSSSESSSSISSTESVTS
FT                   ESSEVSSSSVSESSIASAVSSSAISVSEVSSSSESSSSISSTESVTSESSEVSSSSVSE
FT                   SSIASAVSSPTTSVSEVSSSSESSSSISSTESVTSESSEVSSSSVSESSIASAVSSPTT
FT                   SVSEVSSSSVSESSIASAVNSPTTSVSEVSSSSVSESSIASAVSSSAISVSEVSSISKS
FT                   ESGISAIVSSSTLPQKYSSESIVVSSMSSLSFGYYSNTSSSFFSISETTYTLSSTSSVI
FT                   TITSSSLPSSSESAFLASVSATSPSEIITPSLLSSLPTSQSELPSTSSSPVVEENDFRL
FT                   LAFSINPDIDFEQFLTHDGQFITFTNTGGDTFHLSLPPGYLTVGGLYVTADSNGFHLSN
FT                   EPFANWQETSSPAALVKREDGDSLSLNGQDVFYACPDTAPALELVNSSGCIPVSLKVVE
FT                   ESPSSGTTSTSETETGTSTSETSGSSSCSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGS
FT                   GSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSDSGHEGPIASTPVIT
FT                   IPGTTLATSTTSYAPSIPTVFAAVGGAIRIHLSPITFILLMLLHIV"
FT   gene            complement(<26684..>30589)
FT                   /gene="HYR2.1"
FT                   /locus_tag="PICST_50059"
FT   mRNA            complement(join(<26684..26931,29416..>30589))
FT                   /gene="HYR2.1"
FT                   /locus_tag="PICST_50059"
FT                   /product="hyphally regulated cell wall protein"
FT   CDS_pept        complement(join(26684..26931,29416..30589))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="HYR2.1"
FT                   /locus_tag="PICST_50059"
FT                   /product="hyphally regulated cell wall protein"
FT                   /note="hyphally regulated cell wall protein similar to
FT                   Candida albicans HYR1, HYR3, HYR5, HYR10"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_50059"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68189"
FT                   /db_xref="InterPro:IPR021031"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYL1"
FT                   /protein_id="ABN68189.2"
FT                   /translation="MLLSSLLARILVLVSVVYATRDVVITGSKVDKGPINLSIGDITIE
FT                   ENSYWSIFDNSVSALKGSLWVKKGAGFYITGTDRLINLSVTLAFGQNSIKNEGTVVFNS
FT                   IFCKLATKYELIGSSFYNSGEMFLATNGALGSLTAITSSSWTNSGLLVFYQNSRTSAIV
FT                   SLGKPLGTIRNDGQICLHNELFKQETNIVGSGCITADKNSSIFLSNCLLEIDPKQSFYL
FT                   ADSQSSIRAKAISKSKTYTVYGFGNGNKIGLDLPLISLPILGSWGYDEKRGILTLRALG
FT                   NLAHNFIIGTGYDKKKFQITTDSSLGLLSVFNGALKYNGPVPNSSIPSACRPCKPVPSV
FT                   PDGPHTTSQTTAKTPCTTSTKKHSTRSSKSCNSQITVTSTWTEITTTTVTIISSSVEAS
FT                   CVPSYITVTVTTTAEPIDTVTVTSCPTMKPPHSTDTIYTVTSVYITETTTTTARTTLPT
FT                   VTVTETKTKGYFRFF"
FT   gene            complement(<32472..>32966)
FT                   /locus_tag="PICST_63077"
FT   mRNA            complement(<32472..>32966)
FT                   /locus_tag="PICST_63077"
FT                   /product="predicted protein"
FT   CDS_pept        complement(32472..32966)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63077"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63077"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68190"
FT                   /db_xref="GOA:A3LYL2"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYL2"
FT                   /protein_id="ABN68190.1"
FT                   /translation="MTASTNQNIIVSDDEKLQNEKRRAIYIRPFLLFYVNSLIAEVVFL
FT                   LVAIFIMSGTDDIINKVLWTLVFCPLGMGGAMGGIVNVFIVDKYYGSKAIYLTTVISVL
FT                   VLGGCNILCYNLDLVFHFFGASDHPLWFHWRYPMIAFVGYSSGKLLFTDEGQKQLASFG
FT                   V"
FT   gene            <35506..>37335
FT                   /locus_tag="PICST_63551"
FT   mRNA            join(<35506..35784,35854..35952,36073..36436,36509..>37335)
FT                   /locus_tag="PICST_63551"
FT                   /product="predicted protein"
FT   CDS_pept        join(<35506..35784,35854..35952,36073..36436,36509..37335)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63551"
FT                   /product="transcriptional repressor TUP1"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63551"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67995"
FT                   /db_xref="GOA:A3LYL3"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR013890"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYL3"
FT                   /protein_id="ABN67995.2"
FT                   /translation="QRQQHQQRLNELLDAVKQEFDYALTEASSFKQVKEDYDIKYNQQT
FT                   AEMQQIRQTVYELEMAHRKIKEAYEEEILRLKTELESRDRQAQIQQQQQQQPSQPAAIQ
FT                   TPSQQALPPPIKQSPPKQEIKPTSTALTVIDKSQYIVNPTQKALHVKEIPPFLSDLDVS
FT                   KANPDFKKQKLDYYVLYNPAFARDLDVELIHSLDHSSVVCCVRFSKDGKFIATGCNKTT
FT                   QVFNVETGELVAKLIDDNNSSDAASAVAAANGDLYIRSVCFSPDGKLLATGAEDKLIRI
FT                   WDLNTKRIIKILRGHEQDIYSLDFFPDGDRLVSGSGDRTVRIWDLRSSQCSLTLSIEDG
FT                   VTTVAVSPDGQLIAAGSLDRTVRVWDSTTGFLVERLDSGNENGNGNGHEDSVYSVAFTI
FT                   NGKQIASGSLDRTVKLWNLEGKQDPQGNNSPGKKSSCEVTYIGHKDFVLSVCSTPKNEY
FT                   ILSGSKDRGVIFWDQLSGNPLLMLQGHRNSVISVAVSLNSQGTEGIFATGSGDCKARLW
FT                   KWTRK"
FT   gene            <38300..39509
FT                   /locus_tag="PICST_90752"
FT   mRNA            <38300..39509
FT                   /locus_tag="PICST_90752"
FT                   /product="predicted protein"
FT   CDS_pept        38300..39463
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_90752"
FT                   /product="predicted protein"
FT                   /note="go_function ATP binding; kinase activity; go_process
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90752"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67996"
FT                   /db_xref="GOA:A3LYL4"
FT                   /db_xref="InterPro:IPR005935"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR029765"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="InterPro:IPR041431"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYL4"
FT                   /protein_id="ABN67996.1"
FT                   /translation="MSIFTASSTAPVNIATLKYWGKRDTLLNLPTNSSISVTLSQNDLR
FT                   TLTTAAASEAFEKDQLWLNGKLESLDSVRTQACLADLRRLRAEVETSDASLPKLSQFKL
FT                   HIVSENNFPTAAGLASSAAGFAALVSAIAKLYKLPQNMSELSKIARKGSGSACRSLFGG
FT                   FVAWEMGELENGEDSKAVEVAPLSHWPTMKAAILVVSDDKKDTPSTSGMQQTVATSDLF
FT                   QHRITEVVPKRFEEMKRAIAANDFETFGELTMKDSNSFHAVCLDSYPPIFYLNDTSKQI
FT                   IKLVHRLNEQEGKIIAAYTFDAGPNAVIYYDEVNEAKVLGLLYSYFGAVGGWEKHEEVA
FT                   AYKKVTIDGTNPDIYKGISRIILTSIGTGPQETEESLINADGTPKVA"
FT   gene            complement(39594..41662)
FT                   /locus_tag="PICST_68235"
FT   mRNA            complement(39594..41662)
FT                   /locus_tag="PICST_68235"
FT                   /product="predicted protein"
FT   CDS_pept        complement(39640..40989)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_68235"
FT                   /product="predicted protein"
FT                   /note="go_component nucleus; go_function DNA binding;
FT                   go_process regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68235"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68191"
FT                   /db_xref="GOA:A3LYL5"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYL5"
FT                   /protein_id="ABN68191.2"
FT                   /translation="MNYISSNDVLYENPLAANLDPSTTGGDRVDADTADFLNELRHPSS
FT                   QDLAEVPAPLQHATASSTSSSTNSVGMQIDSLGIDPVQQNSVSQSQNQNQIQSHRNGNH
FT                   GSLTFSKPFSADDLATLANVHQMNNNTNNNNTNSNLNSNNNNSNNATSSLFAFHNPFDF
FT                   KSYPITNPPIFDSTLLLPLYSNDGVPRRRRISISNGQIGQIVNHEALFEDDSGFDTDLG
FT                   VTGFGNSQGHSQISSPPQAQLSSMNSNTSIAAIADQQQQQPQQVFPGNFNSQAVPPQYQ
FT                   PQITFAPASTSISVSPNPQTPVASPQKSLSKSHSRKNSTAVPELTGVAGVPPPNHQLIY
FT                   NNEVIYNPNNGPIPGTAAWKKERLLERNRIAASKCRERKKQAQLELQGNISKMKSQYKR
FT                   DQEKIKKLNKLVEFYNKTIVKHLNDGNQELSVLRKFINKDIDEIDIKDIS"
FT   gene            <42907..>46395
FT                   /locus_tag="PICST_33220"
FT   mRNA            <42907..>46395
FT                   /locus_tag="PICST_33220"
FT                   /product="hypothetical protein"
FT   CDS_pept        42907..46395
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33220"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67997"
FT                   /db_xref="InterPro:IPR018789"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYL6"
FT                   /protein_id="ABN67997.2"
FT                   /translation="MLATLLFFLFFSLVQSARIDFIPPGWDWWTSGCTAQKDWYLYKCP
FT                   QGNAQSPGNPEFYSNFQDLWWIQGNTYRAEFNFGFNVDMKSQHLDYLALEGLPSPDPRV
FT                   IDGTLVLVDKANGINLFTQSWNRLSLTLLMLIDAVPDDTRPEPRHCTPPFNVVGRWCQT
FT                   PETQGGQCDTWKYNKEFTIVVDCAAQDCNISQKCFNKHCPGGTPSLPPVPDPTPEPTET
FT                   DPEETETKPTSEPETETPTETDPETEPTSDPETETPTETDPEETETDPTSDPETETPTE
FT                   TDPEETETDPTSDPETETPTETDPETEPTSDPETETPTETDPEETETDPTSDPETVTPT
FT                   ETDPEETETDPTSDPETETPTETDPEETETDPTSDPTSDPETETPTETDPEETETDPTS
FT                   DPETVTPTETDPEETETDPTSDPETETPTETDPEETETDPTSDPTSDPETETPTETDPE
FT                   ETETDPTSDPETETPTETDPETEPTSDPETETPTETDPEETETDPTSDPETETPTETDP
FT                   ETEPTSDPETETPTETDPEETETDPTSDPETETPTETDPEETETDPTSDPTSDPETETP
FT                   TETDPEETETDPTSDPETETPTETDPETEPTSDPETETPTETDPETEPTSDPETETPTE
FT                   TDPEETETDPTSDPTSDPETETPTETDPEETETDPTSDPETVTPTETDPETEPTSDPET
FT                   VTPTETDPEETETDPTSDPETETPTETDPEETETDPTSDPETETPTETPTETDPEETET
FT                   DPTSDPTSDPETETPTETDPEETETDPTSDPETETPTESESEESETPSRTLETVTTTST
FT                   ITLTTVVPCPTGGEETITVTEVTVITTEIEKTVSSPTTIVTETITGLPVPPETLPTEIV
FT                   TTVVTSILPVVTVDTITTTSTITLTTVVPHPTGGEETITVTEQSVITSEVQKTVSSITT
FT                   IVTETVIPKPLPTPITIESVIVTPITVTVTNVITNTVVVPCPTGGYTTEVQLETEEITT
FT                   EVSKTVVVTTVVTKTEQQSTMETVIVSQAGKVTTTKFITQTVTECPEVIQTTIFETIAG
FT                   ETVTRTVDHSVCETYIVVCVEEPTKELVEEIIDDVVHSYTTEYTKTSSFTLEQLVTDEA
FT                   EEQQQLPYEDHIDEEDQLVEESGTYSIEEALEGAGSQMDPAMNMIMAIIALLVSI"
FT   gene            complement(47979..51903)
FT                   /gene="MYO5"
FT                   /locus_tag="PICST_79258"
FT   mRNA            complement(47979..51903)
FT                   /gene="MYO5"
FT                   /locus_tag="PICST_79258"
FT                   /product="Myosin-5 isoform"
FT                   /note="Has EST support"
FT   CDS_pept        complement(48126..51896)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MYO5"
FT                   /locus_tag="PICST_79258"
FT                   /product="Myosin-5 isoform"
FT                   /note="go_component myosin; go_function motor activity; ATP
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_79258"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68192"
FT                   /db_xref="GOA:A3LYL7"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR010926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035535"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR036072"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LYL7"
FT                   /protein_id="ABN68192.2"
FT                   /translation="MAIVKRGGRTKNKTQQQAPAKSGIKKAEFDLHKSKEVGVSDLTLL
FT                   SKITDEAINDNLHKRFMNGTIYTYIGHVLISVNPFQDLGIYGPETLSKYRGRNRLEVPP
FT                   HVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKQIMQYIANVSVDSGNAEISKIK
FT                   DMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIQFSESNHQPIAAHITNYLLEKQRVVS
FT                   QITNERNFHIFYQFTKHCPTQYQQQFGIQGPETYVYTSSAKCINVDGIDDSKDLDETLS
FT                   AMKIIGLTELEQNNIFRMIASILWIGNVSFVEDESGNAAIRDDSVTQFVAYLLEVNPEI
FT                   LKKAIVERVIETTHGMRRGSTYHVPLNIVQATSVRDALAKGIYNNLFEWIVERVNVSLK
FT                   GASQSSKTIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKAEQDEYVKEQIK
FT                   WTPIDYFNNKVVCDLIEATRPQPGLFAALNDSIKTAHADSDAADQVFAQRLSMVGASNR
FT                   HFEDRKGKFIIKHYAGDVTYEVAGMTDKNKDALLRDLVELLSTSANPFVNQVLFPPSLL
FT                   ASITDSKKRPETASDKIKRSANDLVGTLSKCQPSYIRTIKPNQTKRPKEYENQQVLHQI
FT                   KYLGLKENVRIRRAGFAFRTTFEKFVQRFYLLSPATGYAGDYIWRGDDISAVKEILKSC
FT                   FIPATEYQLGTTKVFIKTPETLFGLEDMRDKYWHNMAARIQRAWRRYVKRKEDAARTIQ
FT                   SAWRIKKHGNQFEQLRDYGNGLVQGRKERRRMSMLGSRAFMGDYLGCSDTSGYGRFIVT
FT                   QTGINEKVVFSGRGEILLSKFGRSSKRLPRIFVVTRTTIFIIAEVLIEKRLQLQSEFKI
FT                   PISGLNYVALSHLQDNWVALSLHSPTPSTPDVFISLDFKTEFVTHLKKINPGLTINIGT
FT                   TVQYQKKPGKFHTVKFISGNSSDVPEYGDVYKSGTVTVKPGLPSSSRNPKRPRGKSGKV
FT                   DYSKYYNRGVKKSFPVPSARPTAASQPSYKSPVEQSYQPQVLAYQTPRPEEAKPVQRKA
FT                   PPPAPVVQNQPQRQPQAIEPVRPVKKTAPSPPVRKTAPPPPPPPPALSAPAKPKFPTYK
FT                   AMYDYDGSVAGSIPLVKDVVYYVESINGKWGLVKTLDESKEGWSPIDYLSQCEPPSSLF
FT                   GAANPPSRPVAPSQPKVQSRESTVASAAVSSSTPASTVSNGSLSNGLAEALRAKKTEET
FT                   TLAGSLADALKKRQGATRDDSDDEDDDDDDW"
FT   gene            complement(<52320..>53882)
FT                   /gene="WDR7"
FT                   /locus_tag="PICST_49918"
FT   mRNA            complement(<52320..>53882)
FT                   /gene="WDR7"
FT                   /locus_tag="PICST_49918"
FT                   /product="WD-repeat protein required for cell viability"
FT   CDS_pept        complement(52320..53882)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="WDR7"
FT                   /locus_tag="PICST_49918"
FT                   /product="WD-repeat protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49918"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68193"
FT                   /db_xref="GOA:A3LYL8"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR012972"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYL8"
FT                   /protein_id="ABN68193.1"
FT                   /translation="MATVIPPPSKKQKKEAQKVQEVNLIPDDLPNVLIKFQASDTGESV
FT                   GGSIRVPGGITEKQLEELLNQLHGDIDEPVPYTFALLNKTIDDKSETGSLVDIKDNLYS
FT                   SVLQPGIKTTEDFLTLVYTPRAVFKVKAITRSNAAIAGHGSTILCCQFAPNDSGRMCSG
FT                   AGDSTARIWDCNTQTPLYTLSGHTNWVLCVAYSPCGTMIATGSMDNTVRLWDTDTGKPL
FT                   GKALTGHSKWVSSLTWEPLHLVKPGEKPRLATSSKDGTVKVWDSTRRVCLLTMSGHTNA
FT                   VSCVKWSGSNIIYSASHDKTIKAWDISAQGKCIQTLKSHAHWVNHLSISTDYVLRKGGF
FT                   DHTSTKVSSKKLSMEELRAKALEQYEKVAKVGGVISERLVTASDDFTMYFWEPLKSSKP
FT                   VCRMTGHQKLVNHVSFSPDGRYIVSSSFDNSIKIWDGLKGVFVGTLRGHVAPVYQTAWS
FT                   ADNRLLVSCSKDTTLKVWDIRTRKLSVDLPGHSDEVYAVDWSMDGKRVASGGKDKMVRL
FT                   WSH"
FT   gene            complement(<54396..>55475)
FT                   /locus_tag="PICST_49910"
FT   mRNA            complement(<54396..>55475)
FT                   /locus_tag="PICST_49910"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<54396..55475)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49910"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49910"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68194"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYL9"
FT                   /protein_id="ABN68194.2"
FT                   /translation="MVSLHTIMSQSSQFVHLKSAIPTLDSILHATTRRPNKRIYDMQRA
FT                   PGCSSIFTVMVEFMVSHLSNSPNNKVIVVDTLTPFPWHLLFSHSRFQQEWRQDSRIALH
FT                   DPDTFALLYGLFAYESLEPAINGSTIVIINDFHQTLDIYLHDQTSSYEETILKHHLEVN
FT                   SIIKSNQTQYELEGTKTPVPEIPAQSDLLKMSAISKFNTHLNSLLTMMSKFCYKTNSMC
FT                   FLLGHLETKYIPYSTTSQMSDADFYNTSVSYQDKGRVVLVPSYSESNEEKKEDINSKSI
FT                   DSYLCMRLIFYKDWYHNSPYFAECYPPLEKQNKVVINQAQLRTVFAIKITNFSSKSKYC
FT                   PIYFDYDDIIYHLDDDNEND"
FT   gene            <57261..>58244
FT                   /locus_tag="PICST_20558"
FT   mRNA            join(<57261..57821,57939..>58244)
FT                   /locus_tag="PICST_20558"
FT                   /product="predicted protein"
FT   CDS_pept        join(<57261..57821,57939..>58244)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_20558"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_20558"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67998"
FT                   /db_xref="GOA:A3LYM0"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYM0"
FT                   /protein_id="ABN67998.2"
FT                   /translation="ISKVSGILSLSVWLFAQLPQIIENHLNESVSGVSLLFLICWIGGD
FT                   ATNLIGCILTRALPFQTCLAAYYCFIDCILSLQYWYYTKVYPRHKTHHNLLQSPNFLRP
FT                   STSNKSTNHSTRRNRFDQDLSRSPMEISTSIMDVAQGNGHRGHDQKRIHEGSFIHKILG
FT                   ATFIAGSLPKQAHSMPIPNPQSAADIGMISAWTCSTLYVSSRAPQIIKNFKLKSTRGIT
FT                   VYLFVFAMLGNIFYTISIVSDLYLLSLNKSYFGEDGDSKFKEVFMDQLPFIVGSSGTVL
FT                   FDSIIIFQ"
FT   gene            complement(<59230..>60912)
FT                   /gene="PYC2"
FT                   /locus_tag="PICST_33225"
FT   mRNA            complement(<59230..>60912)
FT                   /gene="PYC2"
FT                   /locus_tag="PICST_33225"
FT                   /product="Acetyl-CoA transporter"
FT                   /note="Has EST support"
FT   CDS_pept        complement(59230..60912)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PYC2"
FT                   /locus_tag="PICST_33225"
FT                   /product="Acetyl-CoA transporter"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33225"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68195"
FT                   /db_xref="GOA:A3LYM1"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR024371"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYM1"
FT                   /protein_id="ABN68195.2"
FT                   /translation="MTASSLDNQLNYVHAAFDEENDGLLPISLQDLTNKHKEASTSKNS
FT                   TFAPKNTSLPSSTKSASLLKVDRPAFFVLVLLYLLQGVPVGLAFGSIPFILKSKLSYSQ
FT                   VGIFSLAAYPYSLKLIWSPIVDAVYSPKLGRRRSWIIPIQTISGVTLIYLGSLIDGLME
FT                   DPQNCLPTITFCFFMLVFFCATQDIAVDGWALTCLSPESLSYASTAQTIGINTGYFSSF
FT                   TIFLALSSPDFANRYLRKVPLDVGLFSLGSYLTFWGWMFLAVTALLWFVPEDPPHLAKR
FT                   NQAKLSNEKIKTESVYNKDSKFKDLQNVYLAMFKVLKLPNVQTFVIILLISKFGFQVNE
FT                   AATNLKLLEKGLSKEDLSITVLIDFPFEMVFGYYAGRWSTGKSPLKPWIFGFAGRLVAA
FT                   ALAQGIVYFFPEDGKISSFYFLLVILQHLLGSFMSTIQFVSLCAFHTKIADPAIGGTYM
FT                   TTLNTLSNYGGTWPRLILLYLIDKLTIEECKVPSVTNSYYITDEDLRQQCKSSGGKLTV
FT                   LRDGYYYTNTICVIIGIFTLLWVKRKTTYLQSLPNSAWRVNKD"
FT   gene            complement(61539..62816)
FT                   /gene="PDB1"
FT                   /locus_tag="PICST_68238"
FT   mRNA            complement(61539..62816)
FT                   /gene="PDB1"
FT                   /locus_tag="PICST_68238"
FT                   /product="pyruvate dehydrogenase E1 component, beta subunit
FT                   (PDH)"
FT                   /note="Has EST support"
FT   CDS_pept        complement(61626..62795)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PDB1"
FT                   /locus_tag="PICST_68238"
FT                   /product="pyruvate dehydrogenase E1 component, beta subunit
FT                   (PDH)"
FT                   /EC_number="1.2.4.1"
FT                   /note="beta subunit of pyruvate dehydrogenase (PDH) (E1
FT                   beta)"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68238"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68196"
FT                   /db_xref="GOA:A3LYM2"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYM2"
FT                   /protein_id="ABN68196.1"
FT                   /translation="MAPKLSQIAQTARLAASATRAHNIANVTGNTTRSVAQAGQYQALR
FT                   MMDSRAASSSAVGSKTITVRDALNAGLAEELDKDDDVFLMGEEVAQYNGAYKVSRGLLD
FT                   RFGERRVIDTPITEMGFTGLAVGAALHGLKPVLEFMTFNFAMQAIDQIVNSAAKTYYMS
FT                   GGKQPCNITFRGPNGAAAGVGAQHSQCYAAWYGSIPGLKVVSPYSAEDYKGLIKAAIRD
FT                   PNPVVFLENEIAYGETFDISEEALSTDFVLPIGKANVEREGTDLTFVSHSRSVKFCMEA
FT                   AETLEKEYGVKAEVINLRSIKPLDVPTIVESVKKTNHLVTVEAGFPAFGVGSEICAQIM
FT                   ESEAFDYLDAPVERVTGCEVPTPYAKELEDFAFPDEPTVIRAAKKVLSL"
FT   gene            64265..66132
FT                   /locus_tag="PICST_73691"
FT   mRNA            64265..66132
FT                   /locus_tag="PICST_73691"
FT                   /product="predicted protein"
FT   CDS_pept        64540..66048
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_73691"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73691"
FT                   /db_xref="EnsemblGenomes-Tr:ABN67999"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYM3"
FT                   /protein_id="ABN67999.1"
FT                   /translation="MFKVARIPRVSARLLPKCNSISVLRFNSNQTNFHRPDKAGSEDAT
FT                   EAADAAATLLAELRDKQTNPNKASWLEALREREKQKAEGKILDSYSYVTPVTTEIGEKT
FT                   RGDSFTYLTLPFKDDKWLCDAYINAFGRLRAGQLFQDLDALAGRIAYRHCSPAEPVNVT
FT                   ASVDRIYMVKKVDEINNYNFVLAGSVSWTGRSSMEISVRGYAFEDSIPETITEETLPQE
FT                   NIFLTANFTFVARNPITHKSFAINRLLPVSEKEWMDYRRAESHNAKKKFAAKNAKVLEP
FT                   TDEESRLIYDMWSSSQALKSADGPPQTGVAFMKDTKVSSTLFMQPQYRNRHSYMIFGGY
FT                   LLRQTFELAYCAAADFASAGPRFVSLDSTTFKAPVPVGSVVSMDASVSYTEHIHKGPSD
FT                   IDADSPFNFKLPATNKLSSNPEAFLSEPGTLIQVKVDTKIKLLDSSSKESGTFIYSFFV
FT                   PKSSYKGKPGYSSVIPQTYSEMMTYIAGRRRAQDTANFVDTLPK"
FT   gene            complement(<66386..>69067)
FT                   /gene="AXL2"
FT                   /locus_tag="PICST_50000"
FT   mRNA            complement(<66386..>69067)
FT                   /gene="AXL2"
FT                   /locus_tag="PICST_50000"
FT                   /product="polarity establishment/cellular polarization"
FT   CDS_pept        complement(66386..69067)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="AXL2"
FT                   /locus_tag="PICST_50000"
FT                   /product="polarity establishment/cellular polarization"
FT                   /note="involved in polarity establishment/cellular
FT                   polarization during budding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_50000"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68197"
FT                   /db_xref="GOA:A3LYM4"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYM4"
FT                   /protein_id="ABN68197.2"
FT                   /translation="MLFILVFLMAIASAQIEVGFPFNEQLPNVARIDTAYSFTMANITY
FT                   KSDNFGVISYQATGLPSWLSFDSDSRTFTGTPSKDDVQEFEIHLFGTDSSDGSTINNTY
FT                   SMIVSNDTGLHLSSNDVMFTEIAKYGDTNGNDGLVVREGQEFNISFEKSVFESYSTSKR
FT                   PIVAYYGRSADRSSLPNWIDFDSDSLTFSGIVPHVVSDIAPSFEYGFSFIGSDYVGFAG
FT                   AEGIFKLIVGAHSLSTSLNESIKVNGTLNHDFDISIPIFSSVFLDGSLISAENISSVDS
FT                   TDLPSWIHLDTDHYTLTGNFPGDATFDNFTINVKDVFQNEVELPYSFNAIGSVFTLSTL
FT                   PNVNATRGQFFEYHLMNSYFTDFNSTDVSVKFDSSNSWLTFHEDNNTFTGQVPKDLQKI
FT                   NVDVSASSDYDSEDKSFDIVGIDSKTSSTSSSSSATATSSSSSSPTSSPSSSSTPVKSK
FT                   ASTNHKALAIGLGVGIPAFLLLVAALILFCCCIKRRKERKQDPRKDMEKDAAVPELTGP
FT                   GFGNTYDNDSQKGRKLAAANARKLDNTKPYDYDDDIHSTSSSITHVESNGSAARYVDAI
FT                   ELPVKSWRARDNSDDKQNRNSEVSLSTVNTEQLFSVRLVDDQSARNSQQSSFVARQLLS
FT                   STSLHEVMRRDSSTNLQRLDSDGNIVDSATSSNASTPSPWKTVPKSGSILAILPEENSR
FT                   EYTNSVRNATDTSTVYLSADHSTNSNNSNSHTSRHDFSESSISNLLSKFNESPSGSERD
FT                   LSQYQHEDSAYLDEFKAVKTSNGDFQWSSDRTDRSSEDNTDLMHKTASNFNLSHDDLAI
FT                   ATKTLPMRHSNLSTISIESGNSDQMLLNHDGSPQIPKRSRSRTSKAKLVNFTRKGSLRE
FT                   SSYEPDIKFHEESAQVHSNDSD"
FT   gene            complement(<70597..>71532)
FT                   /locus_tag="PICST_33229"
FT   mRNA            complement(<70597..>71532)
FT                   /locus_tag="PICST_33229"
FT                   /product="predicted protein"
FT   CDS_pept        complement(70597..71532)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33229"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33229"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68198"
FT                   /db_xref="GOA:A3LYM5"
FT                   /db_xref="InterPro:IPR019388"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYM5"
FT                   /protein_id="ABN68198.2"
FT                   /translation="MPSEVSSVYDRHFRFIEMFFRQIQQRFKMSPSEFLFVISFLVNFV
FT                   IGKIVHSLSPDEEVYNYYTNKKNVLNQVFVKNGWFWTTANIVLFYGIVLYKEKSSAIRI
FT                   NIAKGAVIRYVLATVWWIFFTQWFFGLPIMDKVFVYTGGSCVIEKETHPGQSRFLHLFE
FT                   AAGEEVGNKLSSTSITSYHCRRIKGSWEGGHDPSGHVFLLIHSSLYLFLEVSPYWVSYS
FT                   HFKASLSKLRKEVVKPVSLGEKFSSFIKYSVANPPIVVAKLITLWWFMLLMTNIYFHSL
FT                   GEKLVGLVFGYIGVVGIYYVPRIVEKQKQQ"
FT   gene            complement(<72348..>72638)
FT                   /locus_tag="PICST_49954"
FT   mRNA            complement(<72348..>72638)
FT                   /locus_tag="PICST_49954"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<72348..>72638)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49954"
FT                   /product="predicted protein"
FT                   /note="go_function RNA polymerase II transcription mediator
FT                   activity; go_component mediator complex; go_process
FT                   regulation of transcription"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49954"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68199"
FT                   /db_xref="GOA:A3LYM6"
FT                   /db_xref="InterPro:IPR008831"
FT                   /db_xref="InterPro:IPR038089"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYM6"
FT                   /protein_id="ABN68199.1"
FT                   /translation="SVPTRWEIELEFVQSLSNIQYLNHLAQQGYLNDENFINYIKYLNY
FT                   WKEPQYARYLVYPNCLHILTLLQDEQFRSNIVNPDFMNSLMNDMVQRWQNND"
FT   gene            <73045..>73536
FT                   /locus_tag="PICST_33231"
FT   mRNA            <73045..>73536
FT                   /locus_tag="PICST_33231"
FT                   /product="predicted protein"
FT   CDS_pept        73045..73536
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33231"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33231"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68000"
FT                   /db_xref="GOA:A3LYM7"
FT                   /db_xref="InterPro:IPR013960"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYM7"
FT                   /protein_id="ABN68000.1"
FT                   /translation="MESGTTPTGSTRQVALERELAQLIRINSTVANLIETIKYTHSNIA
FT                   KINESGNSTHTLLDQWVRILSQTNFTHDIINDRTWNGKEDQELEEEDDDLAQKEILEQQ
FT                   LLNQLSKLEAENSELSTKIETKEQEHEQARQRRNDILVQRKRELGLYTVSGRDATKRRR
FT                   "
FT   gene            complement(73655..77477)
FT                   /gene="PYC1"
FT                   /locus_tag="PICST_90975"
FT   mRNA            complement(73655..77477)
FT                   /gene="PYC1"
FT                   /locus_tag="PICST_90975"
FT                   /product="Pyruvate carboxylase"
FT                   /note="Has EST support"
FT   CDS_pept        complement(73808..77347)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PYC1"
FT                   /locus_tag="PICST_90975"
FT                   /product="Pyruvate carboxylase"
FT                   /EC_number="6.4.1.1"
FT                   /note="Pyruvate carboxylase (Pyruvic carboxylase 1) (PCB
FT                   1); go_function ligase activity; catalytic activity; ATP
FT                   binding; go_process metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90975"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68200"
FT                   /db_xref="GOA:A3LYM8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYM8"
FT                   /protein_id="ABN68200.1"
FT                   /translation="MSSLSPHDHHGKINQMRRDSTVLGPMNKILVANRGEIPIRIFRTA
FT                   HELSMQTVAIYSHEDRLSMHRLKADESYVIGKKGEFSPVGAYLQIDEIIKIAKTHNVNM
FT                   IHPGYGFLSENSEFARKVEEAGIAWIGPTHETIDAVGDKVSARNLALANDVPVVPGTPG
FT                   PIDSVEEAEAFVEKYGYPVIIKAAFGGGGRGMRVVREGDDIGDAFKRATSEAKTAFGNG
FT                   TCFIERFLDKPKHIEVQLLADGYGNVIHLFERDCSVQRRHQKVVEIAPAKNLPKAVRDA
FT                   ILTDAVKLAKSANYRNAGTAEFLVDEQNRHYFIEINPRIQVEHTITEEITGVDIVAAQI
FT                   QIAAGASLQQLGLLQDKITTRGFAIQCRITTEDPSKNFQPDTGKIEVYRSSGGNGVRLD
FT                   GGNGFAGSIISPHYDSMLVKCSTSGSTYEIARRKMLRALIEFRIRGVKTNIPFLLALLT
FT                   NETFISGSCWTTFIDDTPSLFQMISSQNRANKILSYLADLIVNGSSIKGQVGLPKLNEE
FT                   AEIPTIHDPKTGIPIDVELNPAPRGWRQVLLEEGPDAFAKKVRNFNGTLITDTTWRDAH
FT                   QSLLATRLRTIDLLNIAPTTAHALNGAFSLECWGGATFDVCMRFLYEDPWARLRKLRKL
FT                   VPNIPFQMLLRGANGVAYSSLPDNAIDQFVKQAKDNGVDIFRVFDALNDLDQLKVGIDA
FT                   VKKAGGVVEATVCYSGDMLQKGKKYNLAYYVDVVDKIVAMGTHFLGIKDMAGTLKPKAA
FT                   TDLVSAIRAKYPDLPIHVHTHDSAGTGVASMTAAAKAGADVVDAASNSMSGMTSQPSIS
FT                   AILASFEGEVETGLSERLVREIDHYWAQMRLLYSCFEADLKGPDPEVYEHEIPGGQLTN
FT                   LLFQAQQLGLGAKWLQTKETYKIANRVLGDVVKVTPTSKVVGDLAQFMVSNNLTEEDVN
FT                   KLAGELDFPDSVLDFMEGLMGTPYGGFPEPLRTNMLGNKRQKLNERPGLSLAPVDFSAL
FT                   KQELVSKYGNSIKEVDLASYTMYPKVYESYRKIVEKYGDLSVLPTRYFLKGINVGEELS
FT                   VEIEQGKTLIVKLLAVGEISQQKGTREVFFELNGEMRSVTVDDKTVSVETITRRKATQP
FT                   NEVGAPMAGVVIEIRTQSGTDVKKGDPIAVLSAMKMEMVISAPVSGVVGEILIKEGESV
FT                   DASDLITSILKHN"
FT   gene            complement(80487..81578)
FT                   /locus_tag="PICST_68241"
FT   mRNA            complement(80487..81578)
FT                   /locus_tag="PICST_68241"
FT                   /product="predicted protein"
FT   CDS_pept        complement(80627..81568)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_68241"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68241"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68201"
FT                   /db_xref="InterPro:IPR006970"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYM9"
FT                   /protein_id="ABN68201.2"
FT                   /translation="MLFKPTVFLSLVAVVLADHTFTLSAGDLGEVTSADSKLTIGNGDA
FT                   PTLILQEPSGLVNVQGTDNYLQLSETGVNLTPQADASSNFQILEGQVFAHGPSDDNAVW
FT                   FACPADTGFVIQIFQAGDCQQITLTAVEQTGDPTEDPTEDPTEDPTEDPTEDPTEDPTE
FT                   DPTEDPTEEPTEEPTEEPTEEPTEEPTEEPTEEPTEEPTEEPTEEPTEEPTEEPTEEPT
FT                   EEPTEEPTEEPTEEPTEEPTEEPTEEPTEEPTEEPTEEPTEEPTEEPTEEPTEEPTEEP
FT                   TEEPEVTPAEGAGASLVASAGSVLLAVAALFL"
FT   gene            <84810..>86015
FT                   /locus_tag="PICST_49214"
FT   mRNA            join(<84810..85447,85694..>86015)
FT                   /locus_tag="PICST_49214"
FT                   /product="predicted protein"
FT   CDS_pept        join(84810..85447,85694..86015)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49214"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49214"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68001"
FT                   /db_xref="GOA:A3LYN0"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYN0"
FT                   /protein_id="ABN68001.2"
FT                   /translation="MSSHNPDKYNNTTSSALLEQLVYIDTFMNNGTSSSAGDLTPNLDI
FT                   DGQLSIDLAAFADDSFIFPDEDKPKNHNHDDDDDRISNKDFGDHNGKENEVIFKTEEDP
FT                   LMTQHPLNLDSSTDNSPDMQQQQKHLLANQNGAGVLNDINFQKLPKFPVPPGAKSSLES
FT                   AGLSQNQIDLLSALIAQHQTSLGNSIPQSQNSPSVQQVSQQQHAQQHSQHNLGNSSSFS
FT                   SFNNDGLTPSANGGSSAELDKRRRNTAASARFRIKKKLKEKQMENKILSLNELIKEFEV
FT                   KIQQLEMENKLLRNLIIEKGSQKSDNELKLLRERAKMN"
FT   gene            <87467..>89251
FT                   /locus_tag="PICST_68242"
FT   mRNA            <87467..>89251
FT                   /locus_tag="PICST_68242"
FT                   /product="predicted protein"
FT   CDS_pept        87467..89251
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_68242"
FT                   /product="zonadhesin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68242"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68002"
FT                   /db_xref="InterPro:IPR022210"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYN1"
FT                   /protein_id="ABN68002.2"
FT                   /translation="MVSTRSGRKDPASVELGQNGKEVKKIPTSKSKSRAIQHNADVITA
FT                   SESVHTKKETRGRKRKVTSIVPEQPDEQDVSLRGKKKRTTEALDSTVSIESANTRPNND
FT                   RSTPSSEWTSSKVPKDTSTPKTNMPIMSIISHKVGKKNPTSTRQDSPSSISGLSDGDMG
FT                   DEPELSTVSSNSDNIKINKRIMSRDTEEVIRMFKKFDDEVLTNPVARARLLSLKFETRK
FT                   RYITTFKHYIRFCCKKKLDNFFVTGPLMKEFYEEQFAISASSNPIIRLKKMDPAFSKLQ
FT                   EINFLVYHLENKDIPDRHIAYDYLFFIETGKYPWYHKPIVNTSSEPVDFSNTANKKSNK
FT                   SLATRVSKGATEKSSGTQPSTNTNSEKEEIASSQQTNKETSQLIPTPTTRRKRTIRKVE
FT                   LEAFIKSQLKQTRSEIHNLNTAHIEALKLITSDQQVLNQVRSLNRNINIALDNFSSLIE
FT                   KGPNEVIYSGAEKDNTVLPKSTHPVIIDMNHNIFTVYEILEEWYRIDPSVEKRIKNWGM
FT                   NWIRDDIDRETYNERNSIVDFVKRISKEINEPDLFLIANDCDRYIHDKSILDEFISEIE
FT                   LDFDDLFKRVLRHRQRRS"
FT   gene            <91398..>92903
FT                   /gene="JEN12"
FT                   /locus_tag="PICST_85334"
FT   mRNA            join(<91398..92718,92746..>92903)
FT                   /gene="JEN12"
FT                   /locus_tag="PICST_85334"
FT                   /product="Carboxylic acid transporter protein homolog"
FT                   /note="Has EST support"
FT   CDS_pept        join(91398..92718,92746..>92903)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="JEN12"
FT                   /locus_tag="PICST_85334"
FT                   /product="Carboxylic acid transporter protein homolog"
FT                   /note="go_component integral to membrane; go_function
FT                   transporter activity; go_process transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85334"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68003"
FT                   /db_xref="GOA:A3LYN2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYN2"
FT                   /protein_id="ABN68003.2"
FT                   /translation="MDTKSVHTIQSIQLQEIRDHNKHIVQPPKFTAQAIKNYFGSRFRS
FT                   LFVPKEELEQYTWADIYNPFSALREVSLREWNFFFLGFWAWTWDAFDFFTVSLNITNIA
FT                   EALDSSVKDISWGITLVLMLRTVGAIIFGLIGDTRGRKWPYIINLALLSVIQIGTGFVQ
FT                   TYKQFLAVRALFGIAMGGLFGICAAEALSDAPRKARGIMSGIFQEGYAFGYLLAVVFQR
FT                   AIADTSSWRNVFYFSAGVGVIFMVWRFFSPETDSFLRQKARMEETAAAGGQGGSKVAAF
FT                   KSQARKAMKQYWLIVIYCVLMMSGFNFSSHGSQDLYPTMLKNQYQFSADKSTVANVAAN
FT                   LGACAGGIFVAHMSTFIGRRLAIILATILCAAVIYPWAFIPNAGSAFAFQFGIQGAWGV
FT                   VPIHLSELSPPQFRSFVTGVAYQLGNLCSSASSTIEATIGEHVYDYGKTMAIFMACVLV
FT                   YQLIIIFIGPENRGADLGIERDDILDEDAYEDDDE"
FT   gene            93457..94265
FT                   /gene="URA5"
FT                   /locus_tag="PICST_90848"
FT   mRNA            93457..94265
FT                   /gene="URA5"
FT                   /locus_tag="PICST_90848"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /note="Has EST support"
FT   CDS_pept        93506..94165
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="URA5"
FT                   /locus_tag="PICST_90848"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="go_process nucleoside metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90848"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68004"
FT                   /db_xref="GOA:A3LYN3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYN3"
FT                   /protein_id="ABN68004.2"
FT                   /translation="MESYQTSFLESALESNALKFGSFTLKSGRQSPYFFNLGFFNTGLL
FT                   LSELATSYAKAIIKSGLEFEVLFGPAYKGIPLVAITAAKLAELDPEHYGNILYSFNRKE
FT                   KKDHGEGGSIVGAALKDKKILIIDDVISAGTAINEAFQIIAAEQGNVVGCIIALDRQET
FT                   TANSDTSATQAVSERYGIPVISIVSLSDIVEILSHKLTEEQLASIKEYRKQYSPKN"
FT   gene            complement(<94377..>95543)
FT                   /locus_tag="PICST_33238"
FT   mRNA            complement(<94377..>95543)
FT                   /locus_tag="PICST_33238"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(94377..95543)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33238"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68202"
FT                   /db_xref="GOA:A3LYN4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYN4"
FT                   /protein_id="ABN68202.2"
FT                   /translation="MSTSAEEGTHLSESTPLLTSGSGSEETRTNPRSSGRSSRFRLLII
FT                   PTLIIIVLVYATNWYITSHSSVNQALPFLGKPLKLRVYTNNIRLDNRYPVKGEQPWSKR
FT                   KKQVINSIDFNTALGHANVVCLQEVLHNQLVDILEGLNKNAEQIWTYYGVGRNDGLEAG
FT                   EYAPILYKNSDWILLDNQTFWLSETPWKPSKGWDAALERIVTMVTLESRINPLIKVNVF
FT                   NTHFDHRGVLARKKSAELIVDKMENFNDNPSFLCGDFNTQPKDQPYHVLSDAGFKDSRK
FT                   LVDYDYSYGHSTTFTGFNKEKEDSSIIDYIWSPYFSQGNFGNDTSPVKDYEDEVANEMN
FT                   NYYNLEHHLVYDIVIKQFGILHNYFKGFYFSDHRPVVASYEITRTHLL"
FT   gene            complement(95946..97826)
FT                   /gene="CAL1"
FT                   /locus_tag="PICST_85362"
FT   mRNA            complement(95946..97826)
FT                   /gene="CAL1"
FT                   /locus_tag="PICST_85362"
FT                   /product="Calnexin homolog"
FT                   /note="Has EST support"
FT   CDS_pept        complement(96003..97754)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="CAL1"
FT                   /locus_tag="PICST_85362"
FT                   /product="Calnexin homolog"
FT                   /note="Calnexin homolog (CALX); go_function calcium ion
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85362"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68203"
FT                   /db_xref="GOA:A3LYN5"
FT                   /db_xref="InterPro:IPR001580"
FT                   /db_xref="InterPro:IPR009033"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018124"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYN5"
FT                   /protein_id="ABN68203.2"
FT                   /translation="MVCLKQVSLLSIALACVVKAEDYIPYDKSKLTTSAIFEQFDYQDL
FT                   DHSPWKPSTAKKFDEGRHEVVSYVGKWAIEPAKKYPAFSNDKGLVLKSKAAHHAISYKL
FT                   PQPFDNTDNDLVLQYEIKLQNGLSCGGTYIKLLDLQDNYDNFSTDTPYQVMFGPDRCGS
FT                   ENKIHFILRRENPLNVSDVQEKKLKNSPMSRSGDLTTLYTLILKQNQDFEIRINGEVAK
FT                   AGNLLRSPHLLEPRLNPPKEIIDENDTKPLDWEDSPRIPDPNVQKPEGYDEKHGLPTIP
FT                   DPEAVKPENWDESVPVLIEDPDSTAPEYWDEEEDGKWLAKEIPNPKCKELAGCGPWSPP
FT                   RIPNKEYTGPWIQPMIDNPNYVGEWKPRMIANPHYYEDDKPSNLNKLVGGLGFELWSMS
FT                   DEILFDNIYLGHSIAEAERIGNLTFKVKYLLEDQHKRANKPKIQNEPVAPPKNFDELLL
FT                   DKNGNTFKQFYLFLQLFALRQFLDIKDFFYDFLRDPVYQITHRPIKFVLYCVVFVFVFT
FT                   VICGIGSVLLFMISNGGGGSHTYEILDEPRSNGPKIELLADDEDVNTIETAKSTGVNRS
FT                   ATEAIKK"
FT   gene            complement(<98321..>98704)
FT                   /gene="ECM1"
FT                   /locus_tag="PICST_9152"
FT   mRNA            complement(<98321..>98704)
FT                   /gene="ECM1"
FT                   /locus_tag="PICST_9152"
FT                   /product="cell wall structure or biosynthesis"
FT                   /note="Has EST support"
FT   CDS_pept        complement(<98321..>98704)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ECM1"
FT                   /locus_tag="PICST_9152"
FT                   /product="cell wall structure or biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_9152"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68204"
FT                   /db_xref="InterPro:IPR022784"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYN6"
FT                   /protein_id="ABN68204.2"
FT                   /translation="VSKHSRAARRGLLAEEGEAKDLSKVPKTESDEVKKSIIRTTIKNE
FT                   NLLAKKMENSKIRKSNQNKRKTSSLKHKLDRSDKLSGVLSTKIEQSIARAKYVQSARKS
FT                   GWDQINKSITIKNDIVLETKVTTG"
FT   gene            complement(<99878..>101731)
FT                   /gene="TFB1"
FT                   /locus_tag="PICST_49623"
FT   mRNA            complement(<99878..>101731)
FT                   /gene="TFB1"
FT                   /locus_tag="PICST_49623"
FT                   /product="RNA polymerase II transcription factor B 73 kDa
FT                   subunit"
FT                   /note="Has EST support"
FT   CDS_pept        complement(99878..101731)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="TFB1"
FT                   /locus_tag="PICST_49623"
FT                   /product="RNA polymerase II transcription factor B 73 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49623"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68205"
FT                   /db_xref="GOA:A3LYN7"
FT                   /db_xref="InterPro:IPR005607"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR027079"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYN7"
FT                   /protein_id="ABN68205.2"
FT                   /translation="MRLRLLYKNDGEDEKSLLLNFSNRPTMNNIKDALQTIVARSRTVI
FT                   KDTPTPATTVSDGNETTPGAITPTSTPTPSSVGASSSASTNGAGSLSFNTPESLSDASL
FT                   LRNFQLQQQYLKEDRNLRSIFTSSVIDNKLTPQLFWSTRLNQLRTYALTISQHRGPYNV
FT                   LSTIKPVATSDNQVNVNVTRDTINEIFDTYPIIRRAFTELVPSKFSEGEFWSRFFNSKL
FT                   FRRLRGDKINNSTNRGDVILDKYLYIDQTQKANEDKESATTSLDQTSKEPQSEQTSTAP
FT                   SLQNPQIKVNKFLDLLGNEEDNSQKLGNRPDLTMRFEDDGIKKVNLGQENEMIVLMKNM
FT                   NKLSSKMVEMSNAISTTQQSLTQPDEPDSLSQAEINEYQEELNLHDLNEVEESEFIRLS
FT                   INSNLDAKSSLRRGSEAQMNHFTPDELSSFFSSNKFKPLVNLSDTYDSKNADIEKSSNE
FT                   VTSLIKHNFRTFKLTTKDSHGVSYDDVKNLVDESLVQEIIRYNMTVVEFLSHFWKLFLN
FT                   GNNPTQLKRLFASLKNCRNDLTALKERATKKFDEMELVKNNEKLREKIIRSLQSCLEPM
FT                   EVSLDMACNEYVAAVRLAQKQQPQETESVEINDNGKRPLQQ"
FT   gene            <102572..>103015
FT                   /locus_tag="PICST_63252"
FT   mRNA            <102572..>103015
FT                   /locus_tag="PICST_63252"
FT                   /product="predicted protein"
FT   CDS_pept        <102572..103015
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63252"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63252"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68005"
FT                   /db_xref="GOA:A3LYN8"
FT                   /db_xref="InterPro:IPR014807"
FT                   /db_xref="InterPro:IPR042432"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYN8"
FT                   /protein_id="ABN68005.1"
FT                   /translation="PVTVDRELPDPFANQKKNRKYFVSYAIGITLACAIIFNYEKTRSP
FT                   ITNSTLYFLRRSALAKEHLGEGIDFRSSWPWISGPLNTVKGDIDISFVVQGSKSKGVLK
FT                   LKASRDTKLHPFEVHHFILEVTDSNGQAVEYDLTKDPAVEFDI"
FT   gene            <105337..>106446
FT                   /locus_tag="PICST_33243"
FT   mRNA            <105337..>106446
FT                   /locus_tag="PICST_33243"
FT                   /product="predicted protein"
FT   CDS_pept        105337..106446
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33243"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33243"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68006"
FT                   /db_xref="GOA:A3LYN9"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYN9"
FT                   /protein_id="ABN68006.2"
FT                   /translation="MVDSQSLTVGLAVGIPSFVIISVVLLLWLRNQRKQKKEDSVNDDI
FT                   DMDLRDDQSFNQFQEELHRPYAKGKAELNINTYSDPNKSSSTTQGESSTEKPYISSHGS
FT                   TSSSNIIDQPHVYATPPRPKYSNANNGTNNVNNNNINNLNNNLNNNINNTNNIHSKSPS
FT                   AYDFYETFIPILPGGGSPSTNNGNTAHHSNANSVHEAHSNGNLQSQLQQPPHIHDVAST
FT                   NNSSNDSLNGNDRSSLDNLAKQLTSPVFFEKLPSRATTVALKPRFPNMQSNNSSSEGLN
FT                   NRLIGDTTALNDNFIYEAPTVDVKKTELQAKDFQRSHLSREQTVKSHEDDVSSISASHA
FT                   EDVDSLVEPDVSRSSNDDEFVSDIDTTAS"
FT   gene            <107211..>108296
FT                   /locus_tag="PICST_33244"
FT   mRNA            <107211..>108296
FT                   /locus_tag="PICST_33244"
FT                   /product="predicted protein"
FT   CDS_pept        107211..108296
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33244"
FT                   /product="metalloendopeptidase activity"
FT                   /note="go_component membrane; go_function
FT                   metalloendopeptidase activity; go_process proteolysis and
FT                   peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33244"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68007"
FT                   /db_xref="GOA:A3LYP0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYP0"
FT                   /protein_id="ABN68007.2"
FT                   /translation="MFPISRAFGRQLGRPSTFSSRFQSVSPASFALRSRVFQSAPARQY
FT                   ATYNRFNGSSSSSSWNTTTFINLLTSRRTIYFGVGFLGFYVYNLNEAPFTHRRRLIWIP
FT                   YWLETKIGDFSYRQIMYQYGDKLVSSQDPLYGRISKIMNRLLSVALENNENQAQRHHLE
FT                   SLKWTIHIIKVDPREYPPNAFILPNGKIFIFSSILPICKNDDGLATVLSHELSHQLAHH
FT                   SSEQLSKQPFYIMLSTLLYTVTGISWFNDLMIKGLLEMPASREMESEADHIGCELLARS
FT                   CFNIGEAVQFWKRMAQAEEGFQARTGSSRLQEFFSTHPATDRRINDIQHWTPGLEIIKE
FT                   SSGCYEHQFGLFQEVSRNFFR"
FT   gene            complement(<108372..>109337)
FT                   /locus_tag="PICST_33245"
FT   mRNA            complement(<108372..>109337)
FT                   /locus_tag="PICST_33245"
FT                   /product="predicted protein"
FT   CDS_pept        complement(108372..109337)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33245"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33245"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68206"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYP1"
FT                   /protein_id="ABN68206.2"
FT                   /translation="MIIIRSSFGEVTLRNFPKLRHTRKFVKISGPIIGPPRKSYIANTN
FT                   ALQYIWNQKISLTTKYFGAIGSCAYTLVHVHHDVLITVCPPLAIGGYYLYKFFRKKQYN
FT                   REVNKILGTSTENENGIVRFKTYDESELGNVLKGIENEADHFKRQVVDVTERRIIDYII
FT                   NQRGEPKVKKFSALFMDENDQFSVNTNENEVESWITAKVKIPNAEDQTQFNEDLNFVKL
FT                   SLPLYSSKDITSRNRTGTIEVSLLQIFQEDIYDENGNLIKPKYIDYNISISVSQFNLLK
FT                   PDSLVIRYVEGEGILKSKLMLEDKEDDTKKEEEEEITVNI"
FT   gene            <109549..>110352
FT                   /locus_tag="PICST_49415"
FT   mRNA            <109549..>110352
FT                   /locus_tag="PICST_49415"
FT                   /product="predicted protein"
FT   CDS_pept        109549..110352
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49415"
FT                   /product="predicted protein"
FT                   /note="go_component nucleus; go_function nucleic acid
FT                   binding; zinc ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49415"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68008"
FT                   /db_xref="GOA:A3LYP2"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR019447"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR037321"
FT                   /db_xref="InterPro:IPR038254"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYP2"
FT                   /protein_id="ABN68008.1"
FT                   /translation="MARAEIGTAKYQSKKLKMAGLQKLKFYCQLCEKQCRDANGFKNHI
FT                   ASPSHQRKIQSLNDEGQGKTVVENYSEQFEKDFMRLLRINHGTKKINANKFYQEYILND
FT                   RDHVHMNSTKWSSLTSFIKYLGQRGLVRVEQGGSGNEDEFNLEIRLVDQSIEIQQNQKE
FT                   KLKAENKRSDEQLTNKFLEEQIRRGKESAKLNEESQPEDVQVPVTVQSGPIKVSLKSTG
FT                   ITKKLQRPSKSIFGDAASDDEVEADKKPEPKETKGKIKFGSIKKH"
FT   gene            complement(<110519..>113368)
FT                   /locus_tag="PICST_62908"
FT   mRNA            complement(join(<110519..112048,112088..112583,
FT                   112755..>113368))
FT                   /locus_tag="PICST_62908"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(110519..112048,112088..112583,
FT                   112755..113368))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62908"
FT                   /product="predicted protein"
FT                   /note="go_function cysteine-type endopeptidase activity;
FT                   ubiquitin thiolesterase activity; go_process
FT                   ubiquitin-dependent protein catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62908"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68207"
FT                   /db_xref="GOA:A3LYP3"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYP3"
FT                   /protein_id="ABN68207.2"
FT                   /translation="MNSEVNDKSNQQYYTKVINHEFRNLQLDPELASKSLFDLIDYCEL
FT                   LYEKSATAFSSGDHHNGLKNYIKGYLIFNYFINSFIMLHFKGFDAFVESNEQDFIIYLN
FT                   VFAFYNADDIIRNSSHTVSSATLRGYIKKYLVDSNLLSFNVEELYAWLHEYIKYLKEKD
FT                   RSMVEINISSGDEMRSDGDLFVETATSSSTRQTSNGNSSITNDSVSEFKHRFPSLNGKN
FT                   DTSLFGSKKLPPPSPPNIPHPIPKHFSPSLLPPHSPPPPPPHSAANTLQPNRASTFPGS
FT                   PTASAPYPPDEITSRSPIPSPISPGLRSPVAPELANDTDEWYFSNPQKSPTDANPNTNS
FT                   YSNLQNNSGNISHRPPQTIPIARPVTSPTNNGNNNHYMNNNNVFHNGQQSNNPFPNYPQ
FT                   QQEVGQQVNQQGANGYYDNNGPSSVQHFGAPRSSVPQHVQMQQYQIKTQKQQYMQEYSV
FT                   CGLRNFGSSCYINSTIQLIFGVSLFKSLFINSAYQRYVKDPKYLRLISSSKLNSHHKDS
FT                   ILLSEAISALLRTFSQHGSVSIAPTKFIRVTSLLKPDFNIPYEQQDAQEFLLFVLERLH
FT                   SELSNKSIETNYELEDYIRKWDINVNMKDRNEYLKWYLSLVKSEGTSPVHDLFQGHLQN
FT                   KLTCNSCGYESISYSPFTILSLPIPSSHSSKNVVNLADCLRYYSQDEVLSGENAWNCPK
FT                   CSKNGDQVSASSVLDNHPVFVNKKSGIFKLGRRSKSPSSQTSTKTTTSSIHSNISTKSL
FT                   NFIKLPQILIIQLSRFSVFNLTDKLDTYIQYPLKLKFNNDGHEIVYKLSGLINHFGNLK
FT                   SGHYTSIVNKSTVNQNLGSNLDNLKVPYWCLFDDENVKVNLPHGSITQPGMGAINSKDV
FT                   YVLCYERV"
FT   gene            complement(<114777..>115733)
FT                   /locus_tag="PICST_49245"
FT   mRNA            complement(<114777..>115733)
FT                   /locus_tag="PICST_49245"
FT                   /product="predicted protein"
FT   CDS_pept        complement(114777..115733)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49245"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49245"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68208"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYP4"
FT                   /protein_id="ABN68208.2"
FT                   /translation="MEDKTPPELPQNFGRISIRDATFRIYSHNVKNGGHKALVPGEEPW
FT                   TKRFRKITASIHFNAQRDSIVCLQEVYKFQLNDIMKELNRYSPNEDWKYYGVGRIDGME
FT                   LGEFVPIIYKESEWELVFSDSLWLNEKNTRSSLTGWDAQYPRIVSYVTMKHKGSENYIN
FT                   VFNTHLDHVGEKSKIGSVKLIGQTMKSINSWPSFLCGDFNTEPDDAAFKQLEESFSDVS
FT                   TLSTPFNRYGHEKSSVTGFEGEVLLQGGQSIDYIFAPKYTAKMSDKPQCDSIDVNSAAN
FT                   KLFLRLQGFGMLHSKFGGSYMSDHRPIVADFSLSGKC"
FT   gene            complement(116727..118274)
FT                   /locus_tag="PICST_85155"
FT   mRNA            complement(116727..118274)
FT                   /locus_tag="PICST_85155"
FT                   /product="predicted protein"
FT   CDS_pept        complement(117029..118081)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85155"
FT                   /product="general RNA polymerase II transcription factor,
FT                   TFIIB subunit"
FT                   /note="go_component nucleus; transcription factor complex;
FT                   go_function RNA polymerase II transcription factor
FT                   activity; go_process regulation of transcription,
FT                   DNA-dependent; transcription initiation from RNA polymerase
FT                   II promoter"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85155"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68209"
FT                   /db_xref="GOA:A3LYP5"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYP5"
FT                   /protein_id="ABN68209.2"
FT                   /translation="MAPGSAATAVSSNGPEPFLGPNLNVTLTCPECKIFPPDLIERFSE
FT                   GDIVCGSCGLVLSDRVVDTRSEWRTFSNDDQNGDDPSRVGDAGNPLLDTEDLSTMISYV
FT                   PENTRVGRELNRAQSKSLVDKKDNALAAAYAKISQMCDGYQLPKIVQDGAKEVYKLVYD
FT                   ERPLRGKSQESIMAAAIFIGCRKAKVARSFKEIWALTNVPRKEIGKVFKIIDKVIQEKN
FT                   AANPNALMFNQDNMQTTQTTAEDLIRRNCSHLGLNAQVTNGAEYIARRCKEVGVLAGRS
FT                   PTTIAATVIYMAALVFGIDLPPSKISDKTGVSDGTIKTSYKVMYEEKEKLIDPYWIETG
FT                   RVKMENIPKS"
FT   gene            119175..120884
FT                   /gene="SSZ1"
FT                   /locus_tag="PICST_85151"
FT   mRNA            119175..120884
FT                   /gene="SSZ1"
FT                   /locus_tag="PICST_85151"
FT                   /product="regulator protein"
FT                   /note="involved in pleiotropic drug resistance that forms a
FT                   ribosome-associated complex similar to HSP70 family"
FT   CDS_pept        119178..120815
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SSZ1"
FT                   /locus_tag="PICST_85151"
FT                   /product="regulator protein"
FT                   /note="DnaK homolog, interacts with Zuo1p (DnaJ homolog) to
FT                   form a ribosome-associated complex (RAC) that is bound to
FT                   the ribosome via the Zuo1p subunit heat shock protein 70
FT                   homolog; involved in pleiotropic drug resistance that forms
FT                   a ribosome-associated complex similar to HSP70 family"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85151"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68009"
FT                   /db_xref="GOA:A3LYP6"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYP6"
FT                   /protein_id="ABN68009.1"
FT                   /translation="MSAVIGITFGNTSSSIAVATQDGKVDVIANPDGDRAIPSALSYVG
FT                   SDEYHGVQAEHQLVRNAKNTIINFRDFIGKSFDEAETAAPYHVGAPAVKTADGKIAYDI
FT                   VRDGNNELITVDEISKRHFKQLKDAAEDYIGKEIEGVVLTVPTDFNEHQRQQLTSIATD
FT                   AGLKVLQLINEPSAALLAHLSADEDRLLQDKIYVVADFGGVRSDAAVISVRGGVLTILA
FT                   TAHEYGLGGDKLDEALAEYFAKEFEKKTKVNPRTNARSIAKLKAESIVVKKTLSNVQTS
FT                   TCSIESLAEGLDFHTSINRLRYELAARQPLSEMTSFVEKAVAKAGLDNLDIDEVLLVGG
FT                   ASHTPKLASNIQFIFPETTTVVAPALDPKALNPTELVARGAALQASLIESFDEDEIKES
FT                   LQPIVVNTQHLTKPIGIKDAEGNFQSILVAETAYPIKRSIQVTNGESASVVVELYEGKR
FT                   TIKETVVEAEPVSDEDSEDDYSDDEPEVKKELVYEAGSKLAELTLKDLKPNSKLEVTVN
FT                   ITQNGTLHLSGRELKQGSVAVKGEITSA"
FT   gene            121241..>123187
FT                   /locus_tag="PICST_85276"
FT   mRNA            join(121241..121524,121567..121591,121739..122290,
FT                   122333..122537,122694..>123187)
FT                   /locus_tag="PICST_85276"
FT                   /product="predicted protein"
FT   CDS_pept        join(121277..121524,121567..121591,121739..122290,
FT                   122333..122537,122694..123187)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85276"
FT                   /product="GTPase-activating protein GYP1"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85276"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68010"
FT                   /db_xref="GOA:A3LYP7"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYP7"
FT                   /protein_id="ABN68010.1"
FT                   /translation="MGKKKQEMSQVYNNSNNEFIFGENGGKGKHLSSFLKNLSLTGTSS
FT                   TSSVHSANTDNIHEINSNIYGTLGYSSSKVSSNQSNSGPPPKRSVSYKDLDDDWDADID
FT                   VSTDSVVRRSPDNRNLSRVTKVESNTSSRSSFNLQPSPMLDSLYPDLTLPATNSSVNLN
FT                   SQKPTNEESLDVEDYRTTMEINRLNQISSRNNKFRNILISDSIVNLQDLRKLAWNGIPS
FT                   ELRALTWQILLGYLPTNRARQASTLKRKRQEYLEGLNASTIDFEDTAPSNSSSLYHQIK
FT                   IDVRRTNQSIKLYGYPETQQSLRKLLYLWAVRHPASGYVQGINDLCTPFFQIFLLNYIW
FT                   QLQQRVLSILEADTYWCLSRLLENITDNYIHEQPGIIRQVGDLRNLISKIDLELLNHLD
FT                   HEGVEFLQFSFRWMNCLLMRELSISLIVRMWDTYLSETPLGFNNFHVYVCAAFLIKFSN
FT                   DLKEKDFQEILLFLQNPPTGHWKEKDIELMLSEAFIWQSLYKNASAHLR"
FT   gene            123590..124789
FT                   /locus_tag="PICST_73792"
FT   mRNA            123590..124789
FT                   /locus_tag="PICST_73792"
FT                   /product="predicted protein"
FT   CDS_pept        123644..124621
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_73792"
FT                   /product="tetrahydrofolate dehydrogenase/cyclohydrolase"
FT                   /note="go_function catalytic activity; go_process folic
FT                   acid and derivative biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73792"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68011"
FT                   /db_xref="GOA:A3LYP8"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR035812"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYP8"
FT                   /protein_id="ABN68011.2"
FT                   /translation="MASTETVTPKPAGRTILASTIAKPFVEEVTGGLTKLDFKPKLVGF
FT                   LANDDPAAKMYANWTGKTCESLGFHYELIDVNKNELENELIKANNDDAVNGIMVYFPVF
FT                   GDSQDQYLQQLISPEKDVEGLNFLYYHNLYHNVRFLDAPTNEQKSILPCTPLAMVKILE
FT                   YLGVYNKILHYGNRLYGKKILVVNRSEIVGRPLAALLANDGATVYSVDIHNVQQFTRGD
FT                   DLSAQRHKVIDLDQNEYSIEKIAPLCDVIITGVPSDNYKFPTEHVKYGTVVINFSSSKN
FT                   FNDDIKLKAGLYVPSIGKVTISMLLRNLLRLIENKQIRLAKEKK"
FT   gene            <125454..>127703
FT                   /locus_tag="PICST_63672"
FT   mRNA            join(<125454..127202,127314..>127703)
FT                   /locus_tag="PICST_63672"
FT                   /product="predicted protein"
FT   CDS_pept        join(<125454..127202,127314..127703)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63672"
FT                   /product="predicted protein"
FT                   /note="go_component nucleus; go_function DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63672"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68012"
FT                   /db_xref="GOA:A3LYP9"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYP9"
FT                   /protein_id="ABN68012.2"
FT                   /translation="KRVEPVDPLAISESLGVQTFRRETRRPFTKEEDDRLTELVNRYYG
FT                   DKVHDLNLDSVDWEFLSKELEPNGSRKPKMCRKRWANSLDPNLKKGKWSPEEDELLIRT
FT                   YQKYGATWLRVASEIPGRTDDQCAKRYTEVLDPSTKDRLKSWTQEEDLKLISLVKIHGT
FT                   KWRTICTKIAGRPALTCRNRWRKLLTDVVRGKSSDFIKRQVQSITDGLKLEATASISNE
FT                   EDQFTKPAASGSMENSTLSQTSKSIQAGSSSISSTIASVLSANSVGTVSASPSVSASTS
FT                   VSGIAEQAGDQVALASRSKPEQRTSSESTREVEWRYTIMGGEDADLPHKRLFNSENGGA
FT                   IKNQEMVHYLISYAKTHGLNITVHQHIHHHYSPPQHAAVDVNGYQQTYQSLLSPVNAIN
FT                   QTDGSHRDTISNASGSPADGRSSSAYLLEPETQLNRHQHFNYLPPTTEVPKLNSSQNSP
FT                   HDNPSTHHHHHHHHHHHHNSLSKRNRILNESESVAKESDLLKILNQSQIDMTDTANERE
FT                   KTPGGHPLTPLTQAVEMAAAAEANSKKRKNTDETRNSKKLHYEVPDEEGLDFWETMRNL
FT                   TDLPNHQSQNHQSPHQQQQLHIHQQSIYGDDHQKQVSHHQQYFSNNSNVQTGEQTIPEG
FT                   KDSHDIHKNGEAEAKHEEIDEDVDPEVLNAYGLFYNVYTREGSVLPEGQPQNQQPPAPG
FT                   AVYDAWGGGFGIIPFNPS"
FT   gene            <129787..>132435
FT                   /locus_tag="PICST_63564"
FT   mRNA            join(<129787..129965,130155..130231,130259..130695,
FT                   130729..>132435)
FT                   /locus_tag="PICST_63564"
FT                   /product="predicted protein"
FT   CDS_pept        join(129787..129965,130155..130231,130259..130695,
FT                   130729..132435)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63564"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63564"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68013"
FT                   /db_xref="GOA:A3LYQ0"
FT                   /db_xref="InterPro:IPR024260"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYQ0"
FT                   /protein_id="ABN68013.2"
FT                   /translation="MLNKSIISSLNKSLKAKQKIISNREPHPKNPTLISDILNTSPQST
FT                   IFPNNISSTNNSTLDQSNSNSNAAPVATLTEVSNDNSNDAASKPPPSKGKQKKISKQNS
FT                   TRTDFFAAKLASAVDDVESSDSDETFVYENNNDFETMSTTMATPNVANDASSVHGSVLA
FT                   SALQMGGAPSFHSPSIAEGHTGGESIAVQPVESIHSTHSSKLPKIQAHATSNRPPSIAN
FT                   SFTSNYLESDKRPAYQRSFSSYSQDEHPGAKLQVPCERSSNNISPSGALDEINSQSHAP
FT                   QGLGIEGRSDHPSQSNSHVARSINDGYNDDNFSYNEVEDVEIDDEMSTDGDFYAQRNAS
FT                   ANPQFGGVSGTTNITNNQASQTNNSLTSRSTSKKNYKSSTSSSKLRSTTSKLFDKKGSQ
FT                   PRRYSIIPDDIDIEDFDDELIYYDNNIRFPYNNSNVNEASPLMSQGHRLPHYRSLNLNF
FT                   PGAKRPSGLKKKRYLSTGQSLIPGAENSGANSPSNVSSHNADIFPFPYQEPQQNYYYDF
FT                   DEYDEESQRNGSNDKDQINRSISRGTKNGLYNHNLTASEGHFFLPRKQSSEFNYHRINC
FT                   IKSFIYTLVSILVILAIGFVMGFVLATTKDLTKVSITSIENAVVSQDELVFNIVVEAFN
FT                   PGWFTVEIEDVNLDLFAKSGYLPDASVQSLEEGGLDDEMSSLANGVETVLLGTVYTLES
FT                   PMSFKGGFFSRESVIQSGEIKLLTPGKNLTTLNNFAKGKKGHNGNSTEPDNSKKWEIIS
FT                   KNPFDLVVRGILMYTLPMGKDTRSVVVDKIGYIDPTQIFSSNVESS"
FT   gene            complement(<132485..>134014)
FT                   /locus_tag="PICST_49761"
FT   mRNA            complement(<132485..>134014)
FT                   /locus_tag="PICST_49761"
FT                   /product="predicted protein"
FT   CDS_pept        complement(132485..>134014)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49761"
FT                   /product="cytochrome P450 1A1"
FT                   /note="go_process electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49761"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68210"
FT                   /db_xref="GOA:A3LYQ1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYQ1"
FT                   /protein_id="ABN68210.2"
FT                   /translation="ISGVFKIPGYPIVGNLFQVINNPAQVFMKWSEVFNVSLFQIRFGS
FT                   RSVVVVNSFEDVTRLWIKYSCSNNSRPVSYTFHQVVSSTRGFTVGSTPAGESYKRKRKS
FT                   ISQHLNHRAVERSKSTLDKEVEYMINQMISRNHELSGPPSVNMFRNSKCELADIDMKIY
FT                   FQQFALRSSVFFAFGIHLDCFGKDSKLCNEIIEVESAIMKFRSPIANLEDFLPILRYFP
FT                   GKFKKAAEFRERRDRYMNKLYKTMIEGIVVGNADAVASIVGTIKIEQDQQMNKLTEEEI
FT                   QSICLTLVSAGLDNTALNINHLMGHFSQPFYGAALQKKAYDALLAGSNGDICQAWDDAV
FT                   DVKCPYVIALVQESLRYFTVLPLGLPRITTKDIVYNGAFIPKETILIMNAFAANHDSCV
FT                   FQSPYEFIPERWLDAETGELIDKHDLIHLSFGAGSRMCAGIQLAINEMYTFTSRLVLYF
FT                   KIKPPTCGAIMDLDPFRNNENPSATSFEPKPFKVRLEPRYSDSLYNKLRRS"
FT   gene            complement(134438..135211)
FT                   /locus_tag="PICST_66033"
FT   mRNA            complement(134438..135211)
FT                   /locus_tag="PICST_66033"
FT                   /product="predicted protein"
FT   CDS_pept        complement(134574..135044)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_66033"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_66033"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68211"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYQ2"
FT                   /protein_id="ABN68211.1"
FT                   /translation="MFFLVLLIAIVLVAIVLYLPYASGLATYKVEKPKRKTDPVAVAKK
FT                   HDDYDQFGYVPPDEVEQASSTSSSVRARASALKEKINVTPDDIPLKIKLNTPEASGLRR
FT                   RGKEKLDLDTDPNNYDYDIDDLINEENEIAVKEQQQDFYRNQEIGKEKEEMV"
FT   gene            <135373..>135891
FT                   /gene="FRD1"
FT                   /locus_tag="PICST_63502"
FT   mRNA            join(<135373..135400,135422..>135891)
FT                   /gene="FRD1"
FT                   /locus_tag="PICST_63502"
FT                   /product="Frataxin homolog, mitochondrial precursor
FT                   Contains: Frataxin homolog intermediate form"
FT   CDS_pept        join(135373..135400,135422..135891)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="FRD1"
FT                   /locus_tag="PICST_63502"
FT                   /product="Frataxin homolog, mitochondrial precursor
FT                   Contains: Frataxin homolog intermediate form"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63502"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68014"
FT                   /db_xref="GOA:A3LYQ3"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR017789"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYQ3"
FT                   /protein_id="ABN68014.1"
FT                   /translation="MFRQVLRYSVRKYAPAIAPRATVLSSPTRHVSAMATRAYSLSTSG
FT                   EDIEDKIDQISVNEYNSISEEYLESLADSLEDLSEKYPQIDCELSHGVMTLTIPPHGTY
FT                   VINKQPPNKQIWLSSPVSGPKRYDLIGGQWITLRDGSALTELITEEVSSALGTEVSLDI
FT                   EG"
FT   gene            136828..138080
FT                   /locus_tag="PICST_68255"
FT   mRNA            136828..138080
FT                   /locus_tag="PICST_68255"
FT                   /product="predicted protein"
FT   CDS_pept        136896..137765
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_68255"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68255"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68015"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYQ4"
FT                   /protein_id="ABN68015.2"
FT                   /translation="MSEGYDRQAPAVPEGEGSIPVNQSGSESSNQQLERPRLPQLPEGW
FT                   IAQWDDEYNHYFFVNTVTGESQWEIPESSVPGASEARSSEFAPSDSNIADNESAERGIG
FT                   GDGTGERGLGSVVGSLLSGGNSGHQSGGTSGLISLVSSLASSKTSGGYGGGYGGGYGGG
FT                   YNRPSHAPGSGGGAGSLLGLLAGGSSGGYGGGYGGGYGGGYNQGGSGGLLGDLLGGGGG
FT                   GYNQGYGNQGYGNQGGHHGGHHGGNGGFGGGFGGGFGGEGRHGGGFGGEGRHGGEHHGG
FT                   GRHNGGGW"
FT   gene            138294..139835
FT                   /locus_tag="PICST_68256"
FT   mRNA            138294..139835
FT                   /locus_tag="PICST_68256"
FT                   /product="predicted protein"
FT   CDS_pept        138439..139764
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_68256"
FT                   /product="zinc finger protein, MIZ type"
FT                   /note="go_function zinc ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68256"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68016"
FT                   /db_xref="GOA:A3LYQ5"
FT                   /db_xref="InterPro:IPR004181"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYQ5"
FT                   /protein_id="ABN68016.2"
FT                   /translation="MTRNSTSDAVNVLPNAVQVISQVAGAGSSQRREIHVKIRLPKQEL
FT                   SKLEIEDVVEDDDDDEDSILRSSHIIPTLPTTFEYESEDPFSSEGDEFLLDAELDKAIK
FT                   SVFGDTPASDTSSPSTKDHPRITTRKPDFQKESTPLRSSQRLREKIQKQEKFERQIVKE
FT                   SVVVHKDQHQVKIVDGYKPVPKHILPMIEQEIGAMNDEFAIVDKFIFSLKDPLGASKIK
FT                   LPVKSMYCIHFECFDFNNFCLFNKIPPGVKLLVKKDLAKKSFESIKLRKRVHKEVKSEY
FT                   VTIISDPKAYTAKFIAPMGPIYKCPICDRSFPLSELVMGDAYNYFVKSTPVDAERVELL
FT                   DMNRYKVLDDKRIPKAVEEEIIVLSDDDDDNNNGIVNANYDDKVNANQADTVGLASLQN
FT                   LSYDSGDDLFDDGLDEEILNLSESDYQRFGQGSSYDDPVTID"
FT   gene            complement(<139965..>141674)
FT                   /locus_tag="PICST_63037"
FT   mRNA            complement(<139965..>141674)
FT                   /locus_tag="PICST_63037"
FT                   /product="predicted protein"
FT   CDS_pept        complement(139965..141674)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63037"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63037"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68212"
FT                   /db_xref="InterPro:IPR025340"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYQ6"
FT                   /protein_id="ABN68212.2"
FT                   /translation="MYRRPKIASKSPFKHPWWAAYTGVGPTIKCKDEWLIIEISNSIRQ
FT                   KPNWKAKYKDPTISAKWKQEVKDFYNDRTKLIDEVIDYVFLELEWYEKTEHDFPGFKGK
FT                   EYSIGCDDKIVFADKAIDPQLAATFKRDIDKLAESFGGDLDYHPKTDNKVIDLVHPSLF
FT                   PLQYGITPIYSSNKNQVEVVEYEEKIEFFKNAVMPFGISKNFQWLPALLSFNKASSSFE
FT                   FISYINNLHPAKHAKLYSSIQAIFNSVLPGLNYILSKAVSKEYIRIEIPKYNDAYSDEY
FT                   KQKLEDIWNGEDAVADEIWDELQDNRVNYLKTFTPIYDQGPIIDKEIDVVRDFQKLKVI
FT                   VKLANIELTPERPTYEGGAWHVEGTINEDIVATVLYYYDSENITESKLKFRTGFEDPEY
FT                   EQNDDDYGREIFGVNDEDLMVKELGHVISREDRVVIFPNIFQHQVDTFELADKSKKGHR
FT                   KILCFFIVDPYNDLVVTTDQVPPQQKEWWDDLGLFKEHDEDAKAGPLNSTLISDNIMKQ
FT                   ILDLKKGNIWPIDLTSAKKVREALMDERTAADNDPQVSDLGAFKRQFSLCEH"
FT   gene            143170..144588
FT                   /locus_tag="PICST_85256"
FT   mRNA            143170..144588
FT                   /locus_tag="PICST_85256"
FT                   /product="predicted protein"
FT   CDS_pept        143220..144503
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85256"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85256"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68017"
FT                   /db_xref="GOA:A3LYQ7"
FT                   /db_xref="InterPro:IPR029427"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LYQ7"
FT                   /protein_id="ABN68017.2"
FT                   /translation="MLRQNRAGLLLVRKLHCSVVVMKPFDISQLARDNSSEKRNQGFNI
FT                   ESLIKNRMDLETDKVVSENATAAPNRFATMFDKEKRQAQKKTGPRRNSESTHHHNAGPY
FT                   PKKPYGKTNSGSKTRPEIKTRPHKRVVRFEFKTGSDQAQAALKSIIAKVHALSTNYKIK
FT                   FIDPVSGEVKLSNLVDIANSTDLREAGLQLLPCKEGDLPSIKKVSTREMLKLYSDELAA
FT                   EKEKALLQSGSVAAQRALNQRLKSERKKSAAKLLNIFWNISLGDLKNQKKTELANRLCK
FT                   GETFTIYLKRKGREVATPEGEGDEESETLNMYDIRRSLAHDEDALNIETQRRELISQQL
FT                   FCILDEMPCTYEVEGQKENKLKVTVSPRQDAVKQSISPSSEECTLSAKDLKKQRQLQKQ
FT                   KEREELLKLKKQEKEDNLDSLYSFKIED"
FT   gene            complement(<144753..>146414)
FT                   /locus_tag="PICST_63490"
FT   mRNA            complement(<144753..>146414)
FT                   /locus_tag="PICST_63490"
FT                   /product="predicted protein"
FT   CDS_pept        complement(144753..146414)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63490"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63490"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68213"
FT                   /db_xref="GOA:A3LYQ8"
FT                   /db_xref="InterPro:IPR005178"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYQ8"
FT                   /protein_id="ABN68213.2"
FT                   /translation="MTSIAIAAISDSSARLPKWVNNICFYSCVLATLIIISCIFLHLRN
FT                   YRKPFQQRLMLRIQIIVPLFALSCYSMLINQESPFNKFILEPVREVYEAFVIYTFFSLL
FT                   TDMLGGERNIIIMTSGREPVKHPGILSYILPPLDISDPYTFLGIKRGILQYVWAKPIIC
FT                   FSTLLSQGLGLYDVNSMGPKSIYLWLTIIYNGSVTMSLYCLAIFWKILWNDLKPFNPVG
FT                   KFLCVKLIIFASYWQGVILAILNVFQVLPGSDESEEKGSIGVCIQNGLLCVELIGFALG
FT                   HWFAFSYHPFTISQIPYGRLKFKYAFKDMVGIKDLIHDFKLTYYGDYYKDYKQFDSVEA
FT                   LIAHPSSRGRMSRINQGLRYHSDGKQKHWLSNQVSTLQQNNTHIRSTSEIAALPNSPPQ
FT                   LNTTNSIRSSNEYSASLNSTGTSMRAIYPGSPKNGSPPESPVVSGSEQLQFISEILRSD
FT                   NFLSSINYSKELLDEDELYYQNACSEVPNYKLDQPEIKRLLNYPIVDEMIGGHAYGYKV
FT                   RRLRQERSYRQSSRDSEDQILNKVNTNESYRYGSIV"
FT   gene            complement(<146999..>148945)
FT                   /gene="OCA2"
FT                   /locus_tag="PICST_33265"
FT   mRNA            complement(join(<146999..147870,147922..148331,
FT                   148647..>148945))
FT                   /gene="OCA2"
FT                   /locus_tag="PICST_33265"
FT                   /product="protein kinase"
FT                   /note="Has EST support; similar to nitrogen permease
FT                   reactivator"
FT   CDS_pept        complement(join(146999..147870,147922..148331,
FT                   148647..148945))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="OCA2"
FT                   /locus_tag="PICST_33265"
FT                   /product="protein kinase"
FT                   /note="go_function protein kinase activity; ATP binding;
FT                   go_process protein amino acid phosphorylation; go_function
FT                   protein kinase activity; ATP binding; go_process protein
FT                   amino acid phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33265"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68214"
FT                   /db_xref="GOA:A3LYQ9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYQ9"
FT                   /protein_id="ABN68214.2"
FT                   /translation="MFSSSSTSLSRKDGAANGAPSASAPSHRSFLRSRNSSGSISNRSS
FT                   RSGQSEKFDNAENHGNHHSDIISNTSNNPNTSYQSNDTASTDTTGDHEFHNANAERFLK
FT                   KLKHTDSRASTTSTKGKSSATSSPTANTVPPPLPDSTTSDLFKKYGPIGKLLGTGASGS
FT                   VNLVTAKDDPTQIFAVKKFRSRMPQESETDYKVKVKNEFKIGDYLKHENLICTIELIKD
FT                   YSSKSSANSSSTSIKYYIVMEYCPYDFFNLVMSGLMSTEEVCCYFRQIVSGVAFLHENG
FT                   LAHRDLKLDNCVVSEFGILKLIDFGSAVQFRKEITDPNASHDDLVDEQYTLVKAKGIVG
FT                   SDPYLSPEVLASPSEGYDPRAADVWSVAVIFCCMILKRFPWKIPRISDPSYRSFVGAPS
FT                   NASEDPVTVMQNSVSEMTVSSSVKSTRNGHHSQGPERLMRLLPEASRELVRRMLILDPA
FT                   NRILMADVLQDDFINSIEQCHMFVDDDNGNEIFVPVSNHTHHLVTEEDLQKLNQEKERV
FT                   KKLKNAGMA"
FT   gene            complement(150533..153189)
FT                   /locus_tag="PICST_85080"
FT   mRNA            complement(join(150533..150773,150867..152747,
FT                   153147..153189))
FT                   /locus_tag="PICST_85080"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(150602..150773,150867..152743))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85080"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85080"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68215"
FT                   /db_xref="GOA:A3LYR0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYR0"
FT                   /protein_id="ABN68215.2"
FT                   /translation="MSKSKLSSRSNHAVPLTSGNAIAKLVFILSQLVKVTHALPVFNKR
FT                   VHAAVSHPDVDATTSSMTAEEFYANLFTSVFLVLAGGVFAGLTLGLMGQDEVYLKVIAT
FT                   SGEPHERRHARKVLSLIGRGKHWVLVTLLLSNVITNETLPIVLDRCLGGGWPAVVTSTA
FT                   SIVIFGEIIPQSICVRYGLQVGALFAPFVLVLMYIMYPIAYPIALLLDHILGEDHGTVY
FT                   KKSGLKTLVTLHKTMGVERLNQDEVTIISAVLDLKEKSVSAIMTPMDRVYTMSADTLLD
FT                   EKTVEEIFNAGFSRIPIHLPNEPLNFIGMLLVRVLISYDPEDALPVASFPLATLPETAL
FT                   DTSCLNILNYFQEGKSHMIVVSEHPGEPVGAIGVLTLEDVIEELIGEEIVDESDVYIDI
FT                   NKNIKRKNPGPLSKRNLTSYLHNLYQRSASTSKRNSLDVSAQSPGQASTPQPSQVQVPD
FT                   LATRLSTTNGNNLVDTKNWKPKNPAANPLETNKSFVTIKRPNAETIAAIPLPNRVGAPG
FT                   AYGAVFSTEVGAIEEAVRRASVDEEAREDITAERADDIRAHEHEVVPMAIPVTESQESR
FT                   IYRTGGIIESVINVQGVHKTIIENVSDEDEVLDINDIENGEIDQISASSSSVIAVDGED
FT                   EEAQGLLKNGHDKGSRNSSVSESSHHRRLSMWDKIRGNTSSNGGGSS"
FT   gene            <157023..>158198
FT                   /gene="HYR5.3"
FT                   /locus_tag="PICST_17369"
FT   mRNA            <157023..>158198
FT                   /gene="HYR5.3"
FT                   /locus_tag="PICST_17369"
FT                   /product="hyphally regulated cell wall protein
FT                   Exo-alpha-sialidase"
FT   CDS_pept        157023..>158198
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="HYR5.3"
FT                   /locus_tag="PICST_17369"
FT                   /product="hyphally regulated cell wall protein
FT                   Exo-alpha-sialidase"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_17369"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68018"
FT                   /db_xref="InterPro:IPR021031"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYR1"
FT                   /protein_id="ABN68018.2"
FT                   /translation="MLFLDLYFVAVLFSIATVWAKTITEDTIDRGAVAIDADETIIVDG
FT                   VYWSLVDNDYTNFAGNVDVGEGSGFYISNTSPSSMYVAILSGSFVNDGITSWNAIEAIN
FT                   APTFNIDGFNFINNGEVYMSADGSTGNPSMGITTTNFDNNGLLVFYQNYRTGNSVELGD
FT                   DLLTINNNGQICLHNKLYAQRTSIAGTGCISAVDDSSIFIQYSALDIDTNQVFHLQDSN
FT                   SNLRAAAAITPKTYTVAGFGNGNKIGLDFALQTLNPWTYDPVSGILTLRSTLLSQRFNI
FT                   GTGYDPALFSITTESGLGLSTVTRGALTYSGPPPNAIPEVCQPCPVPPEAPGMDPIEYT
FT                   TTIVTTNPDGSICTEVADVLVSTDADHIWYTTTNSVQTDCLAATIYTTTFTT"
FT   gene            complement(<164892..>166529)
FT                   /gene="NAR1"
FT                   /locus_tag="PICST_33268"
FT   mRNA            complement(<164892..>166529)
FT                   /gene="NAR1"
FT                   /locus_tag="PICST_33268"
FT                   /product="nuclear architecture related protein"
FT   CDS_pept        complement(164892..166529)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="NAR1"
FT                   /locus_tag="PICST_33268"
FT                   /product="nuclear architecture related protein"
FT                   /note="with sequence similarity to with homology"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33268"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68216"
FT                   /db_xref="GOA:A3LYR2"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LYR2"
FT                   /protein_id="ABN68216.2"
FT                   /translation="MSAILSADDLNDFISPGVACIKPPAQNSDQKFNSLNENGEVEIQI
FT                   DSEGNPLEISKIDGKQTNLSPAQISLADCLACSGCITSAEEVLVAQHSHEELIKALNEK
FT                   VDNNSTKVFVASISHQSRASLATAYNLSIEEIDKLLINLFINQMGFKYIVGTSIGRKLS
FT                   LINEAQNLIEKKESEFDGPVLSSICPGWVLYAEKTHPYVLPRMSTVKSPQQITGCLLKT
FT                   LAAHELGVTRNDIYHLSIMPCFDKKLESARPEKYGEQNTSNDVDCVLTAKELVTLLEQH
FT                   SDKFQLIPPQAHTITNSAIPVVDLYSKCAPRTWPLVQYSWSNDSGSASGGYGYNYLKMY
FT                   QNHLIMKHPTKYQQEGFSIDYVKGRNTDLTEMRLMYGSEKLASSAIVNGFRNIQNLVRK
FT                   LKPTVKPGSTTGKGNALVARRRARVAGGITKASSPAGSDESADASKCDYVEIMACPNGC
FT                   INGGGQINPPEDVSEKDWLSASLEKYNSIPLLDLAAMENVDTVAEIMQWSCLFREEFGV
FT                   SENRLLKTWFNEVEKPTDSASILLGARW"
FT   gene            complement(<167026..>168318)
FT                   /locus_tag="PICST_63445"
FT   mRNA            complement(<167026..>168318)
FT                   /locus_tag="PICST_63445"
FT                   /product="predicted protein"
FT   CDS_pept        complement(167026..168318)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63445"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63445"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68217"
FT                   /db_xref="GOA:A3LYR3"
FT                   /db_xref="InterPro:IPR018827"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYR3"
FT                   /protein_id="ABN68217.2"
FT                   /translation="MDMDEGERKQFHPINPESKTFHWILTLALLLVLPSLSSVLAFADR
FT                   LHWSLLLQCVSTGYSVFESLFLDFPDNVDNHENRTSKGTSWFLSALLGATIFVGTLING
FT                   SNLVINKFYPHWQSRGEYGFTYKIYKTLSFLAVLTGWVRVCMAPVALFGFCYGKHTGQC
FT                   IAHGIMGSAFILYSFVLSFVLVVPWIRTHQLHNSSNLKSQEFYDSTVMCVWGIVNTFTE
FT                   HRWGTEDWSMGDYQHTAMGIIWWSGGLLGMYLSMKNRRTFIPSALLVFTGYSMSQHSQH
FT                   LEISTKVHSLFGLALMGAGVTRVIEISFLLHDKACSETGRILSFQYMPPFCLTLAGILF
FT                   MSATEEQLQLVHDLGSDHSAYILVVSSAAFLIFLWNQLLLALYLRLVGYDENGELSGSG
FT                   EYESVHARQAEDFELGDLSEDDTPVGSGGSG"
FT   gene            <169255..>171975
FT                   /locus_tag="PICST_14973"
FT   mRNA            join(<169255..169696,169739..170835,170902..>171975)
FT                   /locus_tag="PICST_14973"
FT                   /product="predicted protein"
FT   CDS_pept        join(169255..169696,169739..170835,170902..>171975)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_14973"
FT                   /product="predicted protein"
FT                   /note="go_function subtilase activity; go_process
FT                   proteolysis and peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_14973"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68019"
FT                   /db_xref="GOA:A3LYR4"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034182"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYR4"
FT                   /protein_id="ABN68019.2"
FT                   /translation="MLFPLRTLLLILSVLLQVQSTAIPKRDYESKNYYIFEIDTSISQQ
FT                   PLADFTSKYRSHYKFEHQLQGLDNHYVFSINKSHPHNDFLGNHKSNDFNLMKRSPGFED
FT                   EYDYLVSNPHLRSIHQLKPRTLSKRMPVLITDDKEYERIIDSKHANTDAAGNTVDASKQ
FT                   LLKDVSDSLSIRDPGFIEQWHLINTAYPGHDVNVTGLWYEGITGTGIVSAIVDDGLDAE
FT                   SEDLRANFNAKGSWDFNDNTNIPLPRLYDDHHGTRCAGEIAAVKNDVCGVGVAYDSTVA
FT                   GIRILSGPITAAEEAAALIYGLDVNDIYSCSWGPTDDGRTLAEPETVVKKAMIKGVQEG
FT                   RKDKGSIYVFASGNGGRSYDSCNYDGYTNSIFSITVGAIDYKGIHPDYAEACSAVMVVT
FT                   YSSGSGEHIHTTDIKKRCTASHGGTSAAAPLAAGIYALVLQANPNLTWRDVQYVSVLSS
FT                   VPINQQDGNYQTTALNREYSHKYGYGKIDAYQMVHFAKDWKNVKPQAFFYSDIQSKPPA
FT                   DSHKRDGNIIRKKITVTEEDLKIMNVERVEHVTVKLNIMATFRGRVGVRLISPTGVTSD
FT                   LATFRPRDNSGVGFKDWTFMSVAHWGESGLGDWTIEVFGDENSSKQKNTIVFENWQLRF
FT                   FGESIDADKAETYELEKDYAAVRRDRLSQNNDKQPETTSETLSSSESVSSSEVGTSTVS
FT                   TESSTSVTSTSDSTTPVEEDHNAEKVTESVSASSSSTQDAEATESSGAEEDEDGKLKYS
FT                   ADHTGQYFMALAVVGFIVIILFMKFFKTPGSGRRRRREDFEFDIIPGEDYSDSEDDEDS
FT                   MEFGRRSGRRAPPAPSFIPNEVDDEDDDRARDRVYDEFNSDTLPEYEEEMFRIDDEDED
FT                   "
FT   gene            174100..175780
FT                   /gene="ZWF1"
FT                   /locus_tag="PICST_85065"
FT   mRNA            174100..175780
FT                   /gene="ZWF1"
FT                   /locus_tag="PICST_85065"
FT                   /product="Glucose-6-phosphate 1-dehydrogenase"
FT   CDS_pept        174156..175655
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ZWF1"
FT                   /locus_tag="PICST_85065"
FT                   /product="Glucose-6-phosphate 1-dehydrogenase"
FT                   /note="Glucose-6-phosphate 1-dehydrogenase (G6PD);
FT                   go_function glucose-6-phosphate 1-dehydrogenase activity;
FT                   go_process glucose metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85065"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68020"
FT                   /db_xref="GOA:A3LYR5"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYR5"
FT                   /protein_id="ABN68020.2"
FT                   /translation="MSFDPFGSTATIVVFGASGDLAKKKTFPALFGLFREGHLSSDVKI
FT                   IGYARSHLEEDDFKKRISANFKGGNPETVEQFLKLTSYISGPYDTDEGYQTLLKSIEDY
FT                   EAANNVSTPERLFYLALPPSVFTTVASQLKKNVYSETGKTRIIVEKPFGHDLESSRQLQ
FT                   KDLSPLFTEEELYRIDHYLGKEMVKNLLVLRFGNELFNGVWNKNHIKSIQISFKEAFGT
FT                   DGRGGYFDSIGIVRDVMQNHLLQVLTLLTMDRPVSFDPEAVRDEKVKILKAFDALDPED
FT                   ILLGQYGKSEDGSKPGYLDDSTVPKDSKCVTYAALGIKIHNERWEGVPIVMRAGKALDE
FT                   SKVEIRIQFKPVARGMFKEIQRNELVIRVQPNESIYLKINSKIPGISTETSLTDLDLTY
FT                   STRYSKDFWIPEAYEALIRDCYLGNHSNFVRDDELDVSWKLFTPLLQYIESDKSPQPEV
FT                   YAYGSKGPKGLREFLNKHDYIFADEGTYQWPLTTPKVKGKI"
FT   gene            complement(<177075..>179972)
FT                   /gene="FRK26.1"
FT                   /locus_tag="PICST_85029"
FT   mRNA            complement(join(<177075..179041,179132..179256,
FT                   179314..179598,179671..>179972))
FT                   /gene="FRK26.1"
FT                   /locus_tag="PICST_85029"
FT                   /product="6-phosphofructose-2-kinase"
FT                   /note="Has EST support"
FT   CDS_pept        complement(join(177075..179041,179132..179256,
FT                   179314..179598,179671..179972))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="FRK26.1"
FT                   /locus_tag="PICST_85029"
FT                   /product="6-phosphofructose-2-kinase"
FT                   /EC_number="2.7.1.105"
FT                   /note="go_function catalytic activity; ATP binding;
FT                   go_process metabolism; fructose 2,6-bisphosphate
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85029"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68218"
FT                   /db_xref="GOA:A3LYR6"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR013079"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYR6"
FT                   /protein_id="ABN68218.2"
FT                   /translation="MTAKLHPRHHFRKKSNSISNGVLQHARSINKKVSFSKFAHTNSSQ
FT                   VFTSSASSSGASSRNSSDSEDDDDDDEDTHNPANITNSSHPNPSANPGPHPAHFLISNF
FT                   KKNYALRKLSSYPYAGERMGVSKSLDSQLLESRDSSNVNLPEFNKRPLTDTPIVSSMAS
FT                   PETREQSSDDEDEDESHEDPMKKVKEELKNIQKNISDLNLADMNPNVDLEKLKDPEEDS
FT                   NKSKNLESNTLKPAVIPASVSKSEQSGTPSPMAGMAPLSKKISLNEELRSNLLQDLPLE
FT                   LQEQFEKTPSIEKLKSLLLTKPPPSARKTYTLNIPGQTSSKTSPDGKIASVDIGSKLVI
FT                   VMVGLPARGKSYITNKLTRYLNWLQHDCRVFNVGNTRRKDKNNAGPEKKPLPDAVTPTN
FT                   QPSSPSQHNADFFSPDNKSSNALREKWAMDTLDNLLDYIVDGPGSVGIFDATNSTKSRR
FT                   LHVLKRINERTNGELKVLYLESICSDPAIIESNIRLKLSGPDYRDMDPEVALKDFVGRL
FT                   HNYEKAYETIDEEEEKIPQFQYVKMIDVGKKVVSYNIKGFLASQTIYFLLNFNLCERQI
FT                   WITRHGESIDNLRGRIGGDSKLTKRGQKFSKALAKFMVEQRKKFRELQLERFSTRLELK
FT                   YNTLFSEDDVASLDNIPTEPNFCVWTSMLFRAVETGAYFNEQVFSVKQMRMLNELGGGK
FT                   FEGMTYDEIQRRYPKEFDARIHDKLSYRYPGVGGESYLDVLTRLRPLITEIERTTDHLL
FT                   IIAHRVVLRILLAYFLNLEKSAIGELDVPLHTLYCLESKPYGTDYRMYEYDENLDWFVQ
FT                   VQPEHQKNIKEVGVVFRERKYSVVPTAPPTSAAARRASTLRNRTVSTNYGPVSGKLDVN
FT                   NFSIRRSLSFGSNQPTINETG"
FT   gene            <184654..>187227
FT                   /gene="MSN4"
FT                   /locus_tag="PICST_33273"
FT   mRNA            <184654..>187227
FT                   /gene="MSN4"
FT                   /locus_tag="PICST_33273"
FT                   /product="zf-C2H2 Zinc finger, C2H2 type"
FT   CDS_pept        184654..187227
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MSN4"
FT                   /locus_tag="PICST_33273"
FT                   /product="zf-C2H2 Zinc finger, C2H2 type"
FT                   /note="zinc finger transcription factor; go_component
FT                   nucleus; go_function nucleic acid binding; zinc ion
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33273"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68021"
FT                   /db_xref="GOA:A3LYR7"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYR7"
FT                   /protein_id="ABN68021.2"
FT                   /translation="MSSDYPPVFDNPASSSSYLGSQFFNFEGSYNQADLMGLPQNSTSG
FT                   ENVAVAAVSAVQSSPVDENSSTININTINNINANGNANASSTGNAANNANNTIDPLFDY
FT                   SASFAGLGNNNTIASGNSNISPITVIPESLHINDEIFFNNNYQFTNGAVGSGTGSTAQY
FT                   DTHNDDMASNMSSTNSLNNYFQRSNQMSAPGYSPQLLQSKAAGGSNQKLHQQFQQQQQH
FT                   LLQQQQHQIQHQILSTQSYPLLNSNYTTSNNNNINNVSSSNNHINSNSNTTNTNSTNSN
FT                   SNTTNTAGKPSSSSSSFSSSSSNSMVPSAAATTPTISETSVFTATTPSIHAANAAQFSA
FT                   QVVTPQYTINRQLRHNSTSVPVDQLTSLSLKSLSTPTSATGLGLGLQSLPQNQQLQQQP
FT                   QSARKSPSPDYYYTSNVSPVIDETPEERTINPRQLFTSSSKIPTSMSSPTLSTLFSSYT
FT                   NNNNGNSSISNNNSNSSNNNTSNNAVSMNGISATLSSQKVPPQNRLFSSNIPNLANSAT
FT                   SNVANSNGTPLATNRSDLQLDFKMNDECYNAITYWLNNTLSSTARDDLSNVDMNNLDDV
FT                   AAKIMVNPTGIIKGNIQNFSKNRSHSYSATSNNGMYRRRNSVQSPTVLESFPQSSSSDI
FT                   QMQKLQQSQQITQQMIDTYSAGQKKKRRKSSVSYDSTINVNVGTMNSVNNTVLRSSPTQ
FT                   GSPNISPTTSNVLFAPGSSVKLESVPDLEPRRARKSSPAKENSDSPTAAAGTSPEKSKA
FT                   VAAGVPMTPNNNGAFSCTECDKQFKRSEHLKRHIRSVHSNIRPFHCKYCEKKFSRSDNL
FT                   AQHLKTHYRVDSEGNTNIIYGNPNNHSRTNSSGAPAVVANQGKKK"
FT   gene            <187938..>188111
FT                   /locus_tag="PICST_63166"
FT   mRNA            <187938..>188111
FT                   /locus_tag="PICST_63166"
FT                   /product="predicted protein"
FT   CDS_pept        187938..188111
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63166"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63166"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68022"
FT                   /db_xref="GOA:A3LYR8"
FT                   /db_xref="InterPro:IPR012576"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYR8"
FT                   /protein_id="ABN68022.1"
FT                   /translation="MAGNPWAKRDAWRYEGQFSRINRFKSAFPGLGLGAGAFVLYVAYE
FT                   KLVLKKDDAHHH"
FT   gene            complement(<188526..>189350)
FT                   /locus_tag="PICST_36916"
FT   mRNA            complement(<188526..>189350)
FT                   /locus_tag="PICST_36916"
FT                   /product="predicted protein"
FT   CDS_pept        complement(188526..189350)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_36916"
FT                   /product="mitochondrial ribosome small subunit component"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36916"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68219"
FT                   /db_xref="GOA:A3LYR9"
FT                   /db_xref="InterPro:IPR016939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LYR9"
FT                   /protein_id="ABN68219.2"
FT                   /translation="MKIQSKATTVLERTSHYLKVGVLKQKPAWYDVVGAFPPHTDLTKK
FT                   PKVLELKTQKPDPFTSLFGTSRNDGTVKTRASAFDRLQKNNSISRIPQLEFLEDELRDV
FT                   FYHQHPWEFSRPKTLIENKGDEYKDCDWSHMLQFNKPLDGESVVQRTLWLLADSKKNGP
FT                   KLSLFEAYDKARFEFYRLRMREEMNSSVSREESVMYGAVFPTTHLEWGVQKEQEYIDVW
FT                   AKVASDKTKVASANRGRGTSAGSGADEEKGAETSIWESSFEISDAEEVVEEK"
FT   gene            <189957..>192086
FT                   /locus_tag="PICST_33275"
FT   mRNA            <189957..>192086
FT                   /locus_tag="PICST_33275"
FT                   /product="predicted protein"
FT   CDS_pept        189957..192086
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33275"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33275"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68023"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYS0"
FT                   /protein_id="ABN68023.2"
FT                   /translation="MKATKIIIRRFSASVRIRQKSEPVRNRLEAAVANFISKVQKSQSK
FT                   SSGSILSAIDLLIDKHNETLAAHFGIPHETNDYLKVKQQIWDKLSVGDISLAQDQESVE
FT                   AQRSNLLNSHSLRLSSSSSTSLSKFVKCLYPLHKSTSPSLSSSNSNKVLDIPSSLGKYE
FT                   LINHNQLHRTFYELPSPQPFYLSPQHLNDFLHRFLFNKRDFIKSNIVSLSNLNHFAPYR
FT                   FFEYYNQMLFKRQEYVSMVTKILQDLQTYGFETSLTEQNQIIFYTFFKDKAPIVHKINE
FT                   AVGKLKELGMSVTQDAYPTFDLDTYNQLKESMIAKYGKLHISSLNIFLLHAIRHSQESV
FT                   IVDVLQQIGFAELVGGNSLSERLSTPDETTFALLFEYFSSSSYASSKGLSSFVEVFEKA
FT                   VADKSLVFDVKLINVLLKCLCENEELNFAENIVSKLFLQEVPKLQVDESEAVVLKQMSP
FT                   RDKLAYKKLELIYNNIRKVTNDFEISYTILPTESTFKPLISSYCLPLSNTKNSFRKVNY
FT                   LTNFMETYYKLPITTRTFKLIFSKFEASKEEGWELFDLINITSKLISLHDYSYNLSEDT
FT                   SLFGTDGQFSKLDRIEKSSQLTNFINNHLVKQIDLNIPIAQGSFVKLNDSLITSVYHAF
FT                   METIKRSAPNNKEGADELVRRIQRQYDSLRERINKSRGPVDQEGFTTTTRDIYALDELN
FT                   YIKKAFLIDLIDVVG"
FT   gene            complement(<192162..>193775)
FT                   /locus_tag="PICST_33276"
FT   mRNA            complement(<192162..>193775)
FT                   /locus_tag="PICST_33276"
FT                   /product="predicted protein"
FT   CDS_pept        complement(192162..193775)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33276"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33276"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68220"
FT                   /db_xref="GOA:A3LYS1"
FT                   /db_xref="InterPro:IPR010640"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYS1"
FT                   /protein_id="ABN68220.1"
FT                   /translation="MSKKSHDSALVEQVPDSSGSYENNNADYGAIVETEFFSDSEIIEE
FT                   GRSNADLENGAERGEEVLTDSEGEDAFVKKYGAINFSYIKKPTERVWFIRPHALNYFKD
FT                   GVLYRTKGERSSGRTELFLDLMYVAIIANLAGEATENASGAALLKYILLFVAAFTIWAD
FT                   VKDFVNYYYSEDLFQKLCLVWYLLLLMLFANSHYDIATSRASAAYTIVPYMLARMSLSI
FT                   TLVVYSFYIPELRFQQRCYAATIFVTTCLWIPVIFISTRAKIGLSIVIFVLEQTSFMVI
FT                   HHPSFRRYFRLTTSTALNIEHEVERYSVFVTIAVGEFLYKVAANGSLGSGLSLRFLRGV
FT                   FMILIAYAIFWIYIYGSTAKKAIHALRRSGLTAIIYLYGHLPLVAGIVLAADAGGDLSS
FT                   LTNTNLHRHPVEELLVHGEELFNRSEENEELNLYALAFFFAGGIGAALVSLCALGLLDA
FT                   SLDPPKTFLLPRFWRVIWRAPVGVVVAMLPFAELSSTVLMGVITALLLILVIFESVVST
FT                   PKHCLVKGPLSQVHPKPVPE"
FT   gene            194865..198809
FT                   /gene="XYC1"
FT                   /locus_tag="PICST_68263"
FT   mRNA            join(194865..194963,195222..198809)
FT                   /gene="XYC1"
FT                   /locus_tag="PICST_68263"
FT                   /product="hypothetical protein putative xylanase/chitin
FT                   deacetylase"
FT                   /note="Has EST support"
FT   CDS_pept        join(194940..194963,195222..198773)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="XYC1"
FT                   /locus_tag="PICST_68263"
FT                   /product="hypothetical protein putative xylanase/chitin
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68263"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68024"
FT                   /db_xref="GOA:A3LYS2"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR017147"
FT                   /db_xref="InterPro:IPR031468"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR037756"
FT                   /db_xref="InterPro:IPR037761"
FT                   /db_xref="InterPro:IPR037762"
FT                   /db_xref="InterPro:IPR037765"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYS2"
FT                   /protein_id="ABN68024.2"
FT                   /translation="MATTTTSAPTDSVQAPVQVSVDQRELIDSEKNNSVSTKQSELTNK
FT                   TAQKQLPNVQTSLSLQPSEDLDITNVKTKPLARQPQEPTYRGWKEVGHWEHDDALTEDD
FT                   QAVDLLSKPSLFDQYLPPVVFGDWYHNVGYLVVAALVSWIIGWFKFSVAPLFFVMLVFS
FT                   VLYRASVKKYRMLLREEAQREFSVKTIETDYESMDWSNTFLEKFWVYLEPSISQIVCEQ
FT                   VNPILASSPAPAFVKKLWIDSFSAGTKPPRIDCVKTLPGTSDDVVVMDWGFSFTPNTLA
FT                   DANTKQLKNKVNQKLVVKAEVFGFTIPVLVADCAFKGLARIRLRMMSSFPHVETINVTM
FT                   LEAPQFDFNSKILTENNVLWEFLALPGLYPFINEMVKKYVGSLLFAPLSFQLNLQQLLA
FT                   GNAFDSSIGVLSITADSARGLKGFSTIGNTLDPYLTFGFKKDVLAKTSTKDDTNHPVWK
FT                   ETYQICVKSLTEPLNITVIDFNEFRKDRQVGTIQFDLESFLDNPKQSNITAPFIRNGKP
FT                   VGELVFGLNYMPTLEAERSADGAVIPPPDLNTGIARIEIAEARHLKSGEKAASAFAEIH
FT                   FNNEKVLTTSVQKKTNAPSWGDKIEKIVDNRARSKVKIVVKEKGGKTLGQIHTSLNELI
FT                   DATQVDQTWFALAQGGEVRINASWKPVALSNSSGSSGYAAPIGVVRVSIEKAENLRNLE
FT                   AIGKVDPYARILVNGFQRARTVACDSTLDPTWNEVHYISVTSPNQKLTIDVMDVEKTSA
FT                   DRTLGSFDVRLNDIIRKDETGKYTEHIDHGKRHSRLIHKKGPKGVVTYSLSFYPALPVM
FT                   TLEECKEEEEFKKQKEEEKAKKLAESQKEGKEAPVEEEEEEVNEFSSKLKLTLPELLQH
FT                   NSGIFVYEVLDAKLSKDDVYLQAFFDSHGYHDFVSQKLEKKQVKVAATGDVAITELEWS
FT                   QACFRITKDKKDNRAEKCVAEVTIPTMQLLKNAYNKPTQLQLTGGGEHSTITVQCSWIP
FT                   LIYEHGIPVQDSRNNSGKLTVQVLRAENLIAADSNGKSDPFVRLYLNTDKEEFLKTKKV
FT                   KKTLNPTWNESGVVTVANKQDAVIKVVAMDWDIGVEADDLLGIGYAQLSDVDFEHGTEL
FT                   KVPLEAEDGGDGGNVYLKFSFVPEVVINVRRASTTNIGGAIGSVGNVGIGAGKGVVKGV
FT                   GKGLGGGVKVFRKGLKLGKSSADKD"
FT   gene            199362..204405
FT                   /gene="RPA190"
FT                   /locus_tag="PICST_73507"
FT   mRNA            199362..204405
FT                   /gene="RPA190"
FT                   /locus_tag="PICST_73507"
FT                   /product="alpha subunit of RNA polymerase I"
FT   CDS_pept        199372..204306
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RPA190"
FT                   /locus_tag="PICST_73507"
FT                   /product="alpha subunit of RNA polymerase I"
FT                   /note="alpha subunit of RNA polymerase I (RPB1)
FT                   [EC:2.7.7.6] [KO:K00960]; go_component nucleus; go_function
FT                   DNA binding; DNA-directed RNA polymerase activity;
FT                   go_process transcription"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73507"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68025"
FT                   /db_xref="GOA:A3LYS3"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR015699"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYS3"
FT                   /protein_id="ABN68025.2"
FT                   /translation="MDISKPVGSEITSVDFGVLSDDEIRKLSAKQITNPTVFDNLGHPI
FT                   GSGLYDLALGAFLRNVCTTCGLDEKFCPGHLGHIELPVPVYNPLFFNQLYILLRSTCLY
FT                   CHHLKLNALEVHKYKCALRLIQYGLLLEVVELENMYARGQSHEEDDDEDSSSGLDHKAK
FT                   QELMDRREEFVNTAIAKALSEGRTSESGVITATVGEERKHTVHDFYKRLLSRPKCDNCG
FT                   MYSPTFRKDGFTKIFENSLTDKQITNNRVKGLNRPDMLRNGAATSTNSTSSSSSDMPNI
FT                   KHKGGSKYVLSSEIRNILRALFVNEQDVFQMVFHSRPYQKETVVADIFFRQALLVPPTR
FT                   FRLPSKLGDEIHENAQNELLSNILKTALLIRDLNDQISSLVKGKISLDERKIVFNRLMN
FT                   SFVTLQNDVNAFIDSTKNQNSPAGKVPNPGIKQALEKKEGLFRKHMMGKRVNYAARSVI
FT                   SPDPNIETNEIGVPPVFAKKLTYPEPVTAHNAAELRRAVINGPDKWPGAIQVQNEDGSL
FT                   ISLIGMTLEQRKTIANQLLTPSNGATILNKKVYRHIKNHDVVIMNRQPTLHKASMMGHK
FT                   VRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENAKAEALNLANTDSQYITPTSG
FT                   SPLRGLIQDHISAGVWLTSKDSFFTREIYQQLIYGCIRPEDGHSTRSKLITVPPAVFKP
FT                   QPLWTGKQVITSILLNITPDNVPGINLVSKNKVKNEYWGEGSNENEVLFKNGELLCGIL
FT                   DKSQYGATQFGIVHSLHEVYGAAVAGKALSVLGRLFTNYIMMTAFTCGMDDLRLTEEGN
FT                   SWRRDILKQSVDIGRVAAAEVTNLDSKSTGNHDPELLRRLEEILRDDNKLGILDAVTQS
FT                   KVNTITSQVVAKCVPDGTMKRFPYNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRV
FT                   PVMVSGKTLPSFKPFETDARAGGYIKGRFYSGIRPQEYYFHCMAGREGLIDTAVKTSRS
FT                   GYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGGDSIDTTKQSHMNQFKFCAENYDA
FT                   LLAKYNPGELTHHLDTETALHYSKKVRKNMKKQGKLPHYEQQIKYDPVLSVYNPAKYLG
FT                   SVSEKFQEKLDDFVKDNEDIFAKSKEEAKSTGKLTEKKFRALMQLKYMRSLINPGEAVG
FT                   IIASQSIGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDD
FT                   VSDDQADAFCKSVARVVMSEFIDKVLVTETTSTSEDGTNSRSYIINLKFYTRKEYEEAY
FT                   DISQDHLEDVITSTFLHALEAQIVKEVKKQKRPDSLPNIGKSAGKTDLESISAKVTEIN
FT                   DDEDASDEKSRNKGKEAVSYDGPDDEEIETMKKAEETSDEEMVDDDDDDDDSSSSSEDE
FT                   SSDEEMEEEKNTTKELSRTAKDRQAEVISSHNMVTKFDFDDENGEWCEFKLELNGNETQ
FT                   KLLMVNIVEDLCRKVVVREIPQIGRCVHPQPDASGKRILTTEGVNFRAMWDQDDFIDVN
FT                   NITSNDVAAVLRTYGVEAARNTIVNEIYRVFDTYGISVSSRHLDLLGDMMTREGTYLAF
FT                   NRQGIDSSTSAFMKMSYETTCQFLTKAVLDGDREDLESPSARIVLGKLSNVGTGSFDVL
FT                   AQLGKV"
FT   gene            <204660..>205625
FT                   /locus_tag="PICST_33279"
FT   mRNA            <204660..>205625
FT                   /locus_tag="PICST_33279"
FT                   /product="predicted protein"
FT   CDS_pept        204660..205625
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33279"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33279"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68026"
FT                   /db_xref="InterPro:IPR028012"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYS4"
FT                   /protein_id="ABN68026.2"
FT                   /translation="MFIQDITSQSSSSHKVSEGSFSSKRKLDEENSNESSTGVVFYSAG
FT                   NKTSEEPQVKRPKYLAEHKHRHDFFARLTVNVDEFIASHDVWTAFLQDVHSHRLQSTTP
FT                   AKKSRRVTFADSPVYVDRPFKKLGSTCEFNYNELEIETYSGVFFDEIPPVAPLRTPGRL
FT                   EGYDKVGVVFRKLSKIEIGKAVQHSRPQFLFDMLGIEQPFTYVQNPLFGSFRSEPQYYR
FT                   LDSDGEENGMCPYCYDIVFLPKEEYTKHICDCHGIDRNGNPITVPSYMGRYKSHDREHA
FT                   KLYEERVPCLHCKELIEVNRLTRLFPLENYYIHCREKHWK"
FT   gene            complement(<205704..>206135)
FT                   /locus_tag="PICST_49481"
FT   mRNA            complement(<205704..>206135)
FT                   /locus_tag="PICST_49481"
FT                   /product="predicted protein"
FT   CDS_pept        complement(205704..>206135)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49481"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49481"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68221"
FT                   /db_xref="GOA:A3LYS5"
FT                   /db_xref="InterPro:IPR007014"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYS5"
FT                   /protein_id="ABN68221.1"
FT                   /translation="SSLKLLLGATTSIMLISGFSRPLLNDTINARLPATDLSLSLQTPT
FT                   YHKSRFGGKLNYEELTIGSVTGLFVGIIAGKLSSVFIFLSLATYFLVEFLESRNIINIP
FT                   WNYIVTVGKEKINIKELVLEKPSFKISFVLSFLIAAYNI"
FT   gene            207365..>208952
FT                   /locus_tag="PICST_85050"
FT   mRNA            join(207365..208823,208869..>208952)
FT                   /locus_tag="PICST_85050"
FT                   /product="predicted protein"
FT   CDS_pept        join(208095..208823,208869..208952)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85050"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85050"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68027"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYS6"
FT                   /protein_id="ABN68027.2"
FT                   /translation="MFGNSDQFCSLDESMFFNPDSAQEVCPKVWLGPYSALSHDNFLER
FT                   HNIKIIINCLSTGKFLRALEQPQVAISSDVIILSLDPSFSVSDFETQELVSEFTRKFNR
FT                   ILQNYLNYFYVNNPDSTYLIHQIPNNQLLSSIRSPILQGNLKSQFFVLVRLMNLLKSIN
FT                   SNVQCLVLSDTGNSNLSTGLITAYLMDCYNYNIKNSYTVVHSARPSVSALNNNFYDDLL
FT                   IIENLKKFSSENNALKQNNPGEDDSRMDDDMEYNEICVGGDRKRRFHR"
FT   gene            complement(<209322..>209786)
FT                   /locus_tag="PICST_49775"
FT   mRNA            complement(<209322..>209786)
FT                   /locus_tag="PICST_49775"
FT                   /product="predicted protein"
FT   CDS_pept        complement(209322..209786)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49775"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49775"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68222"
FT                   /db_xref="GOA:A3LYS7"
FT                   /db_xref="InterPro:IPR039196"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYS7"
FT                   /protein_id="ABN68222.1"
FT                   /translation="MSPISQKTYPSFKNLYKALHKELVVIQNRTDAIHAAKDIEKQIAL
FT                   LQYKKLNHIRENKDVKEINSQIEKLMKGEFEESKEFKHKHLIKQFVDAGESKDLVQHKY
FT                   KLNNMANVVTFLNSQRVYTELLERYNPGLTMKQDDNVRRTANRVGLSVPE"
FT   gene            210775..212341
FT                   /gene="IDH1"
FT                   /locus_tag="PICST_91057"
FT   mRNA            join(210775..210821,211189..212341)
FT                   /gene="IDH1"
FT                   /locus_tag="PICST_91057"
FT                   /product="isocitrate dehydrogenase"
FT   CDS_pept        join(210795..210821,211189..212250)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="IDH1"
FT                   /locus_tag="PICST_91057"
FT                   /product="isocitrate dehydrogenase"
FT                   /note="Isocitrate dehydrogenase [NAD] subunit 1,
FT                   mitochondrial precursor (Isocitric dehydrogenase)
FT                   (NAD(+)-specific ICDH); go_function oxidoreductase
FT                   activity; go_process metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_91057"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68028"
FT                   /db_xref="GOA:A3LYS8"
FT                   /db_xref="InterPro:IPR004434"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYS8"
FT                   /protein_id="ABN68028.1"
FT                   /translation="MLRTTLVQKSAVRSLATFASPESVLPKKYGGRFTVTLIPGDGVGQ
FT                   EITDSVKTIFKAQNVPIDWEVIDVSGLESSGKNGVTEAVESLKRNKVGLKGILYTPTGS
FT                   SAKSLNVALRKELDIYASLVLIKNIPGVKSRLDGIDFALVRENTEGEYSGLEHQSYPGV
FT                   VESLKIMTRFKSERIAKFAFDFAKKNNRQLVTAIHKANIMKLGDGLFRQTVKDVGQDYS
FT                   GIEVNDLIVDNASMQAVAKPQQFDVLVTPNLYGSILSNIGAALIGGPGLVPGANFGREY
FT                   AVFEPGCRHVGLDLKGQNTANPTAMILSSAMMLRHLGLNDEADKISAATYEVIADGKIR
FT                   TKDIGGTSSTTEFTKAIVDKLA"
FT   gene            212523..214522
FT                   /locus_tag="PICST_85387"
FT   mRNA            212523..214522
FT                   /locus_tag="PICST_85387"
FT                   /product="predicted protein"
FT   CDS_pept        213156..214448
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85387"
FT                   /product="Adenylosuccinate synthetase (IMP--aspartate
FT                   ligase)"
FT                   /note="go_function adenylosuccinate synthase activity; GTP
FT                   binding; go_process purine nucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85387"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68029"
FT                   /db_xref="GOA:A3LYS9"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LYS9"
FT                   /protein_id="ABN68029.1"
FT                   /translation="MCDVVLGSQWGDEGKGKLVDLLCDDIDVCARCQGGNNAGHTIVVG
FT                   DVKYDFHMLPSGLVNPNCLNLVGSGVVVHVPSFFQELENLEKKGLNCRDRLFLSSRAHL
FT                   VFDFHQRTDKLKEAELSENKKAIGTTGKGIGPTYSTKASRSGIRVHHLVSEDPEAWEEF
FT                   KTRYHRLVNSRKQRYGEFDYDVEEELARYEKYRELLRPFVVDSIEFMHTALVQNKRILV
FT                   EGANALMLDIDFGTYPYVTSSSTGIGGVLTGLGIPPKTINNIYGVVKAYTTRVGEGPFP
FT                   TEQLNEFGEALQTIGAEYGVTTGRKRRCGWLDLVVLKYSTLINGYTSLNITKLDVLDSF
FT                   KEIQVGVGYKLNGKSLASFPEDLIKLGKVEVEYKTLPGWETDITKIKTYDELPENAKSY
FT                   LKFIEDYLGVPVQWVGTGPARDSMLEKPISK"
FT   gene            <215553..>216605
FT                   /locus_tag="PICST_5163"
FT   mRNA            join(<215553..215939,216000..>216605)
FT                   /locus_tag="PICST_5163"
FT                   /product="predicted protein"
FT   CDS_pept        join(<215553..215939,216000..>216605)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_5163"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_5163"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68030"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYT0"
FT                   /protein_id="ABN68030.1"
FT                   /translation="DHIVSLGLLNNQYLYTCSNEGKLVIRDLVNDDAFGSYKVYLILNP
FT                   VSDVRLRMAVHDRKRITVASCGKNSELKLYEIDSNEKKECSRISVVQSGNVRTTMDLNV
FT                   IRPLRRSFTTLNLGSEVISLPSSSGANNRHVSVLTPFWTSSTYAKDFLYHATSLDVISS
FT                   WMISVCIIDEYVACGTQFGKLLIFSVLDDIYPIETLTLSQFPIVKLHAIDSSYVIFADS
FT                   MSKVGIVKLSSLKVVSFFDNLRIGPTCSFKFVLPSNVGDRKVNGDILKFDPIYAICTTI
FT                   DKRLVIYKLFDDNTHELLLEMNMGDMTIPAFSVMGDNDYETFNNIFGEPD"
FT   gene            complement(<218651..>219112)
FT                   /locus_tag="PICST_33287"
FT   mRNA            complement(<218651..>219112)
FT                   /locus_tag="PICST_33287"
FT                   /product="predicted protein"
FT   CDS_pept        complement(218651..219112)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33287"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33287"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68223"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYT1"
FT                   /protein_id="ABN68223.2"
FT                   /translation="MSTETVNKLVGYFTITPKSTSSKSISKSKSLFHLGRRPSSRSLKN
FT                   ASSRDSAYWLNLTTETPINPYRDLPFYEETILFYDESDLELVAPNLGYYYSTKINHQVI
FT                   QSKKKYNLQYEMIRTDKAKNGILSHSISCNTLPRLFNETFSNEVTAYNV"
FT   gene            <219647..222034
FT                   /locus_tag="PICST_85406"
FT   mRNA            <219647..222034
FT                   /locus_tag="PICST_85406"
FT                   /product="predicted protein"
FT   CDS_pept        219647..221989
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85406"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85406"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68031"
FT                   /db_xref="GOA:A3LYT2"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013535"
FT                   /db_xref="InterPro:IPR015155"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR033510"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR038122"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYT2"
FT                   /protein_id="ABN68031.2"
FT                   /translation="MPFKLSATLRGHEQDVRGVVAPSDELVVTCSRDSTTRIWLPPSDS
FT                   KQSRFVSDRTEPLIVFHSPNNSFINSVTYIDSKQHEPLIASGSQDAIIYLSEVAVSDRK
FT                   PGDDTGKYQLIGHAGNVCALEYKNNQIISGSWDCTAKVWDLDTLLVKYDLVGHESSVWD
FT                   VKILDNDTFLTCSADKSIRLWNGKKEVQRFSGHTDVIRKLLVFPDGSRFASASNDGTVK
FT                   LWDLKSGRVLQTLHGHESFVYDLTLLPNGDLVSVGEDRTIRVWRDGSILQVITLPCISV
FT                   WCVAALPNGDIVVGGSDNIVRVFTRDSSRIASDEEIAELVEAVQQSSIAEQSLDNLKKT
FT                   DIPSYEALERPGKQEGATIMVKNPSGVIEAHQWSGGEWVKIGDVVGSAGSGQKKTYNGK
FT                   EYDYVFDVDIEDGAPPLKLPYNVNENAYTAAQRFLAENDLPSSYTDEVVKFINKNTEGF
FT                   SIQEADEAPTYDASLNPYSDSYQREHNQDTIASSKPSLKVIPETTYISFKDYKEAQLIA
FT                   GLKKLNSEQDESNQLSESDISTISRNLKLLTSKESLQLIVEYIPRIITTWSPATRLIGY
FT                   DLLRISIPRVTTVDLLRSTEGAEAVLKAISSGLDVADASTIPLLMMILKTLNNLIGNTL
FT                   FVQLYIDPNEDGTYTYNKFFLDLLSTLTAKVIDITENGKFHKLYNTTVTTIATLLYNLS
FT                   VYHLQTSGLKKNPRSSESIVQFTNEVGDLIVESNSEAAYRLAIAYGNLRYAKAFEPVPE
FT                   WLNKAGELYISKGEQRFIDLARDLQSL"
FT   gene            complement(<222151..>222477)
FT                   /locus_tag="PICST_63063"
FT   mRNA            complement(<222151..>222477)
FT                   /locus_tag="PICST_63063"
FT                   /product="predicted protein"
FT   CDS_pept        complement(222151..222477)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63063"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63063"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68224"
FT                   /db_xref="GOA:A3LYT3"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013970"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYT3"
FT                   /protein_id="ABN68224.2"
FT                   /translation="MDATKVRINASLVEKYQGKLVRLIGKCQSFDPINKIATLDSNGEV
FT                   RLEFFDEVNLAVGKIYEITGKVSSNEQKVHAQAVTELSDNTNLEIADKLVSYSQKVPEL
FT                   FIES"
FT   gene            complement(222916..>224485)
FT                   /gene="TRP6"
FT                   /locus_tag="PICST_91065"
FT   mRNA            complement(222916..>224485)
FT                   /gene="TRP6"
FT                   /locus_tag="PICST_91065"
FT                   /product="Anthranilate synthase component II Includes:
FT                   Glutamine amidotransferase Indole-3-glycerol phosphate
FT                   synthase (PRAI)"
FT   CDS_pept        complement(222916..224454)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="TRP6"
FT                   /locus_tag="PICST_91065"
FT                   /product="Anthranilate synthase component II Includes:
FT                   Glutamine amidotransferase Indole-3-glycerol phosphate
FT                   synthase (PRAI)"
FT                   /note="Anthranilate synthase component II [Includes:
FT                   Glutamine amidotransferase Indole-3-glycerol phosphate
FT                   synthase (PRAI)] (TRPG); go_function catalytic activity;
FT                   indole-3-glycerol-phosphate synthase activity; go_process
FT                   tryptophan metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_91065"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68225"
FT                   /db_xref="GOA:A3LYT4"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYT4"
FT                   /protein_id="ABN68225.1"
FT                   /translation="MTKELPKRHVLIIDNYDSFTWNLYQYLYQSPLCGKVDVFRNDKID
FT                   ISTIENQVKPDIILISPGPGHPTSDSGISRDVIKHFMGKLPIFGICMGQQCMIDAFGGE
FT                   VTYAGEIVHGKTTTIKHDGRGMFDTVPQSVAVTRYHSLAGTQQTLPDCLEVTALTETTP
FT                   EIIMGVRHKIYTIEGVQFHPESILTESGQIMINNLLSVTGGTWDENKANGSGFSKKENI
FT                   LSKIYKQRQIDYKRIESLPGKSLEQLEISLALNIAPPITDFYQRLKYTQDVLKQTIILS
FT                   EFKRASPSKGDINIDAHPGKQALTYATNGCSTISVLTEPKWFKGSLDDLSLIRKVIDIP
FT                   TTEGYKRPAVLRKEFIFSKYQILEARLAGADTVLLIVKMLNDIKLLQQLYEYSLSLGMI
FT                   PLVEVQNKQELDQAVKLTYNDDTKEPLVIGVNNRNLATFDVDLNTTSSLVESSKKSQRR
FT                   GDVLVLALSGITSVEDVKNYKYNDGVDGFLIGESLMRAEERGEAGKFLNDLCNC"
FT   gene            complement(<224660..227901)
FT                   /locus_tag="PICST_66043"
FT   mRNA            complement(join(<224660..224921,224980..224984,
FT                   225044..227901))
FT                   /locus_tag="PICST_66043"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(224755..224921,224980..224984,
FT                   225044..227901))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_66043"
FT                   /product="predicted protein"
FT                   /note="go_function hydrolase activity; go_process
FT                   nucleotide metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_66043"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68226"
FT                   /db_xref="GOA:A3LYT5"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR007070"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR017852"
FT                   /db_xref="InterPro:IPR037671"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYT5"
FT                   /protein_id="ABN68226.2"
FT                   /translation="MNRNRQLLLLVGLVFHFFYLWSIFDIYFVSPLVHGMDHHVSTTTA
FT                   PAKRLFLIVGDGLRADKTFQKLKHPRTGETKYLAPYLRSIAQNEGTWGISNTRMPTESR
FT                   PGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSKHTYSFGSPDILPMFAYGEGVVPG
FT                   RIDVCMYGHEFEDYTQSSIELDAFVFKHFDELMANSETNQTLHDELHEEGNVFFLHLLG
FT                   PDTAGHAYRPYSAEYYENIEYIDMQLSKLIPRIHEFFGDDDSAFVFTADHGMSDFGSHG
FT                   DGHPDNTRTPLIAWGAGVNKPKHIKDLPDPQAQRAKQDPVRSGYEDTYFETWELDHLVR
FT                   NDVKQADIASLMAYLIGANYPANSVGELPLAYLDTDAVTKIKALFANALAIIEQYYVKE
FT                   KEVYNHQFKFKPFRPFDEKSIDEYSGQINSFIYSLQNEQLSQSQKELLEKEAVMVVEEL
FT                   MKTALDGLNYLQTYNWLLLRSIVTLGFIGWIVYAFGLFLKLFIISEEDLQTLKPGNSIF
FT                   LLSSFSALALSTNYLLFYQNSPFNYYMYAAFPLYFWYTIFNELTYLGEGLNQLLYGISI
FT                   PTRVFIAVSFIGMYEGIAYGFFERFVFSIIFVLIGLYPLFVSGNEKVSTYQKLVWLASC
FT                   SLMCIFTNLNPVKVESLLQINAGALFSLIIASIGISKVFKRPIESVQKRLVIHQLLIIP
FT                   LILYATNVSVLSLQARNGLPLYSQVLGWLSFVASLLLPVFHSVYPSKDYALRLLIIFLT
FT                   FVPAFIILTISFELLFYNGFSLILLQWLNIEENLKFPRAEIIKSQEETGRLPKGYWLQL
FT                   IRISIIGFFFLQLAFFGTGNIASISSFSLDSVYRLIPIFDPFPMGALLMFKLIVPYVLL
FT                   STCLGIMNHNLEIRQFTISTLIISTSDFLSLNFFFLVRTEGSWLDIGLSISNYCLAILS
FT                   SLFMLILELVGSIILRGVEYNDKGINEEEIEDEDEDVEDEEEDDDHNGEIDPRNIIPAQ
FT                   SETEELPISARIRRRGAKRD"
FT   gene            <228544..>229632
FT                   /locus_tag="PICST_33291"
FT   mRNA            <228544..>229632
FT                   /locus_tag="PICST_33291"
FT                   /product="predicted protein"
FT   CDS_pept        228544..229632
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33291"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33291"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68032"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYT6"
FT                   /protein_id="ABN68032.2"
FT                   /translation="MYSPILRYDSESTLESPFHPPRNQSKRHHYSEESDNDMSPLKRRQ
FT                   ILHEPSELANERKFETKYNFNDWITRHPIEASTPMRPTKGKFPTDLYKEESTPFSYREE
FT                   ASTSEKSLGLSLSGKLYRDFKTPPTTAFDIFERTQVTEESIISPELEAVRRSFFADCSL
FT                   GIENDHITQQSKEEKTGQSNTEGYVMDLIGSSLLPQNLRPYRYYINKDVSPIYKTTRRL
FT                   EAEDKKNSLIDSEAELVPITTSFFLEKEPGTFPIQPIFPNWLVSKLATTEKSNFKNTIP
FT                   STKTEREYFPEGEDNQTVLSCSDIPISSGTKRACKRSTSQRFFDWIEKLKREHEERRLK
FT                   RKAVGKGVIQLTRQPQYSYKDK"
FT   gene            complement(<229763..>231559)
FT                   /locus_tag="PICST_49716"
FT   mRNA            complement(<229763..>231559)
FT                   /locus_tag="PICST_49716"
FT                   /product="predicted protein"
FT   CDS_pept        complement(229763..231559)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49716"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49716"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68227"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYT7"
FT                   /protein_id="ABN68227.2"
FT                   /translation="MSTAGSQDYYGLLGLPQVATIEEIKKAYKKLSLKYHPDKTPNKEH
FT                   HELFIKLNEAYDTLKDPETKQKYDQKIGLSSSSSSSSYTTNHSYNPYSRSTNYNATGHA
FT                   GTYFSFYQHFYGRKDDSVRRAEEEKARIYKEQLEKLHAEQEKRRQQELLRKQEEERLRA
FT                   AAEAERQRVAAQEATRAARDRLLKKLNIKAEEEERRRVQKQQEEDYFEEEYKQAKKNAS
FT                   QQYQQQSPYVVEDFFDRQYYSNTPHSSPEGKSYYSSESSGHGHNSSDPIVLDDEEGQDS
FT                   DEDLAGEEKKAEITPEPAEVDSNEINPISDEEERASSSDESDTLAQNFQAYEHLGQTFG
FT                   SRPRARPRVNMRSLSPRRNINQATSNARDTPLPRNSSKKPRTSAFTFDDISDSLGQNIE
FT                   TIDYTDLFNSLPRDVKGRRKMSENMTTMRPKRAKFAEYSNGTSRAETLSTPLNKNSVRG
FT                   HEAAPSSTTKSSRLSELDFHASPTIHNCTPPEPPIAVINPNIDAEGWQKYVESIQNYQQ
FT                   KFMKYNQLIIQYQTERSAKDQQYYEVVNGDPATFEVYHKCLQRDLEVSQEFTESLRIFA
FT                   DIMRVYKQNCDWMSTRHGNNGI"
FT   gene            <233105..>234079
FT                   /locus_tag="PICST_62909"
FT   mRNA            <233105..>234079
FT                   /locus_tag="PICST_62909"
FT                   /product="predicted protein"
FT   CDS_pept        233105..234079
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62909"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62909"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68033"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015399"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYT8"
FT                   /protein_id="ABN68033.2"
FT                   /translation="MSSSYTKEQETIVLKTLSYKPHQFYQILAVEKTATDGEIKKSYRK
FT                   LAIKLHPDKNPHPRADEAFKFVNKAWGVLSDPSKKRIFDQTGSDPDSRFSGHSSEGSST
FT                   GASPFARGSPFGFQNAGAAPFDDDIFNLFFGGGRGGPTFTFGGDGFTFQTFGGGEHPFM
FT                   RHRQAQTRQRTRSQQQASGEVPAQPPLRETLSQLLPVLLILIVPILSALFSDSSSAPEY
FT                   SFHKSKSFSVERKTPKFSIPFYVSDSFIEKKKLSGKQLKNFDSKVENLYIQDRRSKCAR
FT                   EQHIKNEMIDDAQGWFYTDQMKLAEAESLPMPNCQALRNLNLI"
FT   gene            235611..239148
FT                   /gene="NIK1"
FT                   /locus_tag="PICST_73542"
FT   mRNA            235611..239148
FT                   /gene="NIK1"
FT                   /locus_tag="PICST_73542"
FT                   /product="histidine kinase osmosensor"
FT   CDS_pept        235679..239035
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="NIK1"
FT                   /locus_tag="PICST_73542"
FT                   /product="histidine kinase osmosensor"
FT                   /note="go_component membrane; go_function two-component
FT                   response regulator activity; DNA binding; two-component
FT                   sensor molecule activity; signal transducer activity; ATP
FT                   binding; go_process two-component signal transduction
FT                   system (phosphorelay); regulation of transcription,
FT                   DNA-dependent; signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73542"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68034"
FT                   /db_xref="GOA:A3LYT9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYT9"
FT                   /protein_id="ABN68034.2"
FT                   /translation="MDSSRILALLEDPESFQQNYEQIRYDIISHIKQQDSVIANVTNEL
FT                   ATSKTANKAFKQALSEIGTVVISVAMGDLSKKVEIHTVESDPEILKVKITINTMMDQLQ
FT                   AFANEVTKVATEVANGELGGQAKNEGSVGIWRSLTDNVNIMALNLTNQVREIADVTRAV
FT                   ARGDLSRKINVHAQGEILQLQMTINTMVDQLRTFAFEVSKVARDVGVLGILGGQALIEN
FT                   VEGIWKELTDNVNAMALNLTTQVRNIANVTTAVAKGDLSKKVTADCKGEILNLKLTINQ
FT                   MVDRLQNFALEVTTLSREVGTLGILGGQANVQDVEGAWKAVTENVNLMATNLTNQVRSI
FT                   ATVTTAVAHGDLSQKIDVHAQGEILQLKNTINKMVDSLQLFASEVSKVARDVGINGKLG
FT                   IQAQVSDVDGLWKEITSNVNTMASNLTSQVRAFAQITAAATDGDFTRFITVEASGEMDA
FT                   LKTKINQMVLNLRESIQRNTAAREAAELANSAKSEFLANMSHEIRTPLNGIIGMTQLSL
FT                   DTELTQYQREMLSIVHNLANSLLTIIDDILDISKIEANRMTVEQIDFSLRGTVFGALKT
FT                   LAVKAIEKSLDLTYQCDSSFPDNLIGDSFRLRQVILNLAGNAIKFTKQGKVSVSVKKSS
FT                   KFTDDSEKLLLEVCVSDTGIGIEKDKLGLIFDTFCQADGSTTRKFGGTGLGLSISKQLI
FT                   HLMGGEIWVTSEYGSGSNFYFTVSVSPSNIRYTRQTEQLLPFSSHYILFVSTEHTDAEL
FT                   EDIRNGIIELGLNPVIVRDIRDASLTDPVKYDIIMIDSIDIAKNLRLLPEVKYIPLVLL
FT                   HHSIPELNMRVCIDLGISSYGNTPCTITDLASAIIPALESRSIAQNSDESVSYKILLAE
FT                   DNLVNQKLAVRILEKQGHQVEVVENGLEAYEAIRKKKYDVVLMDVQMPVMGGFEATEKI
FT                   RQWEKKSNPIDSLSFRTPIIALTAHAMLGDREKSLAKGMDDYVSKPLKPKLLMQTINKC
FT                   IHNINQLKELSKQNNSNRTSEFAKNLKKGSIKSGEHPNLLSNISSPTLVNAMTNGSNSS
FT                   RSTPPFSGSDSYGESPSIKKANSNDFIAKSRPGQLSMNSRSVTESQIPKAQSKEDGKDG
FT                   EYFSSKIETLE"
FT   gene            <239286..>240560
FT                   /locus_tag="PICST_63574"
FT   mRNA            <239286..>240560
FT                   /locus_tag="PICST_63574"
FT                   /product="predicted protein"
FT   CDS_pept        239286..240560
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63574"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63574"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68035"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYU0"
FT                   /protein_id="ABN68035.1"
FT                   /translation="MYPFQFVALPDKEALLRAYKNKKLNELPTPSVVIDRAVFQENCEK
FT                   MLANAERLKVDFRPHIKTHKTLEGARLQLGSGRRKSDKIIVSTMMEAWNLLPLVNEGLS
FT                   VTDFLYSLPVVKPRVAELAEFATKIPHLRLLIDHREQLDILSEWSEAHPHSKRWSVFIK
FT                   IDMGTHRAGLTNESHNLGETLQHILTDATSRKNIELYGFYCHAGHSYSSTTEDSAKELL
FT                   LEEIVQANHAAIAAKSIDPSLHLRLSVGATPTSHASEILTIEELESALGPNSLQGTLEL
FT                   HAGNYCCCDLQQLATGCIREENISLSVIAHVISTYPKRGEKTPGEQLINAGVVALSRES
FT                   GPIIGYGKVIEPAEYNNWIVGRLSQEHGILVPFDEHHATKFIPIGTQIRIVPQHSCITA
FT                   ASNPWFFIVDSGDVVVDVWVPFRGW"
FT   gene            <240792..>244040
FT                   /gene="DPOD"
FT                   /locus_tag="PICST_63206"
FT   mRNA            join(<240792..240851,240888..>244040)
FT                   /gene="DPOD"
FT                   /locus_tag="PICST_63206"
FT                   /product="DNA polymerase delta catalytic subunit (DNA
FT                   polymerase III)"
FT   CDS_pept        join(240792..240851,240888..244040)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="DPOD"
FT                   /locus_tag="PICST_63206"
FT                   /product="DNA polymerase delta catalytic subunit (DNA
FT                   polymerase III)"
FT                   /note="go_function nucleotide binding; DNA binding;
FT                   DNA-directed DNA polymerase activity; 3'-5' exonuclease
FT                   activity; go_process DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63206"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68036"
FT                   /db_xref="GOA:A3LYU1"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR025687"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYU1"
FT                   /protein_id="ABN68036.2"
FT                   /translation="MSQPKRPYNEFHQEQAHSLPLTTSQQQLLKKVRRPNGGEEPSEFE
FT                   RELLDMTQSAKEIEHEEDQKWGRPPLPETFDPTIDDVSFQQLDAEEFQIGDYTIARYFG
FT                   ITEEGHSVLCNVTGFVHYFYVPVPKGFYKDQHLDQFSSYLRANYEGVENIELALKESIW
FT                   GYNKSVKTPFFKFFINNTKNITKLRSAFERGEIRFENLFPPQNVSYDNINYLLRLMIDC
FT                   KVTGMSWVTLPKGKFSLVHSNDKVSTCQIECSINYKDLISHPSEGEWLKMAPLRILSFD
FT                   IECAGRKGIFPEAEHDPVIQIANVVSKHGESRPFVRNVFTVNTCSPIIGSQIFEHEKEE
FT                   DMLMNWKDFVVSVDADVIIGYNTANFDIPYLLDRAKALGLRNFPFFSRLKNSKQEAKDS
FT                   VFSSRAYGTRENKVVNIDGRMQLDLLQFIQREYKLRSYTLNSVSAHFLGEQKEDVQHSI
FT                   ITDLQNGTSETRRRLAVYCLKDAYLPLRLLDKLMCLVNYTEMARVTGVPFSYLLARGQQ
FT                   IKVISQLFRKCLEEDIVIPNMKSEGTNEEYEGATVIEPSRGYYDVPIATLDFSSLYPSI
FT                   MMAHNLCYTTLLNIQTIKAFNLTEDDYTRTPNGDYFVKDHKKQGILPTILNELLTARKK
FT                   AKADLKKETDPFKRDVLNGRQLALKISANSVYGFTGATIGKLPCLAISSSVTAFGREMI
FT                   EKTKNEVQEFYSKKNGYPYDAQVIYGDTDSVMVKFGYQDLETCMKLGEEAANYVSTKFK
FT                   KPIKLEFEKVYFPYLLINKKRYAGLYWTRPDKFDKMDTKGIETVRRDNCRLVQNVITKV
FT                   LEFILEDRDVEKAQRFVKQTIADLLQNRVDLSQLVITKAYAKHDYAAKQAHVELAERMK
FT                   KRDAGSAPTLGDRVAYVIIKGSGSDKNYEKSEDPLYVLENSLPIDVKYYLDNQLTKPLE
FT                   RIFNPILGDAKTKELLAGSHTRTIKMSAPKTGALMRFAKKSEVCVNCKTPLRSDNHGAL
FT                   CPNCIREGKGPTLYGNALSQMNYLENKFSRLWTECQRCQGSLHQEVLCSNNDCPIFYMR
FT                   KKAQKDVHQQSMELVKWENTVW"
FT   gene            <244327..244865
FT                   /locus_tag="PICST_66044"
FT   mRNA            <244327..244865
FT                   /locus_tag="PICST_66044"
FT                   /product="predicted protein"
FT   CDS_pept        244327..244815
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_66044"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_66044"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68037"
FT                   /db_xref="GOA:A3LYU2"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR010371"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYU2"
FT                   /protein_id="ABN68037.1"
FT                   /translation="MPHEIYSYTLEQLDELEGSKITLPEFNTEIAWKIGSYAREQSLVK
FT                   FPNKAIVIDIQLASGQVLFHTSTGAGATVDNDKWVERKVNVVNRFGKSSFFVGQKLRIK
FT                   KKPIEEAFLISSLEFATHGGCVPIRIKNLDSVVGTLTISGLAQEEDHLFALQVLENFA"
FT   gene            <245526..>247823
FT                   /locus_tag="PICST_33298"
FT   mRNA            <245526..>247823
FT                   /locus_tag="PICST_33298"
FT                   /product="predicted protein"
FT   CDS_pept        245526..247823
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33298"
FT                   /product="oligopeptide transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33298"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68038"
FT                   /db_xref="GOA:A3LYU3"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYU3"
FT                   /protein_id="ABN68038.1"
FT                   /translation="MSSSREKGSFSKTSIEKETYLPDIADEKVVDIENVHEESSDSENE
FT                   LDADVAELPKVVREIVPLEDDPSTPVMTFRYFLLSFIFIIPGAFISTMNSYRTTSAAYS
FT                   IFFVQIASHWVGKWLARVLPHKKVKIGRFSFNLNPGPWSIKETAMVTITASSGATGNQG
FT                   TSALSLAEIYYGEKVNAAVALFYMWAIVFVGYSYAAIARNFLLYDPQFVWPQALMQTTL
FT                   FQTQKRSDADSKLGSKQMKVFFAVLIGVTVWEFFPEFIFPMTSSLAFLCWVAPRNKTAN
FT                   FIGSGLGGMGFLNLTLDWSNITSSIMLSPYWIQVIQFLAFVVGAWILIPAAKWGNLSNF
FT                   KYGLMSNSLFMSNGTSYPTSQLLTADFRLNETAYAELGKVHIGAQRAWNMFFDYASYIS
FT                   GIIWVVVFGYDTLGNSFKKLIASFKDRKSNKGALSINLQYTDRLNKLQSKYNEVPLYWY
FT                   VVLFLASFITLLVIFATGQLFMPWWCLLVGLGFGSIIVTPLAWLYALSNFQLAIGTFNE
FT                   LLYGYMVQNSSVRHPAGAVTYGAIAGDAWYRAQYILQDQKIAHYMHLPPKAVFFSQIFG
FT                   ELIGVPINYAALRWVLSSKRDYLDGTKVDPLHQWTGQSIVSYQTNAVQYVILGPKRLFS
FT                   NYPMLPYAFLMGAGAPCVFFALHKLFPNSKLKFRLWNTTVFFSTLSIFFGNVSTGYLSQ
FT                   FIGGTITMFWAFRYRHNLWKRYNYLLAAACDTGYNLAILLIFIFFSAAKTVSMPNWWGN
FT                   NAVSIERCFALE"
FT   gene            <248095..>249249
FT                   /gene="MRP7"
FT                   /locus_tag="PICST_49247"
FT   mRNA            <248095..>249249
FT                   /gene="MRP7"
FT                   /locus_tag="PICST_49247"
FT                   /product="mitochondrial large ribosomal subunit"
FT   CDS_pept        248095..249249
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MRP7"
FT                   /locus_tag="PICST_49247"
FT                   /product="mitochondrial large ribosomal subunit"
FT                   /note="go_component intracellular; ribosome; go_function
FT                   structural constituent of ribosome; go_process protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49247"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68039"
FT                   /db_xref="GOA:A3LYU4"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="InterPro:IPR041244"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYU4"
FT                   /protein_id="ABN68039.1"
FT                   /translation="MSLFRKVGISCYPNISNLQVTSLGAVNQVRNATKKVSGSKTNKND
FT                   SAGRRLGPKAHEGNFVKPGQIIMRQRGSKIHPGENVKIGIDHTIYAVEPGYVRFYHDPF
FT                   HPLRKYVGVSLKKDLNLPTPHFSPRVRRFGYELLTEPSEAKKEEDHMSRKEYTYQPKLE
FT                   EALKAENELKSRITSEFEDALRNKFKLVLNQEDLKVALTRFYDIFQLVKIGKPVEDAKI
FT                   QATYNFIHDLKLTERRAEISADEFLSKKAYFEKFFSSLDSQVTVDVDGSLIAYIAEEER
FT                   QSERQRISKTLHSTYSNRVLSVKERKEVESLICTPGVFDLLQRYQLRTKYTPSVVPFSV
FT                   PDSVIEITDVKNPPEGVIIQKIFDEAARSTRIVGRPREVFAFRK"
FT   gene            <249453..>250028
FT                   /locus_tag="PICST_36928"
FT   mRNA            <249453..>250028
FT                   /locus_tag="PICST_36928"
FT                   /product="predicted protein"
FT   CDS_pept        249453..250028
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_36928"
FT                   /product="predicted protein"
FT                   /note="go_component integral to membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36928"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68040"
FT                   /db_xref="GOA:A3LYU5"
FT                   /db_xref="InterPro:IPR004932"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYU5"
FT                   /protein_id="ABN68040.1"
FT                   /translation="MAIDFSASWIQENPAYQQFVKVEVTYQKFLDQAVPHTTNRWIGTA
FT                   ILLSLFLLRIFVSQGWYIICYALGIYLLNLFLAFLTPKFDPSLEQELRNESIEEGVIED
FT                   EPTQEDEEFRPFIRRLPEFKFWYNGTRATVLALFLSFWSIFDIPVFWPILLMYFIILFT
FT                   LTMRKQIQHMIKYKYLPFDFGKTRYRRN"
FT   gene            251217..>254352
FT                   /locus_tag="PICST_85048"
FT   mRNA            251217..>254352
FT                   /locus_tag="PICST_85048"
FT                   /product="predicted protein"
FT   CDS_pept        251218..254352
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85048"
FT                   /product="structural constituent of cytoskeleton"
FT                   /note="go_function actin binding; phospholipid binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85048"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68041"
FT                   /db_xref="GOA:A3LYU6"
FT                   /db_xref="InterPro:IPR002558"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR011417"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="InterPro:IPR030224"
FT                   /db_xref="InterPro:IPR035964"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYU6"
FT                   /protein_id="ABN68041.2"
FT                   /translation="MSRAEVDLQNSVKKACNNDEVPPKRKHVRACIVYTWDHKNSRAFW
FT                   NAVKIQPLQSDEVQLFKALIMIHKVLQEGHPNTLKDAYRNRDFLSSLSSVFPSHGTAYG
FT                   RLINQYDRFILQKLDFHRNNPGFNGIFEYEEYISLRAVNDPNEGFESIFQLMDLQDSIN
FT                   DLQKLIFATINQTPNNLCKVSALVPLISESYGIYKFCTSMLRAMYQQLGDDEALKMLFE
FT                   RFDSQHFVLRDFYTDCHAIKFLTSLITIPRLSNNPPNLQVTDEGTPISRPRSVSTENTP
FT                   QISSQPTSNFEAPPNPPPAVDQLFNQQTGILFQQQQEQERIQRDLEMQRLQQLEQQQLQ
FT                   QRLFEEQQREQEKRFVQEQQALQQQQSQQQQTRVSELEHDLLMFKNQYDNDQSLLQQYD
FT                   ARVKNLETELMNFNNTATQQIASKDEQIKNLEDQILNWTKKYESLAKLYSQLRQEHLNL
FT                   LSKFKKIQQKINSAQESILKKEKFEKDLKAKTVELADLIRERDRARMDLDRVRASKDQE
FT                   IENLNAELRELNSQASESGKLQSLNLSNIISKHETEMNSLRRELAQKDLRLKDAGDSFE
FT                   LQDRLKEKDIELEIAQESLKYALEELSISKNDNEDVVNAEIDHILLKNIDKLRNLIDIF
FT                   LENNIKRVQDIKHELSSPMQAGNLNSTPEYLLSIVELCQDTANDFATTFNSFIAEGKQA
FT                   YDDNDNTYSEIILSSSELTASVNDLMLNSKGITKSIQKSEEDNLLSLVSNTLSSTEKYF
FT                   RELKSDRLNTFSDDEDRIDSVIDSNLTLQNDLQAIVQFVESLSSNRGISRSGNLEDLLN
FT                   NEMEHTAQTVDSASKFLDKLLQNPNIHGGNLEVHEALLSAAKAVTLAVTLLISAATESQ
FT                   REIVNKGRGSQSRIEFYKKNSRWTEGLISASKAVAGATNVLIQTADGVLSESNSHEQLI
FT                   VASNEVAASTAQLVAASRVKANFTSKTQENLEVASSKVSTACKSLVSKVQALLEVEESS
FT                   QHDVDLSKLTPYEGKTIEMEQQVEILKLENKLNAARKRLGEIRKHGYRDDDSDNE"
FT   gene            complement(<255444..>258135)
FT                   /gene="POL5.2"
FT                   /locus_tag="PICST_33302"
FT   mRNA            complement(join(<255444..257730,258113..>258135))
FT                   /gene="POL5.2"
FT                   /locus_tag="PICST_33302"
FT                   /product="RNA-directed DNA polymerase Tps5.2"
FT   CDS_pept        complement(join(255444..257730,258113..258135))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="POL5.2"
FT                   /locus_tag="PICST_33302"
FT                   /product="RNA-directed DNA polymerase Tps5.2"
FT                   /note="Part of Tps5 polyprotein; 29 other similar fragments
FT                   in chromosome; go_function DNA binding |3677"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33302"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68228"
FT                   /db_xref="GOA:A3LYU7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025724"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR039537"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYU7"
FT                   /protein_id="ABN68228.2"
FT                   /translation="MSWFRWLYTQNLLTSAVTTTGDKLVISHDDIVHPKYGQLATRDSR
FT                   NLYLSCLEIVSPSTVSRANHSAYSATAPVSASALVHARLGHPSPTVVRSALKYPNMPRT
FT                   AVHDSISCEACLSSKSTRVIPKTTTGPVTFAPLQLLHCDLSGPHAGGPSSLFYFCILLD
FT                   DFTRFKAVGPILKKSDAADFIIKVIKAWTNHFSSRGGYRVCNFRSDNGGEFVNSTLTSF
FT                   FAAEGSQTQLTVPGNSHQNGRAERAIRSVLDKTRTMITASSLPSPLYPHALQHAAFLLN
FT                   RLPTPVLQNRPPFELWHGARPILSQLKVFGCAAFVNVPPNHRQSKLVARAIKGVYLGSD
FT                   PFRKAHLVYDLATRQVITSSHVRFQENVFLFARPSTSTVVSATSIGGGGSGGGSFPSIS
FT                   APAPGLTQGPRVSSPPSPSPPSTPSDSTVAQSPGSSAASSSASAPVSPAASTTPSSQPP
FT                   STPTPVPSPISVPSPTPAPTSAPVPSDTSVPSTSAALTAPSRAVVSAQRSDSPPSDSYE
FT                   SSDDSYTAPASREVPTLTASREVPTLTAPRKVPSLPSTRKVPSLPAPRTVPSLPAPRTV
FT                   PSLLPVPRNRLSAPTAPLGLPHPAVEAPPTIPGSSSAIPMEIDSTYTEPESMSEDGYGM
FT                   EVVSDQEFFDAPEQYGTHPRSSPLISTRSSMDVSSDQEEYPDPSTYMDIVVMDSDDFSS
FT                   YHDSEMEDASDMDPLPLIRPTSNMEMEDASDTVSSTPHLLLYPCLRHFIVHSFYPCPSI
FT                   LASDSFAIAIGSLGAT"
FT   gene            <268360..>269503
FT                   /gene="RTP1"
FT                   /locus_tag="PICST_33305"
FT   mRNA            join(<268360..268890,269486..>269503)
FT                   /gene="RTP1"
FT                   /locus_tag="PICST_33305"
FT                   /product="retrotransposon"
FT   CDS_pept        join(268360..268890,269486..269503)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RTP1"
FT                   /locus_tag="PICST_33305"
FT                   /product="retrotransposon"
FT                   /note="Pichia stipitis transposon polyprotein 5 (Tps5)
FT                   (TCA5)(TDH5) retrotransposon polyprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33305"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68042"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYU8"
FT                   /protein_id="ABN68042.2"
FT                   /translation="MNNPIQSTELPKQTVQQVMSQLNSGLMVIDTLLLRGRENFSEWKD
FT                   WMTGMFSSCVLATEIAAYLSEKELSITFTDQQALSHKLRELILKCMKPDVQSLFTHYSS
FT                   GVETWKAVETKYAIASSRDAVGYLKYLFGRLADPTITTEAGFLIAEKLTAFMTKYDNDS
FT                   MKALLFLYGTGNSKDLQPF"
FT   gene            complement(<272888..>273466)
FT                   /locus_tag="PICST_14352"
FT   mRNA            complement(<272888..>273466)
FT                   /locus_tag="PICST_14352"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<272888..>273466)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_14352"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_14352"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68229"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYU9"
FT                   /protein_id="ABN68229.2"
FT                   /translation="PSSQPPSTPTPVPSPISVPSPTPAPASTPVPSSAPVPSSAPVPSS
FT                   APVPSSAPVPSDTSVPSTSAALTAPSRAVVSAQRSDSPPSDSYESSDDSYTAPASREVP
FT                   TLTAPRTVPSLPAPRKVPSLPAPRKVPSLPSTRKVPSLPAPRTVPSLPAPRTVPSLLPV
FT                   PRNILSAPTAPLGLPHPAVKAPSPIPGSSS"
FT   gene            complement(289165..289946)
FT                   /locus_tag="PICST_73528"
FT   mRNA            complement(289165..289946)
FT                   /locus_tag="PICST_73528"
FT                   /product="predicted protein"
FT   CDS_pept        complement(289745..>289945)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_73528"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73528"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68230"
FT                   /db_xref="GOA:A3LYV0"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYV0"
FT                   /protein_id="ABN68230.2"
FT                   /translation="LCRSLRRLLRRCLLLFWYLLLLRLSLLLRYLLSLRYLLSLRYLLS
FT                   LRYLLSLRYLSILWYLLLSRL"
FT   gene            complement(<299534..>301525)
FT                   /locus_tag="PICST_33311"
FT   mRNA            complement(<299534..>301525)
FT                   /locus_tag="PICST_33311"
FT                   /product="predicted protein"
FT   CDS_pept        complement(299534..301525)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33311"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33311"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68231"
FT                   /db_xref="GOA:A3LYV1"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032319"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYV1"
FT                   /protein_id="ABN68231.2"
FT                   /translation="MSAYAALKDTSSIASIFHEAEDGEDTDIVRYELNSSDEEAEIPTI
FT                   VDTNSIRASSAPKVSYKPSNSISHSRFIPSSENLIFGEDEVIIGLKVNEFVVLNGQCEL
FT                   NVQRGAVLMNNHHYMFAEPIYYKIFAPASQSLPVISSTQVLDRSIGIQDTMTPENSHLF
FT                   NSDYKSVIVLRNFHTGAENIGEYYSPFKRLLYSKLIFDESDEIGDYEKLFFRYSFEIIL
FT                   RDRGFNALYLDRPWSATIERLGHSMNKQQLPKVIMIIGNKNSGKSTASKAILNTLLLRG
FT                   DSPVSYLELDPGQPEFSYPYSLSLREITKPVFGMCLPSSSSCSIENTVEHYFGFSSPIH
FT                   EPKQYIRIIKSLIKSYRKLHALKGNHLVINTPGWIRGYGKEILMEVTQIVNPDFLLLLT
FT                   SSLDKDHPDNLEILQNLHYQNLDILPGIFNTSKYSPSQIRNFSKLLYFHQLEAEKFDFN
FT                   GHILDSSPFRISYETVNSVETFTGVSSFTMLNFDVGKDFNYEDIVLMMDSTIVGVYLVD
FT                   AEVHHTIKNYRHPSTLHNTLPLYLNSSQFVAIVGGNDSQGILYMGLSMIHSINRTLNYL
FT                   NMYMPCQNSDKIKSLIEHGYTVYLVRGEGEIPSSEILNSTLLIKQISSQSAKSNIIPVP
FT                   YPYVSFEKKSRIGGIWKIRRNVKRRAYQ"
FT   gene            302512..304065
FT                   /gene="GLK1"
FT                   /locus_tag="PICST_73701"
FT   mRNA            302512..304065
FT                   /gene="GLK1"
FT                   /locus_tag="PICST_73701"
FT                   /product="Glucokinase"
FT                   /note="Has EST support"
FT   CDS_pept        302545..303960
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="GLK1"
FT                   /locus_tag="PICST_73701"
FT                   /product="Glucokinase"
FT                   /note="go_function hexokinase activity; ATP binding;
FT                   go_process glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73701"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68043"
FT                   /db_xref="GOA:A3LYV2"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR019807"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYV2"
FT                   /protein_id="ABN68043.1"
FT                   /translation="MNIELEAAVEEIVKQFAIDKDFLVEATKHFHESMSAGLATSTPTR
FT                   DYMPMIPTYVTGIPTGKEKGLYLAADLGGTNFRVCSIHLGGDHTFEMKQSKYKIPVDLM
FT                   QGEDATADGLFNYLAEKVKTFLDQHHNEHAEQLKLGFTFSFPVNQTALNRGTLIRWTKG
FT                   FDLPDCVDKDVVELLQKHMELLGVKVHVAALANDTVGTLLSRAYSNDISKTNSNTVVGA
FT                   IFGTGTNGAYFETLKNIPKLKKEDIPEGAKGMVINTEWGSFDNTLKILPCTKYDKLVDD
FT                   ETANVGYHLFEKRISGMFLGELLRVALMDLFDRGLIFQELYKARGGTLPHRIFEPWLIS
FT                   AEVLSYLQIDDSTDLKMSELVLENHLRLPTNKEERLVIQKLTQSISHRAAYLSAIPLAS
FT                   IVARVQDQYKDDDRDFEFGCDGSVVEFYPGFRSKILEAVALIDPLKGSSKKIHLRIAKD
FT                   GSGVGAALCASVS"
FT   gene            <304203..>305633
FT                   /locus_tag="PICST_49945"
FT   mRNA            <304203..>305633
FT                   /locus_tag="PICST_49945"
FT                   /product="predicted protein"
FT   CDS_pept        304203..305633
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49945"
FT                   /product="predicted protein"
FT                   /note="go_component membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49945"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68044"
FT                   /db_xref="GOA:A3LYV3"
FT                   /db_xref="InterPro:IPR005052"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR035661"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYV3"
FT                   /protein_id="ABN68044.2"
FT                   /translation="MNWKLYLLSVAPFVHFSQGLLPELEIEPELSNNEQNVSPLSLPNL
FT                   LNIQKLTELHENWNILGEVRLDTGRLLIENTGGIWSIPYLEGTKDWTVELVFRSTGSGT
FT                   SDLQFSATNGLSFWLINPDNSLPISSQNVDNFGGPSEYDGFQFLVNNQDINGLKIFNND
FT                   GSKRVDNKLEKSVGSCAFNFLDSSIPFTMRVSYSEPKKWFKVQIDNELCFKTDQIVFPN
FT                   DISNFVLGITGSVDKSSKEIFEILRLEVWNHLTNDAIDDHGLMSEGQVHVTVASTPEEV
FT                   VPSRIVRESLLERNRKHREEIQRQIQEDNNSLKDVHQKLDHLEIILETLEKSVSYDTKS
FT                   IDSQIQELKLVQNEQRKIVSELGKNLENFEQTITQQYSQMLGAFSKLNEKVIGEVREQH
FT                   YGMEELSRKVDLLMSNHREISDQYKHQNAHTIESREDMSNLINSVVKFFLIPVVIALIA
FT                   LTIFVYKVKHEIKHSKLL"
FT   gene            complement(<305721..>308363)
FT                   /locus_tag="PICST_33314"
FT   mRNA            complement(<305721..>308363)
FT                   /locus_tag="PICST_33314"
FT                   /product="predicted protein"
FT   CDS_pept        complement(305721..308363)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33314"
FT                   /product="predicted protein"
FT                   /note="go_process intracellular signaling cascade"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33314"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68232"
FT                   /db_xref="GOA:A3LYV4"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR001060"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR031160"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYV4"
FT                   /protein_id="ABN68232.2"
FT                   /translation="MSLANSFWTQDYESGFRILFDQLYQGVSENEDFVQLFTKRMESEL
FT                   LYGTQLEAIEKSVVRRSSKRQNNDDYVSSIKNAFQKVNENFTKQGELHLQIASNIKLLV
FT                   LEPFEKWCKEHKQRVEYSESVILDKNKVFKNAKHSLEKLQKRYFNKCRMLEEFKSHYGE
FT                   DELNEELKDFSFSESIEKGDSKEEENIEDEEDSTKYQIAGTDFDHRSLKQLLKNILNGI
FT                   ELASHKVPILGTYQNVSTGSAITQWLLDNREDLNRNIVKAEQFGQGLVNLGFIRLIGTM
FT                   GNKNFINSSQFYYQWKPIVFELTKLTNMETAVSGDDVSRETSLVNKAQFQDYFDDVKEA
FT                   IGVGSVDYSDISQLSKLISEVNQLDSHYYKKAVELDKIRCDYEELIMDHLTFMQKCEFD
FT                   RLKAIKKVTFDFLSSFANKVTSMKSACDELLILEETINPTNDLKFLIENYATGNFKPHV
FT                   ILYDNYYNSNINQTFGVDLSVKSRLDRKVVPIIIQSILSHLDKVYPGLANDEERINLWT
FT                   HPIHLSNVHSLRFQINNVNDPSIIQEILSQVHPMIITNVLKLYFMELPDSVVPHSYYDL
FT                   IKSLYQNYPVNDPSKTNHRINGLQNVLVDLPKSNLATLDAILTHLNRLIQIIGAKDGEL
FT                   ANSLQVKLSKEFGSLILRPKVDSMNVDISRNLHNDKHQINFINDLFENKETIFKELRRR
FT                   NSTRQVNSNTPSREPSVTSRLTPRSSLVASSKSRLESKFQSAIHRTKKTDSSNKFGSAS
FT                   DENGSPSYDSEADSTPPPITPKKAEPNSLKRSTSPNKKKLNTLLSEEKLSVVSSRSPKK
FT                   DNSGDSGNGSISDLAQPAAPSLSRKTSVRNSASHFDSPSSEVSEDRAESPSREAKLRKD
FT                   SKSEVIVVD"
FT   gene            complement(308563..310865)
FT                   /locus_tag="PICST_73592"
FT   mRNA            complement(308563..310865)
FT                   /locus_tag="PICST_73592"
FT                   /product="predicted protein"
FT   CDS_pept        complement(308637..310856)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_73592"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73592"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68233"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYV5"
FT                   /protein_id="ABN68233.2"
FT                   /translation="MAAFEIVNPSYPATARFVNASKVQLEIGAPEDGDEPDWNILIPKF
FT                   GFPIFQLEDNNYYVLIKHIAEILNFPSSYQLIAAFVARSGLPKDVFTLTTSKELNSYLS
FT                   KSNAITKSEVRFKLFYAKLDTIYSIIKNKESLFVEVPVPSKDEASVPEVKKVEEKASQD
FT                   PSKAANDEDDEDDDENGNDKEDEDEDDEEEEDDEEEEEEEKIVVNKRSDYKAASPNEKV
FT                   TVSQAFPQYGLVDSSLQLNHATFNSLNSLTKLNYYKTLQASSYKFLPNSKLNFAERELV
FT                   IRDHDYLEIQIEGDENEQQDRKRIRKPIGKSKKHNINIDPNSMDLAESVIPGQGYIQEF
FT                   SVNHLCKVPNYYITSNQQNVSSSSSSTSLFNLKRINSASNSSFLFNENIKMSKNIQQLV
FT                   FSNDSDTYHHSKYFYTKSYRGPGSGNYKDAALMNRINKIHLIADPLRVTHKTKISKSAS
FT                   KRYNQNLKGLIYEKYNKYWVDSVLNKQRKYTEDYLNLEILHNNLQFNLLVNSYREISED
FT                   TWQNYYKFKTSDYEQLRALQREHDEIELRNRDIEKRREWELHERERQEKLRSLVEQTRT
FT                   EKENIQRERIQRQKDSEEKRRQRQLEATFNDPFSNESSSSIPEVSTSDLDEKERELDEK
FT                   FQTEKLELVHPAPLPMPIETPQLDAVNRFTAPTFYPEIVKKLPMGLRKAVLHNKEDIPA
FT                   IKKPVRYVTTYPDKNNPEILNRIEILKLPNSNSVGWDNLKKFHED"
FT   gene            <311116..>311658
FT                   /locus_tag="PICST_62979"
FT   mRNA            <311116..>311658
FT                   /locus_tag="PICST_62979"
FT                   /product="predicted protein"
FT   CDS_pept        311116..311658
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62979"
FT                   /product="predicted protein"
FT                   /note="go_function GTP binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62979"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68045"
FT                   /db_xref="GOA:A3LYV6"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYV6"
FT                   /protein_id="ABN68045.1"
FT                   /translation="MGLSFSKLFSGLFGRKEMRILMVGLDAAGKTTILYKLKLGEIVTT
FT                   IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRYYFQNTQGIIFVVDSNDRDRIGEAR
FT                   EELQQMLNEDELRDALLLVFANKQDLPNAMNAAEITEKLGLHSIRQRPWYIQATCATTG
FT                   DGLYEGLEWLSTNLKNA"
FT   gene            <312828..>313652
FT                   /locus_tag="PICST_63463"
FT   mRNA            <312828..>313652
FT                   /locus_tag="PICST_63463"
FT                   /product="predicted protein"
FT   CDS_pept        312828..313652
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63463"
FT                   /product="predicted protein"
FT                   /note="go_function catalytic activity; go_process
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63463"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68046"
FT                   /db_xref="GOA:A3LYV7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYV7"
FT                   /protein_id="ABN68046.2"
FT                   /translation="MEGEDILYEVRGKVTIITFNIPQKLNALNGEQYLLLAKLVERADK
FT                   EEDTILTLIQSSGRFFSAGANFADKSLANTDAADLFSHEYWLNRFVARNTYLTELFHNH
FT                   RKILAAAVNGPVIGLSASLLALCDLIYVKEEKDFYILTPFANLGLVAEGAASATLFLRL
FT                   GWSKASEALLLAKPISGKDLNNLGFINKTYDGQFKTTEEFNQAVHDELVNAFENLHFDS
FT                   IIQNKQLLKSNRDQLITSANSKEVIRGFNKWIEGVPQGRFVQLAQKDIKHKF"
FT   gene            <314509..>316743
FT                   /locus_tag="PICST_63276"
FT   mRNA            join(<314509..314611,314654..315652,315680..>316743)
FT                   /locus_tag="PICST_63276"
FT                   /product="predicted protein"
FT   CDS_pept        join(314509..314611,314654..315652,315680..316743)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63276"
FT                   /product="predicted protein"
FT                   /note="go_function molecular function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63276"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68047"
FT                   /db_xref="GOA:A3LYV8"
FT                   /db_xref="InterPro:IPR005365"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LYV8"
FT                   /protein_id="ABN68047.2"
FT                   /translation="MSYNLPNPSLIGILLIISTHSGPQLIYKQPPGLTKEPDEDEGEYD
FT                   QEDIAETESDEYGNYFEYDEDSNMYGTNLYKQWDANHLNYYMGTKKDLISFLDEIETKR
FT                   KQASMKAVAKKRSQLSKIASNPSTISTTGNSGNDSIFGIEPAYLCEMLAPPKKMCNSRF
FT                   EIMIDDKIFLGLPVHKYDNGSWRLKGSSKRINRNKEENTHQHEVDNSKSKLNLNMFHLV
FT                   FIMNPPVIEYNYRIDEMFHYVISRLSLVLRYEQSKNDFISNQVKMILNLKEQFKEKEEL
FT                   ESQLLNKSSLCKMIHDCYLSISQSKIANLSVNNKLRSFQIPIKTEFHSLPESSVPFIPG
FT                   SHLSSTVGLLGTTGLINVGETTRYGEAMNDENEGISEAADDIVYFALLLLDDAESIIRD
FT                   IKTESSGTLAKFIRMINPTESLLKLSTRSNSLDTLQVKSFAFHLIYWRRARVIQPLSTR
FT                   SVYFVSPMAPITTNLYTDIREFKKSFPTLPSLPQFLKLLSPQSKKPSQFATVIPSKDHR
FT                   DIYFEALSWLIRFGYVTQLQTFIWLKISRKIKIKVEEDLENESSSRKRSNITKKLLMGG
FT                   TDNSSKDPAAESSTDNRIMDQNDDKEENATKQLSNINAEDQEIENIKERLKSTSLGPLV
FT                   SLEDDDDTILLDPGRATTLERRWINKIIFDECKLSSELTNAFYKLLKYMDGKSPLELLL
FT                   LKENISRTEIRKLLIAIEDHIISVRHW"
FT   gene            complement(<316805..>324031)
FT                   /locus_tag="PICST_33319"
FT   mRNA            complement(<316805..>324031)
FT                   /locus_tag="PICST_33319"
FT                   /product="predicted protein"
FT   CDS_pept        complement(316805..324031)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33319"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33319"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68234"
FT                   /db_xref="GOA:A3LYV9"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012591"
FT                   /db_xref="InterPro:IPR012592"
FT                   /db_xref="InterPro:IPR012984"
FT                   /db_xref="InterPro:IPR019580"
FT                   /db_xref="InterPro:IPR019581"
FT                   /db_xref="InterPro:IPR019582"
FT                   /db_xref="InterPro:IPR021983"
FT                   /db_xref="InterPro:IPR027652"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="InterPro:IPR042516"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYV9"
FT                   /protein_id="ABN68234.2"
FT                   /translation="MGRKLPPPPPPPPPPRAQNRNGVIGRVNPRHPPPPPPPPPSSSAS
FT                   VPSSTAINRNPPPLRPPPPPPRPPTSGLAEKRIKTSDNVTSEELDARSRRWLQLQKSRY
FT                   KSISSKGDAPATGQKPQMPPEHLRKIMIDHGDLSSKKVASDKRAHLGSLRYVPHAILKL
FT                   LENMPQPWEQSKDVKVLYHISGAITFVDEVPRVIEPVYTAQWATVWSAMRREKRDRRHF
FT                   KRMRFPPFDDEEPPLDWSENLEDVEPQDSIRLPLGSQRESAVIDWMYDGKPLMDDPNIV
FT                   NGDSYRLWNLDLAKMACLYRLSKPILSERSGLTNVHLFDKNALFTAKSLNVALPGGPKF
FT                   EPLFKDKSENLATEDFTEFNSIDRIIIRIPVRTEYKVAFPYLYNSFVKGVHVSWYHDPV
FT                   KCYVESSDPVATSFTFQHYFNSITQLKCTGPDLESKDLDLCGLVPFMGKEYDEQSDCYV
FT                   DTEVEPEGTSDALQLWWAPYPFNRRSGRMIRAEDVALTKSWYKERAPRDSNIKVRVSYQ
FT                   KLLKNYVLNELHNPPGKRTGSMSRNRSKAKLLKNLRATKYFQQTNIDWVEAGLQVCRQG
FT                   FNMLNLLIHRKGLTYLHLDYNFNLKPTKTLTTKERKKSRFGNAFHLIREILRVIKIVVD
FT                   SHVQFRLGNVDAFQLADGIYYILNHLGQLTGIYRYKYKVMHQIRACKDLKHIVYSRFNK
FT                   MIGKGPGCGFWQPAWRIWISFLRGIVPLLERWLGNLLARQFEGRRSNDVAKTITKQRVD
FT                   SYYDLELRSQVMHDILDMIPDGLKQNKSKTILQHLSEAWRCWKANIPWNVPGLPTPIEN
FT                   IIRRYIQAKADGWVSVAHYNRERIRQGTTVEKTVAKKNLGRLTRLWIKNEQERQSNFAK
FT                   DGPYVSPNEAVAIFQAMVNWLESRKFSPIPFPPLSYKHDTKLLVLALENLKESYNPEAR
FT                   LNSAQREELALIEQAYDNPHECLARVKKFLLTQRIFKEVGLEMMDYYSHLVPTYAVDPL
FT                   EKITDAYLDQYLWYEADKRKLFPNWVKPSDDEIPPLLVYKWVQGINNLQNVWNTSDGEC
FT                   NVMLETSLERLTEKIDFTLLNRLLRLIVDPNIADYITSKNNVNLSYKDMNHINQFGLLR
FT                   GLQFASFVYQYYGLVIDLLILGPERASEISGPAAQPNSFLQFKDIDAETSSPIRLYSRY
FT                   LDKIHIFFRFDNESANDLIQDYLSENPDTNFENVVGYNNKRCWPKDSRMRLMRHDVNLG
FT                   RAVFWEIASRIPRSLTSIEWKDSFASVYSRDNPNLLFTMCGFEVRILPKFRAKEEISSQ
FT                   EGVWDLIDQSTKERTARAYLQVSQDEIDKFNNRIRQVLMSSGSTTFTKVAAKWNTALIA
FT                   LFSYFREAAVSTEALLDVLVKCETKIQNRVKMGLNSKMPSRFPPAVFYTPKELGGLGML
FT                   SASHILIPSSDLRWSKQTDTGITHFRAGMSHEEEKMIPTIFRYITSWENEFLDSQRVWA
FT                   EYAIKRAEALEQNRRLTFEDMENNWDRGLPRISTLFQKDRHTLAYDKGHRIRRQFKQFS
FT                   LARFNPFWWTNNHHDGKLWNLNAYRTDVIQALGGIETILEHTLFKGTGFDSWEGLFWEK
FT                   ASGFEDSLKFKKLTNAQRSGLSQIPNRRFTLWWSPTINRANVYVGFLVQLDLTGIFLHG
FT                   KIPTLKISLIQIFRAHLWQKIHESIVQDLCQVLDKELEVLQINAVEKQAIHPRKSYKMN
FT                   SSCADIVLSSTYKWNVSRPSSLNDKNDNMELQANKFWIDVQLRYGDYDSHDISRYARSK
FT                   FLDYTTDSSSTYPSPTGIVIAIDLAYNMYDAYGNWIPGLKPLVQNAMKEVMKANPALYV
FT                   LRERIRKGLQLYQTQPQEAYLNSNNYAELFNNETQLFVDDTNVYRVTVHKTFEGNLTTK
FT                   PINGSIFILNPKSGQLFLKVIHTSVWSGQKRLGQLAKWKTAEEIAALIRSLPREEQPKQ
FT                   LIVTRKGMLDPLEVHMLDFPNISIRPSELHLPFASAMKIDKLADIVLKANEPQMVLFNL
FT                   YDDWLNDISPYTAFSRVILLLRAMGIDQENTKLILHPDANVVTQDYHIWPTLTDEQWID
FT                   VESQLRDLILSDYSKKHNVNVQSLTQSEIRDLILGQDIRAPSVKRQEIAEIEAAPEEST
FT                   NKELTALKTTTTNVHGEEIVTVTTTNYEQQTFSSKNEWRNRAIASSNLHLRSKNIYVSS
FT                   ENFVDDGSFTYILPKNILKKFIQISDLRIQVGAFLYGKSPVDNNEVKEIKCIAIVPQLG
FT                   NSTSIQFPKQLPDQVGPLENLELLGWIHTQSQDLGYLSPIDITSTSSFFDNYDPNFITL
FT                   AVSFTPGSVSLAAFELSEEGFKWGKTNTDFMSPNPTGFSTNFGKKGQLILSDRIAGSFA
FT                   VPDDNLWNYFFTGAVWNPNNLYVLKLDVPLSFYNELHRPIHFTTFNEIENNDLEADQEN
FT                   VFA"
FT   gene            <324539..>326671
FT                   /locus_tag="PICST_63549"
FT   mRNA            <324539..>326671
FT                   /locus_tag="PICST_63549"
FT                   /product="predicted protein"
FT   CDS_pept        324539..326671
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63549"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63549"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68048"
FT                   /db_xref="GOA:A3LYW0"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYW0"
FT                   /protein_id="ABN68048.2"
FT                   /translation="MASTNTMRNQQLAMNLNRRVMYNSKSADLLKKLTIISLRIAVISL
FT                   LLYNCYNVLVTLNLLGHIGIPGNSLPWIYQVIPDRFFIYDPEFFCNNKYMKTPSTQVLI
FT                   GPTSDMYWPIFLTFCLSSFTETFISSVQGKKPYTEGGLTIFEHSLAFQEFSSRGAFFFG
FT                   SSKYHVRPTEQLLLSSLFSILNHLNIHIGGLINNNKYRLIPSSILGISFLGYFISALVN
FT                   WKIMDFPAILIMTFIPQVLVLSIILISAVIFVTAIVANGFRLQDLNYASLFLYESREDS
FT                   DISFQSLTFSLSDDFYTALLNVGGLAVTSAGKSSYITELSLVAVDNETWIERNLWEKIM
FT                   LVAKAINKNPKTVNSNDVVSYLKENGLSGYGNLIDKPSQRLIAAVADEDFQNDLNSNKM
FT                   SVFRRRYSSTKEIIVNFSDLFYSLFTDKIFFSFIPNLFRQYTLGEKLAVVQPPEFETAI
FT                   EFGERKRSLPLFLRKFAKRRTASHENDMSVELDINILSDKTIDENYLQLLGGDPLPETD
FT                   YSGDFNLNDYSNSDYESEAESIEVTSNANPGSGRSPMPVLETKEDDPINELISGEEFKE
FT                   LITSPNFTILHHHLNSESTGVMTRSRYHRLVKSSLTSGVAPEEQTNEDDGLKLLEIIIN
FT                   KRTSKPQENTADHDESFSDRFECVICQTNPREIIVWPCKCFAICESCRLTLVSKGIEGC
FT                   VCCRREVEGVSKVFIP"
FT   gene            327341..329430
FT                   /gene="LCB1"
FT                   /locus_tag="PICST_90811"
FT   mRNA            327341..329430
FT                   /gene="LCB1"
FT                   /locus_tag="PICST_90811"
FT                   /product="serine palmitoyltransferase component"
FT                   /note="Has EST support; catalyses the committed step in
FT                   sphingolipid synthesis, the condensation of serine with
FT                   palmitoyl-CoA to form 3-ketosphinganine"
FT   CDS_pept        327572..329311
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="LCB1"
FT                   /locus_tag="PICST_90811"
FT                   /product="serine palmitoyltransferase component"
FT                   /EC_number="2.3.1.50"
FT                   /note="catalyses the committed step in sphingolipid
FT                   synthesis, the condensation of serine with palmitoyl-CoA to
FT                   form 3-ketosphinganine"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90811"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68049"
FT                   /db_xref="GOA:A3LYW1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYW1"
FT                   /protein_id="ABN68049.2"
FT                   /translation="MSDVVFTTTTTTTTTTTLAPTWDLVEATIAENFVRYLDSLGNLPG
FT                   GQIILRYIKSSYKNDPIRSLFELALFIFALNYFLSSKKKENKSELVKFSQREIDELCDE
FT                   WVPEPLIKELSDLEKWQMYSIPTIEGHNGSHVTINNKKVVNLASSDFLNLNESESVKEA
FT                   AKSTISNTGVGACGPPNFYGTQDVHVRLEEDIAKYLDGENSILYGQDFVTAGSVIPAFL
FT                   KRGDLCVVDSGVNFAIQKALIVSRCNIEWYDHNDMDHLEEILTEIKPVMDKQRPIRRRF
FT                   IVTEGLFANSGDVVNLPRIIELKNKFKYRLFLDETLSIGVLGATGKGVVEHYGVPREEI
FT                   SITIGSMAMSFASSGGFCVGANPMVLHQRIQSIAYVFSASLPPYAAKVASQAIKEITSN
FT                   LNADGSSVIVSQLQKKVTFAYEKLVSLSKSSKFFEVASGPHSPIIHLALNTQYREELNL
FT                   PTLYGSPVFLSTGKPSKFLNEFDDYYNIESFLLQKVIDYVLDHSSTLISRSKLILEHEN
FT                   LPVLAPRLQIYINNGVTTEELSRLVQILPIAFNEVLKNVDSELKLISLNSEIGNYKPHY
FT                   INY"
FT   gene            complement(<329456..>331192)
FT                   /locus_tag="PICST_63396"
FT   mRNA            complement(join(<329456..329742,329776..330769,
FT                   330818..>331192))
FT                   /locus_tag="PICST_63396"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(329456..329742,329776..330769,
FT                   330818..331192))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63396"
FT                   /product="predicted protein"
FT                   /note="go_component anaphase-promoting complex; go_process
FT                   regulation of mitotic metaphase/anaphase transition"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63396"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68235"
FT                   /db_xref="GOA:A3LYW2"
FT                   /db_xref="InterPro:IPR007192"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYW2"
FT                   /protein_id="ABN68235.2"
FT                   /translation="MSSEKPDQVETLRRDLLKACNTLSNVNLFQAAKWCAEALNGLPEP
FT                   KPETADLQPEMLILDEDALLDQNKYLLAKAYFNCKEFDRAAHILKNCKTGDALFLRLYS
FT                   ILISVDKRATEETDGSINIGSDVVDDMNNRLSKIIQESENYLTKSKPNSFLYYLNGVIY
FT                   NKKKKYALAQSNLYNSLKLFPYNWSAWQELISSLITFEEAINFITKVKAAKSSLSSSIM
FT                   FQFFEVVVLQEFYQQSSSLFDSLNHLITIFPSFTFLKVQQFLISYHSLDYFQAESTFDQ
FT                   ILVDDPLRLDDLDTYSNMLYVMEKRSKLSFLAQFASMIDKFRPETCCIIANYHSMRSEH
FT                   EKAIMYYKRALTLNKNCLSAWTLMGHEFVELKNSHAAIESYRRAVDTNPKDFRAWYGLG
FT                   QAYEVLDMHLYALYYYQRATNLQPLDKRMWQALGNCYEKIDKLEEAVKSFEKALTINSA
FT                   EPHICYRLALISEKLGDVKETYKYMKLCFEQELDWGVNDETSKARLWLARNSLESRRFE
FT                   EAYELAKDLSHSNAHDIEEARSIAREARNRMSKN"
FT   gene            331345..332649
FT                   /locus_tag="PICST_85054"
FT   mRNA            331345..332649
FT                   /locus_tag="PICST_85054"
FT                   /product="predicted protein"
FT   CDS_pept        331434..332588
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85054"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85054"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68050"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYW3"
FT                   /protein_id="ABN68050.2"
FT                   /translation="MEEKIIALSSSLSKTAETYGSARELLESSRVLSNEKSPIDDEGIS
FT                   RLQESKKKFILDSFRVSKVQKEYKEWERRQTDSFVKNEITAYNKTISESARLNIKVDKL
FT                   MRDYEILHGSVKLPSFTFSIETLKKFGNDEFLGNLQKDENGEYPSKIHLHQVFSADSKS
FT                   SLPFPDFQVFYDLVNLEFRLRTEKRIKYEILVLIRNQIAVNNTKWTARDNHLSDFIGKR
FT                   LYSEISEIEKIRVSEAQMKENESDESEYDPEDNIVQEIEEEEEHDEREQDEDEEEEEEE
FT                   VEKNDHEELAQAESDENEPAVREEEGEYEAKEHEALEEDGEEEEEEEEKEKEDEEEPNE
FT                   DIDISQDEEEPSVPIPQISSTRRSSRLRGNQKSEADSDDDMLIG"
FT   gene            complement(<332722..>333117)
FT                   /locus_tag="PICST_49478"
FT   mRNA            complement(<332722..>333117)
FT                   /locus_tag="PICST_49478"
FT                   /product="predicted protein"
FT   CDS_pept        complement(332722..333117)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49478"
FT                   /product="predicted protein"
FT                   /note="go_function molecular function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49478"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68236"
FT                   /db_xref="GOA:A3LYW4"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYW4"
FT                   /protein_id="ABN68236.1"
FT                   /translation="MAAAAQHTSKFTRFMNSETGPKTVHFWAPVFKWALVVAGFNDLQR
FT                   PVEKLSGTQQVALFATGAIWTRWAGFVIKPRNALLASVNFFLGGVAGYQIIRIVNYRRD
FT                   LGDSPAQVFGYILNGDPNAAPAAEEAK"
FT   gene            complement(<333467..>337027)
FT                   /locus_tag="PICST_36940"
FT   mRNA            complement(join(<333467..335336,335424..>337027))
FT                   /locus_tag="PICST_36940"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(333467..335336,335424..337027))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_36940"
FT                   /product="predicted protein"
FT                   /note="go_component membrane; integral to membrane;
FT                   go_function ATP binding; go_process transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36940"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68237"
FT                   /db_xref="GOA:A3LYW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYW5"
FT                   /protein_id="ABN68237.2"
FT                   /translation="MFSVAFIQSIFFNEYLLKNLELGLGVRASLTSLIYQKSLKLSSEA
FT                   RLKVSSGDIINLMSVDVNRVQSVSQNISTLVLAPADIVMCIISLWPLLGKATMAGVFTM
FT                   ILLIPLNSVIIKYSRRLNKTQMKLKDNRSRIINEILVSIKSIKLYAWEKPMLAKLREAR
FT                   NEKELKNLRKIRIVNQCASLVWNLIPFLVSFTSFATFALTQNIPLTSEIVFPALAILNL
FT                   LSSPLLQLPATITNIIEGSVAIDRIKTFLTSSEVDESLLNHMPHPAKENEVAISIENTS
FT                   FLWSQGTYSDDTTDTRRFALKDINFSVRRGELSCIVGKVGSGKSSLLYSLLGQLIMVNG
FT                   EGNGVPAVNIKGTIAYCAQSPWIMNASVKENILFGCRYEKDFYERTLDACQLLPDLEVL
FT                   PDGDDTQVGEKGVSLSGGQKARLALARAVYARADIYLFDDILSAVDSHVGKKIIQKVLS
FT                   KSEGLLAHSTIILCTNSISVLSYSDNVTLIEKGHIIETTSYEDIKLGNHPKLFDLISEF
FT                   GNSDISKTPSVSESNFNVAASIETLRWDPLKKLLPNLRSGQITEESQKGKVKWSVYHAY
FT                   ARACSIPGVAAWFGLLILASFVSVGGNYWLKYWTEKNSQSGKNVSVWKFITVYAIFGFG
FT                   ASTMSVLRSSVMMLWLAINASREIHDMMATRILRAPMDFFERTPVGRIMNRFTNDMNRV
FT                   DDSIPGVFQGFVVQSISALITFGVIGFVMPFYIIVIAVLSLGYVYYDVYYIALSRELKR
FT                   LVSISRSPIYGHLGESLNGLDTIRAYNQGVRFDFINNANVDCNLQTQYMLRSINRWLMF
FT                   RLQLIGSLGVLGAGLLALMTIFTASPLTSSMAGFIMTYALEVTVSLKMMVRQSAEVETS
FT                   IVAVERCLEYSTLPVEEDIENKTLIVPPIQWPNRGSIEFVNYSTRYRANLDLVLRNISM
FT                   IINSGEKVGIVGRTGAGKSSLALSIFRIIEAVEGNINIDDIDTGSISLYDLRHRLSIIP
FT                   QDSQLLEGTVRQNLDPFNYYTDEEVWKALKLAHLKDHIVNLKETEGETPESKLDCKVYE
FT                   GGSNFSSGQRQLMSLARVLLKMTNSKVLVLDEATAAVDVQTDKIIQETIRAEFKDKTII
FT                   TIAHRLETVMDCDRIVSLDKGELKEYDSPQNLLKNEKSIFHSLCKQGGYI"
FT   gene            complement(<337307..>338017)
FT                   /locus_tag="PICST_49751"
FT   mRNA            complement(<337307..>338017)
FT                   /locus_tag="PICST_49751"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<337307..338017)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49751"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49751"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68238"
FT                   /db_xref="GOA:A3LYW6"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYW6"
FT                   /protein_id="ABN68238.2"
FT                   /translation="MSNYPVLVCGLRAFLHPMGPNKENAFNPCFVTWLYGVFAIVTFVS
FT                   GFVYLFHTLRYGLRYGTYSPKDTGLSHYIRVNSVLLHVILFLYLTSFNSIHERLADHKI
FT                   FAFGSVSIVLLFLILPLHFIETSYRAIPSDLLLLFWPGLTLLHLISLFQDNYTNWPVIK
FT                   SVEYDSQIKVIEFFLIGNSISIFWMEFSKDIWRPNSELTLQYTKDGRAEKLCEPNVIET
FT                   ITFSWMNELIMTSYK"
FT   gene            340000..342521
FT                   /gene="ACO1"
FT                   /locus_tag="PICST_85181"
FT   mRNA            340000..342521
FT                   /gene="ACO1"
FT                   /locus_tag="PICST_85181"
FT                   /product="Aconitase, mitochondrial"
FT                   /note="Has EST support"
FT   CDS_pept        340060..342402
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ACO1"
FT                   /locus_tag="PICST_85181"
FT                   /product="Aconitase, mitochondrial"
FT                   /EC_number="4.2.1.3"
FT                   /note="go_function lyase activity; hydro-lyase activity;
FT                   go_process metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85181"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68051"
FT                   /db_xref="GOA:A3LYW7"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006248"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYW7"
FT                   /protein_id="ABN68051.1"
FT                   /translation="MLSRTAVRAPRSIRGLATAGLTRDSQVNQNLLESHSFIQYKKQLE
FT                   NLDIVKARLNRPLTYAEKLLYGHLDDPHGQDIQRGVSYLKLRPDRVACQDATAQMAILQ
FT                   FMSAGLPQVATPSTVHCDHLIQAQIGGAKDLARAIDLNKEVYDFLSTACAKYNLGFWKP
FT                   GSGIIHQIVLENYAFPGALLIGTDSHTPNAGGLGQLAIGVGGADAVDVMADLAWELKAP
FT                   KIIGVKLTGRMSGWTSPKDIILKLAGITTVKGGTGSIVEYFGSGVETFSCTGMGTICNM
FT                   GAEIGATTSVFPFNNSMVDYLNATGRSNIAEFANLYKKDYLSADEGCEYDQVIEIDLNT
FT                   LEPHINGPFTPDLATPVSKMKETAIKNGWPLEVKVGLIGSCTNSSYEDMTRAASIIEDA
FT                   ATHGLKSKAIYTVSPGSEQVRATIARDGQLKTFEDFGGVVMANACGPCIGQWDRQDIKK
FT                   GDKNTIVSSFNRNFTARNDGNPATHAFVASPEMTTAFAISGDLGFNPITDTLKDANGNE
FT                   FKLKEPVGVGLPVNGYDPGENTYQAPPEDRSTVQVQIAPTSDRLQKLTPFKPWDGKDAE
FT                   RLPILIKAVGKTTTDHISMAGPWLKYRGHLENISNNYMIGAINAENGEANNVKNHYTGV
FT                   YSGVPDTGAAYRDAGHKWVVIGDENFGEGSSREHAALEPRFLGGFAIITKSFARIHETN
FT                   LKKQGLLPLNFTDVAAYDKIQPEDEVDLLGLTELAPGKNVILRVHPADGSATWETELSH
FT                   TYNIEQIEWFKYGSALNKMAAVAAEKK"
FT   gene            complement(<342632..>343246)
FT                   /locus_tag="PICST_33327"
FT   mRNA            complement(<342632..>343246)
FT                   /locus_tag="PICST_33327"
FT                   /product="predicted protein"
FT   CDS_pept        complement(342632..343246)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33327"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33327"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68239"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYW8"
FT                   /protein_id="ABN68239.2"
FT                   /translation="MHAVEDTLQDDDPSVDELESLLSAITEQVKTELDGLGGNEFDGEN
FT                   GNEFDLEDGENENEADYENEYTEQDEIIDNSKKTLDFGFEGGEFEDFPDFVMQEIYKQE
FT                   KKIPKRKTENSGTSKSTNNLPTKASDILSRYNNDSDYTSDGSDWDIVESDSDKYDNELE
FT                   LINDEDKIIDVDSSSDVEVQDDEQEMKYIPEKYDRSLDVSR"
FT   gene            <343873..>345042
FT                   /locus_tag="PICST_50119"
FT   mRNA            <343873..>345042
FT                   /locus_tag="PICST_50119"
FT                   /product="predicted protein"
FT   CDS_pept        343873..345042
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_50119"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_50119"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68052"
FT                   /db_xref="GOA:A3LYW9"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYW9"
FT                   /protein_id="ABN68052.2"
FT                   /translation="MSNFRPYGSHEARVISDLSRFDYESISARNRSRNPTPTSIDDEKS
FT                   SVLTLDTIIPLYSSRINKEPYHPPKTLLEIAENSSPLPKARPPPLPEKDGNLLRSQSAK
FT                   EFAPYPESVYDESLPPMMETSQFVEVPKTSQESVSLETLNSKQKALEEDLVRRVMNRPL
FT                   FTISGRDLGVPKYEDKSYTISANSFIYLFEIIIDIIIIVLSSVLVNKDRNVGVGIYRYF
FT                   IADGSISLIISLLFISTIINFEKRNGSFYCLAATILKLVSFIMVVSHLLPKGNCKTRDI
FT                   CDTRKATSAFIIISTFIWIGNLVMFLTTLYISRLNLLNDINFDFSNQGLNKKYNMSQDT
FT                   LHEQGSPNNHTDKPLKEYYLTESGEMYEITDEWQRLNHQGKNKILVYTF"
FT   gene            <345185..>346771
FT                   /locus_tag="PICST_33329"
FT   mRNA            <345185..>346771
FT                   /locus_tag="PICST_33329"
FT                   /product="hypothetical protein"
FT   CDS_pept        345185..346771
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33329"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68053"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYX0"
FT                   /protein_id="ABN68053.2"
FT                   /translation="MKVLCFLFFFAFARSLLIKSAEDIIPSKLSLSALREGKIKLEGEL
FT                   QSLISKVNERIAEASIRDEDEELLVLPRQLLNSKVLNKLGLNSLVEGGSLFNLSIHKNL
FT                   NHDNILVPPGTKSLFIFNSSDSLKIPKRVHHNFSRFIDSSPPFNLPEVMNFVDYYMVLP
FT                   RSYLKNISWEDTDSVYYRSLLKVRTTKLPIFRKCISENKPLLVFMFNRVSDKAQAMKEE
FT                   GLSTVMTVKNFLKSKISSDSVSSFFDKFASTWVNNVAYDSLLHSVFCSTNTELMEDSYC
FT                   LKIGETMKTVFLYPAFFDINRLSRRNDNEQMEVTADAQAIRQAHDKLSVAADRLDEITY
FT                   ELATDPKKLIKEYDEKVDTKVADLVDRTKLAIERLEEKKEVLKEEVKNKLNKARKLRKA
FT                   STSQQYDLDNEQDEDNESYDYIDSEDNMYSTKKKRSEIFDEDTWDKEDVERGLELPLSL
FT                   INLKKPGRYARTNEYSQIIFDYGTETIPSLVKRAEEENSEECTPITWYNIFHHSIFGKT
FT                   KFCEDQSSIRN"
FT   gene            complement(346758..349748)
FT                   /locus_tag="PICST_79644"
FT   mRNA            complement(346758..349748)
FT                   /locus_tag="PICST_79644"
FT                   /product="predicted protein"
FT   CDS_pept        complement(346873..349191)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_79644"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_79644"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68240"
FT                   /db_xref="GOA:A3LYX1"
FT                   /db_xref="InterPro:IPR010308"
FT                   /db_xref="InterPro:IPR032800"
FT                   /db_xref="InterPro:IPR040241"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYX1"
FT                   /protein_id="ABN68240.2"
FT                   /translation="MRLNLIYIWIFSLLQAALAQSVLKTSSLLTCMDNSKFTASFFDVR
FT                   YFPHNTSVYFQVNAISSLDTNVTAQITLIAYGLNILSRNVSLCNLNYPEICPLTSGHLD
FT                   LTSSYNVSRSITDQIPGIAFTIPDLDARVRVTITEDGKSDQLACVEAVLTNGKTVQTKY
FT                   AAWPIAAIAGLGVITSGVVSVIGHSNTAAHIASNSMSLFVYFQSLAITAMMAVAKVPPI
FT                   AAAWAQNFQWSLGIVRVGFVQNIANWYLQATGGTPTDILGSQYLSISVQKKLKKRAYEL
FT                   FESFYKPQESVVSGLSKRASITLDSDDFGYSDSLNSTLYSLNEKDKDLSSKILVLRGIQ
FT                   RVAFLTRIEITDLFMTGIIFLLFFAFVMVVCLMLFKAIIEILIRAKLMNEGKFNEYRSQ
FT                   WSLVIKGTLYRLFVLALPQIAVLCLWELTTRDSVGTTVIAVFLFVLSVVLLFQAAIRVF
FT                   MFGRKSVSQYKNPAYLLYGDGAFLNKFGFLYVQFRADCYYFILVSLVYMLAKSLFVAVL
FT                   QTHGKVQSVIVFVIELAYCVLVSWIRPFMDKRTNAFNITIAVISTLNALFFMFFSFVFR
FT                   QPHVVASVMGVVYFVINAVFALFCLIFTVVTCVLALLYKNPDARYQPMKDDRVSFLPRF
FT                   DNPKQAQNGEEDLELMALGATARKGHEHGGKPANLYDEDESMYEEDSMFPNKDSRNESN
FT                   SNSNFNFSHDANDSKHDSYLETMEPTQPGSTIVGNPGAITGYHNSAYVGGSSRGPPVNP
FT                   YSQSTSYNTSQSGSRVNFI"
FT   gene            complement(<350549..356353)
FT                   /gene="STT4"
FT                   /locus_tag="PICST_79239"
FT   mRNA            complement(<350549..356353)
FT                   /gene="STT4"
FT                   /locus_tag="PICST_79239"
FT                   /product="phosphatidylinositol-4-kinase involved in protein
FT                   kinase C pathway"
FT                   /note="Has EST support"
FT   CDS_pept        complement(350621..356353)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="STT4"
FT                   /locus_tag="PICST_79239"
FT                   /product="phosphatidylinositol-4-kinase involved in protein
FT                   kinase C pathway"
FT                   /EC_number="2.7.1.67"
FT                   /note="go_function phosphotransferase activity, alcohol
FT                   group as acceptor; inositol or phosphatidylinositol kinase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_79239"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68241"
FT                   /db_xref="GOA:A3LYX2"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="InterPro:IPR042236"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYX2"
FT                   /protein_id="ABN68241.2"
FT                   /translation="MDFTGISRGSIRGEALQKLAKLSVEHAPASLPPTGISEQGNSLDE
FT                   FGTLMSLAPKEETTDEEEDLSEIPITTKEYEVLIALCDSTGFAVKFPPQVKLLLDKFRV
FT                   YLLELPNQKFNHSLVASARESPPWAVLGEKLTTALINIAYKFDKKYLENVLDIFSEFNE
FT                   RFFSFEEPEISNYFTLLGYIDALSKNSKILTESPKAFKIFLTVDTCIDTFDFLNDIEWY
FT                   SDAIFTETSDYSMLLENEYIVDFSPILYLEKLSKLMASILNSIVGNKDKSLLEYVLDKV
FT                   ASKYSDSEKLPNGQDLSKDNLDISQSHMQIIKTLSDLAIHKMEFLDRGETYIVYSTYKR
FT                   LKHGYLAKSHNIEVISCGMFTDNVDLKIAKRFFKICSEIKDVMLDPDLGISTLQLGSLL
FT                   VFKDDSVGSSLTRTFTSLVANPKFNTDYCIEASKCVGFASKVMSQDAVITTIYALTNLL
FT                   FVGNDGLQLSNRNSVRRTNGPISRALDGLSLRDVPLSRRASISSLPTNTSRTNLSIRSV
FT                   AGEYDENDYNKVCENAVTSIIEISQACNDETIPTLAVTILSQKITKLETPIGGLLLKGL
FT                   AACAPFLPEREFTILVRLLNRLSVDANDAKNVVLLDDLIATRVSLSRKLKKDNPLYLIY
FT                   LKEMLQAIISKGDVQVLEHHRSHNEISEIGDQIAIYLKPLAEMLPDVRKGDDPLVIKET
FT                   ETINLFRNIWFNMVVHGYSINSKNSKAYSKELERIAYNTPPLASELSWDRTETSLEMNT
FT                   VLRRGSSNHNIKDHRHIIGDIFEVHRNLSYPKLIFLSATVFVESLRVKSGDCATILQYY
FT                   SDPSIKTSGVEKYIGFISFKIVKDYIYLVSCGANKQFTAEHIASQLTNILVFCCHRLED
FT                   LQDAAVQCADLLINKVPSSLCHHRSLYTLFDLLTILFDSIVDAETHQYEPTTSYRAKRT
FT                   GIRISLSDSYKWRNETFNRLHEKSKHWLKLVLHKSSVDVKSLIQSYVTEGERFQSAKRL
FT                   DFGVSFALEMAGSILANDRELTHISRYPVKNLNTLPTLVSQLNWRSGFVDDLVDQIPKN
FT                   TRTLDSDEALAAIRAKVIELGVKSGADTVNNHEVIDLLTEIAGFTLITESDQSELVRYL
FT                   VDVPFQFFEPSIMDAAIGIWFAVMKDRPNSAMLLLSEVAKKWETTIELGKGLFSKEQDI
FT                   EDPEFSKMEYSPSDRKTVNRTAFKTARSFEPHLLIIELFSSSFQATLNQSDHLLKLYTR
FT                   FVEVGLKSLETASLHPFARIGRFELIRFSFDVLNYHHKLGSRSTANLTKLILNGSLSWF
FT                   KQRSAYPFGSNILKFRADYTLLKEVARLVNNIPVHRSEDLESRRTLLSFFLDDEISKIS
FT                   VWLDPLNPSETTGSYVSQQISSSHITKAFNIDPILAVNLAFRYKSKNLDDVLQSLIVKN
FT                   PLPAISYPDAVQFFIGLNAGTNMPSHHLLFWEALAPIDSITLFLPPFSNNPYILQYTMR
FT                   SLEHHDVNLTFFYVPQIVQCLRYDQKGYVERFILETAKVSQLFAHQIIWNMLANSYKDE
FT                   ESSEPDSIKPVLDKIQTKMLASYSQEDLAFYEKEFGFFNEVTGISGKLKPYIKKTKAEK
FT                   KVKIDEEMAKIEVKPGVYLPCNPDGVVIDINRKSGRPLQSHAKAPFMATFRVKKDVEEV
FT                   QESGEIKTVTIEKWQSAIFKVGDDCRQDVLALQLISVFRTIWTNAGLDLYVFPNRVTAT
FT                   APGCGVIDVLPNATSRDMLGREAVNGLYEYFTTKFGPETSPEFQTARNNLIKSLAAYSI
FT                   ISYLLQFKDRHNGNIMYDDQGHVLHIDFGFCFDIVPGGVKFEVAPFKLTHEMIAVLGGR
FT                   IDTQAFKWFEELCVKGYLACRPYMETIVRCVNPMLESGLPCFKENTIKKLRSRFVPGKS
FT                   EKEASLYFRGLIKKSMESFYTKGYDEFQRITNGIPY"
FT   gene            complement(<356676..357663)
FT                   /locus_tag="PICST_66051"
FT   mRNA            complement(<356676..357663)
FT                   /locus_tag="PICST_66051"
FT                   /product="predicted protein"
FT   CDS_pept        complement(356926..357663)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_66051"
FT                   /product="predicted protein"
FT                   /note="go_function translation initiation factor activity;
FT                   go_process translational initiation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_66051"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68242"
FT                   /db_xref="GOA:A3LYX3"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYX3"
FT                   /protein_id="ABN68242.1"
FT                   /translation="MATRTQFENSNEVGVFSKLTNSYNLVAVGGSENFYSAFEAELGDV
FT                   IPIVHTTIAGTRIVGRMTAGNRRGLLVPTQTTDQELMHLRNSLPDAVKIQRVEERLSAL
FT                   GNVICCNDYVALVHPDIERETEELIADVLGVEVFRQTIAGNVLVGSYCSLSNQGGIVHP
FT                   QTSIQDQEELSSLLQVPLVAGTVNRGSSVVGAGMVVNDWLAVTGLDTTAPELSVIESIF
FT                   RLQDAQPESISGNLRDTLIETYS"
FT   gene            <358237..>359199
FT                   /locus_tag="PICST_33333"
FT   mRNA            <358237..>359199
FT                   /locus_tag="PICST_33333"
FT                   /product="predicted protein"
FT   CDS_pept        358237..359199
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33333"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33333"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68054"
FT                   /db_xref="GOA:A3LYX4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYX4"
FT                   /protein_id="ABN68054.2"
FT                   /translation="MKYKVPDLSDLETRLSASIVGQPQAVKKVSECLRRSLAQSSSRHF
FT                   RSMLVLVGSPGSGKSELVRRLAEYLYGSEKAVIRLPREISVSSLLGSSIDGEGIQEGLL
FT                   VTALLANPTCVILVEEAENVPPETLALLSRIVATGSITSSRGRVVPCTHTVVVLKSRLA
FT                   QPKLLTEEEILDRVSNHLKTHFEDLDDDLTSTIVFNPLGPKSIYDIISLQLGQVQDRFA
FT                   RFGYGKSISFELDDNALKFLYENGYSPTLGAKELERVLQAELLSRVAIYLLTGQVRDQE
FT                   TARVTSGKSGLQVFPNHEPIEVVTVDSEEEWDETYYEDF"
FT   gene            complement(359230..362090)
FT                   /locus_tag="PICST_85379"
FT   mRNA            complement(359230..362090)
FT                   /locus_tag="PICST_85379"
FT                   /product="predicted protein"
FT   CDS_pept        complement(359322..362030)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85379"
FT                   /product="predicted protein"
FT                   /note="go_function ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85379"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68243"
FT                   /db_xref="GOA:A3LYX5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYX5"
FT                   /protein_id="ABN68243.1"
FT                   /translation="MDETQFTDNALKIITSAQQLAKDNAHAQLLPLHMLAAMVPSDDPE
FT                   STVYLKTLIQKGRFEWPTFERTVNKHLVRLPSQTPAPDEVRPSYAAGQVLTRANNIKAQ
FT                   QKDSYVAQDHILLALLEDQSIKDIFKEAGIKVDAVKAAAIELRGNQRIDSRQADSSSTY
FT                   EFLNKYCEDLTEKAREGRIDPVIGREEEIRRVIRVLARRTKSNSVLVGEAGVGKTSIVE
FT                   GVAQRIIDGDVPGVLQNSRLFALDLGALTAGAKYKGEFEERIKGVLNEIEKSKEFIILF
FT                   IDEIHMLMGDGKSDAANLLKPMLARGTLHCIGATTFVEYRKFVSKDGAFERRFQKIDVP
FT                   AATVNETVAILRGLQPKYEIHHGVRILDSALVAASQLASRYLTYRNLPDSAVDLIDEAA
FT                   ATVAVARDSKPEELDNLERQLHLVEVEINALERDVDADADSKDRLELAKKKQAELEETL
FT                   APLRERFSAERAGHEQLISAKRKLDELEIKAQDAERRHDTSTAADLRYFAIPDVQKQIE
FT                   ELEVKVAEEEASIGPDALLKHVVGAEQVAETAARLTGIPVTKLTQAENSKLINMEKELS
FT                   SGVVGQSDAVKAVSNAIRLTRSGLANPNQPSSFLFLGLSGSGKTELAKKVAGFLFADER
FT                   AMVRIDCSELGDKWSASKLLGAAPGYVGYEEGGILTEALLRRPYSVVLFDEVEKAAPEV
FT                   LTVLLQILDDGRVTSSQGKVVNCSNCIIIMTSNLGAEYINASKGSKITAETKDLVMGSV
FT                   RAHFRPEFLNRISSTVIFNRLSKKAIAKIVQIRLKEIQDRFAANGKTLTLDVDDSALEY
FT                   LCKKGYSRDLGARPLNRLIQTKILNRLAVLLLKGQVKDKETAHVTMGEKGIEVLPNHEP
FT                   DDVEMGDYDVEDWEDSDDGDEDSEEFGAGLD"
FT   gene            <363928..>364842
FT                   /locus_tag="PICST_33338"
FT   mRNA            <363928..>364842
FT                   /locus_tag="PICST_33338"
FT                   /product="predicted protein"
FT   CDS_pept        363928..364842
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33338"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33338"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68055"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYX6"
FT                   /protein_id="ABN68055.2"
FT                   /translation="MDLLQEYSSGASDSSSPEEDEEEVIGKQPRLQVPDPSTQPPLSVP
FT                   ELIIYSQNYSDTQMNRKSIFLYVPWKPTRDAVSKLNAATSKVLAAKNILLAEYKWTPIH
FT                   QQRSNLGYHITLHPNIYGEEYKMKVLSDNIRNALITDVKYPKNSIGYDEERLERNNRLS
FT                   KLLGKSKDDGPDQKSINLRFQPKLRVFQSPNSNKLFLSGLIEYSDEVQQFFTSVNEVIE
FT                   NSVDSLQLEKSPFYSLDHHHITFSTGSPNTVGQQYEELDALNQELESVDVGDIIGDVNV
FT                   SISEIVMSQLGQSQQVDSFPFDI"
FT   gene            365405..>367125
FT                   /gene="GTS1"
FT                   /locus_tag="PICST_90941"
FT   mRNA            join(365405..366957,367027..>367125)
FT                   /gene="GTS1"
FT                   /locus_tag="PICST_90941"
FT                   /product="protein (LSR1 protein)"
FT                   /note="Has EST support"
FT   CDS_pept        join(365722..366957,367027..367125)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="GTS1"
FT                   /locus_tag="PICST_90941"
FT                   /product="protein (LSR1 protein)"
FT                   /note="go_component nucleus; go_function DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90941"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68056"
FT                   /db_xref="GOA:A3LYX7"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR038508"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYX7"
FT                   /protein_id="ABN68056.2"
FT                   /translation="MSRKQQQEIEKQLIEIVNSSKNENKCGECGSSYPTWASYNLGIFL
FT                   CGRCASVHKKILGPPNNNISKVKSLTLDKWNHEQLDHLRRVGNKKAKKRWNPKRVPFPY
FT                   DGADDVAAVEQYIRDKYVIGKFRDDNIEAADYEEGRGSRYSDESDSASRVSIRNGRSRA
FT                   NSRATSNLTPGGGRSRSGSKNFEIPRLSHRKLTTFENTQYSQQLHKILNYGYTNRDSVL
FT                   ESLLLSGGEIELALDILDQDSKLNPNQDEIPPELPRRRPGAPPTTSLIDTAPTTSASTQ
FT                   QVQPSEEWWSTNSGAAQSQVTGIAQPQIYQYTDPITGQVSYVDANGQQYLDPTNPQHQQ
FT                   QLLQQSNPQLIAQQTNKQNILSLYNQPNSFTTPVAVPVSQQHAQQAQTQQVQPTQQAQV
FT                   QAQQQYIQQPQQIQFAPQFTGFGQPQQQSYNPYNQTQQQNQFNWR"
FT   gene            <368754..>370331
FT                   /gene="QUP2"
FT                   /locus_tag="PICST_36948"
FT   mRNA            <368754..>370331
FT                   /gene="QUP2"
FT                   /locus_tag="PICST_36948"
FT                   /product="high-affinity hexose (glucose) transporter"
FT   CDS_pept        368754..370331
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="QUP2"
FT                   /locus_tag="PICST_36948"
FT                   /product="high-affinity hexose (glucose) transporter"
FT                   /note="high-affinity hexose (glucose) transporter (HXT1);
FT                   go_component integral to membrane; go_function transporter
FT                   activity; go_process transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36948"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68057"
FT                   /db_xref="GOA:A3LYX8"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYX8"
FT                   /protein_id="ABN68057.1"
FT                   /translation="MVVVALTAAFAAVIIGYDAGFVGGTVALESFQDEFNMPSMTAKER
FT                   SNISANVVSVFQAGAFWGAIFFYPIGELLGRKIGLCLSGFFLTFGAAISLYSKSSTGLG
FT                   AIYAGRVLTGIGIGGCSGLAPIYISESSPALIRGKLVGMWEMSWQVGGVVGYWINYGVL
FT                   QNIPDSRKQWLIPFAIQLVPSGMFWAGSFLIPESPRYLVHRGQMEQARKNLSFLRNLPV
FT                   DHPYSIHEMENIVKDINDKKAKLGSDGFFAPFKKVLSSKKILYRLLLTTSLFPMQNGSG
FT                   INAITYYSPTVFKSFGIDATKAGLQSTGVFGLLKAFASLVWLFLVVDRFGRKTALVWGS
FT                   VPCSLCMWYIGAYVKIANPSQRVANGNTTQDAGGKAAQAMLYIWTLFYGASWNGTPWVF
FT                   NSEVFSQEVRTLTQAINASANWFWAFVMGRWSGQALDAIGYKFYFIFATCMIVFPVVIL
FT                   LLYPETKEVPLEAIDYLFEVPAWRARKHAMEQYRIEYENGAKVNEMFAIDSDSSEKERG
FT                   RSREESNE"
FT   gene            370988..373299
FT                   /gene="FAO1"
FT                   /locus_tag="PICST_90828"
FT   mRNA            370988..373299
FT                   /gene="FAO1"
FT                   /locus_tag="PICST_90828"
FT                   /product="long chain fatty acid oxidase"
FT                   /note="Has EST support"
FT   CDS_pept        371112..373211
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="FAO1"
FT                   /locus_tag="PICST_90828"
FT                   /product="long chain fatty acid oxidase"
FT                   /EC_number="1.1.3.6"
FT                   /note="go_function oxidoreductase activity; go_process
FT                   electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90828"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68058"
FT                   /db_xref="GOA:A3LYX9"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012400"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYX9"
FT                   /protein_id="ABN68058.1"
FT                   /translation="MSSVSESHIEILVALADGIIHDTTADVVRPYLDPGFPIDRLEEYL
FT                   KNYTRPSETEGFKQFVTNVINSNPTHSRRMFTVLMTVLDSRILAPTLTGSLTLIRDMTV
FT                   EQREQLLQSWRDSPIVTKRRAFRMVHAAAVSTFARMATDLHLKAIGYPGVETREKLYAD
FT                   QVPDTFKYSMLKKPQVDGYELHIPDVDVLIIGSGSGAGVVAHTIAEAGYKALVLEKGKY
FT                   FSSEEFTFNDLTGYQNLYEQQGALVSSNQQLFVLAGSTFGGGSAINWSACLKTPFKVRK
FT                   EWYDDFGLEWAASESFDKCTDYVWTQMGANKNNINHSLANKVILEGGAKLGYKVKEVEQ
FT                   NNGAHADHSCGFCHLGCKYGIKQSSPACWFREPADKGSLFMDQVKVIKVLHNRGVAIGV
FT                   LCEDILTGKQFKITGPKKYVVSGGSLCTPVVLQNSGFRNKHIGANLKLHPISIVFGNFG
FT                   REARADPHEHPILTSVCTEVDDLDGKAHGAKIETVLNAPFLESVFLPWQNSDKLREDLL
FT                   KYQNLATMLLITRDKSSGYVRADSNAPNSLIVDYTVNQYDRNALLQAFVTTADMLYIQG
FT                   AKEIFGSQAWLPVFKSEKPKHERAITDQDFVDWRNAVLKIGLDSYGNVYGSAHQMSSCR
FT                   MSGKGPRYGACDENGHLFECKNVYVADASAMPTASGANPMITTMAIARHVALGLVKDLQ
FT                   PAAKL"
FT   gene            complement(<373408..>373869)
FT                   /locus_tag="PICST_49706"
FT   mRNA            complement(<373408..>373869)
FT                   /locus_tag="PICST_49706"
FT                   /product="predicted protein"
FT   CDS_pept        complement(373408..373869)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49706"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49706"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68244"
FT                   /db_xref="GOA:A3LYY0"
FT                   /db_xref="InterPro:IPR007515"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR011323"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYY0"
FT                   /protein_id="ABN68244.2"
FT                   /translation="MSSYKAFDLDQISLEKRVVLRCPFKQCNARIIPLSKALVSSKISI
FT                   DKAPEMVAVGQIPSVDEPRTESTSDFYKVDDVWDFDNIGVSRAVENLSSPIELASDPGE
FT                   PVTLNIERLLICSECDKGPLGFAGISEKDAADVKNLKYFLSCNSVVYDV"
FT   gene            374543..377006
FT                   /locus_tag="PICST_85176"
FT   mRNA            join(374543..375825,375844..376284,376338..376354,
FT                   376458..377006)
FT                   /locus_tag="PICST_85176"
FT                   /product="predicted protein"
FT   CDS_pept        join(374683..375825,375844..376284,376338..376354,
FT                   376458..376938)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85176"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85176"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68059"
FT                   /db_xref="GOA:A3LYY1"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYY1"
FT                   /protein_id="ABN68059.2"
FT                   /translation="MTPIPSWWMLLSAIALFIGGITASSSNNNWNTLYAYVDGRIYIHL
FT                   KNNDLLALNFSIAGFSGSSNGLSVTDIDLTNNQQVETLPSPPENATLFLFNEELYGLIG
FT                   VKTNSKLDVCGEGIIQLLKFDSTQKMWSQVHANLNFNNINDASYYQHATVLTTPTDTDT
FT                   VYLYGGICDSQHGIVSNRLLSFNMSSYEFVNITTSTKPEAFYGAGNLLAPNPQTQLVIG
FT                   GQSNQGWLNMYQLATWDFSSGWSFKQINKDGNDPTMNSRTFPLILPIFSQLSNNTIEAV
FT                   SNFLSIQEVLLIGGDLLGEESTPQYAKLSTSSNDWSWNTTFNVTWDYSEILGAATIFNT
FT                   LVIINSTSEGNSKRDGSGSSYSVSLYDTNTFASVTSVKSNTTQQAASSFKHSVSKKAIL
FT                   GTVIPLVVIAIVVAAVIFYTRRRKRQQQQDELNALDYQIGNYFDRESMVSNKNSTRHNL
FT                   LPTDYTSSKVMDLNNDSSSTLEDQASFDSWIRKRQEFDQTRLKTRNSYMASNETLFNNN
FT                   MNRSSTSEEDYHATDTHHGATITNSNGSINSYTLMNRSVSRLKKSFSFNSAPGSPTSGE
FT                   YGLLKKKRSTGLLRKSSEQSFVSENSPEMAVKERSDMIAEETDHESIDDQDMDVQVLVS
FT                   SKRRSVLKVMNPDMGETSLDQTPEDNEDDNTEIDLSSRYDETVEIRQRVPSGGKTEDD"
FT   gene            <378459..>381488
FT                   /gene="MSN2"
FT                   /locus_tag="PICST_68294"
FT   mRNA            <378459..>381488
FT                   /gene="MSN2"
FT                   /locus_tag="PICST_68294"
FT                   /product="zf-C2H2 Zinc finger, C2H2 type"
FT                   /note="Has EST support"
FT   CDS_pept        378459..381488
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MSN2"
FT                   /locus_tag="PICST_68294"
FT                   /product="zf-C2H2 Zinc finger, C2H2 type"
FT                   /note="Calponin Calponin family repeat; go_component
FT                   nucleus; go_function nucleic acid binding; zinc ion
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68294"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68060"
FT                   /db_xref="GOA:A3LYY2"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYY2"
FT                   /protein_id="ABN68060.2"
FT                   /translation="MDNDSDIYQYSSEPSQRYGYQDGETFDFQTIQENHHDVKDSEIVH
FT                   SDIEENLNRDLENGGLSNGKTLNHTSSNNTINNSINNYNNNIKNINNNSMSSHNNTNTI
FT                   NNTNNYNNNNVSNTINSTDYESIFALNSFGLPSNALFGGTDPSNIVYRPNNMISNLESP
FT                   ENFPGVDFEHAAENQNQANVSFSMPGAFHDGDNMDLDESPPFTIESETYYDPHIESTSI
FT                   NHETESLFKANGNANTNVGNTLLAPQQRTPTQRIESSFSPFDNSSRVSSFRVENGNGIN
FT                   PNGGFVFNHVTTNADNGVNQSGPVLGSVDNYYSNINGNSNANNIGNTNNSSGSKNGNDN
FT                   SNSNGNGNGNGNGNFNNNNINNTTPNSHNTNSVYNTNNGNYLSVHSNITGNAFSNASLG
FT                   QNSNNNFYNELSPITTTTSLTPSISSVHSTQPSFFSAHQFLTRNSLDQGPPTHLVSSSF
FT                   DLFNKGRPSMDSQQSSSRRNPSSGRYTSFTNSLTNMIPFMGDRNQRSPISGPPSPQSQN
FT                   SSSFMSQPPPQQPRHLIRSIFKSNSAPNNVQAANDELTNAFVIDESSDPFVSGSGNTED
FT                   FLMMSPTKEEPELEAIDVSVQPKKAKRSKRSLFTRFKGPSVKQEPIDENEMLMIDEFAV
FT                   KEGENLDNSTSTSGPFQPTSISRTPSTATGNFLDSASSSNTSHNQSQSQLLPQSQTQPQ
FT                   NPQSQEPDYASLFENVGKRKIVNTSSYRKSKTKVKNEDGTTSNNSNSTVENSPILNVSL
FT                   GNKKIKTDSEIGSGNNSGHTTEKSSLHNLRLSHQRSNQSSGNNISVKEEYSDRGSVGGM
FT                   SSKSNTSKDNRLHPQSSEEVDISDDESTTSTTASSNFATASKRILGSKLMKKKTSPVKM
FT                   PVATVINKGVEVEVDLKSLDLPPNTQIFPTSIINSKNRTRGRKENKEADMVDSTKIYLC
FT                   NYCSRRFKRQEHLKRHFRSLHTFEKPYDCTICNKKFSRSDNLNQHLKIHKQEEEAAALE
FT                   KELLEQGSMAKTKVEDELME"
FT   gene            complement(382045..>384402)
FT                   /gene="ACE2"
FT                   /locus_tag="PICST_85279"
FT   mRNA            complement(join(382045..382761,382867..383116,
FT                   383237..>384402))
FT                   /gene="ACE2"
FT                   /locus_tag="PICST_85279"
FT                   /product="Metallothionein expression activator"
FT                   /note="Has EST support"
FT   CDS_pept        complement(join(<382045..382761,382867..383116,
FT                   383237..384147))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ACE2"
FT                   /locus_tag="PICST_85279"
FT                   /product="Metallothionein expression activator"
FT                   /note="go_component nucleus; go_function nucleic acid
FT                   binding; zinc ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85279"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68245"
FT                   /db_xref="GOA:A3LYY3"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYY3"
FT                   /protein_id="ABN68245.2"
FT                   /translation="MDSYTNWEEVNSATRAMPLPHENFDQYFAEYDEIDNLFNETLTGL
FT                   QDLDVPSGFASQLQDKLETPSHQKHARKTSGTAIFGFVDHTRELSITGLANDLYKPIKQ
FT                   SLDLGKSISPGELLKSLNASQSQQFDFEVDPIVQKPILLLEEDELNEQQKASKDIIPAS
FT                   LPQSSPMRLQPKQEEYIVTNESPKSYKFPPSPSPSPSRERIPANGNARFQTVNNYSVKY
FT                   LQELNNQGANLQQNYVDDIEPLIDGTGSEQKSNFNVNNNQIKYIPIPIQQPVVYKKENE
FT                   SPSVQQFQQAQFQQQAQQQVQQHSNTYLPPPSPPSLSNASPELSSSPDPLSPSPNRSVI
FT                   SGYESQKFSSPLHPQLRNANVNFYSPQFFSESDNGSFYRNNDGSNISQQQQMNSSPGYS
FT                   NSSLSSSPVKYYTSPIRVPGALEEVEDANATITQLTPLRNQFPSTPARNQVTLEWSPVI
FT                   SPSAKASKDVKKHIQQSTPRRRVKKTSLLPPGELDQYWEGPDEDKIYTCTYKNCGKKFT
FT                   RRYNVRSHIQTHLSDRPFACAYCPKRFVRQHDLNRHVKGHLEARHCRCPCGKEFVRLDA
FT                   LKKHRERNICVGGIASSTNHCITKPQPKKKDSVYSELMISKVKENQDKLL"
FT   gene            complement(385796..387813)
FT                   /gene="KGD2"
FT                   /locus_tag="PICST_68297"
FT   mRNA            complement(385796..387813)
FT                   /gene="KGD2"
FT                   /locus_tag="PICST_68297"
FT                   /product="2-oxoglutarate dehydrogenase complex E2
FT                   component"
FT                   /note="Has EST support"
FT   CDS_pept        complement(385916..387232)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="KGD2"
FT                   /locus_tag="PICST_68297"
FT                   /product="2-oxoglutarate dehydrogenase complex E2
FT                   component"
FT                   /EC_number="2.3.1.12"
FT                   /EC_number="2.3.1.61"
FT                   /note="Dihydrolipoamide succinyltransferase (2-oxoglutarate
FT                   dehydrogenase, E2 subunit); go_function acyltransferase
FT                   activity; go_process metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68297"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68246"
FT                   /db_xref="GOA:A3LYY4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYY4"
FT                   /protein_id="ABN68246.1"
FT                   /translation="MLSRSIKSSLKRAPVSRAVALSATKLSLRMSSGPVSRSIHTATTS
FT                   GAGFSRISGLTFKRYASVTVKVPDMAESITEGTLSALNKNVGDYVNVDETIATVETDKI
FT                   DVEVNSPVAGTITEFLVAVDDTVEVGQDLAKIEEGEAPAGGAAPSEAPKEEAAPAAAPA
FT                   AAPAAAPAAAPKAAPAAPKAPAPAKKEEPKKEAPVASFTNFSRNEERVKMNRMRLRIAE
FT                   RLKESQNTAASLTTFNEVDMTNLMEMRKLYKDEFLEKTGIKLGFMGAFAKASCLAAKDI
FT                   PAVNASIENNDTLVFRDYTDISVAVATPKGLVTPVVRNAESLSILGIEQEIASLGKKAR
FT                   DGKLTLEDMTGGTFTISNGGVFGSLYGTPIINMPQTAVLGLHGTKQRPVTVNGQIVSRP
FT                   MMYLALTYDHRVLDGREAVTFLKTVKELIEDPRKMLLLE"
FT   gene            <389423..>390856
FT                   /gene="LPD1"
FT                   /locus_tag="PICST_36951"
FT   mRNA            <389423..>390856
FT                   /gene="LPD1"
FT                   /locus_tag="PICST_36951"
FT                   /product="FAD flavoprotein"
FT                   /note="Has EST support; contains a pair of redox-active
FT                   cysteines involved in the transfer of reducing equivalents
FT                   from the FAD cofactor to the substrate"
FT   CDS_pept        389423..390856
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="LPD1"
FT                   /locus_tag="PICST_36951"
FT                   /product="FAD flavoprotein"
FT                   /EC_number="1.8.1.4"
FT                   /note="dihydrolipoamide dehydrogenase; contains a pair of
FT                   redox-active cysteines involved in the transfer of reducing
FT                   equivalents from the FAD cofactor to the substrate;
FT                   go_component cytoplasm; go_function disulfide
FT                   oxidoreductase activity; oxidoreductase activity;
FT                   go_process electron transport; go_component cytoplasm;
FT                   go_function disulfide oxidoreductase activity;
FT                   oxidoreductase activity; go_process electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36951"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68061"
FT                   /db_xref="GOA:A3LYY5"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYY5"
FT                   /protein_id="ABN68061.1"
FT                   /translation="MAQFVRYASTKYDVVVIGGGPGGYVAAIKAAQLGYNTACIEKRGA
FT                   LGGTCLNVGCIPSKSLLNNSHLYHQIKHDSENRGIAIDGEVSVNFPKLMEAKEKAVKQL
FT                   TGGIEMLFKKNKVTYIKGSGAFVDEKKVSVTPIDGSEELELEADHFIVATGSEPTPFPG
FT                   ITIDEERIVTSTGVLALKEIPKRLSIIGGGIIGLEMASVYSRLGSEVTVIEFQNAIGAG
FT                   MDAEVAKTSQKLLAKQGLKFKLGTKVVSGVRDGEVVKIEVEDVKSGKKEDLEADVLLVA
FT                   IGRRPYTEGLALEKAGLELDNKGRLVIDSQYRTKHDHIRVIGDVTFGPMLAHKAEEEGI
FT                   AAAEYIKHGHGHVNYGNIPSVMYTHPEVAWVGLNEEQLKEQGIKYKVGKFPFIANSRAK
FT                   TNLDTDGFVKFLADAETQRVLGVHIVGPNAGEMIAEAGLALEYGASTEDIARTCHAHPT
FT                   LSEAFKEAALSTFDKPINF"
FT   gene            <391145..>391900
FT                   /locus_tag="PICST_62940"
FT   mRNA            <391145..>391900
FT                   /locus_tag="PICST_62940"
FT                   /product="predicted protein"
FT   CDS_pept        391145..391900
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62940"
FT                   /product="predicted protein"
FT                   /note="go_component intracellular; ribosome; go_function
FT                   structural constituent of ribosome; go_process protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62940"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68062"
FT                   /db_xref="GOA:A3LYY6"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYY6"
FT                   /protein_id="ABN68062.2"
FT                   /translation="MPSLQKFHANVARHVKSMDKNLTANLIRHEYIVTTRTKAKRVQAK
FT                   AETFLADALHRNDKIAQDQPINSKIVANRALNFLQPPDKFEVGSKIIQELAPRYQQRRS
FT                   GFTRIIKLEPRLGEDKAPMSVIELVDSEYEIKFWYTAKIVARLELQGLKVDDITQLNVQ
FT                   KLTKFRPEGEKEFAAAVETCKVEFFKYDPETQQVTDPEALKNLENLPVNLEYYGGDLSG
FT                   SLVASKRFKTQPRPEKEQAEIPVSPFVAK"
FT   gene            <392416..>393402
FT                   /gene="TSC10"
FT                   /locus_tag="PICST_36953"
FT   mRNA            <392416..>393402
FT                   /gene="TSC10"
FT                   /locus_tag="PICST_36953"
FT                   /product="3-ketosphinganine reductase"
FT   CDS_pept        392416..393402
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="TSC10"
FT                   /locus_tag="PICST_36953"
FT                   /product="3-ketosphinganine reductase"
FT                   /EC_number="1.1.1.56"
FT                   /note="go_function oxidoreductase activity; go_process
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36953"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68063"
FT                   /db_xref="GOA:A3LYY7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYY7"
FT                   /protein_id="ABN68063.2"
FT                   /translation="MWFSTSNFPVSGKVALIIGASQGIGADLALKLYERDCSCILVART
FT                   ASKLKQQIERIEKSVGKKENTSLSYLAHDVSDYDQCVELWDQIVDSHHQDPDVIFCCAG
FT                   SSVPKLFNDLTGAEIQSGITTNYNTAVNVVHAGFKKVLATNPKLAFNKHKHRHVILFSS
FT                   VASFYGFIGYAQYAPMKAAIQSLSIVLRQELGPYNYRVSCVFPGNFMSEGFVEEQKTKP
FT                   EITITIEGPSSPIPGEECAELIINKLSKGYDTVTTDFIGWLLGCSVLGVLPRTWGLFQV
FT                   IVSFLFSIFAPLANWIVYRDIIKYFKKRQLEIESEAVDEDEESHKKK"
FT   gene            complement(<393605..>393976)
FT                   /locus_tag="PICST_49885"
FT   mRNA            complement(<393605..>393976)
FT                   /locus_tag="PICST_49885"
FT                   /product="predicted protein"
FT   CDS_pept        complement(393605..393976)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49885"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49885"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68247"
FT                   /db_xref="GOA:A3LYY8"
FT                   /db_xref="InterPro:IPR031463"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYY8"
FT                   /protein_id="ABN68247.1"
FT                   /translation="MGGRIHGFLGGVLLTSAFAYYTGEYIRKNEQFVSQQLRSANNIIQ
FT                   NKILTDRDLINESVPKSSHSISTQRVSVTETAKDIWNDEIIKMVNWVYSINWYQAGLTA
FT                   DRKVLEFADKLVASVSEKK"
FT   gene            complement(<396905..397877)
FT                   /locus_tag="PICST_90761"
FT   mRNA            complement(<396905..397877)
FT                   /locus_tag="PICST_90761"
FT                   /product="predicted protein"
FT   CDS_pept        complement(396978..397877)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_90761"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90761"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68248"
FT                   /db_xref="GOA:A3LYY9"
FT                   /db_xref="InterPro:IPR010729"
FT                   /db_xref="InterPro:IPR038340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LYY9"
FT                   /protein_id="ABN68248.2"
FT                   /translation="MSLRVSMRAFSLSSRVCARSGSKFSFGDLSKVKLRAPIIPTHKNF
FT                   DVSPDHPLWAFFPEGNNTETALRSGDELDMNSREWTFAELRRKSFEDLHKLWYLTLKER
FT                   NILAREVRLAESLRYSRTQQHDALDEKLVTVQKRIKQVLLERQVAHERVQTFTQQQQQY
FT                   LTEFEERYLNASEHEIVSFNEKLVRLQYAFFGIEPQLQDYDLEDINIKFVEGLSFVANL
FT                   KVKRYLKQNPAQEQEFELPLNGVVEELPFLLRNVTEAIEEVKALRQSGESVKLDKIDVF
FT                   PFLRSALSNAIEQEELDQ"
FT   gene            <398110..>398376
FT                   /locus_tag="PICST_63621"
FT   mRNA            <398110..>398376
FT                   /locus_tag="PICST_63621"
FT                   /product="predicted protein"
FT   CDS_pept        398110..398376
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63621"
FT                   /product="predicted protein"
FT                   /note="go_component nucleus; small nucleolar
FT                   ribonucleoprotein complex"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63621"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68064"
FT                   /db_xref="GOA:A3LYZ0"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR034105"
FT                   /db_xref="InterPro:IPR040002"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYZ0"
FT                   /protein_id="ABN68064.2"
FT                   /translation="MSTIRTESQQQEPLDLIRFQLDEFVLVKLRGAREMKGRLQGYDSH
FT                   CNMVLSEAEEYIYSAGDEETVVKKTEMVFVRGDSVILISPISE"
FT   gene            complement(<398617..>399513)
FT                   /locus_tag="PICST_49747"
FT   mRNA            complement(<398617..>399513)
FT                   /locus_tag="PICST_49747"
FT                   /product="predicted protein"
FT   CDS_pept        complement(398617..399513)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49747"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49747"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68249"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYZ1"
FT                   /protein_id="ABN68249.2"
FT                   /translation="MSFVNTKQQRLIEDSVTNHVKYYDKITANYLKLRQSIFKLNASIT
FT                   KQLSEENSIVSDENKVEVYQLRFELDRAIEAYTSHLQELERNLVIAKDIKPPYRSEANS
FT                   EFKTLQEKEQQLTEEIKDIQEVQKPRLDKMMSLVKSFDSNSKSNTARAMNPYRLRDLDK
FT                   NEKVTEVDLRNLLFTHEEIVTLFDDVTVNLKNGNENEDHFSLKAQAIEQLNNNKIFEKV
FT                   ADSKYYYKLHRSQLRDVSASMAVHDYDELINTTIAEITALTKQGNDKKENWNKNAHKLE
FT                   AIKNLLDDMDLEMDSSM"
FT   gene            <399988..>402255
FT                   /locus_tag="PICST_33355"
FT   mRNA            join(<399988..402058,402119..>402255)
FT                   /locus_tag="PICST_33355"
FT                   /product="predicted protein"
FT   CDS_pept        join(399988..402058,402119..402255)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33355"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33355"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68065"
FT                   /db_xref="GOA:A3LYZ2"
FT                   /db_xref="InterPro:IPR013244"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYZ2"
FT                   /protein_id="ABN68065.2"
FT                   /translation="MGFLAELLNAFVRDVDISIDFDMDLEEFSNWIINATNSGLPNDAS
FT                   LRKTAYDLNAECNSQAFCLSFSENDSASPETIELKFIQAKTLQIAKYFNDIHAFSGLFK
FT                   EVHSYTTFLPWFKGLVESYRYYWVNYGSLNAGSVNFDQFLRLDSYSDQFDIMIEPLNKD
FT                   AYSDKLSVSNWFKNVILPLINYNNNNFGPLLNWLFLEETVVLSQPASRKYDIWNKALKA
FT                   IIEYPSIGFNDFKDVISYFLASCYYFALYHENSDRILTSEVIKKYDLIKDTLALLWTEK
FT                   EAPSFDIQVSELPAYASFIEFLKTESNPLRPLFEPTGSSIVALSEIIDTCQSLYPINKL
FT                   SIARYLELKNPSSAHDDKGKEVRKIIANVNPGNYNSLLSSAKLFYGKFVEDNDVEKTKV
FT                   KEIVLERLLFANLFEVVSELYSTPEFRLPVNNYYTLISDKFWDSFNNSSSLNEKIGRFK
FT                   DANNCVNLFDSISADPELEPENKDQIIRIKHLLKAIFNIKNFKLSLEKGKPFTPFQLVD
FT                   KFRNVGQFAVGEKSTPLDLITIILEQNAKSYLAFEKLYKILNDLLLFFEDGTHESDTHY
FT                   FNKLKSACIESSLVANDFQFAYAQSMGLFDHYVKSDSNLNDIWLTFYQVGKYVSPLWFD
FT                   DDSYQEERIQILCKQREILSRTIQIIQPNSLTSDNSKVILSQWERVNSQIEEHYTMTDN
FT                   LGYMANELISDATATTNKTSEKLSNLFVSGLGWAIGANQQQ"
FT   gene            complement(<405241..>407370)
FT                   /locus_tag="PICST_33357"
FT   mRNA            complement(<405241..>407370)
FT                   /locus_tag="PICST_33357"
FT                   /product="predicted protein"
FT   CDS_pept        complement(405241..407370)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33357"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33357"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68250"
FT                   /db_xref="GOA:A3LYZ3"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYZ3"
FT                   /protein_id="ABN68250.2"
FT                   /translation="MLDVQFRHLRSAVTYLGLGLRGFHSSEGLFNSNLRGYLRSGTTKY
FT                   RKQKADRTTKDGVAKQPSRLLKYDPNAQIADFTTFGVFPFLQKKLNDFLLPETQKTNAI
FT                   PDFNASPTPDQKRILSVLKSGHNLLINGGFQTGKSIAMLTYCIEQTLSTTPAFDHHNRP
FT                   DRVQSLIIVPTDELVNRYATYTRYLLKDIPPNCCPKRLVASSSSQRKTVYTLERGPMNL
FT                   AFLSHDSKPQFYSTNVDSHNVGVPNIVVTTAASLEKAIQGQLNLEPSALQDLKFIGVDE
FT                   LDIFLSTTSIGEWDVVVQEGNKNKYVNKIEKMIQKLKSDSISCYSDSLTNDLERVEKKH
FT                   YFKMSSESSFNYSEIVINNRIDDVKSFIANEFKGTSKPDSSLLKKLIKLKRKNLYKPIQ
FT                   YCFLNSAKSNQAYNFGNLPSLSKPEDNDLLISFVDKALRLTNSQKKWKENERRLFQVEN
FT                   FSIPNNAILDNSGKTVFGGIINAYILNSSKSKVKDVQLENEVRDDLSFGDWKNLEKTYL
FT                   RSKLKQISALNEDNYVSVVYETLCIAKKLGITKPFLIMIPEGVDNSMVAASLQQFGNIG
FT                   KISCLSSGTVHEESHVIAHPSQLLGNTIPCVSNILVVGIESLLPEFALGKKATCTTKDN
FT                   IPGLVDPVSDLSIFYLSRLLSSPSSVPKNLIFAISNWNLDPQDIQVTNDLNKLSRSMAF
FT                   NGLLNHVRLKKTSSN"
FT   gene            complement(<407631..>412271)
FT                   /locus_tag="PICST_33358"
FT   mRNA            complement(<407631..>412271)
FT                   /locus_tag="PICST_33358"
FT                   /product="predicted protein"
FT   CDS_pept        complement(407631..412271)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33358"
FT                   /product="predicted protein"
FT                   /note="go_function catalytic activity; nutrient reservoir
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33358"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68251"
FT                   /db_xref="GOA:A3LYZ4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LYZ4"
FT                   /protein_id="ABN68251.2"
FT                   /translation="MKDSTEALNSIAFAVDTTLSSILPSSLAPPSAPPATSSFLKSIWY
FT                   AFWWLWSMVVFKIMNIILLYIPSKIMNALSINFEITLNLSSILVALSAIITVCFLVVRY
FT                   KYLTGYSKDTSDRKTKGKVNPSASNINLKNQSLDYVDQKKGHRRTTNYLDEFLSAIKVF
FT                   GYLEKSVFHELTKNMTTQKLSHDEILYLDEKLGFSIVVEGVMQVYTRITENSNVSGGFD
FT                   PDDDNELNYEKDDVLIIGNQRYQLLNEVKSGAPLSSLVSVLDLLKPVDSEDSTSDMLHS
FT                   FNISDDDNISKIPEISPISLPFQGIHAGAKDDSVPPSPIIRPSKTKQLYPEIVARPKSR
FT                   PHKEHTGHHLHHVHHSGATIAIIPYSAFQRVQSKYPKATSHIVTMVLARLYKVTFNTIH
FT                   DYLGLTKEIMESEVKLNTTSSVRGANLPGYLFDGLLDKIYGANGINEASLSRKSDFQRA
FT                   SSVNLNKQKTTLCDAKSSRYVLLDSRLKSTHPGDLLSSVPLSRRSDYYQTHSHPLSADD
FT                   PLVRSAFPSSKTLSSLSSPTSNLKRASSNLKFENIRDRSFSDDREETEETSLRIAVVES
FT                   IFKILGISEKSTAMRNLSSFNSGRSSVSSSIVGLSNLMSADDKFDTNAARVRFDSYNGF
FT                   SSTATSISRSSTPIKFYNTINQNQLHNHHMGDSVSGINISTLSRQHQANRNSSPTEFNF
FT                   ANVKSDFAKCLEIKSYGPNTTIVEQGSFNSGLYYVIDGSLDVLYRPSNHGEPSSNREDN
FT                   LKKLYSVKSGGVAGYLSSVVGFRSLVTIRTSKKRGVIVAHISKSDYSKLMDRYYFLQLP
FT                   VATKLKKLLSPQILTIDYALEWCHIPAGGVLCSQGDLANGFHIVLSGRFRVVRNKSDRY
FT                   QGNTSDDDILGFSDTSMDCSPSSDINNEDLEVLGEYGHGESIGEVEVLTASRRTNSLIA
FT                   VRDSETARIPRTLFEMLSLSNPSIMVKVSRIVASKVVYKDVLDQSSRNSTLIPSSTASH
FT                   ISNDYKTITILPTVSGLPVREFADKLVSALKAIGRNVIALDQASTLTHLGRHAFDERLA
FT                   QLKLSGYFAYLEEEYETIVYICDTPLKSNWTSTCISQGDCILLLADAEDDVVATGIGDY
FT                   ERLLINLKTMARTDLCLLHPEKYVEPGSTSIWLKNRIWVQGHHHIEMEIIRKKDENSVK
FT                   KRPNIISELASKIGSKTNPSIKSTLEDVRLKAISSFVKLNTSFVHSDRYKAVQPHKNDF
FT                   LRLARILSNEAVGLVLGGGGSRGISHVGIVTALERHGIPVDLIGGTSIGSLVGGLYAKD
FT                   YNIVSIYGRAKKFSKRVASLWRSVFDLTYPVTSYITGYEFNRGIWKIFGFTEIEDFWIR
FT                   YFCNTTNITNSTMDIHESGYSWRFIRASMSLAGLLPPIAFQGCMLLDGGYLDNLPVSEM
FT                   KKKGAKYIIAVDVGSADDRTPMNYGDTLSGFWVLFNRWNPFSKHPNVPNMMDIQMRLAY
FT                   VASVNALEAAKKTNGVIYLRPPIDNYATLDFAKFDEIYHVGLNYADKLFSSWSKNGKLP
FT                   AIAGMVDKAKIKSGDDKKVLYRRNSI"
FT   gene            complement(<412966..>414609)
FT                   /locus_tag="PICST_63214"
FT   mRNA            complement(join(<412966..414334,414362..414441,
FT                   414457..>414609))
FT                   /locus_tag="PICST_63214"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(412966..414334,414362..414441,
FT                   414457..414609))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63214"
FT                   /product="predicted protein"
FT                   /note="go_function transaminase activity; go_process
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63214"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68252"
FT                   /db_xref="GOA:A3LYZ5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYZ5"
FT                   /protein_id="ABN68252.2"
FT                   /translation="MSQAPYSNDSDDAESLLEFERLESTLPPALKRSASSLFEAIQSQN
FT                   PSGHSSPNRENHFNSSWINTGNPTPRTPSQHAVNALLSKLSHSENGRESSPIPVPRPKF
FT                   NEDIVKPAMNTKQSSTGVLWVTERATEYGFDAENQTDWANLGQGAPEHGDTVPGSFIRP
FT                   KTIPVPDYSKEYAPTAGIKKLREAVANYYNETYRQNKLSKYTYKNVCIVPGGRAGLTRI
FT                   ASIISDCYLSFFLPDYTAYAEMLSLFKNFSPIPVPLDEADNYEMHLEMIKNELTRGVSA
FT                   LLTSNPRNPTGRCMTPLHLKQLHDLCREKCLLIMDEFYSHYYYDDGCTGSSISSAQFVD
FT                   DINQDPVLILNGLTKAFRLPGWRICWILGPEEYISALSSAGSFLDGGSNAPFQFTAVDF
FT                   LEPLKVRAEMKALQIHFKMKRDYIIGRLSKMGFTFTEKNIPNSTFYLWLNLSHLPGKLS
FT                   NCLGFFHECLHEKVIVVPGFFFLINPQNLSRLEDVIWYNYVRLSYGPEFNSLVLGMDGI
FT                   ERILHRFGCLPYDPNQ"
FT   gene            <419255..>421177
FT                   /gene="FBX2"
FT                   /locus_tag="PICST_49718"
FT   mRNA            join(<419255..420037,420137..>421177)
FT                   /gene="FBX2"
FT                   /locus_tag="PICST_49718"
FT                   /product="F-box/LRR-repeat protein"
FT                   /note="Has EST support. strong"
FT   CDS_pept        join(<419255..420037,420137..421177)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="FBX2"
FT                   /locus_tag="PICST_49718"
FT                   /product="F-box/LRR-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49718"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68066"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYZ6"
FT                   /protein_id="ABN68066.2"
FT                   /translation="TLVPITSPPDDRSGVHQYPSQFFLSPITSNDSTVSENEDNIVVDD
FT                   SQIDVDVEVTSEHNQEPLSPASSIDSDITDVQNYSQKSFVNESFSPLLSLPLEILYRII
FT                   EIVYYDNHSYNSINSNLETFSQTVPLLSKKFHQLSLCFLYKYAIFNRPHSFDKFLHNLK
FT                   KSPQIGMYVEFMDFQQFTSIGLGRTGRMNQEIQMVTSRTISKALSLTPNLMEFLASENI
FT                   QDDMDVEVLNHLFNRLGKIRALDFCGASSENFVKAFQELPARNLSNLTKVSFHDCSNLT
FT                   PDIFSKVLPHLINLKRLDLNHTSITSTILLNYMPTSIRLTHLSLARCSKLTTRDLIKFI
FT                   TVHPAVSHNSLQWLNLQIDSNVVSPLTDVYLLYTLKHLNAPDLRYVNLGGMPVGSKHLP
FT                   IIKHRFPNLESLAISHSSVNLTDIQEYMKDNTQVKFLDLTGIKQLTRFNLLHILKSNFN
FT                   SSLRGIEFDYKILYDLTSKGEFIKVTPVQTSFIESIQTPQVWKFYDNEGRRSWIYKLAE
FT                   TDSEYRSIMNGRKPSVSAQSNLVYYDLETGSKISTVVKKPDFLKFASRKINCSIGYYNL
FT                   NKYKSKNHHEDVWPVEFSQRGIYNYYSLNLK"
FT   gene            <421661..>422887
FT                   /locus_tag="PICST_33361"
FT   mRNA            <421661..>422887
FT                   /locus_tag="PICST_33361"
FT                   /product="protein serine/threonine kinase activity"
FT   CDS_pept        421661..422887
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33361"
FT                   /product="protein serine/threonine kinase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33361"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68067"
FT                   /db_xref="GOA:A3LYZ7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYZ7"
FT                   /protein_id="ABN68067.2"
FT                   /translation="MSAPELSPVRHPIDVRSLTSYLHSLTPESKGTTLGVNVPDFSKYK
FT                   KLDIQQFKFGQSNPTYLLTDVDTGRQFVLRKKPSPNAKLVSKSAHAVEREFFMLRSIGL
FT                   LNRDPESKGNVPVPEVYLLCEDESIIGYVFYLMEYINGIQIKNPEMIGVSPEDKKLYWK
FT                   SIVETISAIHLLDTTKLIAELPPSHYPQFQNLDKLKKSTYFQRQVRTLSGIANLQNKVV
FT                   DPIPSFQENCEWLLRRAPKDPAKLTLIHGDLKIDNVLFDPKKKVVIGVLDWELCTIGHP
FT                   LFDLANFLQPFQLPNQLNKKMSGSDTTIGSENQDSIDFIYKVLGDYSKKVTWDPQDPSN
FT                   NPIDHWLLGYVFGLLRLCVITQGIAMRSKQGNASSGNAAAYGSFYPFLADLAIKGIEEY
FT                   EARRRSSKF"
FT   gene            423323..424518
FT                   /gene="AROC"
FT                   /locus_tag="PICST_90939"
FT   mRNA            423323..424518
FT                   /gene="AROC"
FT                   /locus_tag="PICST_90939"
FT                   /product="Chorismate synthase"
FT   CDS_pept        423326..424459
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="AROC"
FT                   /locus_tag="PICST_90939"
FT                   /product="Chorismate synthase"
FT                   /note="Chorismate synthase
FT                   (5-enolpyruvylshikimate-3-phosphate phospholyase) (AROC);
FT                   go_component extracellular region; go_function
FT                   neurohypophyseal hormone activity; chorismate synthase
FT                   activity; go_process aromatic amino acid family
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90939"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68068"
FT                   /db_xref="GOA:A3LYZ8"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYZ8"
FT                   /protein_id="ABN68068.1"
FT                   /translation="MSSFGTLFRVTTYGESHCKSVGCIVDGVPPNLELTEDDIQPQLTR
FT                   RRPGQSKLSTPRNEKDRVEIQSGTENGLTLGSPIAMIVKNEDHRPHDYSETDLYPRPSH
FT                   ADWTYIQKYGTKSSSGGGRSSARETIGRVAAGAIAEKLLSKANGVEIVAFVSSIGPVSM
FT                   ARDASDPKFHELLNTVTREQIDATGPIRCPDETVREDMVKVIEKYRDAQDSIGGVVTCV
FT                   VRNCPIGLGEPCFDKLEAKLAHAMLSLPATKGFEFGSGFLGTQIPGSKHNDPFYYDELH
FT                   KRLRTTTNFSGGIQGGISNGENIYFSVAFKSAATISQEQPTATYDGKDGVLAARGRHDP
FT                   SVTPRAVPIVESMTALVLADQLLIQKARESGAAIVGN"
FT   gene            complement(<424746..>425294)
FT                   /locus_tag="PICST_33363"
FT   mRNA            complement(<424746..>425294)
FT                   /locus_tag="PICST_33363"
FT                   /product="predicted protein"
FT   CDS_pept        complement(424746..425294)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33363"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33363"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68253"
FT                   /db_xref="UniProtKB/TrEMBL:A3LYZ9"
FT                   /protein_id="ABN68253.2"
FT                   /translation="MPSFICSTTTSTSVRIMTVRRSKKSTLRKWLVKFCIALLQFKKST
FT                   NSMKAVTTQKQMVTDSNGLILSSNLSSEGYKVVPQTASEIIVVERVHKFSYYLKSETIF
FT                   WDITENSIKDDENALYTELETTGDNLKDTCINNDPISPSQVLSDDSISILSSAVEDNLS
FT                   TNSSPCIDICKEVEYIGKG"
FT   gene            425960..426731
FT                   /gene="EMP24"
FT                   /locus_tag="PICST_91130"
FT   mRNA            425960..426731
FT                   /gene="EMP24"
FT                   /locus_tag="PICST_91130"
FT                   /product="protein carrier activity"
FT   CDS_pept        426012..426614
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="EMP24"
FT                   /locus_tag="PICST_91130"
FT                   /product="protein carrier activity"
FT                   /note="Endosomal P24B protein precursor (24 kDa
FT                   endomembrane protein) (Basic 24 kDa late endocytic
FT                   intermediate component); go_component membrane; go_function
FT                   protein carrier activity; go_process intracellular protein
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_91130"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68069"
FT                   /db_xref="GOA:A3LZ00"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR015720"
FT                   /db_xref="InterPro:IPR036598"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ00"
FT                   /protein_id="ABN68069.2"
FT                   /translation="MKSIRILLALVFCQLIAAHNILLSPYGKSCFFETLKKNDELAVSF
FT                   QVGSRNPHNAEQYVADFYVISPHGKVILKKTDLDHGDEKVKADTNGKYTYCFSNEKTNI
FT                   VDMDVSFNIHGVVYVDVNDPKADSLDYAIQRLSQLTNDVKAEQGYLVIRERTHRNTAES
FT                   TNSRVKWWSVFQILVVAANSVFQIYYLKRFFEVKSVV"
FT   gene            429607..431182
FT                   /gene="AAT2"
FT                   /locus_tag="PICST_66059"
FT   mRNA            429607..431182
FT                   /gene="AAT2"
FT                   /locus_tag="PICST_66059"
FT                   /product="aspartate aminotransferase"
FT                   /note="Has EST support"
FT   CDS_pept        429862..431109
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="AAT2"
FT                   /locus_tag="PICST_66059"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="Aspartate aminotransferase/Glutamic oxaloacetic
FT                   transaminase AAT2/GOT1; go_function transaminase activity;
FT                   go_process biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_66059"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68070"
FT                   /db_xref="GOA:A3LZ01"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ01"
FT                   /protein_id="ABN68070.2"
FT                   /translation="MSYFAGITELPPDPLFGLKARYVADSRTDKVDLGIGAYRDNNGKP
FT                   WILPAVKLAEAKLVSSPDYNHEYLSISGFEPFLKQASKVILGENSAALAENRVVSQQSL
FT                   SGTGALHVAGVLLKEFYTGEKTVYLSKPTWANHNQIFTSIGFKVASYPYWDNDTKSLDL
FT                   KGFLSTIRTAPAGSIFLLHACAHNPTGLDPSQDEWKQVLKELEAKKHLVLFDSAYQGFA
FT                   SGDLDKDAYAIRYAIDQKVISTPIIICQSFAKNVGMYGERVGAIHVIPSTQKDEQLGRA
FT                   LKSQLNRIIRSEISNPPAYGAKIVSTILNDRALRQQWEADLVTMSSRIHKMRLKLKELL
FT                   TNLHTPGTWDHIVNQTGMFSFTGLSPDMVARLEKVHGIYLVSSGRASVAGLNDGNVEKV
FT                   ANAIDEVVRFYAKPKL"
FT   gene            complement(431272..432213)
FT                   /gene="RS27B"
FT                   /locus_tag="PICST_73895"
FT   mRNA            complement(join(431272..431739,432192..432213))
FT                   /gene="RS27B"
FT                   /locus_tag="PICST_73895"
FT                   /product="40S ribosomal protein S27-B (YS20) (RP61)"
FT   CDS_pept        complement(join(431494..431739,432192..432194))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RS27B"
FT                   /locus_tag="PICST_73895"
FT                   /product="40S ribosomal protein S27-B (YS20) (RP61)"
FT                   /note="structural constituent of ribosome; go_component
FT                   intracellular; ribosome; go_function structural constituent
FT                   of ribosome; go_process protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73895"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68254"
FT                   /db_xref="GOA:A3LZ02"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ02"
FT                   /protein_id="ABN68254.1"
FT                   /translation="MVLVQDLLHPNPATEAKQHKLKTLVQSPRSYFMDVKCQGCLNITT
FT                   VFSHAQTAVTCDSCSTVLCTPTGGKAKLTEGCSFRRK"
FT   gene            complement(433158..435172)
FT                   /gene="GLC7"
FT                   /locus_tag="PICST_85252"
FT   mRNA            complement(433158..435172)
FT                   /gene="GLC7"
FT                   /locus_tag="PICST_85252"
FT                   /product="protein phosphatase type I"
FT   CDS_pept        complement(433758..434744)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="GLC7"
FT                   /locus_tag="PICST_85252"
FT                   /product="protein phosphatase type I"
FT                   /EC_number="3.1.3.16"
FT                   /note="Serine/threonine protein phosphatase; go_function
FT                   hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85252"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68255"
FT                   /db_xref="GOA:A3LZ03"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR031675"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ03"
FT                   /protein_id="ABN68255.1"
FT                   /translation="MSADHQEADIDSIVDRLLEVRGSRPGKQVTLLEHEIRYLCTKARE
FT                   IFIQQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLET
FT                   ICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIA
FT                   AIIDEKIFTMHGGLSPDLNSMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDITGWSENDR
FT                   GVSFTFGPDVVSRFLQKHDMDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAG
FT                   AMMSVDESLLCSFQILKPADKKPRYPPSAGANNRPGATPRKPKKTGK"
FT   gene            <436578..>437207
FT                   /locus_tag="PICST_63068"
FT   mRNA            join(<436578..436873,436904..>437207)
FT                   /locus_tag="PICST_63068"
FT                   /product="predicted protein"
FT   CDS_pept        join(436578..436873,436904..437207)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63068"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63068"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68071"
FT                   /db_xref="InterPro:IPR013640"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ04"
FT                   /protein_id="ABN68071.2"
FT                   /translation="MSQPKQLPPFPNSYATKKVADSDAKPCTICYKPATTVLLNDNKMD
FT                   FFYTCDLHLQDEHFATPLPNEEHAELVKSREELEKNLTDLKTKMDAVKPYIWNNTDTKT
FT                   STNDKDDKKDSEKSANKSNNEKFKEYETEIRDKTIKLSETNIKISQFKFKAYKLNQDVY
FT                   RGRIQNYIKAKMNQARTQKIQSDPTFFPTVPSNKLE"
FT   gene            complement(<437464..>438336)
FT                   /locus_tag="PICST_63552"
FT   mRNA            complement(<437464..>438336)
FT                   /locus_tag="PICST_63552"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(437464..438336)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63552"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68256"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ05"
FT                   /protein_id="ABN68256.2"
FT                   /translation="MDLVQQILLTALAGLVIVLVLFFVQSGGISRTFTSSSSPYFKPTF
FT                   LILGANNAGKTSLFYRFVDDSVPEGKKRPVTPTVSSIEPNITEIELPFSNNSISRVYQL
FT                   VDYPGHLKYFQLFYKLLLEDITLQKVKGIVYVIDSSSQWFNNSENIEVISKYLFNLFSV
FT                   TERLQNGVDFLFAVNKNDLFDSVPVHKVKSVLEAEINKLIQNELNTVDKQSGIDKSEDD
FT                   AESDEQYSSTIGHESLREFWLSVIGRPENKFTFDQLEGNTDFVAGSVLKNKVETWENWF
FT                   DEKVVNSNL"
FT   gene            <438943..>439215
FT                   /locus_tag="PICST_63333"
FT   mRNA            join(<438943..439002,439057..>439215)
FT                   /locus_tag="PICST_63333"
FT                   /product="predicted protein"
FT   CDS_pept        join(438943..439002,439057..439215)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63333"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63333"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68072"
FT                   /db_xref="GOA:A3LZ06"
FT                   /db_xref="InterPro:IPR013959"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ06"
FT                   /protein_id="ABN68072.1"
FT                   /translation="MENPHEQAQNALLSRIINNMENLNESVVTINKCLQEVNRNNLDTE
FT                   ILSQMWESYLRNAEFNLEATGQKKEPL"
FT   gene            complement(<439830..>440009)
FT                   /gene="NOP10"
FT                   /locus_tag="PICST_49236"
FT   mRNA            complement(<439830..>440009)
FT                   /gene="NOP10"
FT                   /locus_tag="PICST_49236"
FT                   /product="H/ACA ribonucleoprotein complex subunit 3
FT                   (Nucleolar protein family A member 3) (snoRNP protein
FT                   NOP10)"
FT   CDS_pept        complement(439830..440009)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="NOP10"
FT                   /locus_tag="PICST_49236"
FT                   /product="H/ACA ribonucleoprotein complex subunit 3
FT                   (Nucleolar protein family A member 3) (snoRNP protein
FT                   NOP10)"
FT                   /EC_number="5.4.99.7"
FT                   /note="carries out complex cyclization step of squalene to
FT                   lanosterol in sterol biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49236"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68257"
FT                   /db_xref="GOA:A3LZ07"
FT                   /db_xref="InterPro:IPR007264"
FT                   /db_xref="InterPro:IPR036756"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ07"
FT                   /protein_id="ABN68257.1"
FT                   /translation="MHLMYTLGQDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQR
FT                   VTLKKRYGLLPTQN"
FT   gene            440830..443362
FT                   /gene="SWA2"
FT                   /locus_tag="PICST_66061"
FT   mRNA            join(440830..441993,442015..442019,442122..443362)
FT                   /gene="SWA2"
FT                   /locus_tag="PICST_66061"
FT                   /product="auxilin-like clathrin-binding protein required
FT                   for normal clathrin function"
FT                   /note="Has EST support. strong"
FT   CDS_pept        join(440873..441993,442015..442019,442122..443248)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SWA2"
FT                   /locus_tag="PICST_66061"
FT                   /product="auxilin-like clathrin-binding protein required
FT                   for normal clathrin function"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_66061"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68073"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ08"
FT                   /protein_id="ABN68073.2"
FT                   /translation="MVPPPKKDAFADLFQSATSSTSTKTNSLSMSERQKDLQKSQSLQK
FT                   QQSSSSGLLSTWSNIDVLSGNSSRTSSPAQINPNSFNTYSVLTPSQSSIPASGGSSTAS
FT                   LPRNNVVDDPFDIFGEPAVSSTKPVESHSNGSSNRSNEISLLEGDFEDAFVKKQPIVEP
FT                   QPQHTVAQPKLPTRQDSTPSPVMASRQHTLDNKQRQSPVDRTDSVLAQLVDIGFQIDDA
FT                   TEALEKQGADLQSCVNYIISKNSAVNSRGSTPRNSSRNVASKGLEELSSDFLRSAGYLF
FT                   NKSRQTVLKNLEQLNLSGSNSSSPGVPEWMKNQQKYKDEATEKKFGNGELDYGSDSENI
FT                   NYDEIETFMKSQKEKDRERVKERFENIKTKALKKSKQQRQKPQPRGSNSSQDPDLLNGV
FT                   DTGVVPRRAPKASVIPPVPPRAQKPEPKSNEVDLLGLSSSDESKAVSSLRSSVPLNQFE
FT                   SVDYITSKTTAQNAFKSGDYGTALDSYLTCMNKLPPKHELRVIILSNLGVVYKLVGQLR
FT                   QSLESIESALELISVKEEVQNVAFMIDSKPVKYWYTKLIITKAEVLELMEKYELSLQHY
FT                   QILIKDLGVLDKKIMDGKRRVDKIVNPDNHKAKPATPSTTPKPRPVPASRPASAAPVVS
FT                   KPEGSDVDPLVKDKIDIMIQNWAQSRNNQLRGLLTNLGEIIPSNISMKPALRSLTTNEL
FT                   MLPKQVKVQYLKVISSIHPDKLASQCKDNKQSELVCNGVFIILNKAWDSFKEENKM"
FT   gene            443587..444830
FT                   /locus_tag="PICST_90967"
FT   mRNA            443587..444830
FT                   /locus_tag="PICST_90967"
FT                   /product="Putative trehalase"
FT   CDS_pept        443611..444798
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_90967"
FT                   /product="Putative trehalase"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90967"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68074"
FT                   /db_xref="GOA:A3LZ09"
FT                   /db_xref="InterPro:IPR012901"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ09"
FT                   /protein_id="ABN68074.2"
FT                   /translation="MSQDAEEFRALTSTLSAFYNYHRWETEQIVKPRRIKYDSLSADEK
FT                   LLVPWYEKHTEHLMMCIEMNMQFCQMLATNIATDWGVSADPNDWEPATANEYDKVRSTL
FT                   LQLSKEWSDDGQNERQVSYRKIVDELEAMFPDEEKRQNIKILNPGCGLGRLVMDLIVKG
FT                   FWCQGNEFSYHMLLTSNFVLNHCKFAHNFSIFPYLHKSSHMVKRLNQIRPVSLPDLNPT
FT                   SISELSSKNPSIPYDELMSMTAGSFTDLYGPEDLVISETYTQDTIANEFRSTNKDHFDV
FT                   LVSCFFIDTASNIIDYLKSIHYCLKTGGVWINFGPLLWHFEDDFSTKIISRDNTKVQTI
FT                   MKGLELSREDLVELVEKIGFKFEKRESDIETTYCGDIKALGSFVYKCEYWVCRKL"
FT   gene            complement(<444915..>446612)
FT                   /gene="MLS1.2"
FT                   /locus_tag="PICST_90814"
FT   mRNA            complement(<444915..>446612)
FT                   /gene="MLS1.2"
FT                   /locus_tag="PICST_90814"
FT                   /product="Malate synthase 1, glyoxysomal (MAS) (DAL7)"
FT                   /note="Has EST support"
FT   CDS_pept        complement(444915..446612)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MLS1.2"
FT                   /locus_tag="PICST_90814"
FT                   /product="Malate synthase 1, glyoxysomal (MAS) (DAL7)"
FT                   /note="Malate synthase 1, glyoxysomal carbon-catabolite
FT                   sensitive malate synthase in S. cerevisiae; go_function
FT                   malate synthase activity; go_process glyoxylate cycle;
FT                   tricarboxylic acid cycle"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90814"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68258"
FT                   /db_xref="GOA:A3LZ10"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR019830"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ10"
FT                   /protein_id="ABN68258.2"
FT                   /translation="MTIQAQPLFSSLAGVQVLAPVSKTPEYEPSTTTQADILTKSALSF
FT                   VVLLHRSFNSTRKQLLENRQLVQEQLDQGIPLSFLQDETMTKVRNDPTWQGAFPAPGLT
FT                   DRRTEITGPPERKMIVNALNTPVKTYMSDFEDSSAPTWANVITGQVNLYDAVRHQIDFV
FT                   SKDNGKAYRVNQSQQFSTPTLLVRPRGWHMVDKHILVDGEPVSASILDFGLYFFHNAHE
FT                   LINQGRGPYFYLPKMEHHLEAKLWNDVFNVAQDSLAVSRGTIRATVLIETLPAAYQMEE
FT                   IIFQLRNHSAGLNCGRWDYIFSTIKRLRNDPSKILPDRDQVTMTVPFMKAYCERLINIC
FT                   HRRQVHAMGGMAAQIPIKNDPEANKVAISKVKNDKLREATMNYDGTWVAHPALAPIAND
FT                   VFNEHMPTPNQIHIVPDEDVSEADLSNTAIAGGKITTEGIRKNLFIALSYIESWLRGVG
FT                   CVPINNLMEDAATAEVSRLQLYSWVLHSVKMEDSNKTVTPDLMSSILEEEVEKLTEQFG
FT                   SKGRKFKEAARYLEPEITGKSVSEFLTTLIYDSVVTVGKPIDLEALKD"
FT   gene            complement(<447982..>448905)
FT                   /locus_tag="PICST_36967"
FT   mRNA            complement(<447982..>448905)
FT                   /locus_tag="PICST_36967"
FT                   /product="predicted protein"
FT   CDS_pept        complement(447982..448905)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_36967"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36967"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68259"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ11"
FT                   /protein_id="ABN68259.1"
FT                   /translation="MSLTKLRVAYIPEHFSTPLMFAEKHGFYEKRGLEIEFVEVIEGSG
FT                   RLIKLLNSNEVDIAIGLTEAFVADIAKGNDAYKLIDTYVKSPLLWAISTGSKRDELTVA
FT                   QQLDGKAIGVSRIGSGSYVMSFVLAHSLKFAHEFSSFPILSNFQNLRDSVNLKFGNESE
FT                   LKNSDAFMWEYFTSKKYYDNGEIKQIGEIYTPWPSWVINATKNVYTSNKKAVSDFLAAV
FT                   NEGIAYFNSHVDEAIDHIGTNLDYSKEDAQEWSKTVQFNDKLGEAGLDWESVVSKTSAI
FT                   LKLAGVLSDSDEVIAQRLEGGVVRQL"
FT   gene            complement(<449364..>450011)
FT                   /gene="VPS21"
FT                   /locus_tag="PICST_63641"
FT   mRNA            complement(<449364..>450011)
FT                   /gene="VPS21"
FT                   /locus_tag="PICST_63641"
FT                   /product="Rab5-like GTPase"
FT                   /note="involved in vacuolar protein sorting and endocytosis
FT                   post vesicle internalization"
FT   CDS_pept        complement(449364..450011)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="VPS21"
FT                   /locus_tag="PICST_63641"
FT                   /product="Rab5-like GTPase"
FT                   /note="involved in vacuolar protein sorting and endocytosis
FT                   post vesicle internalization; go_function GTP binding;
FT                   go_process small GTPase mediated signal transduction;
FT                   go_function GTP binding; go_process small GTPase mediated
FT                   signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63641"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68260"
FT                   /db_xref="GOA:A3LZ12"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ12"
FT                   /protein_id="ABN68260.1"
FT                   /translation="MSFPNPATSVKLVLLGEAAVGKSSLVLRFVSNDFQENKEPTIGAA
FT                   FLTQKCTIGERTIKYEIWDTAGQERFASLAPMYYRNAQAAIVVYDITKPASFIKARHWV
FT                   KELHEQASKDITIALVGNKYDLVEDDTEEESLRKVSVEEGKGLAEEEGLLFFETSAKTS
FT                   YNVNDVFIGIGSKIPEAASAGPNQIHQTNNDGRIDLTSDPNNRPRAAGDCAC"
FT   gene            <457638..>458684
FT                   /locus_tag="PICST_36969"
FT   mRNA            join(<457638..457911,457984..>458684)
FT                   /locus_tag="PICST_36969"
FT                   /product="predicted protein"
FT   CDS_pept        join(457638..457911,457984..458684)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_36969"
FT                   /product="predicted protein"
FT                   /note="go_function protein tyrosine phosphatase activity;
FT                   go_process protein amino acid dephosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36969"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68075"
FT                   /db_xref="GOA:A3LZ13"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR016277"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ13"
FT                   /protein_id="ABN68075.2"
FT                   /translation="MAVVPPFMKVPLQQQKENFHQLNDLEAARIRSGLRLPEESDWSVA
FT                   DGINKANAKRNRYTNVFPYDISRVKLPLNEDATGTDYINASYVKLYKSTYIAAQGPLEA
FT                   TVNQFWSMAYNESEKQNNEVILIVMVTPLTESGMVKCNRYWPDKDQKVLEMAAENKQDG
FT                   IDISGLTLEHVSETYDEIGDFLLTEMNLKSSSKSKKVYHFYYYKWADSRVPASIYPLLY
FT                   LSEEINSIRKLVENPPIPIVHCSAGVGRTGTFIAIDHLFRDFDKFIAVCDKAKSSKGYD
FT                   IDFDPVFQTVLQLRDSRMMMVQTAYQFSFLYESAKKLYKERFK"
FT   gene            <458902..>459951
FT                   /locus_tag="PICST_33377"
FT   mRNA            <458902..>459951
FT                   /locus_tag="PICST_33377"
FT                   /product="predicted protein"
FT   CDS_pept        458902..459951
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33377"
FT                   /product="predicted protein"
FT                   /note="go_function nucleic acid binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33377"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68076"
FT                   /db_xref="GOA:A3LZ14"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ14"
FT                   /protein_id="ABN68076.2"
FT                   /translation="MGMDSIYMTSEESMDVTVPISFEFPLQSRYIYRVSVADCGETAQE
FT                   PGNEDRNLDNVPRMVISEKLLQNCLVEVVQYFALEELAIVDGETVHLDNKMLLVCEKCV
FT                   VSQSWVIDMIGDPSIIEHVTMMVFTASLSQDRLIEVEADFWCRYSLARYCRKSHTEYFG
FT                   CKMRHTFEEIYDDTGFIVELLKHKRSCKEIVVKCEDFNTLMVPEPSSSLEMNTEQGIPE
FT                   LVELQNNVEENKENLNAEIKENYENKVNSPLQHSQYRSSMITATVHLKQREVSSLIGVN
FT                   GTRLNTIREQTGCKIKVQPVGNGGNRGIARKDTPQQITVSGHNANVQEAIDEIRSFIVR
FT                   YRSGDFSFM"
FT   gene            460430..462390
FT                   /gene="HSP70.1"
FT                   /locus_tag="PICST_79362"
FT   mRNA            460430..462390
FT                   /gene="HSP70.1"
FT                   /locus_tag="PICST_79362"
FT                   /product="heat shock protein of the HSP70 family (SSB1)
FT                   (HSP75)"
FT   CDS_pept        460467..462308
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="HSP70.1"
FT                   /locus_tag="PICST_79362"
FT                   /product="heat shock protein of the HSP70 family (SSB1)
FT                   (HSP75)"
FT                   /note="heat shock protein of the HSP70 family most
FT                   prevalant transcript on glucose under aerobic conditions"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_79362"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68077"
FT                   /db_xref="GOA:A3LZ15"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ15"
FT                   /protein_id="ABN68077.1"
FT                   /translation="MADGVFQGAIGIDLGTTYSCVATFDSAVEIIANEQGNRVTPSFVA
FT                   FTNEERLIGDAAKNQAALNPKNTVFDAKRLIGRAFDDESVQKDIKSWPFKVIDSNGNPQ
FT                   IEVEYLEETKTFSPQEISSMVLTKMKEIAEAKIGKKVEKAVVTVPAYFNDAQRQATKDA
FT                   GAIAGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLNITGGVFTV
FT                   KATAGDTHLGGQDFDTNLLEHFKKEFQKKTGLDISGDARALRRLRTACERAKRSLSSGT
FT                   QTTVEIDSLFDGEDFSANITRARFEDINSALFKSTLDPVEQVLKDAKISKANVDEVVLV
FT                   GGSTRIPKVQKLLSDFFDGKQLEKSINPDEAVAYGAAVQGAILTGQSTSEDTKDLLLLD
FT                   VIPLSLGVAMQGNVFAPVVPRNTTVPTIKRRTFTTVADHQTTVQFPVYQGERVNCSENT
FT                   LLGEFDLKNIPPMQAGEPVLEAIFEVDANGILKVTAVEKSTGRSANITISNSIGRLSSE
FT                   EIEKMISDAEKFKSSDDAFAKRHEQKQKLEAYVASVESTVTDPVLSAKLKKSAKDRIET
FT                   ALSDALQTLEIEDSSADDYRKAELALKRAVTKGMSTR"
FT   gene            complement(<462546..>463814)
FT                   /locus_tag="PICST_33379"
FT   mRNA            complement(<462546..>463814)
FT                   /locus_tag="PICST_33379"
FT                   /product="predicted protein"
FT   CDS_pept        complement(462546..463814)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33379"
FT                   /product="predicted protein"
FT                   /note="go_function molecular function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33379"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68261"
FT                   /db_xref="GOA:A3LZ16"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR030484"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ16"
FT                   /protein_id="ABN68261.2"
FT                   /translation="MKLDTSHMRYLTSDDFKVLQAVEIGSRNHELVPTTLIHSIGGLKS
FT                   PSGTNRAIGDLAKLKLVNRLRNAKYDGFRLTYSGYDYLALKSMLNRQTVYSVGTTIGVG
FT                   KESDIYSVSDPQGVQKVMKIHRLGRTSFKTVKNNRDYLKNKSTSNWMYLSRLAAEKEHE
FT                   FMVVLYNNGFNVPEPFDSSRHCVLMEWIKGIPMKHLRKHRDYRKLYSELMNFIVKLANH
FT                   GLIHCDFNEFNIIIRDDSEASKHEFDFVVIDFPQCVSIEHPDAKQYFDRDVEGIRSFFE
FT                   KKFRYAPSHDATMFDTEGYGDGYKYAYPNFKRDVIREKSLDVEVKASGYAKKTTGVKED
FT                   KDLEKAVLGMRINRYEDEDDLSEFDDEDVDGEDDEDGDDYEEEEIDSDDDNQEEENERI
FT                   VEMLSSGVKNLKMDKLGNYIIEE"
FT   gene            <465217..>466631
FT                   /locus_tag="PICST_63669"
FT   mRNA            join(<465217..465234,465291..>466631)
FT                   /locus_tag="PICST_63669"
FT                   /product="predicted protein"
FT   CDS_pept        join(465217..465234,465291..466631)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63669"
FT                   /product="zinc metalloprotease"
FT                   /note="go_component membrane; go_function
FT                   metalloendopeptidase activity; go_process proteolysis and
FT                   peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63669"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68078"
FT                   /db_xref="GOA:A3LZ17"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR027057"
FT                   /db_xref="InterPro:IPR032456"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ17"
FT                   /protein_id="ABN68078.2"
FT                   /translation="MFSISESFKFLDSDLINWKLVLGLLSTGKYVFDTYLKYRQYEVLQ
FT                   QKSIPASIKAEIDPNDFEKSTDYNIAKLKLSVFNNTYYLFQRLFTIRTNIFYSLWQTTG
FT                   LLMSRAIPFLPQFMKGTITHSLFFYTTISLISEIIDLPFSYYREFVVEEKFGFNKQTIG
FT                   LWLRDHIVGFALNTVIVNGVLSGLLKVFEIYGESFIVYATGFLFAVSLAFFSLSPFIGR
FT                   LFHKYTPLQDENLKHQIENLASKLNFPKTNIFVIDGSSRSSHSNAYFVGLPWYKEIVIF
FT                   DTLIEKQTTEGVVAVLGHELGHWKLNHIPKLMLIQLLDFTQIFGLFGVFINNKSLYSSF
FT                   GFTESQPAIVGLVLYWIIKEPISSATRFVTNIFSRKFECQADEFAKNLGYQDDLSKSLL
FT                   KLHISSSSVTSTVWLYSAYYNGHPLLSERLSGLGYISKEKISRETKSKPLKED"
FT   gene            <466998..>467405
FT                   /locus_tag="PICST_33381"
FT   mRNA            <466998..>467405
FT                   /locus_tag="PICST_33381"
FT                   /product="predicted protein"
FT   CDS_pept        466998..467405
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33381"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33381"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68079"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ18"
FT                   /protein_id="ABN68079.2"
FT                   /translation="MDIDSINESEGPHEDSSRFNVSNKALNEPKPSDIGRKRHSDVARD
FT                   DSMDLDGEFSDAVETGEFEPSFVTARSTTADDSLAATQEISNVSNTLNEEPEMSIMDSF
FT                   ETSVLKISDGTYAGLYSSWSKQSGFWGNEMV"
FT   gene            complement(<469743..>470558)
FT                   /locus_tag="PICST_33382"
FT   mRNA            complement(<469743..>470558)
FT                   /locus_tag="PICST_33382"
FT                   /product="predicted protein"
FT   CDS_pept        complement(469743..470558)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33382"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33382"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68262"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ19"
FT                   /protein_id="ABN68262.2"
FT                   /translation="MISILVSIFLSFLGIVTAAINDPAYYNSLSSFINKEHNFSKGNGT
FT                   ISVEAASLVYNKRSEYDSYFKDFSFYSFDAFDKLVQLHSLLKDAELASATGDRLYLYNY
FT                   IAFNGQDEQVELSSSSAFKQEVCKFLDINSLNDTSTLSASSGNADLSLFYQQIQIEDCG
FT                   KSKNIARDSTSCDGSHAPNAGNCQALADDLEYNHGGDVFSDSPRSYCLAGCCVSWSAPI
FT                   SATGDWLSAKAGWCIQQCVNAGLSCEIFGVVYANKTLDFCLSYRADGCT"
FT   gene            <471737..>472261
FT                   /locus_tag="PICST_33383"
FT   mRNA            <471737..>472261
FT                   /locus_tag="PICST_33383"
FT                   /product="predicted protein"
FT   CDS_pept        471737..472261
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33383"
FT                   /product="repeat protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33383"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68080"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ20"
FT                   /protein_id="ABN68080.2"
FT                   /translation="MMFHVLLYLILNFCLVNAVMTTSYSKAIGLFTSGTASFAKNSGVI
FT                   RVGSRDAPRDGINPYFVPLNFYSFDNYSKLKAISSILNAAVEAGATGDILYLYNYIAFN
FT                   GEEGNVALTNYTSNFKDEVCLFLKTYEANSTLELSETTADKKLSTYYKNFPVGDCGGDV
FT                   GGDFSSHGYKT"
FT   gene            complement(<472682..>473998)
FT                   /locus_tag="PICST_49558"
FT   mRNA            complement(join(<472682..473622,473689..>473998))
FT                   /locus_tag="PICST_49558"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(472682..473622,473689..473998))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49558"
FT                   /product="putative inositol phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49558"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68263"
FT                   /db_xref="GOA:A3LZ21"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ21"
FT                   /protein_id="ABN68263.2"
FT                   /translation="MKNHVLGALVIIVQLWRRVVLSVLNGRNIFQFILNFFISFSPVLI
FT                   WLSIFKNAGLIPNWTRPPIHVKLAMTLDRYIFDIFLYPIYGITSLSFLVALCGALIKYQ
FT                   ELELQVTTIPMDATLLNSPHSLDADVTPFFERDSNPELFVEHYNNNNGRVSKSLETPKT
FT                   KPLNCWCLATPILVPTSWFILNLVYWFRDPIRTPKDLLAWFLYVVCHLVAPIFTAIWLY
FT                   LFQPPGALRLFSLGLGIQNIAGVVTHLIFPNVPPWYIYFYGEETIPDYDMPGFAAGLIR
FT                   IDMIMGTHIHTAGFHISPIVFGALPSLHSAMAVMVFLFVSYYSRNMGVKIAYLLYVVLQ
FT                   WWATIYLDHHWRLDLIVGMLYSIASFSFLLFWSRGLSFVERNFILARKRCDFKNGSTAG
FT                   MRIFRNTKLQTVFDPYS"
FT   gene            <475614..>476930
FT                   /locus_tag="PICST_63545"
FT   mRNA            join(<475614..475923,475990..>476930)
FT                   /locus_tag="PICST_63545"
FT                   /product="predicted protein"
FT   CDS_pept        join(475614..475923,475990..476930)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63545"
FT                   /product="Inositolphosphotransferase 1"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63545"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68081"
FT                   /db_xref="GOA:A3LZ21"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ21"
FT                   /protein_id="ABN68081.2"
FT                   /translation="MKNHVLGALVIIVQLWRRVVLSVLNGRNIFQFILNFFISFSPVLI
FT                   WLSIFKNAGLIPNWTRPPIHVKLAMTLDRYIFDIFLYPIYGITSLSFLVALCGALIKYQ
FT                   ELELQVTTIPMDATLLNSPHSLDADVTPFFERDSNPELFVEHYNNNNGRVSKSLETPKT
FT                   KPLNCWCLATPILVPTSWFILNLVYWFRDPIRTPKDLLAWFLYVVCHLVAPIFTAIWLY
FT                   LFQPPGALRLFSLGLGIQNIAGVVTHLIFPNVPPWYIYFYGEETIPDYDMPGFAAGLIR
FT                   IDMIMGTHIHTAGFHISPIVFGALPSLHSAMAVMVFLFVSYYSRNMGVKIAYLLYVVLQ
FT                   WWATIYLDHHWRLDLIVGMLYSIASFSFLLFWSRGLSFVERNFILARKRCDFKNGSTAG
FT                   MRIFRNTKLQTVFDPYS"
FT   gene            complement(<477351..>477875)
FT                   /locus_tag="PICST_33386"
FT   mRNA            complement(<477351..>477875)
FT                   /locus_tag="PICST_33386"
FT                   /product="predicted protein"
FT   CDS_pept        complement(477351..477875)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33386"
FT                   /product="repeat protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33386"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68264"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ20"
FT                   /protein_id="ABN68264.2"
FT                   /translation="MMFHVLLYLILNFCLVNAVMTTSYSKAIGLFTSGTASFAKNSGVI
FT                   RVGSRDAPRDGINPYFVPLNFYSFDNYSKLKAISSILNAAVEAGATGDILYLYNYIAFN
FT                   GEEGNVALTNYTSNFKDEVCLFLKTYEANSTLELSETTADKKLSTYYKNFPVGDCGGDV
FT                   GGDFSSHGYKT"
FT   gene            <479054..>479869
FT                   /locus_tag="PICST_33387"
FT   mRNA            <479054..>479869
FT                   /locus_tag="PICST_33387"
FT                   /product="predicted protein"
FT   CDS_pept        479054..479869
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33387"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33387"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68082"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ19"
FT                   /protein_id="ABN68082.2"
FT                   /translation="MISILVSIFLSFLGIVTAAINDPAYYNSLSSFINKEHNFSKGNGT
FT                   ISVEAASLVYNKRSEYDSYFKDFSFYSFDAFDKLVQLHSLLKDAELASATGDRLYLYNY
FT                   IAFNGQDEQVELSSSSAFKQEVCKFLDINSLNDTSTLSASSGNADLSLFYQQIQIEDCG
FT                   KSKNIARDSTSCDGSHAPNAGNCQALADDLEYNHGGDVFSDSPRSYCLAGCCVSWSAPI
FT                   SATGDWLSAKAGWCIQQCVNAGLSCEIFGVVYANKTLDFCLSYRADGCT"
FT   gene            complement(<485918..488831)
FT                   /locus_tag="PICST_68309"
FT   mRNA            complement(<485918..488831)
FT                   /locus_tag="PICST_68309"
FT                   /product="predicted protein"
FT   CDS_pept        complement(486048..488831)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_68309"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68309"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68265"
FT                   /db_xref="GOA:A3LZ25"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR007722"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR036189"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ25"
FT                   /protein_id="ABN68265.2"
FT                   /translation="MSKSKIYNSRFTNHIHSLSYLFASFTIHSSSFLSFSTLSSISNSL
FT                   MSIQLRDGLANQSVDLVLEDLLVRFLVNCPEEDLSSIERVFFQVEEAQWFYTDFVRVLN
FT                   PALPNMKMKSFCSKFLEKCPLFWKWGDPNDALSRFGKYKSTIPVRGVALFNRDLTKVLL
FT                   VKGTESNSWSFPRGKISKDESDINCAIREVEEETGFNAKDLINESDVIERTFKGKNYKI
FT                   YLVRDVPEDYNFSPVARGEIAMIEWHDIKTLQKKIRASPNNYFIVETVIKPMIQWINKK
FT                   KGGLNEAELMLKAEIQLKALLGVGKREENVDAGRELLNILQKVSPSHSASDSNVVPLSS
FT                   TVPGAPQQQNYIQFALPQHLQNQIPFFSSSSTHHPQPMLPFFNPFGFYPGGSPLPPHAI
FT                   TPVPMPVPPHQIPFSNVSPQKQRHPYEIHQPTSESLQKPTGKNSKEFLSILNTKSSKIT
FT                   DEATSKDYVRSTEAENNRTKAQDLLNLVGKQRKESVTSESRSILDLVNRKQVSSSPSPE
FT                   QDPGKTLLNILNEKKHPEIVPTRDSRFLGINSPIASNDLEESVIHGAGLGLPAPEPGKI
FT                   TLLKRPDDATEGRRKKSADLLSLLGKKPIVQPRQEVKSSSNEILDLLKGPKKPLSETTR
FT                   SPNSSSKELLELLKPKKEPIAVDHTSSNELLDLLIKNKPSSESEKKPNNPLLDMLHSKA
FT                   PRQVSQPNAEHNHTSANELLGLLNKKPSIPLNDADSNFIREEKIEETQFDNFEDFEDFE
FT                   DFGVIDNQLLGKTSFRNFDIASDEEDVDHLIDDLGDPYSAPNTAVESFSNPPDFFSDPQ
FT                   PSLEPKKGKIRLLKPGEVLNDIFSTNRPNVSSPPVHASNANGQNLLALLNGKNPSNSNG
FT                   AIPVSDSFQSIYGNANPTAGLDSNTPSSLTNALSGQNSPNKNSANFLKDILWKREP"
FT   gene            <490772..>492415
FT                   /gene="MDR16"
FT                   /locus_tag="PICST_63750"
FT   mRNA            <490772..>492415
FT                   /gene="MDR16"
FT                   /locus_tag="PICST_63750"
FT                   /product="multidrug resistance protein 6
FT                   benomyl/methotrexate resistance protein"
FT   CDS_pept        490772..492415
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MDR16"
FT                   /locus_tag="PICST_63750"
FT                   /product="multidrug resistance protein 6
FT                   benomyl/methotrexate resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63750"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68083"
FT                   /db_xref="GOA:A3LZ26"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ26"
FT                   /protein_id="ABN68083.2"
FT                   /translation="MHYRFIRDSFFGRVVYHLSGHQFFSHKEESSDYIVPEIYLKGTEG
FT                   ANFSKEENELNSIVSNSLSSQSEQTILAADRIIVDWDGEDDPENPVNWPLYQKAFFIFE
FT                   IAFLTVSVYMGAALYTPGLEQIMEEFHISQVVATLPLTFFVIGYGIGPMVLSPLSENAA
FT                   VGRTSIYIITLFVYFILQIPTALSKDIASLTVLRFISGIFASPCLATGGASIAEVLTDP
FT                   YAPVGLACWAIAGFCGPSLGPFIGSVLVVKGGWRWAFWFQCIATGVCLLVLTFFLPESY
FT                   GSTLLYRKAKRLRRVTGNENITSEGEIENSKLTLRELVVETLWRPIEISILEPVVLLIH
FT                   MHIAMVYSILYLWFEAFPIVFMETKGFTLIELGMTYLSINVGSFLGAAIYVPIVLHAYT
FT                   KKVLNNETIVPEVFIPLAIVGSVCMPVGVFIFGWTSVKEFPWVAPLIGAAIFTIGAFFI
FT                   FQTLFNYMGMSFKKYLASAFAGNDLFRSVIAGVFPLFGRPLFENLKTDKYPVGWGSSIL
FT                   GFITLGMVAIPVLFYLNGPKLRARSKYSSL"
FT   gene            <493576..>494439
FT                   /locus_tag="PICST_63799"
FT   mRNA            <493576..>494439
FT                   /locus_tag="PICST_63799"
FT                   /product="predicted protein"
FT   CDS_pept        493576..494439
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63799"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63799"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68084"
FT                   /db_xref="InterPro:IPR007849"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ27"
FT                   /protein_id="ABN68084.2"
FT                   /translation="MFRNSVRSFSVAVPRSNKSPRFVTTLKEASKPALEKSRPITKPIG
FT                   LESPVLLNHKLGDTYSLTNIKQELFSSEAKERRQKKLDYEIRHSPFYETKSFRNTNGKI
FT                   FTPPISFFKKDKALYFPDFISSTLDGQSRSLYEILADKVSIVRLYSTVSGEQCSHSYFK
FT                   VDGKDYAQGDYGVFEENHPQSQIIDINIPQNWMKGFLLGLSKSNIKKTISPQRHNKYFI
FT                   LPDHIFQYSLREKLMCDNMCSGYIYLLDHNGKLRWATSGYANDEELALMWKCVRGLEKE
FT                   LSSLKD"
FT   gene            <495820..>497544
FT                   /gene="PSV1"
FT                   /locus_tag="PICST_91557"
FT   mRNA            <495820..>497544
FT                   /gene="PSV1"
FT                   /locus_tag="PICST_91557"
FT                   /product="Major viral coat protein"
FT   CDS_pept        495820..497544
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PSV1"
FT                   /locus_tag="PICST_91557"
FT                   /product="Major viral coat protein"
FT                   /note="Pichia stiptis virus 1 PsVirus1 Major viral coat
FT                   protein GAG1 (MCP) similar to Saccharomyces cerevisiae
FT                   virus L-A (L1) with sequence similarity to similar"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_91557"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68085"
FT                   /db_xref="InterPro:IPR015302"
FT                   /db_xref="InterPro:IPR036332"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ28"
FT                   /protein_id="ABN68085.2"
FT                   /translation="MITALASANSTNLGFHPFHVEGHCSFLSQVEVRNGDNRRNFKPKT
FT                   NFVWLGEVHGIINAREPTHFINEGTSYYKKPRLVGIDERSESQHALLVNLIRLYHLTLL
FT                   NEEGDLRNVKNIRYDDGHSTAHTSWPREIGEKWNWPNSSSSEEYPEFISLDETSEQQSH
FT                   SMVLDFTGLSDEEITIMWRMCSRWCQRTNFKLDFELPKLASRIYCKSSRTMPNFLEVEE
FT                   VRTRNPKRIPKSSQIWDLIVKYVRRNRLESQARSSCLVISHIMLSLLPDTLEGLSFLSE
FT                   RVEIHLPSLFSLRQLSSDKEENERMLNDWRQIEKYPAIIFNYGLFVANCFPIGLMKREL
FT                   FPTEGVHEKDLVNAMVSYATGIGVASFDNSNLFVSYPNLVDTKNRVFAVKANVEEEKGY
FT                   SVENDIVSSFGFPCFGNPYLFHPLHTFKNEIEQGTPHEGEFMLKKPKIENNKCILNLID
FT                   AWSYAWTYRIGGYDCHIEIDNSHLFKAFAPNESSWTVIYLVNKKKTDNLVESKVTITKI
FT                   EKRKNSFFKLQDFTKPDFSPSCVEVVVKKKYPIDTNKSVQKLQNWDNILDGAKNLKG"
FT   gene            <498357..500277
FT                   /gene="PSV2"
FT                   /locus_tag="PICST_91558"
FT   mRNA            <498357..500277
FT                   /gene="PSV2"
FT                   /locus_tag="PICST_91558"
FT                   /product="major coat protein/ssRNA-binding protein-IMP
FT                   dehydrogenase/GMP reductase"
FT   CDS_pept        498357..>500276
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PSV2"
FT                   /locus_tag="PICST_91558"
FT                   /product="major coat protein/ssRNA-binding protein-IMP
FT                   dehydrogenase/GMP reductase"
FT                   /note="Pichia stiptis virus 1 MCP2 1-650 aa: major coat
FT                   protein 600-end: ssRNA-binding protein - IMP
FT                   dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_91558"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68086"
FT                   /db_xref="InterPro:IPR015302"
FT                   /db_xref="InterPro:IPR036332"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ29"
FT                   /protein_id="ABN68086.2"
FT                   /translation="MLYTGINCYSPTQEHGHTKVYLEILLRAICSDSIQSKTFEAVQSF
FT                   TWLGPVRSKFAPSESSFDGLSKLFLTIDSGLCLDNIKLQAKILTGLQMSSIDDHFDEFS
FT                   STNWYDNHVSLLINILRLYILLDLAEKKGLQTGRFPPLNNKTYEVDVNNILPFPDTPVK
FT                   FSWPGGSEKKGYPNFVYANDFFPTSSSPYIDLRGLDIDEARIVLFMTGEWKAQTNFKVD
FT                   FNSSKLCNEIFYRYRKPINELDLWYNSDDFGMPMSHVVLSALRKYVVNNSLYYQFHIAS
FT                   DLISQLMLTIFPENVEGMTWLQHTAEINLPIFGSIRGRYPFLCQGETAIARPDHIKEWA
FT                   LFIANPYLLFSRSLVLATCFNIGLAARDFRIRNSLSSKETIEEFFLDSESFYASAISLA
FT                   TGSEFPKNEMTSACLFYPSLLETCGTYSVPVSSLQNQSEIIVDNCVFHDVPFVGSPYTS
FT                   YPIAVFDDESPYSGKFSIPTPIRVVDNGAIYSPLDTWKLAWLCEVAGYKLHASSMKSKD
FT                   EIYKHAGRSKWYSLSLNCLSIDSEGLLVTGFERINEDFIHLPNFLLPDTYPSFDIEVEV
FT                   CNLFVDVKNCRESRRAISAGVSSIRWRSFGDSTPEIVKGSMKRVNGSLIATEYEREVVQ
FT                   GKDFE"
FT   gene            510566..511234
FT                   /gene="RPS20"
FT                   /locus_tag="PICST_85261"
FT   mRNA            510566..511234
FT                   /gene="RPS20"
FT                   /locus_tag="PICST_85261"
FT                   /product="ribosomal protein S20"
FT   CDS_pept        510586..510945
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RPS20"
FT                   /locus_tag="PICST_85261"
FT                   /product="ribosomal protein S20"
FT                   /note="go_component intracellular; ribosome; go_function
FT                   structural constituent of ribosome; go_process protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85261"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68087"
FT                   /db_xref="GOA:A3LZ30"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ30"
FT                   /protein_id="ABN68087.1"
FT                   /translation="MSAPINKEKVEQEQEQAIHKIRITLTSTKVKQLENVSANIIRNAV
FT                   QNDIVKKGPVRMPTKVLKITTRKTPNGEGSKTWDTYEMRIHKRVIDLQAPAATVKKITQ
FT                   ITIEPGVDVEVTIAA"
FT   gene            <511891..>513816
FT                   /locus_tag="PICST_36975"
FT   mRNA            join(<511891..512000,512145..>513816)
FT                   /locus_tag="PICST_36975"
FT                   /product="predicted protein"
FT   CDS_pept        join(511891..512000,512145..513816)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_36975"
FT                   /product="predicted protein"
FT                   /note="go_function catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36975"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68088"
FT                   /db_xref="GOA:A3LZ31"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ31"
FT                   /protein_id="ABN68088.2"
FT                   /translation="MVFVLAARPRLLYVSSRQLHSFNKRLLSKTVSTKLLNISNSSTNN
FT                   RNNSNNSNKNRNNSSNYTSFKGRNGSVALVSGVIIVGSYITFSSSNYYNLDTLPSHNGN
FT                   NNGNPRLLTAAANDGKKYFSTSTSSMHQKNSISQQQHKEGVFLLNEEQVSAKLRQFEES
FT                   YFVHRGRGVTRYDICQLPSNSPIEDDRAEEIVQVPILQENNIKTSTDWMFFGVFDGHGG
FT                   WTTSSKLRDQLIGYIIHELGTIFKTASTEENLRYVPNSATIDQAIKNGFLKLDHELVNK
FT                   NIEKLLNDNNKAKAAELLMPALSGSCALLSFYDTNSKTLKVAVTGDSRAILGSFKDNQW
FT                   TVRQLSIDQTGSNPTEVARIISEHPDESKVIRNGRVLGSLEPTRAFGDCRYKLPASIQE
FT                   RIYKQFFGKRLPNHLQSPPYVTAEPVITTTKINPENNDFLVMASDGLYEMLTNEEIVGL
FT                   VVKWMEKEKVIKPQKSFWNVFGSNENKLPEVSDVTNDKSSKKPIRKTKGSNGAFLLEDR
FT                   NVSTHLIRNALSNGGSKEQTTMLISIPNPVSRRYRDDLTVTVVFFGEDVHGENEAGKLE
FT                   INANATAGGIDSSKPKL"
FT   gene            514529..>515651
FT                   /gene="PEX19"
FT                   /locus_tag="PICST_85253"
FT   mRNA            join(514529..514863,514888..>515651)
FT                   /gene="PEX19"
FT                   /locus_tag="PICST_85253"
FT                   /product="40 kDa farnesylated protein associated with
FT                   peroxisomes"
FT                   /note="Has EST support"
FT   CDS_pept        join(514632..514863,514888..515651)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PEX19"
FT                   /locus_tag="PICST_85253"
FT                   /product="40 kDa farnesylated protein associated with
FT                   peroxisomes"
FT                   /note="go_component peroxisome"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85253"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68089"
FT                   /db_xref="GOA:A3LZ32"
FT                   /db_xref="InterPro:IPR006708"
FT                   /db_xref="InterPro:IPR038322"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ32"
FT                   /protein_id="ABN68089.1"
FT                   /translation="MSSEKTTVPESQAPLPAENPTPDSVEEKTVPVGDAKTEQKAGSNV
FT                   AAADDDLDDLDDLLDDFADDVLNKPPGSALAGAGGADTAGKKTADAPLNDEFKLNIEGL
FT                   IKDLNIEDPETKDQFEDLVKQFEVNHRADIEAEEKKPYNFEYVMKETMERLKKSGETVD
FT                   EKIKNDPSAANPEDMLSELLAGFGGAGGAGDMDMSKLLSDMLEQLSSKEVLYEPIKDLN
FT                   TKLPGYLKENKGVINEVQYAKYSSQYDITGEILAVFDAPGYSDDQKDKREKVNSLLESL
FT                   QEFGQPPVELVGEGGIPGLDGGLGGDGLDFNDKDLPKDLEKQLEDGCKQQ"
FT   gene            complement(515775..518322)
FT                   /gene="AFG2"
FT                   /locus_tag="PICST_90881"
FT   mRNA            complement(515775..518322)
FT                   /gene="AFG2"
FT                   /locus_tag="PICST_90881"
FT                   /product="AAA+-type ATPase"
FT                   /note="Has EST support"
FT   CDS_pept        complement(515939..518305)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="AFG2"
FT                   /locus_tag="PICST_90881"
FT                   /product="AAA+-type ATPase"
FT                   /note="go_function ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90881"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68266"
FT                   /db_xref="GOA:A3LZ33"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ33"
FT                   /protein_id="ABN68266.2"
FT                   /translation="MSSKQSSKKKSAGTPTQPTPSKKVKIPKQFIVRPNSNSSTKSLSR
FT                   AYLNSEIFQALEFTNGTLLFVSRADSGAPGVLVSVYYDDTILDKNIITVSSNMRNLGGL
FT                   LLGDRVQFSRYLQQPEYAKSVSLAIEGFNEDSFSDETINYIRKTLDETGIIFPGLKISI
FT                   SLPQEGSEEKTTQLSIVDINRGEDLEKALSKLQISADDIDDENDDDCFSQVGTVSPAFL
FT                   FQRSKTSVIKSVEDQPSRSKYPNLPVQIGYANIGGLSKQVALLQSTVELPLNNPTLFSD
FT                   FGISPPRGILLHGPPGTGKTMLLRCVASETNAHILTINGPSIVSKYLGETENAIRDIFI
FT                   EARKYQPSIIFMDEIDSLVPSRNSDDSGETESRVVATLLTMMDGMGDSGRIVVVAATNR
FT                   PNSIDAALRRPGRFDQEVEIGIPDVDARTDILLKQFAKMNASKCDLSEDDITLVASKTH
FT                   GYVGADLTALCREAVMKAIGRGLKAGIAQTQLKVNLQDLTEALPEIRPSAMREIFLEMP
FT                   KVFWSDIGGQHELKQKLMEVVQLPLEAADSFKALGVSAPKGVLLYGPPGCSKTLTAKAL
FT                   ATESGLNFLAVKGPEIFNKYVGESERAIREIFRKARAAAPSIIFFDEIDAISGDRESAS
FT                   TSASQHVLTSLLNEIDGVEELKGVVIVAATNKPTEIDPALLRPGRLDRHIYVAPPDYEA
FT                   RLQILKNGSKKFNIVPEDVDLSELALLTDGCSGAEVALVCQEAGLAAVMESRNASTVQK
FT                   KHFEHALKGISKGITSDMIRYYEEFANRGGLNVKT"
FT   gene            complement(<518699..523579)
FT                   /locus_tag="PICST_85287"
FT   mRNA            complement(join(<518699..521919,521953..522904,
FT                   522938..523579))
FT                   /locus_tag="PICST_85287"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(519794..521919,521953..522904,
FT                   522938..523579))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85287"
FT                   /product="predicted protein"
FT                   /note="go_function nucleic acid binding; helicase activity;
FT                   ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85287"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68267"
FT                   /db_xref="GOA:A3LZ34"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR016438"
FT                   /db_xref="InterPro:IPR025696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040801"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ34"
FT                   /protein_id="ABN68267.2"
FT                   /translation="MSVDSGAEDDALRSILDPHTRTNFREDFGEDFAAQDQELLNSYVA
FT                   PSDHVTWEIQRSVQTVPQVDKQKVHRLLLKSPERMRRTSYRLKRNILFGQVTGYKEELR
FT                   QADIDNAKAENSMSVNRKYTTKLEALRGRSSYLPFNPGGIIGDLKEVKPIVKTKRSHRD
FT                   QYGLLDRPPDLSRGLKLDESQQNQQIESLAESIDSLKMLNEVNDLDDEGTKQSSQEQPS
FT                   SQVFPVPFVAAEIEGIVVPDFVAINAASKAKRKQKSWAHVVDLDHTIDNFHELIPNMAR
FT                   TWPFELDTFQKEAVYHLEKGDSVFVAAHTSAGKTVVAEYAIAMASRNLTRTIYTSPIKA
FT                   LSNQKFRDFKETFKDTDVGLITGDVQINPGANCLIMTTEVLRSMLYRGADIIRDVEFVI
FT                   FDEVHYVNDIDRGVVWEEVIIMLPDHIKYILLSATVPNTFEFANWVGRTKEKDIYVIST
FT                   PKRPVPLEIFISAKDNMFKVVDSHRVFSEDEFKKHKEHLENSKKKPGLPKASMGSGTRG
FT                   GPGGSARGGNRGGRGGQSANRGRGNLVTRAGGRFFAQDGPNKGTWLNLVQYLKKSNLLP
FT                   CVAFVFSKKKCEEYADSLTSVDLCTAREKSEIHMFIDKSLFRLKKEDRELPQILKIREM
FT                   LSRGIAVHHGGLLPIVKECIEILFAKTLVKVLFATETFAMGLNLPTRTVVFSSLRKNDG
FT                   RSFRNLLPGEFTQMSGRAGRRGIDATGTVIVMAYNDPLSPVDFKEITLGTPTKLQSQFR
FT                   LTYNMILNLLRIEALPVEEMIKHSFSENSTQVLLPENQKKVDKLLLQSHSLKLTPCEEC
FT                   DLEGIQETYDLMKSYEVLYGQLTALIHEVSASKLQILKSGRLVFFRDNNKVVRMGAIVK
FT                   SDNSTDSVSIITFDHGKPFEEDSAMFKLPFVPIYEYRLMNFKKIIFNGNLRVESVPYES
FT                   ICFICGYAIMANIFQVLQNEEKAVSEFKEQINSILEFQNEIEEVSFGLMNKLSLYESLA
FT                   GKRNIYEQLCKTTSWECSNFKSHYVEIHEKNKLEVEIASLQSMISDENLELLPDYAQRL
FT                   QVLETMGFIDEQQNVVLKGRVACEINSGWELVVTELVLDNFLGDFEPEEIVALLSCFVY
FT                   EGRTNEEEPPLINGRLERGKTRILELTEKLLDVYGEHQVSLTSEEEEFLDRKRFALTNV
FT                   VFEWARGLSFNEVMQISPEAEGTIVRVITRLDEVCREVRNAALIVGDSTLSQKMSVAQE
FT                   KIKRDIVFCASLYL"
FT   gene            <524162..524981
FT                   /locus_tag="PICST_85060"
FT   mRNA            <524162..524981
FT                   /locus_tag="PICST_85060"
FT                   /product="predicted protein"
FT   CDS_pept        524162..524638
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85060"
FT                   /product="predicted protein"
FT                   /note="go_function ubiquitin conjugating enzyme activity;
FT                   go_process protein modification; ubiquitin cycle"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85060"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68090"
FT                   /db_xref="GOA:A3LZ35"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="InterPro:IPR027230"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ35"
FT                   /protein_id="ABN68090.1"
FT                   /translation="MSLCKTRLQEERKQWRKDHPFGFFAKPCKAPDGSLDLTQWTAGIP
FT                   GKAGTLWEDAVYPITISFPEEYPSKPPKVKFPANFYHPNVYPSGTICLSILNEEQDWRP
FT                   AITLKQIVLGIQELLDTPNPDSPAQEPAWKAFSKDRTMYDKKVKEQAKRYVNAG"
FT   gene            complement(525029..527183)
FT                   /gene="FBP26"
FT                   /locus_tag="PICST_68318"
FT   mRNA            complement(525029..527183)
FT                   /gene="FBP26"
FT                   /locus_tag="PICST_68318"
FT                   /product="fructose-2,6-bisphosphatase (FBP26)"
FT                   /note="Has EST support"
FT   CDS_pept        complement(525124..526494)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="FBP26"
FT                   /locus_tag="PICST_68318"
FT                   /product="fructose-2,6-bisphosphatase (FBP26)"
FT                   /EC_number="3.1.3.46"
FT                   /note="fructose-2,6-bisphosphatase (FBP26) (FRK26);
FT                   go_function catalytic activity; ATP binding; go_process
FT                   metabolism; fructose 2,6-bisphosphate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68318"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68268"
FT                   /db_xref="GOA:A3LZ36"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR013079"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ36"
FT                   /protein_id="ABN68268.2"
FT                   /translation="MPVYSISHVENVRVCVVMVGLPARGKSLIAQKIVRYLSWLSINSK
FT                   CFNVGSYRREIATDTVVDAEFFDPKNEVGMNYRQEAITRATTDMMKWFSDDNGVVGILD
FT                   ATNSTRDRRDKILKLCRENSIEPMFLESFCDDQDLIMQNILDVKTTSPDYLNRNNEFAA
FT                   EDFLKRIKFYEQVYETMDQKADADLTFIKLVNVNSQIILNRIESYLESRIVYYVMNLHI
FT                   KPRSIWLSRHGESEYNLTGQIGGDSNLSERGWRYAKRLPELVLKSLGEENKHTNLTVWT
FT                   STLKRTQQTSSFLPYKRKLQWKALDELDAGECDGMTYEEIEKTFPEDFKARDDDKYEYR
FT                   YRGGESYRDIVIRLEPIIMELERQENILIITHQAVLRCLYAYFMNVPQEESPWMSIPLH
FT                   TLIKLEPRAYSTLVSRIKADIPAVSTYKEKGTSQLGELETGTASKSRDLIRDSELAK"
FT   gene            <528162..>529913
FT                   /locus_tag="PICST_62920"
FT   mRNA            join(<528162..529441,529469..529574,529623..>529913)
FT                   /locus_tag="PICST_62920"
FT                   /product="predicted protein"
FT   CDS_pept        join(<528162..529441,529469..529574,529623..529913)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62920"
FT                   /product="predicted protein"
FT                   /note="go_function hydrolase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62920"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68091"
FT                   /db_xref="GOA:A3LZ37"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR014485"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041823"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ37"
FT                   /protein_id="ABN68091.2"
FT                   /translation="RDLEWKDVNFLHTTDTHGWYSGHLNQKTYNANWGDFVSFVTRMRE
FT                   KAKANGQDLLLVDSGDRHDGNGLSDITTPNGIKSTPIFIKQEYDILTTGNHELYVWENS
FT                   KMEYEVIAKHFPENYVSSNVEFKLENGTFVPFGKRYRYFTTPNRNLRVLAFGFLFDFNR
FT                   YNDGTRVIPIQEIVDQSHWFNETLHAHPAGEVDIIVVVAHVPVQREWPELFYLHNHLRK
FT                   FYPDTLIQYFGGHSHIRDFTVFDNKSTGLQSGRYCETVGWNGVNTNVEAISNIRGRYSR
FT                   SYIDFNVNSFLHHSKFDSKDDFDTQKGVEVTELIKKTRKSLNLNKPLGYVKENYFVDYV
FT                   PLANHKNIFNLLSNKILPELIPESKNITTASERIIIINTGSIRYDLYKGSYTIDSMYIV
FT                   SPFQNQWHKMTLPKSIAVQVATTLNAARKIDNRELAPPHQYLQSSDADVTKVSKRQQVF
FT                   HYPVKVKLSKGYVTYDDFGSDGDDTPHKAVVNFPIPNVIESRQLDKRTGDDTSIDLVFY
FT                   DFITPNILWALEQLNYTVSASSEFYSSKYLGLIMNDFFKEK"
FT   gene            complement(<530026..>530638)
FT                   /locus_tag="PICST_36980"
FT   mRNA            complement(join(<530026..530543,530614..>530638))
FT                   /locus_tag="PICST_36980"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(530026..530543,530614..530638))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_36980"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36980"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68269"
FT                   /db_xref="GOA:A3LZ38"
FT                   /db_xref="InterPro:IPR019488"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ38"
FT                   /protein_id="ABN68269.2"
FT                   /translation="MSQIQQDPKPFLKKFLSSLDIQFNSPTSSTQFANVDQYATSFGKN
FT                   LKRSSAVIVDGTPLIPTGTDDARLEFQKKWIQVPLTMHQLNSYDCHLIPGTGVFVINLS
FT                   VKVKFDESGRSKLGESADLVHDSTGSRNTRPIWGSWFGVNINMVVDETVINNGDGEVIS
FT                   SFDYRFTYKPDDSVIRI"
FT   gene            <532885..534913
FT                   /gene="ASH1"
FT                   /locus_tag="PICST_66069"
FT   mRNA            join(<532885..532997,533085..533306,533502..533756,
FT                   533790..533977,534041..534227,534276..534913)
FT                   /gene="ASH1"
FT                   /locus_tag="PICST_66069"
FT                   /product="GATA-type transcription factor"
FT                   /note="Has EST support"
FT   CDS_pept        join(532885..532997,533085..533306,533502..533756,
FT                   533790..533977,534041..534227,534276..534711)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ASH1"
FT                   /locus_tag="PICST_66069"
FT                   /product="GATA-type transcription factor"
FT                   /note="asymetrically localized transcriptional regulator
FT                   that controls filamentous growth; go_component nucleus;
FT                   go_function transcription factor activity; go_process
FT                   regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_66069"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68092"
FT                   /db_xref="GOA:A3LZ39"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ39"
FT                   /protein_id="ABN68092.2"
FT                   /translation="MSLVQSPAMFNNHHHNASYQQGHLRSRSYNEMLTSFNASHSDLVK
FT                   QSTEGLAFYDQKRSRTAPPSPPYEINNKFGPGSALSVSSSSTDKLITSNVIRPNPNLRS
FT                   RSLSPSKKLPSISAALQSTKSSSIRLKPVITPPTVSLDYFDTYKPNDENWRYELLDTIN
FT                   KDSKYFHLNQYNYLNKYATSAKYQSQSQQHSINSISSKIANQRPSLPSVSSICHEKKIN
FT                   FPFESNYTYLNKTYMNDVEKYPEYLELAQSLIQLSQPPVTPPTSYSPNSSAAPPPTRLP
FT                   IVKPSQYSHQTYTEAPVPVVYHQSGTITPPASRLPSIQANNHSPELVTLHHAPVQVQPL
FT                   ATPAAQQSHKFIPITPPSSKSKSRTELLKSPPKHHYNHHSPRVCISCGSDQSPCWRPSW
FT                   SIKEGQLCNSCGLRYKKTSARCLNNNCKKIPAKGEWSLMQSKGKTMFDDGHDGYSCLEC
FT                   GWRVEIKT"
FT   gene            535407..>536514
FT                   /locus_tag="PICST_85034"
FT   mRNA            join(535407..536110,536132..>536514)
FT                   /locus_tag="PICST_85034"
FT                   /product="predicted protein"
FT   CDS_pept        join(535408..536110,536132..536514)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85034"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85034"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68093"
FT                   /db_xref="GOA:A3LZ40"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ40"
FT                   /protein_id="ABN68093.2"
FT                   /translation="MSDTNIDITIKSSGDTKYELSVSPSLTVYDLKELIADKADIPADR
FT                   QRLIYSGKVLKDTETIASYKVQTGHTIHMVRSAARATGAPSASNATGTSGNTTSASATP
FT                   SGSTNITGNSAAGTGVPSNIAAGQGSFNPLADLTGARYAGYAQLPSASMFGPDGGMNAM
FT                   PDPDQLASMMNDPMVQQQLNAMLSNPQMIDYMINQNPQLRAMGPQARQMLQSPMFRQMM
FT                   TNPEMMRMMMSMGPGAGQGASAFPAPGANPNVADTSTDSTASAADTPTTNATANNANAA
FT                   AAANPFTSLFPGGVPPVDPFALFGGGAPAPVDNRPPEERYESQLRQLNDMGFFDFDRNV
FT                   EALRRTGGSVQGAIEYLLSNN"
FT   gene            <536838..>538082
FT                   /locus_tag="PICST_63446"
FT   mRNA            join(<536838..537545,537699..>538082)
FT                   /locus_tag="PICST_63446"
FT                   /product="predicted protein"
FT   CDS_pept        join(536838..537545,537699..>538082)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63446"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63446"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68094"
FT                   /db_xref="GOA:A3LZ41"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR019473"
FT                   /db_xref="InterPro:IPR037818"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ41"
FT                   /protein_id="ABN68094.2"
FT                   /translation="MSITTTSTPVDFQLAKSIAIILEAKNIHCTEEFLFQLTDLTASYF
FT                   HDIANTLRECTHLQRRQKPTISDVQLFLRLHDIHTTALIDQVQATKKSMTPKIKQQVED
FT                   VQKQTIAIRKALDSENADVDDDSPSLPFFSNESYQIAELVPREVEQPQYIPSYFPDLPP
FT                   DYTYRNTPKYMKTVTDLKELRLKLVEESRLTEKSLYDLIEDEERVWRKNLEKEIQTMED
FT                   ADSSDNNSIMSDTPPVDTNVFDIVAYAEKRRQILITRDEKLIAKRKLHENNIYIKAERV
FT                   YSPYATEKRTAEVDTYFKGAIQDEFKSAIKAVRLAEASKKRKIEAILKGRANLQKKKEA
FT                   ENVQFDFQFNGMNQMSDEDSDEEN"
FT   gene            complement(<539917..>540240)
FT                   /locus_tag="PICST_63737"
FT   mRNA            complement(<539917..>540240)
FT                   /locus_tag="PICST_63737"
FT                   /product="predicted protein"
FT   CDS_pept        complement(539917..>540240)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63737"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63737"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68270"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ42"
FT                   /protein_id="ABN68270.1"
FT                   /translation="NIRPYDLNNRVESEVALKVAARMAENEIVVEGYSEILTFRSLITY
FT                   FYDAKDHVNIEMQLDGVGGGAVIAKADVHGERAIFLLFSFYHLIETEGVTNMTKPLGYE
FT                   VLA"
FT   gene            complement(<542909..>545650)
FT                   /locus_tag="PICST_63741"
FT   mRNA            complement(<542909..>545650)
FT                   /locus_tag="PICST_63741"
FT                   /product="predicted protein"
FT   CDS_pept        complement(542909..545650)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63741"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63741"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68271"
FT                   /db_xref="GOA:A3LZ43"
FT                   /db_xref="InterPro:IPR004648"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ43"
FT                   /protein_id="ABN68271.2"
FT                   /translation="MSKVEKKEKLDNIVSIGSVTSHLQLEDHEVNLRAITSNPVSINEI
FT                   GVSLSNEQKHFILKRLHLDGLQSLDELPPQVIFYLDKIEKLGNDEALSILKETLVEHHD
FT                   DTNIPTHDLELWTKLVDIGAENSGTRVKLDSALNEKNNESGESSSQEVFEGGKYESSIH
FT                   QVVDWDLQLRLEAVLIAYHSPYPEVRSVTDPFDDPTIPVETIRVYILGIVWTAIGAVID
FT                   QFFSERQPAIALYPAVVQVFLYPCGLLLEYVLPKYKFKIWKYTIDLNPGPWNYKEQMLA
FT                   SLFYSVTGGATSYVSYNIHVQKMKMFYDNQWVDFGYQTLLILSNNFLGFGFAGIFRRFA
FT                   VYPVEAIWPTVLPTLALNRALMVPEKKEIINGWKIAKYTFFFIAFAASFVYFWIPNYLF
FT                   GALSTFNWMTWIAPFNFNLVAITGTFFGLGLNPIPSFDWNVLSLNAPLIYPFYSQLNNY
FT                   IGNILGFLAVAGVYWTNSKWSGYLPINSPSLYTNTGEIYRVTSVVNENSLFDIEKYQEY
FT                   GPPFYTAGNLVAYGSYFVLYPFSVVYEIGTRYKQTWRAFKSLYLSFRNFKKSTYEGYND
FT                   PHSTMMSAYKEVPDWVFLVVLVISLVLAIICVEIYPAETPVWGLFFSLGINFVFLIPIT
FT                   AVYSRTGWGFGLNVLVELIVGYALPGNGLALNFIKAFGTNIDSQAQNYITNQKMAHYSK
FT                   VPPRALFRVQIIGVFIASFVQLGIINFLINNIEDYCDPHNKQKFTCPHSKTFYNASIIW
FT                   GIIGPKKVFNGLYPILQYCFLIGFLLAILALAFKKFAPLKYTKFFEPTLVIGGFINYGA
FT                   YNLSYYTGSFYLSVVFMYYIRNKYEAWWQKYNYLLSAALTAGVAFSSIIIFFAVQYHDK
FT                   SILWWGNSVMFGGIEGGYGQQSILNVTEAPGGYFGPRIGNFP"
FT   gene            complement(<548339..>548971)
FT                   /locus_tag="PICST_33409"
FT   mRNA            complement(<548339..>548971)
FT                   /locus_tag="PICST_33409"
FT                   /product="predicted protein"
FT   CDS_pept        complement(548339..548971)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33409"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33409"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68272"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ44"
FT                   /protein_id="ABN68272.2"
FT                   /translation="MSELQPINQPEGPLGIFSGESSSNQALNEPKPPDIDRNPHDHVAP
FT                   PDSMDLDGESSDAVETGELEPSFVTAGSVIADDSFDDTQEASNALNTLNEGPEMSTMDS
FT                   FETSVSKNSSHHVIEEEHDPVLAAKGDTVMISQNPTSISDWLKSTSTSDSVEITNVYIK
FT                   EKNPKSQKKSFQKMKKSKKNNLRSSSYRSDSERSEFLAPTSQKQFIN"
FT   gene            complement(<550039..>551076)
FT                   /locus_tag="PICST_33410"
FT   mRNA            complement(<550039..>551076)
FT                   /locus_tag="PICST_33410"
FT                   /product="predicted protein"
FT   CDS_pept        complement(550039..551076)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33410"
FT                   /product="peptidase M48, Ste24p"
FT                   /note="go_component membrane; go_function
FT                   metalloendopeptidase activity; go_process proteolysis and
FT                   peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33410"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68273"
FT                   /db_xref="GOA:A3LZ45"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR027057"
FT                   /db_xref="InterPro:IPR032456"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ45"
FT                   /protein_id="ABN68273.2"
FT                   /translation="MSRAVFLPKFMKGTITHSLFFYTTISLISELIDLPFSYYREFVVE
FT                   EKFGFNKQTLGLWLRDHILAFSLNTVIVNVVLSGLLKIFEIYGESFIIYTTGFLVVVSF
FT                   AVQSLSPFIGRLFYKFTALQDENLKHQIENLASKFNFPKTNIFVIDGSTRSSHSNAYFV
FT                   GLPWYKEIVIFDTLIEKQTTEGVVAVLGHELGHWKLNHIPKLMLIQLLDFTQIFGLFGV
FT                   FIYNKSLYSSFGFTDNQPAIVGLVLYWIIKEPISTATRFVTNIFSRKFEYQADEFAKSL
FT                   GYQDELSKSLLKLDINSSSVTNTDWLYSAYYNGHPLLSERLSALGYISKEKISRETKSK
FT                   PLKED"
FT   gene            <563841..>566576
FT                   /locus_tag="PICST_50085"
FT   mRNA            <563841..>566576
FT                   /locus_tag="PICST_50085"
FT                   /product="predicted protein"
FT   CDS_pept        563841..566576
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_50085"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_50085"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68095"
FT                   /db_xref="GOA:A3LZ46"
FT                   /db_xref="InterPro:IPR004648"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ46"
FT                   /protein_id="ABN68095.1"
FT                   /translation="MSTEEKNTTDKKEKLDNITSIRSVGSYLQLEDHEIDLKAVTSNPI
FT                   SLGEVGASLTDDQKLLILRRVHLDKLTSFEELPPQAAFYIQKVEHLTTTEALTILNQAV
FT                   IDLDADANFPTKDYNLLTSLVQSSESKQFNAKEKLASALDGSSSEQSLEKDYDTHSIVD
FT                   WDLQVRLEAVLIAYHSPYPQVRAVTDPYDDPTIPVETIRVYILGIIWTAIGAVINQFFS
FT                   DRLPSISLDPAVVQVFLYPCGILLEYILPKKKIKIWRYTIDLNPGPWNYKEQMLATVFY
FT                   SVSCPIGTSYVSSNITVQKMEMFYNNKWVDFGYQVLLILSNNFLGFGFAGIFRRFAVYP
FT                   PEAIWPSVLPTLALNRALMVPEKKEIINGWRISKYNFFFITFAASFVYFWIPTYLFAAL
FT                   STFNWMTWIKPYNFNLAAITGTNFGLGLNPIPTFDWNVINTNSPLVLPFFTQINNYIGV
FT                   LIGFIAIVGVYWSNYKWTGFLPINSNAVFTNTGEPYAVTEVVDGNSLLDNEKYQQYSPP
FT                   FYTAGNLVVYGAFFAIYPFSIVYEIGSRYKQTWKALKSVYSSVRDFKRGAYEGFDDPHS
FT                   KMMTAYKEVPDWPFFVVLVISLVLAIICVKIYPAETPVWGLFFALGINFVFLIPITAIY
FT                   SRTGIGFGLNVLVELIVGYAIPGNGLALNFIKAFGYNIDGQAQTYITDQKMAHYAKIPP
FT                   RALFRVQILGVFIASFVQLGILNFVLTNIDNYCDPHNKQKFTCAGSRTFYSASILWGVI
FT                   GPKKVFNGLYPILQYCFLIGFLIAIPAVVFKFYAPRKYTKSFEPSVVILGVMSFAPTNL
FT                   TYYTGGLYASIAFMYYVKTRYEAWWQKYNYLLSAALTAGVAFSAIIIFFAVQYHDKSIN
FT                   WWGNIVPYEGIDGGYGQQSRLNVTELAPDGYFGPRIGNFP"
FT   gene            complement(567470..568474)
FT                   /locus_tag="PICST_79556"
FT   mRNA            complement(567470..568474)
FT                   /locus_tag="PICST_79556"
FT                   /product="predicted protein"
FT   CDS_pept        complement(567679..568467)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_79556"
FT                   /product="40S ribosomal protein S4"
FT                   /note="go_component intracellular; ribosome; go_function
FT                   structural constituent of ribosome; RNA binding; go_process
FT                   protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_79556"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68274"
FT                   /db_xref="GOA:A3LZ47"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR018199"
FT                   /db_xref="InterPro:IPR032277"
FT                   /db_xref="InterPro:IPR038237"
FT                   /db_xref="InterPro:IPR041982"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ47"
FT                   /protein_id="ABN68274.1"
FT                   /translation="MGRGPKKHLKRLAAPSHWMLDKLSGTYAPRPSAGPHKLRESLPLV
FT                   VFLRNRLKYALNGREVKAILMQQHVKVDGKVRTDSTFPAGFMDVISLEATNEHFRLIYD
FT                   VKGRFAVHRITAEEASYKLGKVKKVQLGKRGVPYVVTHDGRTLRYPDPLIRANDTVKID
FT                   LATGKITDFIKFDTGRLVMVTGGRNLGRVGVIVHREKHEGGFDLVHIKDSLDNTFVTRL
FT                   ANVFVIGTEAGKPWVSLPKGKGIKLSISEERDRRRAQQGL"
FT   gene            complement(569107..571220)
FT                   /locus_tag="PICST_85359"
FT   mRNA            complement(join(569107..569331,569386..569789,
FT                   569826..570860,570879..571220))
FT                   /locus_tag="PICST_85359"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(569169..569331,569386..569789,
FT                   569826..570860,570879..571202))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85359"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85359"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68275"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ48"
FT                   /protein_id="ABN68275.2"
FT                   /translation="MSTSNDEFEDANSHNQAIPETVTENDKSDNSQNQTSDNNEESNNQ
FT                   DESLQQESDPSQSHKQEDDPSSQQKHEDDKPPEEVVEDTSPPLSGPPLPDRSAIKDALK
FT                   LGSNNKENVEGLDLMSSTYDKQSSNYLLESKFNQIDRSFSAKDSKYKESVNSGTDNIKK
FT                   TFNDIKNTVGGFSDMFEYKIDWDFWTQIVNDYGAVIHNDSNKLNDLISSGIPKEFRGII
FT                   WQLVSKSKNFQLEEFYISLKAEASIHEKSIKRDLSRTSFFTNVEAVNKGEELFNVIKAY
FT                   SLYDPDVGYTQGMIFIAVPLIMNMNDAECFCLLVTLMKEYRLRDLFCPEMKGLHLLLYE
FT                   FDRVLENYSPLLYNHLVKQGIKSSMYATQWFLTFFAYKFPLDIVLRIYDIIITQGIESI
FT                   LKFAVNLMIKNEANLLALKFDKLLEFLKDKLFNVYINDDFINFNGDSYALKSPTRNSLT
FT                   GAANSGTCYYKLEELVHDAMKINVDPIELGKYANEFEHIYEGEKSKTDDINKIRIENGE
FT                   LRHKIKQLETNYANLNRDHVGIVQKMVDLKVTLPEILNDNDDLNNEIEQLRTDIEELES
FT                   KIAETPPSSANDIENNIQELLATNAQETERFANLEDEFNTLVAEEAALDKELKTHANSK
FT                   WFGRWG"
FT   gene            complement(<576064..>578412)
FT                   /locus_tag="PICST_63766"
FT   mRNA            complement(<576064..>578412)
FT                   /locus_tag="PICST_63766"
FT                   /product="predicted protein"
FT   CDS_pept        complement(576064..578412)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63766"
FT                   /product="oligopeptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63766"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68276"
FT                   /db_xref="GOA:A3LZ49"
FT                   /db_xref="InterPro:IPR004648"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ49"
FT                   /protein_id="ABN68276.2"
FT                   /translation="MEKLRSAFKSSGASTTEVYSDEKKNDFETGSPVNLELVASKSQEF
FT                   DPISSNLVKDVIEDEYATVTVEDDSPYPEVRAAVPSTDDPSLPQNTIRAWVLGLIMTTI
FT                   GSGINLLFSLHAPNASITTFVTSIIAWPLGLAWAKTLPNWKIFGCELNPGPFNIKEHTI
FT                   ITIMANVSFNGGAAYATDILLAQNKFYFQDFGWGFDLLAIWSTQCIGFALGGIARRVVV
FT                   YPSSAIWPSNLVTCTFLTNMHINENHPANGWKISRLAFFGITFAISFIYYWFPGWIFQA
FT                   LSYFSWITWIKPNNVIINQIFGSFSGLGMFPNNIALDWNQINAYLGSPLIPPVGTIATI
FT                   FLSMVVIFWIIVPAVHYSNTWYAQYLPISSSSSYDRYGKRYNVSRIINPETLTFNKEAY
FT                   EAYSPLFLSTTFAMSYGLSFASITATLVHTALFHGKDIINQVKQKEKMDVHYRLMKSYK
FT                   EAPDWWFAVVFVVFFALSIVTVRVWNTEFPIWALVVALLIAIVFLLPVAIIYSVTNIAV
FT                   GLNVVTEFIIGYMLPGKPLAMMFFKTFGYITNAQAVTFAQDMKLGHYMKIAPRVLFASQ
FT                   LIASIWGSLVQIAVLRWSYGNIDHLCDPDQVNHYTCPNGTVFFNASIIWGVIGPQRQFS
FT                   SGQIYYGLLFFFIIGAVLPIMNWLVLKKWPNSMIRHLNWPVFFSGTGYIPPATAYNYTS
FT                   YCFVGLVFGWWIKKRWFHWWSKYNYSLSAGLDIGVAWGLLIIFLTLSLTNATAPNWWGN
FT                   NVIAGTLEQQGKAIRVVLPEGQGFGPSSW"
FT   gene            complement(<582618..585229)
FT                   /locus_tag="PICST_73580"
FT   mRNA            complement(<582618..585229)
FT                   /locus_tag="PICST_73580"
FT                   /product="predicted protein"
FT   CDS_pept        complement(582881..585229)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_73580"
FT                   /product="oligopeptide transporter OPT"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73580"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68277"
FT                   /db_xref="GOA:A3LZ50"
FT                   /db_xref="InterPro:IPR004648"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ50"
FT                   /protein_id="ABN68277.2"
FT                   /translation="MEKLRSAFKSSGATTTEVYSDEKKNDFETGSPVNLELVASKSQEF
FT                   DPISSNLVKDVIEDEYATITVEDDSPYPEVRAAVPSTDDPSLPQNTIRAWVLGLIMTTI
FT                   GCGINLLFSLHTPSAYITTYVTAIVAWPLGLAWAKFLPNWKIFGCELNPGPFNIKEHTI
FT                   ITIMGNVSFGGGAAYATDILLAQNKFYNQDFGWGFDLLAIWSTQCIGFALGGIARRVVV
FT                   YPSSAIWPSNLVTCTFLTNLHINENHTVNGWKISRLAFFGVILGGSFVYYWFPGWIFQA
FT                   LSYFSWITWIKPNNVIINQIFGSYTGLGMFPNNIALDWNQIAGYVGSPLIPPAGTIATI
FT                   FLSMVVIFWIIVPAVHYSNTWYAQYLPISSSSSYDRYAKRYNVSRIINPETLTFNKEAY
FT                   EAYSPLFLSTTFAMSYGLSFASITATLVHTVLFHGKDIINQVKQKEKMDVHYRLMKSYR
FT                   EAPDWWFAVVFVVFFALSIVTVRVWNTEFPIWALVVALLIAIVFLLPVAIIYSLTNIAV
FT                   GLNVVTEFIIGYMLPGKPLAMMFFKTFGYITNNQAVTFAQDMKLGHYMKIAPRVLFASQ
FT                   LIATIWGSLVQIAVLRWSYGNIDHLCDPEQVNNYNCPNGTVFFNASIIWGVIGPQRQFS
FT                   SGQIYYGLLFFFIIGAILPIINWLVLKKWPNSMIRHLNWPVFFSGTGYIPPATAYNYTS
FT                   YCCVGLVFGWWIKKRWFHWWSKYNYTLSAGLDIGLAWGMLIIFLTLYLTNATAPNWWGN
FT                   NVILGTLEQNNAAIRVVLPEGQGFGPSSW"
FT   gene            complement(<587071..588817)
FT                   /locus_tag="PICST_73698"
FT   mRNA            complement(<587071..588817)
FT                   /locus_tag="PICST_73698"
FT                   /product="predicted protein"
FT   CDS_pept        complement(587282..588817)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_73698"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73698"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68278"
FT                   /db_xref="GOA:A3LZ51"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ51"
FT                   /protein_id="ABN68278.2"
FT                   /translation="MKLYFEAEKFLKPNERAGSLQSRIFNDSKLSNSPKHIFALVHSTL
FT                   KYKEYIEMIIKKSKIKQGLQMKKLKISDELLLLLVHDLVFSAKGRIQSGKHPIKDAFLQ
FT                   HQTRLQAEFTKMKLKYRVKSASEFPTKEADEDETPIRWFRINTIKVASPEKVFETNELL
FT                   KNLQPVNSIDDIKDTGFIYHDEYIPNLYGIHPREKLTSTQAYIKGEVIIQDRASCFPGY
FT                   ILNQDSGDIHTEVIDACAAPGNKTTHSASFLPEDRSSVVYAFERDSKRVKILKTMCEKA
FT                   TGKSKKELIQITHADFTTTRPDDFPNVTGFVVDPSCSGSGIFGRALEDSQKEEEKQQEI
FT                   DTTRLNKLAGFQFKIVKHALLFPSARKLVYSTCSIHPHENERVVVDLLTDPEIKSRGWH
FT                   LEDRSKVIPNWERRGWKEEFTSIAGGDNEMCEKLAGGCVRSIPKEDGGIGFFAACFVRD
FT                   NEKTQLEDNGGSEVRNGCCKPITDASDKAQETSEEVAETSNTDTQAEWTGFND"
FT   gene            complement(<589050..>590234)
FT                   /locus_tag="PICST_33418"
FT   mRNA            complement(<589050..>590234)
FT                   /locus_tag="PICST_33418"
FT                   /product="predicted protein"
FT   CDS_pept        complement(589050..590234)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33418"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33418"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68279"
FT                   /db_xref="GOA:A3LZ52"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ52"
FT                   /protein_id="ABN68279.2"
FT                   /translation="MTIIRRLLSTSNWKPPESYFSHSPLNYESYSRRLKGAIHYIAQNG
FT                   RFTESILIDCIRANRQLQQQNWNSSPIIQKTRSRNDFLNLKLSPSNSTLEDELFSFVFN
FT                   RHQERSSSPEIVRSYLITEPLPSNTARVIDVGVKGFEYSFLKQKVEPSLVFTALRLLLD
FT                   RKDYQNSFKLIDSTFNCDAYKELQRHQIGRNLFGWFSYIAVATVVQAILFPLVSILALF
FT                   SVNTATAGILMYGLLRLDTAENLGRISWRPYVSMLYKFTHRDELLAINTVITHFEEHNE
FT                   VNIKNYHHSRVRKLSNLKLFDQDEYVLELPNDSVELASVEYSGQTFQEEKGIVELQQYF
FT                   KHELNSRKMVFNDLPEELIFLEFWFTHGENFEWVEPDQDPAEIIKLDIQNQKTD"
FT   gene            <591080..>592927
FT                   /locus_tag="PICST_33419"
FT   mRNA            <591080..>592927
FT                   /locus_tag="PICST_33419"
FT                   /product="predicted protein"
FT   CDS_pept        591080..592927
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33419"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33419"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68096"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ53"
FT                   /protein_id="ABN68096.2"
FT                   /translation="MDPPNKLDPLGFLDPSPQSSIDSIEFRKHLASMAEDHQSKKAAAS
FT                   EFSYSASENLNTPQSSKIRTQETENPSFDSSKNDSQLLHLRNQSGASGYEQSKHRLTTD
FT                   SYGLQTPVLQGEDFLANLHSPASDFSKFKAPRTRESYLSQYSGKVDRVDDMGAQATVKL
FT                   VRHDSTKKEEKSKDVSTNSVSPSQSSLQSGKEPSIKLGKLPTVTKSYSPEEDSKSPDIS
FT                   YTTNIEGSVPPRSNRRPLSSAVSSSIDNDHSNEDLENSIVENVEKTPDTKFKQRRSRAF
FT                   SGTLNHDLDQLMLSANSLKSEESHDIPEEQKPTISDTSANLARETEAGPSAKEDFQGFG
FT                   GNLPGSNITLEPIERPQLQEIPHDEREISNTKSIKSHNSVRSGHSEPDLHPKDSTDTFQ
FT                   TAESPGELHSEKLRSKTPTSSLPPRPSLDNIIRAREASASYQIRESPESEEDENATAKL
FT                   EEIDNSKEVTQPEQELDVAGEPIVTPHINQGNDDSYIDIEEPRLVHKPSRGKSVKDSTR
FT                   RHTHKKSKTVKTKQAKGTSANLKPFSYNTLINLLESMNGTIIGEEFSQLNLPMKEKQLI
FT                   EKIVDSLSRLTSDMVLDQSRYEIGIQRLEKALRVLEGFM"
FT   gene            complement(<593060..>596425)
FT                   /gene="RGR1"
FT                   /locus_tag="PICST_63118"
FT   mRNA            complement(join(<593060..593210,593280..594012,
FT                   594034..594301,594368..594568,594596..>596425))
FT                   /gene="RGR1"
FT                   /locus_tag="PICST_63118"
FT                   /product="Regulator of Glucose Repression (transcriptional
FT                   regulation Mediator complex subunit RGR1; Glucose
FT                   repression regulatory protein)"
FT   CDS_pept        complement(join(593060..593210,593280..594012,
FT                   594034..594301,594368..594568,594596..>596425))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RGR1"
FT                   /locus_tag="PICST_63118"
FT                   /product="Regulator of Glucose Repression (transcriptional
FT                   regulation Mediator complex subunit RGR1; Glucose
FT                   repression regulatory protein)"
FT                   /note="transcriptional regulation; affects chromatin
FT                   structure, transcriptional regulation of diverse genes and
FT                   sporulation, required for glucose repression, HO
FT                   repression, RME1 repression and sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63118"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68280"
FT                   /db_xref="GOA:A3LZ54"
FT                   /db_xref="InterPro:IPR013947"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LZ54"
FT                   /protein_id="ABN68280.2"
FT                   /translation="PELPHITNNVIPLSNVLKFYTQEAFKQITTLVENLASTKDSEDDS
FT                   VRKKKFLELIIALRQDFIKIYTLVKWAANSKDVSRFIDLLNWLRMQEFYFDQLTFQLNA
FT                   LNGYSGAKLPNSDLITSLEVLFKGRPQLPSYNYIKIPKISPEKTLEVMQDLNLILMTRI
FT                   ALIDIPKRFINNYVIKDGRIYFSVPNEFQVSITVANDMIIESHDEYTKSPFYFIDFKFL
FT                   FGINPDTSLITHRDNKIVTKLPRSSHENLEKIVNATLLNQGLHGLYDLLHKFSISFKLY
FT                   LIAKQLKELQINTRWRNNLQVNYQNGKSLIILNYWSGQYLSKGWKSFIELGIDRNYNLN
FT                   FRWFKNGKYNVNTELSALFNKHLKNTNEGEEEKDDSTDDIEEPEDLNVDLILNIVVNKH
FT                   SELLMSKVFNSLDAKLNTTDNPDQISYITPHQLLIKSSPTKSTIFCINPLTGLFYFIDP
FT                   CPVQNLIAKKINSPPTVVKNKNFVAESDMVNTIVDGLTQLRLEIFNKEIHNRLLTTEWI
FT                   NNDIIGLNDYEISRLSNFFANSLDYNLNVNKIQFYRRKNWPSSWFLINLVSGVTSVTFW
FT                   WVARIKSVSGEWKIQWIQKLHLNEKTPSVEITDDPTNLNFEFFNNLSTACSNMIIDHML
FT                   LEELFKRNIKFLKVDNTALILQKFNIDKIPDDEDTQDTDDKNKPLIYESIIMIYNDNNL
FT                   LPVYNSATSLFLKIKLINLNNLTQMKLKLFGKLRNLSIRNSPENFLQLNLKIDEIKNFF
FT                   EIDDLINLSSRTNGSDSASSATTNHLLDKIFNNLNKLNKLIKILDQLNKNKIQIINNSV
FT                   NDIIIKIDDNLDNLIIKLPEKATDSIKLISEEEVKDGGNPEVKLILDYLNKYLSNYYSD
FT                   DFFANDEDKFYDGNKKTSIVGIIKYLKEINPILKSVQTIKAKLRKPESAFKLSNGLSKL
FT                   NFDIKFTTLNLIQYVFHMNYQTPSSSKKIFKDKIVISLSFKNNKFDKVSKNLIKISLKD
FT                   NLNSKNLKYKKLFELIFKSINDGSMDAHAHQLIKLNYDFLVNSSLVGELMVRIANCFVL
FT                   YLQAESNGRYNQ"
FT   gene            complement(<597481..>598722)
FT                   /locus_tag="PICST_2520"
FT   mRNA            complement(<597481..>598722)
FT                   /locus_tag="PICST_2520"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<597481..>598722)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_2520"
FT                   /product="serine/threonine kinase"
FT                   /note="go_function protein kinase activity; ATP binding;
FT                   go_process protein amino acid phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_2520"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68281"
FT                   /db_xref="GOA:A3LZ55"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ55"
FT                   /protein_id="ABN68281.2"
FT                   /translation="KRFVSNPFIHPTSPRGTPTPPPFTPPRFLKSVSATSPEEELAVGS
FT                   VVPKSKYYQKSFYSQRLNKSFVYISEIGSGNFSTVLLAGSDDTLVAIKAITVPLESRSQ
FT                   MANFKSFIRRELSILSQIAPFPCVTTLLDYSITLEIPTIDNYDSDGEEESVSEAEHANV
FT                   VHSNDQLIFLQYCPGGTLLQYLTSHKQSDHSHDLSYWLVVKRIVCELLVTVGYLHENNI
FT                   VHRDIKLENILLNYTASELVQLITSNVPTELPAFTNLSDFGLSKKLRSQDQYLSTRCGS
FT                   QDYIAPEVLLGIKYNGFLTDSWSVGVLIYSIMENRLPFDLPPIDSVSINGISPSVLRRK
FT                   RSRNSSAHRIAMIDWDWFKVNEYLADETIQPEIKDIFRSLQSLVNLLLVRKDKRVAIRD
FT                   ILSQDQFRWVEDFVP"
FT   gene            complement(<598808..599070)
FT                   /locus_tag="PICST_79392"
FT   mRNA            complement(<598808..599070)
FT                   /locus_tag="PICST_79392"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<598810..>599070)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_79392"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_79392"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68282"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ56"
FT                   /protein_id="ABN68282.2"
FT                   /translation="IAQLPTPILNNGSFINYSTLSANSSLLNNSPIQETTALELPKQRS
FT                   PKTRLNYNNTQNLNQTVNQINNQIGNSANYQHNDHQDQVSVV"
FT   gene            <601822..608526
FT                   /locus_tag="PICST_68327"
FT   mRNA            <601822..608526
FT                   /locus_tag="PICST_68327"
FT                   /product="hypothetical protein"
FT   CDS_pept        601822..608460
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_68327"
FT                   /product="putative vesicle coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68327"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68097"
FT                   /db_xref="GOA:A3LZ57"
FT                   /db_xref="InterPro:IPR024298"
FT                   /db_xref="InterPro:IPR024340"
FT                   /db_xref="InterPro:IPR024880"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LZ57"
FT                   /protein_id="ABN68097.2"
FT                   /translation="MSIRKSTTSPVSGTDRADLNDSFAVSEAEPSQLHGHVEYGADVSV
FT                   GVEDASGFTAEDAFQVGGEEDEEQVSTVTNGAVVPQSVVAAESADEDVLSRSTKKEEFL
FT                   PESTSIAEPVKSDVITNVIDANADTGLDDDPWMKDGTPEFPPADENLPEVPPVAETKVE
FT                   TSKSIAKQQIYGEKVEDFTENSASPQEVDSKQTSSTIADFIPTPEHIHSNLHTSETENE
FT                   PIKQSQLPWESHVEQIEALPWEEQPQKVEHVLPWEEKPDEVSQKDEALPWEERRVEHPE
FT                   QAAESTLPWEEQPNVEEFQAHEPALPWEERPEVEESSLPWEEKVGESQGQEAALPWEEQ
FT                   QEVEVSSLLLEEKVRESSLPWEGEEGESQAQESKLPWEEQRIQSTPPSEEQVLEPVEGS
FT                   SLPVEEKDSTEGSLPWNQHHEGEAQEILPWEQSTKPQDTQPQVSQEELHDYSVSNVISQ
FT                   SEIVEEQAQPVSQAYESQFLAGFFTERRPEQESETKQESLDELFEKDEDFLPELKQPVE
FT                   QSTQTSKPKEFNLPELDLDDDLLLDDDLLDDDEPELVPEPVAPVEPIQEAIQNNVAKSP
FT                   RQTYIPTQPHHNMYAPQISRTDTGEYVKKLEENKKRNDAYDFPDILMPPKVKPAPRHHQ
FT                   PTTKYSQPVASPNLSNIPSAPPATTIPPPVSIGIEASKKELPTTPQVAPGKPKSFFEEL
FT                   PVSMPKKAARAAPVKAVNQPHIQKSPQISNTPISASSKPAPVNPYMPSNTQKQNPHSPL
FT                   QGSQYSFPRKTSSGLAPPPALNQYAPPSSNQYATVSAQVQPGLPQSSLPQSGMSQPGLQ
FT                   PFPQPQGHLVPPNLVAPQIQNSPLGQPQQTHNYAPPINTNVARAQGNLSATSPYVPNAG
FT                   PYAPNNHNRSHSRASSLVGGGKGKEINPYAPALPPVSHSGTSPSIAQSSLTSRNRGISN
FT                   PRNIYSKAQPAPKISNPNSLNQRQFPIFNWSNSQKVVTLIPNSSHNLYESHGESIRVRA
FT                   AIDLLKDKEMYSTFPGPLSKSKTKRKDVEKWLESNIALLTTNSIENQDEYLLNQVLLEA
FT                   VKFEGGFNSHEFIKAVCMVLNPTADYNTPGDISGMTSVSANAYKLDNAGIGIVFGLIQG
FT                   GHIDKALEFTLSKGDWALALVVSNFAGHDRFAKVAADYARFSFPYQKSNNKIHHIIPIL
FT                   LKLAVGNVKSVIDDLNAVATEGEYASHHWREIVSSVIISGVSKSQDFLVEFGKFLGLHH
FT                   NIAASEICYVIAGLPLSPQALQPSGIVVSVIGSLTGTSMYTEVYEYILKISTVFVQQGV
FT                   GIIPHLLPLKLKHATVLADYGLFNESQKYIDSINNNMKTLGNRSPYLNAAFIHELQSLI
FT                   VRLQELGSSESSWFSGKMSKVNLDNIWGQIDKFIGGEEPKSKSGENGVFSKFSPSVSRN
FT                   TSTLDFTAMNVSSNKYPHSSPQMPSGQFGSSSIAPSTADGVSVPVTRAMPPLQSFNSTP
FT                   AINTLSMNSKYSLPHLQQTKNASFSVHSQSTQVPPSHHSTPQQSHVHPNVPLHHAAESK
FT                   YSPSNASPQVPDSTASPYVPPVKRTTPRVAAKAVNATGPYVYANPEGHVSNSSIGSHRQ
FT                   HGYHPPTSQTPTVNAKRHSVASVISNEATPNSEVIHSHHNHSPSIQSDISMDYPSEFKP
FT                   PPAVKQIVDHKLVSALNDHAPDTIDESPEFKSEAIVEKVPPLSASQEVSGQPSAASTSV
FT                   PSSEKAATVDDETTSSAASAPPPQSKASLKKPAKVNPYAPGANRSGTARKSKYGPPTGA
FT                   SSSKYSVPANLAQQDEPINDDTLKYGSMFDYSGYKTGEPTVADNDNVEPPTQSETTSKH
FT                   AAEEDVTELIVEPKPSIPESPSAPKIVREPETSAPPHFKQPESHFAPFGYNTPLKARTK
FT                   HYANIDDSFDNSEVSGDQDLTDIHTPRKRPLILNNGPPQLTGKESMFNPYQGDSGVNKF
FT                   GLDFPIPGSPDYTTRANSVVDQPGYFSSRLSQSQQSALYQQYEVEDDTVRDYVPTVEED
FT                   DEEDEDEEDRDKKRLQEEEEKRAKAASEEAKKKASEAAAKRDPGRGWFNWSGKNDGKPK
FT                   PIKAKLGNPSTFYYDEKHKRWLDKSRPIEEQLQAAAPPPPPAMKKKAPAASSNITASSG
FT                   PPSAGPPPGINPSGVAPTAAPSGPPSAPSGVTSGPPSIGTGPSNGAGGPPFAKATSVQS
FT                   SAPSLANAGLDDLLSMGGSSVAGGTRKAKRNTRRGHINVFDKK"
FT   gene            complement(610178..612084)
FT                   /locus_tag="PICST_68328"
FT   mRNA            complement(610178..612084)
FT                   /locus_tag="PICST_68328"
FT                   /product="predicted protein"
FT   CDS_pept        complement(610266..611747)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_68328"
FT                   /product="fungal transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68328"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68283"
FT                   /db_xref="GOA:A3LZ58"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ58"
FT                   /protein_id="ABN68283.2"
FT                   /translation="MSSHDLLSYSIMNHGSKLDYRPASSAYPRDRSPMSLPPLYPIIKQ
FT                   LAPAHSSIGSSPEHHQHVLLPPLSSNYTTSYSSATSPSSTISTGSNTPNYSHTAKLTEN
FT                   NLRHLGNSLETTAHSGLGLLTSAIANISSQERLEKTRTNSVDSQSFNRRLSGNTVSTPN
FT                   AHSVNSNTISHNATHHIQLPSLLHSSSSTLSSVASSVSSVSPMSSPSIPAASASGTSAV
FT                   KDSAVTTGNSNNKRRQRLGPSCDSCRLRKVKCNAEITILSKSVSDEPNVCSLLLAFNLS
FT                   AEQVESVLRQGELVKVANDFNLIVSNNKLIKFKSCNSCNMKSLTCCFTKGFTKEDIMVN
FT                   SSKKSDGSSAKKEKEKPAKIAKKKLAPTSTTSVNAVKSISSLTKALSKTLETQQEQVYS
FT                   IHEDHQQSHQNIASKQVLIKSNSPVTSGAVLSTSVSVPGSLSTSSNSSNTRKSSCTCCR
FT                   KRKVKCVFIEAQNKCESCIKKNADCLFDNRASYWV"
FT   gene            complement(617767..618767)
FT                   /locus_tag="PICST_85423"
FT   mRNA            complement(617767..618767)
FT                   /locus_tag="PICST_85423"
FT                   /product="hypothetical uncharacterized conserved protein"
FT                   /note="Has EST support"
FT   CDS_pept        complement(617838..618746)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85423"
FT                   /product="hypothetical uncharacterized conserved protein"
FT                   /note="go_function aldose 1-epimerase activity; go_process
FT                   galactose metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85423"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68284"
FT                   /db_xref="GOA:A3LZ59"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR025532"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ59"
FT                   /protein_id="ABN68284.2"
FT                   /translation="MPVEDNDSQVVLTHPEDNSTTVTILKYGANVLSWKNKGKEQLWLS
FT                   EGAKVDGSKPVRGGIPLVFPVFGKQKDANHPTFPLPQHGFARSSEWEFLGQTSANPPTV
FT                   QFALSPEQVSSEALKLWGNGDYDFTLILTVSLELDKLTTEIEVENAGEKEFEFNWLFHT
FT                   YFRVPDITDTLVNNLIDQKCFDQLLAEEYVEKSPIISFHEEFDRIYKKVDYGKTFQIIE
FT                   FGKVLINVVRKNLPDAVVWNPWIKKSDGMADFLPKNGYLNMLCVEPGNVSDFVKLQKGE
FT                   KWTGAQILTVGGEIKVQSNIY"
FT   gene            620405..622649
FT                   /locus_tag="PICST_91106"
FT   mRNA            620405..622649
FT                   /locus_tag="PICST_91106"
FT                   /product="predicted protein"
FT   CDS_pept        620886..622355
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_91106"
FT                   /product="Aureobasidin A resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_91106"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68098"
FT                   /db_xref="GOA:A3LZ60"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ60"
FT                   /protein_id="ABN68098.1"
FT                   /translation="MSTILRSRAIQKPYQLFHYFFLSEKQPNNTLSDLSFDTDISISIR
FT                   KFKNHNWTVKEVLHYGFLASVIFFVFIIFPASFLVKIPILAAFTFCFLLPLTSQFFVHA
FT                   LPIFSWLALYFSAGKIPTAWKPAISVKVLPAMETILYGDNLSNVLATVTTSFLDIVAWL
FT                   PYGILHFSAPFVVAIFIFLFGPPTSLRSFGFAFGYMNLVGVMTQILFPAAAPWYKNLYG
FT                   LEPANYSMHGSPGGLGRIDELLGFDMYTTAFSNSPVIFGAFPSLHSGCAVMDVLFLCWL
FT                   FPKYRVLWWGYATYLWWSTMYLTHHYFIDLIGGAALSFVVFQYTRYNHLPVVEANKFCR
FT                   WSYTEIEKIDIPTIDPLSSHFVSINDMESSIGNSRYNYPYFLEQHNNNGTLVEDFEMST
FT                   VSRSRQASRNLLPTTFAATEPAGVSLHQHLVEEEEEDISSMENSATPSVFEDEHHQMMS
FT                   STASQTSLEELESTASIHLDTPSSKSYNKSK"
FT   gene            <625510..>627141
FT                   /locus_tag="PICST_62927"
FT   mRNA            <625510..>627141
FT                   /locus_tag="PICST_62927"
FT                   /product="predicted protein"
FT   CDS_pept        625510..>627141
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62927"
FT                   /product="G-protein coupled receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62927"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68099"
FT                   /db_xref="GOA:A3LZ61"
FT                   /db_xref="InterPro:IPR022596"
FT                   /db_xref="InterPro:IPR023041"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ61"
FT                   /protein_id="ABN68099.2"
FT                   /translation="MESLQSLSITATSFLPESTFLAFTEDAVKPSSSNFFVSATKMVID
FT                   LVIRASGHNQIDEFTDRQALVQRILATSSSCASISLCLAAFYSFLAIDPRRLIFRHQLI
FT                   FFLLSFDMLKAVILLLYPTRVLTHSSSYYNDQFCQVVGFFTATAIEGADIAILAFAVHT
FT                   YLLIFKPSLSTKVKNSTRTEGGLYKFRFYVYVMSFLIPLVLASLAFVNGTGYISLVCWC
FT                   YLPQRPVWYRFVLSWVPRYCIVVIIFVFYALIYYHVIREFKTLGGVFTTMHKSQGNVHP
FT                   KLADDEKPGLYSALKYFLSLIKDTAMPKFVFPTEELTPSNTRQMHEDPRHKNENDDDEE
FT                   DVSDLSSTPPVHVDTENIVYDPELHAANLESFRKRQKIIQKQMKSIFVYPFAYCFLWLF
FT                   PFILHITQVNYEERHGPIYWINCMGAFFQPFNGFVDALVFFYREQPWNYTIMKNYEKEH
FT                   TTRMNSMMLHPMHHASQASPHHFQSIGSESITTSARLTKNSDSITAGLIDLSQYPFYRR
FT                   WLNDLHFPLFALPTEENIIKLQNKFIQ"
FT   gene            <628798..>630627
FT                   /gene="AZR1"
FT                   /locus_tag="PICST_33428"
FT   mRNA            <628798..>630627
FT                   /gene="AZR1"
FT                   /locus_tag="PICST_33428"
FT                   /product="MDR transporter"
FT   CDS_pept        628798..630627
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="AZR1"
FT                   /locus_tag="PICST_33428"
FT                   /product="MDR transporter"
FT                   /note="MDR transporter adjacent to AZR2"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33428"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68100"
FT                   /db_xref="GOA:A3LZ62"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ62"
FT                   /protein_id="ABN68100.2"
FT                   /translation="MSLASDDKESILPTSKDYGSTPLSQDNSEDSVAVNEKGDIDTSNK
FT                   KKYYESNAGDGSRAEDQHLTGLTLAVTLVSCVSCLFLVALDQTIVSTILTQVGDKFKEF
FT                   EKIGWLTSGYLLPMATLAPSYGKVGIAFGRKYTLLVAVIVFEIGSLISGLSNSMSMLIG
FT                   GRVIQGIGGGCVQAMVVVILTESVPISRRPLSYMLLGVTFSLSSVLGPFIGGAFATHVS
FT                   WRWCFYINIPIGGMAAALLIFGFHPPKPEGNIRQKLAKIDYSGTFLLTVGLVLVLLGLT
FT                   FGGIDFPWKSAAVICSFVIGGLFLIAFCVWNFKFSKNPIIIPQIVRIPPLMAACISGSF
FT                   NFGFFLANFTYLAVYFQVIFGATAWKSGVDLLPMIIAVTMTSILNGVFIKFTRYVKITM
FT                   LISGVLGPVGTGLLLLLRKDSPLADRIGLLILCGISIGLQFQSSMLATQLCAPPDITGS
FT                   LILSTIFLNFLKSTAAAISVSLAQLIFQASGTSYIKSLVNSLPRDSAEYQALYGIPPKD
FT                   LISTPRIINTLPESARQMVLDQFMRALHNVFYLGLAFSIVALIGAVFTTNKKIPKASDI
FT                   AKNSDVEKGNKDAATTEESEIISQIESTAKDQE"
FT   gene            <631297..>633180
FT                   /gene="AZR2"
FT                   /locus_tag="PICST_33429"
FT   mRNA            <631297..>633180
FT                   /gene="AZR2"
FT                   /locus_tag="PICST_33429"
FT                   /product="MDR transporter"
FT   CDS_pept        631297..633180
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="AZR2"
FT                   /locus_tag="PICST_33429"
FT                   /product="MDR transporter"
FT                   /note="MDR transporter adjacent to AZR1"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33429"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68101"
FT                   /db_xref="GOA:A3LZ63"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ63"
FT                   /protein_id="ABN68101.2"
FT                   /translation="MSERQSIPVLASTIESSRRSPTDLHSQELSPQDLNSCSPKTTRKS
FT                   GKYYESNAGDGTKNSEQYIKGIKLAVTLVSCVACLFLVALDQTIIATILTQVGDKFQEF
FT                   EKVGWLTTGFFLPIACLSPSYGKIGIAFGRKYTLLVGVIVFEIGSLISALANSMGMLIS
FT                   GRVVSGLGGGCVQAMVVLILTESVPINLRPLSYTLLGVTFSVASVLGPFVGGALATHVS
FT                   WRWCFYINLPIGAMASLLLMLGFHPPKPHGSIRQKMARIDYLGTFLLTTGLVLVLLALT
FT                   FGGISNPWNSALVISFFVVGGVLCIVFNIWNFGFSTHPMIIKEVIMVPQAAAACINACF
FT                   NFGFFIPLMTYLAVYFQVIFGHSAWKSGVDLIPMIISVTFSSISNGVFIRFSRNVKLTM
FT                   VISGVLGPVGTGLLLLLNKHSSAKDRIGLLIVSGVSIGLSFQSSMLAAQLKAPPDIEGS
FT                   LISVTIFVNFVKNLGAAVSVTIAQLIFQTTGQRYLNDLIRSLPPDSSEYRELIRYPPKQ
FT                   VISSPEIIKSFSESTRQLVLDQFMKCIKNVFYLAFALSVIAMIASFFTTNKRIPKHSDI
FT                   ERDDDGDDEEANEIQNEDTESDQLNENNKISPDSSNGESSSGSETKQEFTA"
FT   gene            complement(<633424..>635007)
FT                   /gene="NUF2"
FT                   /locus_tag="PICST_49790"
FT   mRNA            complement(join(<633424..634563,634696..>635007))
FT                   /gene="NUF2"
FT                   /locus_tag="PICST_49790"
FT                   /product="Myosin-like protein NUF2 (Nuclear
FT                   filament-containing protein 2) (Nuclear division protein
FT                   NUF2)"
FT   CDS_pept        complement(join(633424..634563,634696..635007))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="NUF2"
FT                   /locus_tag="PICST_49790"
FT                   /product="Myosin-like protein NUF2 (Nuclear
FT                   filament-containing protein 2) (Nuclear division protein
FT                   NUF2)"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49790"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68285"
FT                   /db_xref="GOA:A3LZ64"
FT                   /db_xref="InterPro:IPR005549"
FT                   /db_xref="InterPro:IPR038275"
FT                   /db_xref="InterPro:IPR041112"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ64"
FT                   /protein_id="ABN68285.2"
FT                   /translation="MSRLSTIYRTGTQSNRRLHQLTQQDVFPLLDVKEITICLQSCDFI
FT                   ATEELVSKPTSQFIRSLFEQFLDTFMGLPIEALSNKVRGLNQQNDLKNGTTNGSNGNAD
FT                   NDNEEDEDDTVEALNLIGLHRAAYKFFQGCGIYDLTIMDIVRPDPFKTRRILSAVVNYA
FT                   RFREEHSAECEQLVMESEASLEKIRQLQSDNDRVVSQIQGIKRRIEDDPSSSEKKATLK
FT                   QVNSYNLKVESELKKLKKAQEIVTLEHMQYKEEKARLIEKLDDVQYLVFESSKEVDRLK
FT                   AYSETDLTILQKIISDLKSQLSELQNAYNELDQRDKNLSVTIDSIQTVENELKNLFRIL
FT                   EEISNDISKEREASAKLSDGQEFLDQLNLRTNDLVRSIQQVQRQLNNMQEKTDKLRAQA
FT                   DERISKSQQMLTKYRQDYTKLVEERNLKEEEYNKKKELISEIETSISKKQLDYQMEVRN
FT                   TELKAARLNAHIKLYLDEVGKKILN"
FT   gene            <635382..>636530
FT                   /gene="HMC4"
FT                   /locus_tag="PICST_33431"
FT   mRNA            <635382..>636530
FT                   /gene="HMC4"
FT                   /locus_tag="PICST_33431"
FT                   /product="hypothetical multicopy protein"
FT                   /note="occurs in multiple copies through genome"
FT   CDS_pept        635382..636530
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="HMC4"
FT                   /locus_tag="PICST_33431"
FT                   /product="hypothetical multicopy protein"
FT                   /note="occurs in multiple copies through genome"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33431"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68102"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ65"
FT                   /protein_id="ABN68102.2"
FT                   /translation="MSNLSTNVLSAGRSAPPESHGSKTLTVDNIAELIKIQLEDYEAKF
FT                   LKLYAQQQSQVNELISIILTKKSDSEKDTGDSAITSTDSDINLITSIESSSVLAGKDIT
FT                   ENTSVPPKIETFPSLRTSQTTALDGFDFFERTQRVIRKSQKHIHEYWKKLPPLNETSAE
FT                   LWSRAIQDLNNEMDYRALSKANFKVDWNTFQSKTGLRGDKLEYFYECWKDALIGRYRNN
FT                   TLRILAVNRDHIITLEDLLEYTSQNADYDKTNSILEEVQRRRRINPMCQDYISEFRGTN
FT                   IHDYDRIIQFLNGHPADLYCAISHFCNQKHEGNRTIAAATVNFYYQDFMTKDNFQYPSV
FT                   NAFEKKMKSTLGYSCKFYSDSSKLRTNSKHRRGKSNSNHYSQ"
FT   gene            complement(636753..637595)
FT                   /gene="CAT5"
FT                   /locus_tag="PICST_73817"
FT   mRNA            complement(636753..637595)
FT                   /gene="CAT5"
FT                   /locus_tag="PICST_73817"
FT                   /product="DMQ mono-oxygenase/Ubiquinone biosynthesis
FT                   protein COQ7/CLK-1/CAT5"
FT                   /note="Has EST support"
FT   CDS_pept        complement(636823..637578)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="CAT5"
FT                   /locus_tag="PICST_73817"
FT                   /product="DMQ mono-oxygenase/Ubiquinone biosynthesis
FT                   protein COQ7/CLK-1/CAT5"
FT                   /note="go_process ubiquinone biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73817"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68286"
FT                   /db_xref="GOA:A3LZ66"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ66"
FT                   /protein_id="ABN68286.1"
FT                   /translation="MLTRIVYKETPVCRRYFSTISRRFQEALSSEDKEAAKKYYGDDVN
FT                   YGELSKAQKAFLDRVIRVDQAGELGANYIYMGQYMVLASKYPHLRPVLKHMWEQEIHHH
FT                   DTFNKLQTERRVRPSLLTPLWKIGAIGMGAGTALISKEAAMACTVAVETVIGGHYNEQL
FT                   RVLMNQYNVPVYDKSTGEQLSGDEINTDIEISPEISSLKDTISEFRDEELEHLDTAIQH
FT                   DAKKAVPYMLLTEGIKMVCRGAIWTAERV"
FT   gene            complement(<637969..>638904)
FT                   /locus_tag="PICST_49700"
FT   mRNA            complement(join(<637969..638568,638767..>638904))
FT                   /locus_tag="PICST_49700"
FT                   /product="uncharacterized conserved hypothetical protein"
FT                   /note="similar to YTHD2"
FT   CDS_pept        complement(join(637969..638568,638767..638904))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49700"
FT                   /product="uncharacterized conserved hypothetical protein"
FT                   /note="similar to YTHD2"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49700"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68287"
FT                   /db_xref="GOA:A3LZ67"
FT                   /db_xref="InterPro:IPR007275"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ67"
FT                   /protein_id="ABN68287.2"
FT                   /translation="MSSSRGKLCTPRALLAVESLDSDNGIDYLPSTLKESIWSTSFRSN
FT                   RSFNSLNSAPITPESPTASNYKRIHTGSIGSPHLCLTFRTYKGTVFTVPPNSKFFVIKS
FT                   YNILDVTSSFTHNIWTSTDLGNKRLNKAYEELSFTGNKDNCGKVFLFFSVNSSGKFCGV
FT                   CEMKAGIDFNKTSDIWMEQTRWKGEFPVEWLLIKDVPNRFFQHLKIPSNEYKPVTNSRD
FT                   TQEIPYDIGVSMLKIISSFKYNG"
FT   gene            <639399..>640118
FT                   /gene="RBM25"
FT                   /locus_tag="PICST_63288"
FT   mRNA            join(<639399..639800,639837..>640118)
FT                   /gene="RBM25"
FT                   /locus_tag="PICST_63288"
FT                   /product="Probable RNA-binding protein"
FT   CDS_pept        join(639399..639800,639837..640118)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RBM25"
FT                   /locus_tag="PICST_63288"
FT                   /product="Probable RNA-binding protein"
FT                   /note="go_process mRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63288"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68103"
FT                   /db_xref="GOA:A3LZ68"
FT                   /db_xref="InterPro:IPR002483"
FT                   /db_xref="InterPro:IPR036483"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ68"
FT                   /protein_id="ABN68103.2"
FT                   /translation="MSYRVNEVDSEFVKKQATKDRSGTKYPKCFKVEVDVTKVNLPIIK
FT                   DWITRTISEHLPDDDIVADYVYELLVANEKNPDIKGIHSQVQDFLGKEESLVFCEKLWK
FT                   LLISAQDDVDGIPKEILEERKKEMEQKQKSVEVEKSRTNYNRTQSSYGESQSRERVMRE
FT                   REGVRGERSRERIRTDKQPSRDRNGYPEREYRDRDEYRDKDRYGARGRRRDTRDRSRSR
FT                   ERART"
FT   gene            640569..642531
FT                   /gene="SNF1"
FT                   /locus_tag="PICST_68332"
FT   mRNA            640569..642531
FT                   /gene="SNF1"
FT                   /locus_tag="PICST_68332"
FT                   /product="carbon catabolite derepressing ser/thr protein
FT                   kinase"
FT                   /note="Has EST support"
FT   CDS_pept        640760..642502
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SNF1"
FT                   /locus_tag="PICST_68332"
FT                   /product="carbon catabolite derepressing ser/thr protein
FT                   kinase"
FT                   /EC_number="2.7.11.31"
FT                   /note="go_function protein kinase activity; ATP binding;
FT                   go_process protein amino acid phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68332"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68104"
FT                   /db_xref="GOA:A3LZ69"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013896"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR028375"
FT                   /db_xref="InterPro:IPR032270"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ69"
FT                   /protein_id="ABN68104.2"
FT                   /translation="MVEEHHHHHHHHHQHHEHHDQPTPIDANSNPANRIGKYQVIKTLG
FT                   EGSFGKVKLAQHTTTGQKVALKIINKKTLAKSDMQGRIEREISYLRLLRHPHIIKLYDV
FT                   IKSKDEIIMVIEFAGKELFDYIVQRGKMPEDEARRFFQQIIAAVEYCHRHKIVHRDLKP
FT                   ENLLLDDQLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSSG
FT                   VILYVMLCGRLPFDDDFIPALFKKISNGVYTLPNYLSAGAKHLLTRMLVVNPLNRITIH
FT                   EIMEDEWFKKDIADYLLPPDLSKTMHNKIDVDEDVITALTMAMGYDRYEIINVIEKCNK
FT                   SSTPSQQSNEILDAYLLMKENHSLVKDLKKSKSEKVDSFLSQSPPPSFINSSTSSAPGV
FT                   QQSLTYQTLATVPDLSTLPNSTIAILPSSLPSIHRAFMMEHNNQAVINPVSSRKSKTRW
FT                   HFGIRSRSYPLDVMGEIYRALKNLGAEWAKPTEEELWTIKVRWRYDSCEMEQAPNLMKM
FT                   QIQLFQLEPNNYLVDFKFDGWETSGEQSSFKQDADEVSSFSAYPFLHLATRLIMELAVN
FT                   SQSG"
FT   gene            <643763..>644788
FT                   /gene="HST3"
FT                   /locus_tag="PICST_49645"
FT   mRNA            <643763..>644788
FT                   /gene="HST3"
FT                   /locus_tag="PICST_49645"
FT                   /product="NAD-dependent deacetylase HST3 (Homologous to
FT                   SIR2 protein 3)"
FT                   /note="Has EST support"
FT   CDS_pept        643763..>644788
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="HST3"
FT                   /locus_tag="PICST_49645"
FT                   /product="NAD-dependent deacetylase HST3 (Homologous to
FT                   SIR2 protein 3)"
FT                   /note="go_component chromatin silencing complex;
FT                   go_function DNA binding; go_process chromatin silencing;
FT                   regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49645"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68105"
FT                   /db_xref="GOA:A3LZ70"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ70"
FT                   /protein_id="ABN68105.1"
FT                   /translation="MLTIDLLERKTSADVPAEDMISLNEIFKHIFKAKRTTVVTGAGIS
FT                   CNAGIPDFRSSDGLYNMVRTKFPKTVVKGQDLFDISLFRNEMSLAVFCTFMEGLYKSTL
FT                   VAKPTETHRFIKILKDKNKLLRCYTQNIDSLESTINLNMGINLSEFDTCHKNFVQNWKN
FT                   LDVVQLHGNLHKLSCTNCFTNFDWNEKYQSQLAEGLNPQCSKCYEKYEERLYSGKRLTG
FT                   NIGLLRPDIVLYGEHHPQSEILAQGLNVDIRAKPDMLIVMGTSLKVDGVKKLVRSLSAS
FT                   VHAKGGKVIFINKTPLAKQWDSVFDYEILSDCDSFVRLLKNEVPDLFLTQEQLDSKKLK
FT                   NN"
FT   gene            645816..648001
FT                   /locus_tag="PICST_85290"
FT   mRNA            join(645816..646435,646505..647615,647670..648001)
FT                   /locus_tag="PICST_85290"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(646286..646435,646505..647615,647670..647974)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85290"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68106"
FT                   /db_xref="GOA:A3LZ71"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ71"
FT                   /protein_id="ABN68106.2"
FT                   /translation="MDSVSSFFENILVVDPDTAGKAKSQPEPNRRNSGLNTMDFSSLWN
FT                   YGKESPSSSFLNNSYMADKLMEKIIEMIIPMDVSDARTGQMLDRIEMQKSRPPLSMAIM
FT                   SNNSTELNKRMTNSFVMTDNIIRFFSWTHPFYTVGVLLIATHLILKPYLMTVLPLVLLL
FT                   VRVLIPHYLIMYPPDSSYLSEYIERNPEPASYQLHKCKVPGPIPQFSREFVLNLTDLQN
FT                   SQTIYISVYDFVMWLTKDYLYFKDENISSVVFLTVLVFVVTNLFVMPGLLSYLASHFYV
FT                   VQGMTIVFVWGFVIAFHPFCRSRILEWLYSEDTRLTFLEMSNNVESKFVDYLESAQEPP
FT                   KLNDEGYVINLDSKDIKLVEIFELQRLDNKTKMWDLVGFTNNIYTVNTATRKFNRGLYN
FT                   FLAEADKHENHEHEQAASDRNRYIKLNKKSSINDVMPPVNWKFADSKWELDLEVGEWVR
FT                   QNYIEDLVMIDDDEKWVYDYDYQDGHVLDQDNEKNDVPRNVYRRRRWIRHVIRESTLED
FT                   DDQQ"
FT   gene            complement(<648105..648953)
FT                   /gene="SNM1"
FT                   /locus_tag="PICST_68335"
FT   mRNA            complement(<648105..648953)
FT                   /gene="SNM1"
FT                   /locus_tag="PICST_68335"
FT                   /product="SNM1-like protein"
FT                   /note="has roles in both mitochondrial DNA replication and
FT                   nuclear 5.8S rRNA processing"
FT   CDS_pept        complement(648222..648953)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SNM1"
FT                   /locus_tag="PICST_68335"
FT                   /product="SNM1-like protein"
FT                   /note="Similar to SNM1 which has roles in both
FT                   mitochondrial DNA replication and nuclear 5.8S rRNA
FT                   processing; Similar to cyclic GMP-binding protein C"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68335"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68288"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ72"
FT                   /protein_id="ABN68288.2"
FT                   /translation="MSSVKQTSLNQNQLTALHLYDVAHCLPLNPLNKQYSLNFSDFLVE
FT                   KSINLPPNPTVTHKFCRNCGVILIPGLTLSLRIVFRKKTKSKKSKESVIRANSSEDFKS
FT                   KPIRKLRYRCLQCRNLEYDDSLIQRNEKRLSRLEAKESSNEIMIGNSNSVSNSNTPEPF
FT                   RAEWSPLTNTNEVSKDIKVKSNNNNSKRNSDNITKSNSKSKERSKKRKQNSLSSMLQQK
FT                   KQQKEQESKTNSLNLMEFMQG"
FT   gene            <650572..>652584
FT                   /gene="SEF2"
FT                   /locus_tag="PICST_62972"
FT   mRNA            join(<650572..650899,650945..651027,651046..>652584)
FT                   /gene="SEF2"
FT                   /locus_tag="PICST_62972"
FT                   /product="putative transcription factor"
FT                   /note="Has EST support"
FT   CDS_pept        join(650572..650899,650945..651027,651046..652584)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SEF2"
FT                   /locus_tag="PICST_62972"
FT                   /product="putative transcription factor"
FT                   /note="putative transcription factor Suppressor protein
FT                   SEF1 homolog; go_component nucleus; go_function
FT                   transcription factor activity; zinc ion binding; go_process
FT                   regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62972"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68107"
FT                   /db_xref="GOA:A3LZ73"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ73"
FT                   /protein_id="ABN68107.2"
FT                   /translation="MQTQSKNRLRLIIPASSSGSKVLKSCIRCRKHKTKCNASVTNPLP
FT                   CTHCAKHKINCVLEVITPSTNRSTIDLAEKLADEVSDLKQVMAKIISRRNALFEKLASS
FT                   GLDIQTRSETPPVSEIQSCINTPQDFAIPLTAPENDNEPVFSISANKSLQSFAISNATA
FT                   SRLFANYERNFNQFLPIFPDNFFKSINLKTFANENDLLFWCIILTSYLNNPVDQSAPSY
FT                   RILSEHIKSLVVEKCWLQTPRSVYVISSLLILTTWPLPNTSSKISDNLCIKFISTMKAL
FT                   SLQFGLHKLEFINEFSHKTKMNISQEVNLDNLIRERIYKFININSNYWLINLGLSNNNY
FT                   NGFTQDYIINKSSNIDILNKTSEGDHYINSLLKISMIQSKLNENMNILIGNNSESVSLL
FT                   PNQLNTSKLINFNMFEIIIDDLNKILVRDDNSLVLNNLIKISIEFSKLQLFVYSLSKSD
FT                   ITILEYKHYITKVLKSCFIIFSSQFQDNSLNFNQLPIHYKFPIELAMLIMLRVFKSPIM
FT                   NSISDYKLVKEKFNQMYDNIIMGGKNNEDWEFLNARLNKVLHKFNKIDNKFIISKMTRH
FT                   NDNDKVVPSFFLINKMKSYLIASLNYEMIWLIYENEHTQTTINNEEINWDVFGIKDNRM
FT                   DMIDYLQSNESIFY"
FT   gene            complement(<652757..>655435)
FT                   /locus_tag="PICST_63104"
FT   mRNA            complement(<652757..>655435)
FT                   /locus_tag="PICST_63104"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(652757..655435)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63104"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68289"
FT                   /db_xref="GOA:A3LZ74"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR011678"
FT                   /db_xref="InterPro:IPR026895"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ74"
FT                   /protein_id="ABN68289.2"
FT                   /translation="MRFASLWTIALALVTVSAVLLEDAFSKEAIQHIYGTLKSYSVIKA
FT                   NKAIGFNDRSQFISIQLDNPNYLEWSVELSSFPALNDFHLAQNHNLAYLSSSEQASLYL
FT                   FETASGVYVREIKLVSPPVKVVDFLNRGLLVLTSNGVLQYVKHESGEVKTVYDFDQPTT
FT                   ILFDSRDGFGSVIAGKLLLKINALAEVVSVSESLPIINAKLFKDGVVVTGNDAVYKFDE
FT                   NGTDVVEITTGKVLNLDIINNNYLYTFTNDSVILYSISAKNNLEVSETLTTSSEIVNVS
FT                   YENFGLNDFIIVTTKNGRKSVYDLTDFLVLDEPSSIKIVDTKVEQLYTDDFITVFNGNY
FT                   QLVSIGPDVNGKIFDLSNGHLVKNVVSVNQFVSVNSKYLIIDKPESQQTLNEFHHLLED
FT                   ANTGFIVTNWLLRVKRHLSELGKYVVSFFAKVEDTETINAVEGDEFGFGKLIIFFEDSA
FT                   KAIIALNSVDGTLVWKSTAVFDGSFVELITYQDNLVALFSSGLYFINSRDGSVLSFEQL
FT                   GEEYSGLFKSSSNEEDSSKIILKKENQFSIFNGTDENDLFFVDNDDTTVSGFKISAGDS
FT                   SSFGTWKFSKSNEKIISLASKPFSTTTSSLGISLANKDVLYKYLNPNVISVLTKDNENE
FT                   QLKFYLLDAVTGNLLHSFEHKREEVVDFSSINLIMDDNWIIYSYFVIAPSLEQRFNVID
FT                   LFDTEKSLKKDNANSVSEFSHNSTIDSYSIKSFIFPERIYGMSSTQSLYGITLKSIIVA
FT                   TENGALIEIPKHLLNSRRIDDRELTQADFQSDFKMIPYEPVIARNAFQILNHKHQLKVT
FT                   KDGNILTRPTHFESTSVVCYYNDFNQFCTTVQPSSSFDLLSRGFDSVKLLITIAILFAV
FT                   YLGSKPFVYNKKLNAQWIDRA"
FT   gene            <655708..>656104
FT                   /locus_tag="PICST_36994"
FT   mRNA            join(<655708..655750,655902..>656104)
FT                   /locus_tag="PICST_36994"
FT                   /product="predicted protein"
FT   CDS_pept        join(655708..655750,655902..656104)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_36994"
FT                   /product="predicted protein"
FT                   /note="go_component integral to membrane; go_function
FT                   molecular function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_36994"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68108"
FT                   /db_xref="GOA:A3LZ75"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ75"
FT                   /protein_id="ABN68108.2"
FT                   /translation="MHSRDWFLVFVGFFLPPVPVLVKRGLSSADFWINILLCILGYFPG
FT                   LIHSYWIISQYPYRETYAALGGDGHNNRTDYGATVG"
FT   gene            complement(<656897..>658375)
FT                   /locus_tag="PICST_18070"
FT   mRNA            complement(join(<656897..657798,657820..>658375))
FT                   /locus_tag="PICST_18070"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<656897..657798,657820..658375))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_18070"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_18070"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68290"
FT                   /db_xref="GOA:A3LZ76"
FT                   /db_xref="InterPro:IPR013929"
FT                   /db_xref="InterPro:IPR013930"
FT                   /db_xref="InterPro:IPR039913"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ76"
FT                   /protein_id="ABN68290.2"
FT                   /translation="MDFIGEIVEHEIEAPSSTIDVEVGGFPDPSKSREKKVSRWKKRVQ
FT                   KKGTEDAAKPLRESANKVKNKNVVNDLTEAEKIHQENMDKIASMTEEEITHEREELLQG
FT                   LDPKLIQSLLKRTESRIQKQADHVHGDSSNHGDHGHEHSEGYNGWIGGMRTKEGMSDLS
FT                   QLDPEDVDKALGIKQLNIKDDFDIEKDNSSKASEKPKKSVTFNEVATVSYEDLDGGIEL
FT                   DPNGWEDVEDLHEMIPNIPHTNNENEIAPEEYQLLTEEEENRMDVHFPKPKPVDDLDLN
FT                   DPDFYDKLHEKYYPDLPKETDKLSWMTKPLPKQTSTTYESVADMRFNFHGDLIELHDET
FT                   SPQANPKNEIPTYMGLHHHAENPHLAGYTLAELAHLARSVVPSQRCVSIQTLGRILHKL
FT                   GLHKYAGVSVEENDEEDKHFNENVREMVASFEKMLWDLIDQLRVIETITDAADEAKTKN
FT                   LSVRNYAIEALWLWKKGGGRPEEYEQTE"
FT   gene            complement(<658513..>659826)
FT                   /locus_tag="PICST_33443"
FT   mRNA            complement(<658513..>659826)
FT                   /locus_tag="PICST_33443"
FT                   /product="predicted protein"
FT   CDS_pept        complement(658513..659826)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33443"
FT                   /product="predicted protein"
FT                   /note="go_function metal ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33443"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68291"
FT                   /db_xref="GOA:A3LZ77"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ77"
FT                   /protein_id="ABN68291.2"
FT                   /translation="MTGHQSPIWSRVVKIGVPIGVIFGLAYIDFASFYSLGYQEIYKHH
FT                   SKGIAVALWVLGGFSQFVMFLYWILMFVIGPGKSPVFQPLNLYGTDDPNLIPCPDIFPC
FT                   DEYGYPEYNSNARSIVTARTFYSKDMGYMVLKFDHFCLWIGTVVGETNYLFFMKYCQWF
FT                   LTYFVVILIFLIRYTPSNIGRGGEINHNFIPLYVMCGMWILMIGALFGTHFYYIVINKV
FT                   TLDQVSENQKRSFERWQNSHKDDKKKRPKPREETGWRYINVKKDNLRLVVQYGINDRVY
FT                   DMGAKKNFINLVYNGNRNHGLEESFYTTQKYFVALAILFIPFVDIYNGFKYAKRPPIDP
FT                   EIGSLQERKRMEFESYSCKLNDDFLQHVYGKIERKECYIAQYIRLPQEHQKPPEDEREP
FT                   QKEASTEIKSETKSETGSEMVSPLKNSTESGSPRSSQQ"
FT   gene            <660145..>661194
FT                   /gene="TFB3"
FT                   /locus_tag="PICST_49633"
FT   mRNA            <660145..>661194
FT                   /gene="TFB3"
FT                   /locus_tag="PICST_49633"
FT                   /product="RNA polymerase II transcription factor B subunit
FT                   3 (RNA polymerase II transcription factor B p38 subunit)
FT                   (RNA polymerase II transcription factor B 38 kDa subunit)"
FT   CDS_pept        660145..661194
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="TFB3"
FT                   /locus_tag="PICST_49633"
FT                   /product="RNA polymerase II transcription factor B subunit
FT                   3 (RNA polymerase II transcription factor B p38 subunit)
FT                   (RNA polymerase II transcription factor B 38 kDa subunit)"
FT                   /note="go_component nucleus; go_process cell cycle"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49633"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68109"
FT                   /db_xref="GOA:A3LZ78"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR004575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015877"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ78"
FT                   /protein_id="ABN68109.2"
FT                   /translation="MPSKFQSLTISLDDRSKDMCPICKTDKYLSPNMNFLINPECYHKI
FT                   CESCVDRIFSLGPAPCPYASCGKILRKNRFKKQIFDDLRIEREIDIRKRVGSVYNKTEE
FT                   DFDDLREFNKYLETIENIIFNLNYGIDAEETEADLVKYEQEHKLEILEKNMRQSQKNAD
FT                   LAAYQEAMERLKQEKLRIQKQMEVEDMEYQKQSQQDLLDKLTTGSASSTDEIIKQQQQN
FT                   ALKRSSLRRRELQQITNQLDQQFNKSNPLYKHAKELEENLKTPFTPFKGDRDLNKNYHL
FT                   LPIPNDIDELMDIENHISDSYFDPYVNQLAKNKEYLGAGWRLQHVFEKALDEAFIGLGC
FT                   FIEKEKATA"
FT   gene            complement(661351..662857)
FT                   /gene="RMT2"
FT                   /locus_tag="PICST_66076"
FT   mRNA            complement(join(661351..662098,662162..662857))
FT                   /gene="RMT2"
FT                   /locus_tag="PICST_66076"
FT                   /product="arginine methyltransferase"
FT                   /note="Has EST support"
FT   CDS_pept        complement(join(661394..662098,662162..662710))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RMT2"
FT                   /locus_tag="PICST_66076"
FT                   /product="arginine methyltransferase"
FT                   /EC_number="2.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_66076"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68292"
FT                   /db_xref="GOA:A3LZ79"
FT                   /db_xref="InterPro:IPR017408"
FT                   /db_xref="InterPro:IPR026480"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ79"
FT                   /protein_id="ABN68292.2"
FT                   /translation="MSDLHDLCRFAERPITSKYVDQLNFYLRSGIPATYTIEEAYNYTN
FT                   DIAAEPTTTTTPLHLICTHVPENATAEELKVVDTMVQTLFEYGAGWCLSDVNNDTPGCI
FT                   LIKRKLNHLNIYTQIVDSGVRAELLLRKVGEFDMEIIEDTDDLDHDRFGEVPELVEEKA
FT                   EQIEQPKSDEKPDPEESNKSNQQSYLNTKLEYVDNALITKDRKDGVMMAWETDLMRLGC
FT                   ESLFKGSIIEDNEEDSEINILNIGFGMGIIDTMINEKNPTKHYICEAHPDVLAKLKADG
FT                   WYDKKNVVILEGRWQEQLDKLLSSGEVYFNGIYYDTFSEHYSDMLELFDYVVGLLKPYG
FT                   VFSFFNGLGADRQVVYEVYKKLSELDLANYGLQCTFTSVEVPKETLQENDKSVWDDVKR
FT                   SYWSCPVYYHPEARFIDL"
FT   gene            <665098..>666402
FT                   /locus_tag="PICST_68338"
FT   mRNA            <665098..>666402
FT                   /locus_tag="PICST_68338"
FT                   /product="hypothetical protein"
FT                   /note="Has EST support"
FT   CDS_pept        665098..666402
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_68338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68338"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68110"
FT                   /db_xref="GOA:A3LZ80"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ80"
FT                   /protein_id="ABN68110.2"
FT                   /translation="MSFKLNDYNAFLTSLFDKNNPQHQQQQQLQNPELAPQQPQSQLSH
FT                   SNPPYDTYDNRSINANSNNNNNNNTSNSNSANANNIIEDEDMNDSVSFPVDFDFGLIAP
FT                   SGNANYNRSKSINFPVNENAPHSNITEFMAELGPPAGGEHGHSPSVNNSYSSNSITADS
FT                   GVLNNNARNTAANNIFGMNYVNTNPTTIGDNYGTPLASPLSLGLNNDPHSNSNPNPHGN
FT                   QDNFYIKQEQLSVLPMQSNQQLHQQASGFNFAAKPQESPSPLSKEHTPPNKKPVKARYA
FT                   RIKSEEQELPVLIGPTQGHPRPRVKSAHNVIEQRYRNKINDKFTALQNSVPTLRMVARR
FT                   KQRQQLNDDYDSDNDDIGISGLSEEDAIELEGLEPARKLNKGTILAKSIEYIKFLELKN
FT                   DRMKMQHEELLLKARMLGLVINDDLVNPDVQNKKK"
FT   gene            <667560..>669140
FT                   /gene="CP51"
FT                   /locus_tag="PICST_63421"
FT   mRNA            <667560..>669140
FT                   /gene="CP51"
FT                   /locus_tag="PICST_63421"
FT                   /product="Cytochrome P450 51 (CYPLI) (P450-LIA1) (Sterol
FT                   14-alpha demethylase) (Lanosterol 14-alpha demethylase)
FT                   (P450-14DM)"
FT   CDS_pept        667560..669140
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="CP51"
FT                   /locus_tag="PICST_63421"
FT                   /product="Cytochrome P450 51 (CYPLI) (P450-LIA1) (Sterol
FT                   14-alpha demethylase) (Lanosterol 14-alpha demethylase)
FT                   (P450-14DM)"
FT                   /note="go_process electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63421"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68111"
FT                   /db_xref="GOA:A3LZ81"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ81"
FT                   /protein_id="ABN68111.2"
FT                   /translation="MALLDSAIVAYNYFVSLSLTQQVSIIVFAPFIYNIVWQFLYSLRR
FT                   DRAPLVFHWIPWFGSAIPFGMAPYKFFEDSRQKYGDVFAFMLLGRTMTVYLGPKGHEFV
FT                   FNSKLNETNAEDAYKHLTTPVFGKGVIYDCPNHRLMEQKKFAKYALTRDAFKTYVPKIR
FT                   EEIISYFKNPEGFNMGEKNSGVANIMKTQPELTIFTASRSLLGDDMRKRFDASFAQLFS
FT                   DLDKGFTPLNFVFTNLPLPNYRKRDNAQQKISATYKSLIEKRRATGDVDPNRDLIDSLM
FT                   TYSTYKDGVKMTDQEIANLLIGILMGGQHTSAATSAWFLLHLGARPDLQDELFEEVSNI
FT                   LKEKGTSNLNDLSYEDLQNMTLTNNVIKETLRLHMPLHSIFRKVSKSLLVPNTNYTVPA
FT                   GHYVLVSPGYTQTSDRFFPNASTFDPHRWDSNNLADKNADEGTVDYGFGAVSKGVSSPY
FT                   LPFGGGRHRCIGEQFAYVQLGTILSAFVYNVKWSLKGEKVPANDFTSMVVLPEEPAEII
FT                   WEKRKTCTF"
FT   gene            669886..671307
FT                   /gene="THR1"
FT                   /locus_tag="PICST_85224"
FT   mRNA            669886..671307
FT                   /gene="THR1"
FT                   /locus_tag="PICST_85224"
FT                   /product="homoserine kinase"
FT                   /note="Has EST support"
FT   CDS_pept        670205..671266
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="THR1"
FT                   /locus_tag="PICST_85224"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="go_function ATP binding; kinase activity; go_process
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85224"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68112"
FT                   /db_xref="GOA:A3LZ82"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ82"
FT                   /protein_id="ABN68112.1"
FT                   /translation="MTIRSFEVKVPASSANIGPGFDVLGVGLQLYLQIKVTIDSSKDTS
FT                   HDPYHVKLSYEGDLAEKVPLTSDKNLITQTALYILRVNGMDSFPQGTHIHVINPVPLGR
FT                   GLGSSASAIVGGIVLGNEIGEFKFSKTRLMDYCLMIERHPDNIAAAMLGGFVGSYLHDL
FT                   SPEDMAAKNVPLDYILPKPDTPKEKIVSSQPPTNIGEYLQYNWCHKIKCVAIVPNFEVS
FT                   TDSSRAVLPEKYDRQDIVFNLQRLAILTNALTQETPNNKLIYESMKDKIHQPYRSGLIP
FT                   GLQKVLASVTPDTHPGLCGICLSGAGPTILCLATGGYDAIAETVIGIFNKAGVECSWKL
FT                   LELAYDGATVEIK"
FT   gene            671531..673108
FT                   /gene="SAM50"
FT                   /locus_tag="PICST_85291"
FT   mRNA            671531..673108
FT                   /gene="SAM50"
FT                   /locus_tag="PICST_85291"
FT                   /product="SAM50-like protein"
FT                   /note="Has EST support. strong"
FT   CDS_pept        671570..673039
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SAM50"
FT                   /locus_tag="PICST_85291"
FT                   /product="SAM50-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85291"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68113"
FT                   /db_xref="GOA:A3LZ83"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ83"
FT                   /protein_id="ABN68113.2"
FT                   /translation="MSEKKQFDSSSDLRSRLITEEVLGTSGTRPLYVSSIEVNGGETFS
FT                   AEFFKKLLTPLIDRSDYTLNQLVDTIGITQDKLNKTNVFKDIAVSLHSDYTALIPSTVK
FT                   NYNKETPVSTKVVFDLQSINLNIGEGFLNFNNQENLTLNLDYLNNNFNDNAELVNIGVN
FT                   YNPYKPNDHLITNTKFLANLNNPSFKFLIDLFHSQQNNQTWQQSSEGSTGGLIGLQYNQ
FT                   SKTLTYLTGLSFARRTIHNIDDAAADELKFFAGDFLKSSIISQVAYSDVEFLNSFTKNF
FT                   PTNGLKFVLSNEISSNQEQENPDNHAAFLKSSLSLNYYKSFLNNAITTEFSSDFGGIYS
FT                   SSNGPVHISDRFYLGGVDSFRGFCRNAVNINGGSSFYKLSGTIFSQLPPFIHPVAKGSA
FT                   VDKKLDDGFGHEANPLRFYATGSIGNVSDNMLEDDSGVSSVGIGLRYFNYWANFDVGYF
FT                   LAKRYGTDAGDSGIKDGLHLSISIGGSNRSV"
FT   gene            <673373..>675403
FT                   /gene="EXO1"
FT                   /locus_tag="PICST_33450"
FT   mRNA            <673373..>675403
FT                   /gene="EXO1"
FT                   /locus_tag="PICST_33450"
FT                   /product="5'-3' exonuclease"
FT   CDS_pept        673373..675403
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="EXO1"
FT                   /locus_tag="PICST_33450"
FT                   /product="5'-3' exonuclease"
FT                   /EC_number="3.1.11.1"
FT                   /note="Exodeoxyribonuclease I (Exonuclease I) (EXO I) (DHS1
FT                   protein); go_function nuclease activity; go_process DNA
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33450"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68114"
FT                   /db_xref="GOA:A3LZ84"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR032641"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ84"
FT                   /protein_id="ABN68114.2"
FT                   /translation="MGVTGLLPCLKEIQNPGTLEQYRGKTLAIDTYGWLHRALISCAEE
FT                   LCLERPTRKYITSILKRVDMLRHFGVEPYFVFDGAALPTKAETANERRVKRQEARKKAE
FT                   EYSKAGKRSLAWKEYMKAASVTSQMAKSVMVELDARGIKYIVAPYEADPQMVYLEKIGL
FT                   VDGILSEDSDLLIFGCNRLITKLKDDGTLVEICRQDFHKVKSIPYLSKFSQEQLRLIAM
FT                   LSGCDYTNGIQGIGIKTAFNLVQKHAKLERIVAVLRAEGKPIDEGFHDELHRANLAFQF
FT                   QKVFNPKLQQLKTLHDYPEDLELDYEVLESCCGRTFSNELYIQICNGSIHPNTHEALVS
FT                   REQSLSSLKSNSVNISSVKSAPAQLSQRSKSITATLTPKGPQKTVFDFFQVRKQVVSVS
FT                   SITGNSVSSVTSLSTGSTTVKTSKTPEKRLYPASDRSKMSPTSRKMQRIADDPIPPASS
FT                   VGKISKFFSSSSDKTQESQVKTVEPSSLSWDSSMIGDSYFSDEPGSPVKSVNTNDILED
FT                   LTDTDDPIFDPPENDTENSTSEQSTSKVESTISDNFGIDDDDDEIEESPVKNKEAPRLQ
FT                   QVQPTKMEVLRENLREEFSFSMNPLPTRSNSSLTYSSNRSARLPLQAKDVNISSRSLKA
FT                   RATEPKCVSTFKPQTEKQQSQQHIKPPKKHIDLKQFAFGRN"
FT   gene            complement(<675508..>676098)
FT                   /locus_tag="PICST_62985"
FT   mRNA            complement(<675508..>676098)
FT                   /locus_tag="PICST_62985"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(675508..676098)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_62985"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_62985"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68293"
FT                   /db_xref="GOA:A3LZ85"
FT                   /db_xref="InterPro:IPR013926"
FT                   /db_xref="InterPro:IPR036504"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ85"
FT                   /protein_id="ABN68293.2"
FT                   /translation="MSWTSVSFPSYPQYTVFISLFTGIENDTISTVKKELIAANAEYDF
FT                   CFLNTYHVVSVEHLYGSIHRSIANYANDTLKARTVNTEIIFNLSPINKIMEALKKFGVD
FT                   EKCPNIIAIKVFKTEDIDEKSFIDTNNHLLKLLRIEKDSNIELNDKTLGQLVDVPKVIK
FT                   VYKLSDVKISSDESQKQAQLTRLVVAACLLRGL"
FT   gene            <676529..>677959
FT                   /locus_tag="PICST_33452"
FT   mRNA            <676529..>677959
FT                   /locus_tag="PICST_33452"
FT                   /product="Uncharacterized conserved protein"
FT   CDS_pept        676529..677959
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33452"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33452"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68115"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ86"
FT                   /protein_id="ABN68115.2"
FT                   /translation="MDSDSKPNAIELHVPTLLDTIFKDNVQELLPPHSIKAPEYTEILL
FT                   QKTTKANKYYGSFQRYTRQFIPDDSAANTAIVRWTNSSIESTQRLIIDSWIGSDYKGNQ
FT                   VRTENSPHQNVQTKTTANSLFSWSSGDAYIEQRKKELQLAKGKEKSRKENQKTHSHQKE
FT                   VSPEETASNNVTESESKREAQEKRLKKLNLTVPKESITNRLNRIIEKESNTFIHARIQR
FT                   IKTHHTEQITKQIHERKRKDHELYLKKLRLKEEEYDKALKAATTETQKQGFFGNLFGFN
FT                   STTTNSRSELDFQLKDSFDNESVASHTSTTASKTNNSNSKRFSFLPVGGLWSSGSGGKE
FT                   SNKNDLSEVSPSKKSESSNDHIHPAEVVLREEIELQEENEVAEIEEKEEVHEGENENGY
FT                   DFDDEEFDDFTSAEPLPKTSTTITAMAPLKPSTFSPPPSSTTNEFNLTTQHNINADLLD
FT                   IFGPEKKSNEANENLLNI"
FT   gene            <678396..>679886
FT                   /gene="MAS2"
FT                   /locus_tag="PICST_49260"
FT   mRNA            <678396..>679886
FT                   /gene="MAS2"
FT                   /locus_tag="PICST_49260"
FT                   /product="Mitochondrial processing peptidase alpha subunit,
FT                   mitochondrial precursor (Alpha-MPP)"
FT   CDS_pept        678396..679886
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MAS2"
FT                   /locus_tag="PICST_49260"
FT                   /product="Mitochondrial processing peptidase alpha subunit,
FT                   mitochondrial precursor (Alpha-MPP)"
FT                   /EC_number="3.4.24.64"
FT                   /note="go_function metalloendopeptidase activity;
FT                   go_process proteolysis and peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49260"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68116"
FT                   /db_xref="GOA:A3LZ87"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ87"
FT                   /protein_id="ABN68116.1"
FT                   /translation="MQRSSLARRAFTAATKPNIETSTLSNGLRLVTDSTPGHFSALGAY
FT                   VDAGSRFENPNKPGLSHICDRLAWKSTEKYSGMELIENLAKLGGNYMCSAQRESVIYQA
FT                   SVFNKDVEKMFDCIAQTVRAPRFTDQELFETLQTAEYEVNEVSLKHDMFLPEVLHSAAY
FT                   QNNTLGLPLFCPPERIPEIGKSDIINYHNQFFQPQNIVVAMVGVPHEHAVKLAEKQFGD
FT                   WKPAKSYRPDFGTVKYTGGEISLPFQPPIYSNMPELYHMQIAFETTGLLSDDLYALATL
FT                   QKLLGGGSSFSAGGPGKGMFSRLYTRVLNQYAYVENCMSFNHSYIDSGLFGITISCSPN
FT                   AGHVMSQIISFELSKLLEKDPAKGGLTEKEVKRAKNQLISSLLMNIESKLARLEDLGRQ
FT                   IQCQNKITTIDEMIQKIESLSLEDLRVVAEKVLTGSVITKGISSGQPTVVMQGDRASFG
FT                   DVEFILRHYGLGKFQGPPLEEPRDFSKIEKPHRFGKWF"
FT   gene            complement(679896..685743)
FT                   /gene="MYO1"
FT                   /locus_tag="PICST_66079"
FT   mRNA            complement(join(679896..683016,683083..685743))
FT                   /gene="MYO1"
FT                   /locus_tag="PICST_66079"
FT                   /product="Myosin-1 (Type II myosin)"
FT                   /note="Has EST support"
FT   CDS_pept        complement(join(679978..683016,683083..685668))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MYO1"
FT                   /locus_tag="PICST_66079"
FT                   /product="Myosin-1 (Type II myosin)"
FT                   /note="Myo1 is a type II myosin, is localized to the
FT                   actomyosin ring and is important for cytokinesis;
FT                   go_component myosin; go_function motor activity; ATP
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_66079"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68294"
FT                   /db_xref="GOA:A3LZ88"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR004009"
FT                   /db_xref="InterPro:IPR008989"
FT                   /db_xref="InterPro:IPR027401"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ88"
FT                   /protein_id="ABN68294.2"
FT                   /translation="MSSDDNGFDSKNWVWIPDTDDLFTKGYITDYNKDGTCQVTVVGGN
FT                   GNGTQRVVPQDQLENCNPAKFNKCNDMAELTHLNEPSVVYNLYLRYNDDLIYTYSGLFL
FT                   VAINPYKSLPIYDTRTLERYHSHVFERPPPHIFATAEGTYRNLLSNKKNQSILVTGESG
FT                   AGKTENTKKIIQYLSSITHPVGGSTPSSPEKIRDISTHSRTIDTRILQANPILESFGNA
FT                   KTIKNNNSSRFGKFIQIYFSSRGEISRANIDYYLLEKSRVVYQASQERNYHVFYQFLKG
FT                   YDQLSNFGLNKDITTYKYLNNPKITIPNVDDFKEFNILSEAFKIMGFEVSEINHIFQIL
FT                   AVVLHLGNLEFTSWKSEQASFTQESPVQIITELLGIDQSDFTNNILRPKVKAGREFVQK
FT                   SKKASEAKYAIDAFAKHLYEKLFQLIIARINVNLENDSDQANEDLNFIGVLDIAGFEIF
FT                   EMNSFEQLCINYTNEKLQQFFNHHSFILEQSEYLKEAIQWEFIDFGLDLQPTIDLIETK
FT                   NPMGVFKLLDEECVIPNSSDKSFMEKLADHWASGQSKKFQQNKFKSGFIIHHYAGLVEY
FT                   NVDGWLQKNTDPVSENLLSLLPYSSNNFIRDMFENDEHLVVDPKRGAKLQTASSKHKDQ
FT                   LKDLMDQLECTEPHFVRCILPNLNKKANKFDKNLVLSQLRCNGVLEGIRITRAGYPNRM
FT                   TFDEFYQRYAIINVKEIYTKDLKTNSERILRFAELDPDTFKVGVTKIFFKNGILGKLEE
FT                   MRDVSLKRLFTDVQSVIRGTSIRSNLQKKIREVQSAQIIARTMKQLDESRSSSLWMDLF
FT                   INIKPLLEESVKVLEDAEMSEKVKDISSKLEEAEKSKSNLEDENSKLKEQEQINKLEDE
FT                   IITTTNLVKDKDLKLEKAKSEEAKISSRIREFESKINQMKQENNKLSEEKKLLDSKLKE
FT                   SSENSNRNIADLSSLTKERDDFKSKLADLELVVKKHKLEKVEREKHIEDLKKEHASLKS
FT                   SSESKVEDMKQLSRKLEEEISKNSLILPKHESLLDEVKKLKDLLSKSESDLESKDREIQ
FT                   ETMSKQKLFEEENIKVLEGTNKALKKEVESHKDEIAQKNAQVEKLQIQVAKLSSLEKET
FT                   EQLNTLVTNQSLEIQNLQEQLSDSVRENKSLSVVVEKLKVDYDAARIAKEEYSDKIFIL
FT                   SKKLSELEEEAREKEIEKENQPPDPAFVEEFAHIKLKLNENTAALRKEKFENKKLVEEL
FT                   SMLRDRFHNESQQDRSPIKQNELRSRTETLDSLHEEINSLKLQLQQEMSNSQRAENYAI
FT                   DIQKKLNRLSATRGINSWTDYEKKFRESQRRVSELEGKFEEFISADESFSEASRSISKS
FT                   DSFGRISFSMTSNSDFAQIYQDITKTLRTTREELTTSKSEILRLKSLLRESEDELYSAK
FT                   TANFKTSISDYEDKLAQLTVRHDTLRTKNSDLASNLELYKRRSEEYYDKLELAEAAVQI
FT                   SKRHEESALNDLNETKNQLKLAKEEARTSQIMIKEIRTNNSKLEETIQDKNFAMKQQEA
FT                   KIKELKEKIYYHKKNYENKEKTDKYREEIITLNKELAFKTDTENSLIKDSKKLQLDLED
FT                   LTKEKKTLEEDYALKIEHVNVLETRVDLLSNKSRQLENAQEINDRKIGNLNKQVSSLRE
FT                   LVESVTNQRDELLETKAKLEDQLSELTHKLDLSEAELAQTNKDMNILRTHLENQRQESS
FT                   EIKSELSQSRSSISSEMQDYQKLRKEHLVSSEENITLKKINKELSSKVHELEEKLYGNE
FT                   QLRFWEDKVRDLMKELDNSQSENHEASRTIKNLEKDVKQLEIKIANEAQLRKKYNDENF
FT                   DYQNKVSHYKSSLDILQNEQSEKDLQIRTAERENINLKESKLSLEKEVLELRQRLGINA
FT                   "
FT   gene            complement(<686711..>688411)
FT                   /locus_tag="PICST_37002"
FT   mRNA            complement(join(<686711..686798,686895..686997,
FT                   687028..687424,687596..>688411))
FT                   /locus_tag="PICST_37002"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(686711..686798,686895..686997,
FT                   687028..687424,687596..688411))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_37002"
FT                   /product="predicted protein"
FT                   /note="go_component nucleus; go_process regulation of cell
FT                   cycle"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_37002"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68295"
FT                   /db_xref="GOA:A3LZ89"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR014399"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="InterPro:IPR039361"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ89"
FT                   /protein_id="ABN68295.2"
FT                   /translation="MSNHKSKNYGPPSYVKPKPYSIMLELLESQANKKLTSEYTQDIVK
FT                   TLSHLEALSSVNPSMIDLQPEIQWFMRPFLLDFLIELHSSFKLQPQTLFLCLNIIDRYC
FT                   AKRIVFKRHYQLVGCTALWIAGKYEDKKSRVPTLKELTIMCRNAYDEEMFIQMEMHILS
FT                   TLEWSFSHPTLEDCLQLAITHSKISTHATPCKYNKLQSSSSSNSANTTTSAVTAVARFF
FT                   CELSLYDKYFLSVPTSLVSITANLLACSMLQIPNASDSLKELMRKVLAKRDEFDEESNQ
FT                   HEIENRQPEVHGAFLSGLDDNAIAVIKRTALMFIIQLSKVTEVLSKKYENLGVIQVINN
FT                   FHSRFTFIIQSIYENQETIISQEPIDAKLESLAEVLLQFPKMEDDLEDLKPPQSPHIFN
FT                   NPVALTPVTPPSASSQYSVFSNRRHNSSSTCVTPIHASISANNSKTEFSPLTATASREN
FT                   NWSSPIMHV"
FT   gene            complement(690803..692541)
FT                   /locus_tag="PICST_85255"
FT   mRNA            complement(690803..692541)
FT                   /locus_tag="PICST_85255"
FT                   /product="predicted protein"
FT   CDS_pept        complement(690851..692479)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85255"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85255"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68296"
FT                   /db_xref="GOA:A3LZ90"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012720"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ90"
FT                   /protein_id="ABN68296.1"
FT                   /translation="MSFTSQTPTIVVLKEGTDTSQGKGAIISNINACLAIQDTLRPTLG
FT                   PFGSDILIVSSNGKTTISNDGATILKLLDIVHPAAKMLVDISRAQDAEVGDGTTSVTIL
FT                   AGELLKEAKSFIEDGVSSHLITKGLRKACELAVEKINELAVDVKRENDEQFRQLLEKCA
FT                   TTAMSSKLISNNSTFFTKMVVDAVLSLDQEDLDEKLIGIKKVPGGSMEDSLFVDGVAFK
FT                   KTFSYAGFEQQPKKFSNPKIVNLNVELELKAEKDNAEVRVQEVKDYQAIVDAEWQIIFN
FT                   KLEAIAATGANIVLSKLPIGDLATQFFADRNIFCAGRVSSEDMGRVIKAVGGNIQSTCS
FT                   NILPEDLGTCERFEEVQIGSERFNIFQGCPQTKTCTLVLRGGAEQVIAEVERSLHDAIM
FT                   IVKRAVSHSSVVAGGGAIEMELSKYLRDYAKTVPGKQQLIIAAFAKALEIIPRQLCENA
FT                   GLDGIELLNKLRSAHAKGEIWYGIDFQKESVGNNMKSFIWEPALVKLNAIQSATEAATL
FT                   LLSVDETISNNSDEGAAGGRGRGAY"
FT   gene            <692805..>693293
FT                   /locus_tag="PICST_63415"
FT   mRNA            <692805..>693293
FT                   /locus_tag="PICST_63415"
FT                   /product="predicted protein"
FT   CDS_pept        692805..693293
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63415"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63415"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68117"
FT                   /db_xref="GOA:A3LZ91"
FT                   /db_xref="InterPro:IPR034600"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ91"
FT                   /protein_id="ABN68117.1"
FT                   /translation="MFRTKVIATTQNLTFTRNVAMKGDVNLSSRRVMRKIRLGKARPAI
FT                   FYQFDTLVELSDGSVIKRRSQAPKDEIRMITDQRNSALWNPNRSDLSTSDPNATGKINK
FT                   FKQRFASFSGEEEPVVANEEEAPKDKQDDLLELMGHNVQEVNKGGKLFNKKESRNRKV"
FT   gene            complement(<693506..>695365)
FT                   /locus_tag="PICST_33458"
FT   mRNA            complement(<693506..>695365)
FT                   /locus_tag="PICST_33458"
FT                   /product="predicted protein"
FT   CDS_pept        complement(693506..695365)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33458"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33458"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68297"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ92"
FT                   /protein_id="ABN68297.2"
FT                   /translation="MLRRTAPLFSRSGVYVRRFVYSSPQITKTVGPILEPLPVSEKKYE
FT                   AKYERLQTVFTLLKSKKTLSSSVARINQIYLKSGRTFVEDLLEIPGTNIYPFLFHYYKH
FT                   SSSIRTLLLDGLVKLIIEGKIDSAVELIDHMRVGKIIPVQASVILFNIHLNKSSQDTSK
FT                   RRQELGKLLIWQTVSTGDVLAAASYLIQFAEAEISVDPEVVKIVLRSIAVHHDSNYLYC
FT                   CHAIHRLLDVYGATVLSSADSLSALEMLQQKPQALFYANWFFQRIPKLEELFQSNPHKF
FT                   LKLLNGLIQFNIENGLYEVALNMWISTKRFQSKYLVPDQIESLAKLLKDSPNLKSLDSL
FT                   VEQIPKYATESQVIVDVLLEKYGTSKESISKFETLLKTVRAPLRRSTLTALFKAYVFQE
FT                   NEPVAEKILSNLLKSKDGATATEINAVFAKLLRQGKLQESIDMILSTDIHIAKIAYVTI
FT                   FKEVVKKRSKTEQEENFLKTMCKRLMLVPRDDEVFELLTVEIVRYYSTHISNRAAKKIF
FT                   INIDKFTAKSSIAVDKQNIKFNFVKVGIPNRFRELLVLLPSSKLQCLDVITKRALQEED
FT                   ASTIVWAVDEYRYQNLEIKDVLQHIQKMDENKFLNSIIRDDIM"
FT   gene            complement(<695765..>698155)
FT                   /gene="RCY1"
FT                   /locus_tag="PICST_33459"
FT   mRNA            complement(<695765..>698155)
FT                   /gene="RCY1"
FT                   /locus_tag="PICST_33459"
FT                   /product="F-box protein: endocytic membrane traffic,
FT                   recycling ReCYcling 1"
FT   CDS_pept        complement(695765..698155)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RCY1"
FT                   /locus_tag="PICST_33459"
FT                   /product="F-box protein: endocytic membrane traffic,
FT                   recycling ReCYcling 1"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33459"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68298"
FT                   /db_xref="GOA:A3LZ93"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR009976"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ93"
FT                   /protein_id="ABN68298.2"
FT                   /translation="MAQVIWNADIDVYNPQVIPSPIARNVAKYLSIPDLLSFSKVSRNA
FT                   YKAANDPLTWIARLKAMELWDSAEIPPKDRPLKSSDFHNLDNPLLCLDKIYRTSKGAKI
FT                   QVLKIHKSLSPYYNDIQLNKPYDRLRIFKDFQSPEDQAKILSNLLVYSNIDFNDDSRTL
FT                   VQEKITALFEIFENALLRELEIHFDLQDYEKTRRFMNILIDLKNQQTLIDFFLQKSIFD
FT                   NEESEIFNLESFDTTKYFILDPEDFHQTRHIINEEAFTGLTQELAHVFNEQSHIIDLIF
FT                   PQTVPMMYKVSEELVSNQLAELLLILIEGSKKPGLYLTLVPYLYEKITIDFLKLLNPSE
FT                   NIGPNYNHLLKELIDMSFESFVVDYTREEIQYFKNTTNDKLLDWKREITKREAETTMNI
FT                   LKHVKAETKSDFLTSFKKVFTISNSSGSKEAESEQQNYSEIQAKAKILSENIKSLTKIF
FT                   SPELILETLNDAKTSLHKLLKFRDFSIASLKNDIFASMQDIFINVMDTIGNEHLKPGFN
FT                   KGLEYLQTYNPSSKTYSESHNESFVEPLVLFFELINMADLIIQMVDIFYKEEMIKKNIV
FT                   KRENSILNPSLQNKKKLEGLVDKYVADGLNVGVEVLVNEIDNVFKNNHTNDYNPSADTP
FT                   PNFGPTETAHKAVQILEENIDLLVDSADSSIVEVFQQEIAERFFQVIVKNLKKSTISVA
FT                   GATNLISDINLYYDFIIAHIRSNKRLIVPLYQALKKVGNIYLIGGDDAKAIGKLVSDLS
FT                   KFNGIFGQEEIYEFVQRRQDWPIIKRHVEKVMYGFGLGDCSIV"
FT   gene            <698987..>701440
FT                   /locus_tag="PICST_33460"
FT   mRNA            <698987..>701440
FT                   /locus_tag="PICST_33460"
FT                   /product="predicted protein"
FT   CDS_pept        698987..701440
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33460"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33460"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68118"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ94"
FT                   /protein_id="ABN68118.2"
FT                   /translation="MFICIARTLARSPVRRLGRPVRLNLRIAYSSKTKPHPTTSKEEEP
FT                   TFFEENSENNKNSIPFKDKLSSFIVNFIKQESQALASSFDNDLLYGNAIDVNTDYSIIL
FT                   EPQLQSEIDNALDNYNKLFILLSHNPISIPAQAYLHFLEKIDTPLDSKLRSLLLKRLLY
FT                   HQQYETCWRICIDTYTSLTDIEDFIDLAAVSLRENNNSTFGLNSLLVASHSQVFNQRLH
FT                   NHILDTLSFKFKIPRPDLEHKLSFYDELQTMQTLEDLALFRENNGSYMSNDVDYEVMYL
FT                   RKHISLIRSDTSIKVSDCYGLLHERENLVRMPGWLSFISPSFLGSTTLNNAVGSLVSTP
FT                   SISTKIVESINHILRTNKHIGLNEADVVYILNSQANIKAYNIYSLYIASNPSLPNKRIV
FT                   NLLMAQVILQLHYVQIRSILFRHYQVLDDDVLVEALVRVLGESTKDFEEIIGKLFKNST
FT                   FSQSLTISTTIVDLAVNSGYSVSQIERMLLIFHGFDKSGKLLGNLLKSETLSSYSEQQH
FT                   IELYSKLIMAPEISSTKTLLELNRCILRRGLIEETLISGILERVLNSTLRKDFILARAR
FT                   DSKRKLPQGFQRIHMLANVSERANFHNSLRALGQTYSLLGAKDMARVVDITSNYIFSRH
FT                   FTFCRDKFGRDYLINNVVSEMMRFVERESRTKPKETIFKVRDLLTELKSDSKVIRCHLF
FT                   RMMVREDPSKAIQLLQFYSDNKSSLAGIIPYMISGILSTEKLEKNRKLQVLDRFLSELV
FT                   VLGYRHRITQKTGHELVRLLKQDSVSGKALTPQSVSWILEFSRNNKALNRVLQVHFRRD
FT                   KKNTL"
FT   gene            complement(<701469..>701994)
FT                   /gene="YOX2"
FT                   /locus_tag="PICST_33461"
FT   mRNA            complement(join(<701469..701507,701562..701907,
FT                   701969..>701994))
FT                   /gene="YOX2"
FT                   /locus_tag="PICST_33461"
FT                   /product="Homeodomain protein"
FT                   /note="binds leu-tRNA gene; acts as a repressor at early
FT                   cell cycle boxes (ECBs) to restrict their activity to the
FT                   M/G1 phase of the cell cycle"
FT   CDS_pept        complement(join(701469..701507,701562..701907,
FT                   701969..701994))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="YOX2"
FT                   /locus_tag="PICST_33461"
FT                   /product="Homeodomain protein"
FT                   /note="Homeobox; Homeodomain protein that binds leu-tRNA
FT                   gene. acts as a repressor at early cell cycle boxes (ECBs)
FT                   to restrict their activity to the M/G1 phase of the cell
FT                   cycle.; go_component nucleus; go_function DNA binding;
FT                   transcription factor activity; go_component nucleus;
FT                   go_function DNA binding; transcription factor activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33461"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68299"
FT                   /db_xref="GOA:A3LZ95"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ95"
FT                   /protein_id="ABN68299.2"
FT                   /translation="MLRDGECFRYLDSSAVLKYSIQNLFDNAVEKASEKKRTFLDHDAQ
FT                   PQEFHLRSVMISITCSTNLSSKVALGDKALVRKRRRKIHSPEIRAILEKEFSLDPSPSR
FT                   AHRKSIAVRCNMSTSEVRIWFANRRNRFKRYQ"
FT   gene            complement(<702293..>702973)
FT                   /gene="MATa2"
FT                   /locus_tag="PICST_33462"
FT   mRNA            complement(join(<702293..702628,702680..>702973))
FT                   /gene="MATa2"
FT                   /locus_tag="PICST_33462"
FT                   /product="mating locus regulatory protein"
FT   CDS_pept        complement(join(702293..702628,702680..702973))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MATa2"
FT                   /locus_tag="PICST_33462"
FT                   /product="mating locus regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33462"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68300"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ96"
FT                   /protein_id="ABN68300.2"
FT                   /translation="MSSSFSFSFPKVNRGTSTGSSVKQLACASSFPLVSTNSSKRDSDF
FT                   LTHENPSSLLKKSRSRNDTFRSRNSFIVARNIITNLMPSDLKTFRDLAKTVSSIWKKSP
FT                   RQFQEYFQYLSLVEASWYEKSTGTIRSAPPAFKHSEYRQLCRSSYYTKSKRDSAPKQSA
FT                   DSFKDKFRVTKVKRERNKGRSQTGAFKIKTSSVNCSLGIFTEDMYK"
FT   gene            <703131..704882
FT                   /gene="PAP1"
FT                   /locus_tag="PICST_85400"
FT   mRNA            <703131..704882
FT                   /gene="PAP1"
FT                   /locus_tag="PICST_85400"
FT                   /product="Poly(A) polymerase PAPalpha (Polynucleotide
FT                   adenylyltransferase alpha)"
FT                   /note="Has EST support"
FT   CDS_pept        703131..704801
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PAP1"
FT                   /locus_tag="PICST_85400"
FT                   /product="Poly(A) polymerase PAPalpha (Polynucleotide
FT                   adenylyltransferase alpha)"
FT                   /EC_number="2.7.7.19"
FT                   /note="go_function nucleotidyltransferase activity;
FT                   polynucleotide adenylyltransferase activity; go_process
FT                   transcription"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85400"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68119"
FT                   /db_xref="GOA:A3LZ97"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR007010"
FT                   /db_xref="InterPro:IPR007012"
FT                   /db_xref="InterPro:IPR011068"
FT                   /db_xref="InterPro:IPR014492"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ97"
FT                   /protein_id="ABN68119.1"
FT                   /translation="MSVRTYGVTDPISTANPTPKENSLNDALIGELRSRGSFESEQATK
FT                   KRVEVLTQFQKMVQEFVFTVSKKKNMSDGMAKDAGGKVFTFGSYRLGVYGPGSDLDTLV
FT                   VVPQHVSREDFFTVFAEIIRKRPELEEIVPVPDAFVPIIKIEYDGVPLDLIFACLNVPR
FT                   IPLDMTLDDKNLLRNLDERDLRSLNGTRVTDEILQLVPKPTVFKHALRCIKMWAQQKAV
FT                   YGNVFGFPGGVAWAMLVARICQLYPNAVSAVIVEKFFNIYTKWNWPQPVLLKPIEDGPL
FT                   QVRVWNPRLYANDRLHRMPVITPAYPSMCATHNITSSTQKVILSELEKGAEVVRQINLG
FT                   KKSWSDLFDRHDFFHHYKFYLCVVAATVASDEEHLKWTGLIESKLRHLVLKLEVTEGVE
FT                   LAHPYVKDFSDSYVLGDANPSDVIGAYGTLSGQPFLDTLAKSDDSNKGEKQIHLTKLFV
FT                   GLNLQQLKSVDGVKKLNIQYPCSEFYNICKGSGFYDEAINHINIKNVKLVDLPDDVYVE
FT                   GEVRPTKNSKKRKKEVSLDKQKRPKSTISTPPVSVNGSG"
FT   gene            complement(<705685..>708600)
FT                   /gene="PIK1"
FT                   /locus_tag="PICST_49430"
FT   mRNA            complement(<705685..>708600)
FT                   /gene="PIK1"
FT                   /locus_tag="PICST_49430"
FT                   /product="Phosphatidylinositol 4-kinase PIK1alpha
FT                   (PI4-kinase)(PtdIns-4-kinase)"
FT   CDS_pept        complement(705685..708600)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PIK1"
FT                   /locus_tag="PICST_49430"
FT                   /product="Phosphatidylinositol 4-kinase PIK1alpha
FT                   (PI4-kinase)(PtdIns-4-kinase)"
FT                   /EC_number="2.7.1.67"
FT                   /note="catalyzes first step in the biosynthesis of
FT                   phosphatidylinositol-4,5-biphosphate may control
FT                   cytokineses through the actin cytoskeleton; go_function
FT                   phosphotransferase activity, alcohol group as acceptor"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49430"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68301"
FT                   /db_xref="GOA:A3LZ98"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR021601"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="InterPro:IPR042236"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ98"
FT                   /protein_id="ABN68301.2"
FT                   /translation="MSLKENELLLEKIRSSDFTALDCIDNLRGYRESIGIQHTLVQKLR
FT                   SYSYDELEFYIPQFVQLLVAFETDSMALEEFLLEYCSKYPHYSMVVFWNLQSCVFELRN
FT                   DPESYSFQVVRNFINKLQNILFNNEELMKKPEFRENFQPAIILCGVIASAIGAPRFNDY
FT                   ASSLVRSQAKQQKSFVFKLANFQKTLTKNLTMKNKRLSSETATETMSDDEARKVGGKLS
FT                   HGHQRSASVPRMQPKKNSLTISSDESEYYTSDEESEFRSSTHIENEMSKLGMRSENRHR
FT                   SYIEVEENLKINTVITPKRKNRARQLTLDSLSTKYEGTDAYVSHSLPDLSRVHEADSQP
FT                   YLSPAESESSLNFPHSSIEQGLKRNLSLHSTVQTPSYNQLLKVLQINYAKKETEFIMAL
FT                   QNISLRLSSVPKEARLSALRAELSIINETLLPSEIDIPQLLPITSSKNKRYHKILKLSI
FT                   NEACVLNSAERVPFLLLVEYLSDEFDFNPFTDANQKIIANRNNHEETSKSSHDLLNEMI
FT                   EGSQSGLKSPVSVRASTENTEDSLVYVEEEETDLGELPMLTVKSDRSFVIQSDIERSPK
FT                   TEQDKKLSSFPSNTNADTTKLLADQMRIASVMLQQLESSGQASSEQSSAIKSRIVESMI
FT                   SLQDQFDTINYERLNLLKGDLPDAGERKLENDFKLGEDWNTKKERIRKSSVYGHLDNWE
FT                   LCSVIAKNGDDLPQEAFACQLISLITSIWKRQGVKDAWTKRMKILITSANTGLVETINN
FT                   AMSIHSIKKSMTEISINDGENTKGRIFTLQDYFENMFGSPTSQKYKRAQNNFARSLASY
FT                   SIICYVLQIKDRHNGNIMLDNDGHIIHIDFGFLLSNSPGSVGFEAAPFKLTSEYVNLLG
FT                   GNESAPYLSFVDMCKKCFNALRKEHRQIVNLVELMQKDSTLPCFKNGENTSVLLEQRLQ
FT                   LQLSEEESEAFVENTLIGRSYGSMYTRLYDQFQMITQGIYS"
FT   gene            complement(<708822..710205)
FT                   /gene="OSH6"
FT                   /locus_tag="PICST_90914"
FT   mRNA            complement(<708822..710205)
FT                   /gene="OSH6"
FT                   /locus_tag="PICST_90914"
FT                   /product="Oxysterol binding protein-like protein OBPa"
FT                   /note="Has EST support"
FT   CDS_pept        complement(708913..710205)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="OSH6"
FT                   /locus_tag="PICST_90914"
FT                   /product="Oxysterol binding protein-like protein OBPa"
FT                   /note="go_process steroid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90914"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68302"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="InterPro:IPR037239"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZ99"
FT                   /protein_id="ABN68302.2"
FT                   /translation="MGLTSKLDKLKLISSGGGDEPVGKSSQSGPENTDDIDEVDNEGQS
FT                   ILMGIIAQLRPGMDLSKITLPTFILEKKSMLERITNFFQIPQILLEANATTDDLERFVL
FT                   IVKWYLASWHIAPKAVKKPLNPVLGETFACYWDDLPGNESAFYLSEQTSHHPPKSSYFY
FT                   LVPEQKIRVDGVVIPKSRFLGNSSAAIMEGWGHVTLGNHDDELYIMNQPNVYVRGILFG
FT                   KMKTELGDHMYIKCPKTGYEADIEFKTKGFISGTYDAIEGVIKNTKKSETLFEISGKWN
FT                   EVMEIKNIKTNKKEVFYDTKKTVTHRPKVRPLEEQWDYESRKLWKPTIDALSRRDHETA
FT                   TEEKYKVENEQRTLAKKRIEDGVEFHPKFFRPVKDSETDQLDLEYLIYKKFDLKDDSET
FT                   LKKHLFEISPFLPGQVADEKYHIPAFKKHKE"
FT   gene            complement(<711199..>712938)
FT                   /gene="GAP1.4"
FT                   /locus_tag="PICST_37009"
FT   mRNA            complement(<711199..>712938)
FT                   /gene="GAP1.4"
FT                   /locus_tag="PICST_37009"
FT                   /product="general amino acid permease"
FT   CDS_pept        complement(711199..712938)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="GAP1.4"
FT                   /locus_tag="PICST_37009"
FT                   /product="general amino acid permease"
FT                   /note="go_component membrane; go_process transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_37009"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68303"
FT                   /db_xref="GOA:A3LZA0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZA0"
FT                   /protein_id="ABN68303.2"
FT                   /translation="MKDKASSEKYSTESDHSNEGVVPTQPTNTQSSRWTGFKDSFKRVE
FT                   IDNQTTYDLNDIERANAATSQGDLHRRLENKHIQMIALGGAVGTGLLIGSGGSLRTGGP
FT                   AALLIAWGLVGTMVFCIIHALGELCVAFPVNGAFSTYATRFVDSSWGFAVGWNYALMWL
FT                   IVMPLELVAAAMCISYWNSSINPVAWVAIFYVLIMGINLFGVRGYGEAEFYLTIVKVIA
FT                   IVGFVILGVVLVCGGGPSKQFIGAKYWNEPGAFAHGFKGVATTFITASYSLAGSEMVGL
FT                   TSAEVDNPRKVLPKAVKQVFWRLFLFYFLSLTFVGLLVPYNSPDLLGSGGTSTSPFVIA
FT                   IKNGGIHTLPSIFNAVILISVISVGNSAVYGCSRTIQSLGAQGLGPEILGYVDRKGRPL
FT                   AGIAFSGVFGLLCFLSAYKNKDEVFGWLLSVSGLATIFSWFNIGLCHIRFRMALRAQGM
FT                   STDELMFTSIAGVWGSIYSMVLLIVVLGVQFWTALFPIGSNGKPNAKNFFQNYLGSIVI
FT                   LIFYCGHKLWTRNWRFYVSLKDIDLITGRRDVDLDVIRAEIEDEKRVNKTKPFYIRVWN
FT                   YWC"
FT   gene            <715625..>715930
FT                   /locus_tag="PICST_49658"
FT   mRNA            <715625..>715930
FT                   /locus_tag="PICST_49658"
FT                   /product="predicted protein"
FT   CDS_pept        <715625..715930
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49658"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49658"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68120"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZA1"
FT                   /protein_id="ABN68120.2"
FT                   /translation="DKFTFPRTQSDFIEAMVHGTVHNVQPDKINKVYVDSGSKILAMGA
FT                   VWDYLQIKTEELDLDFDSLDITEVMNRLRGHEKCHGYGPAYPLDLVNQALSDVLDL"
FT   gene            <717141..>718355
FT                   /locus_tag="PICST_63418"
FT   mRNA            <717141..>718355
FT                   /locus_tag="PICST_63418"
FT                   /product="predicted protein"
FT   CDS_pept        717141..718355
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63418"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63418"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68121"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR041243"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZA2"
FT                   /protein_id="ABN68121.1"
FT                   /translation="MGIDLNMPDMPEPPAASSASASEDASASAATDSAPKAEEPKAKEV
FT                   PKPTEEPKTKEEPKAEEPEDVTMAEPEENTKELADKAKAEGNALYKQRKFDEAIAAYNR
FT                   AWDTHKDITYLNNRAAAEFEKGDYDETIKTCNEAIEQGREVRADYKIIAKSFARLGNAY
FT                   LKKEDLENAVKYFDKSLTEHRTPDVLNKLRATQREIKIREANSYVDPEKAEAARLEGKE
FT                   YFTKGDWPNAVKAYTEMVKRAPEDARGYSNRAAALAKLLSFPDAVEDCNKAIEKDPSFI
FT                   RAYIRKANAQLAMREYAQVMETLNVAREKDLALGEGKNVSEIDQLFNKAASQRFQAIEG
FT                   ETAEQTMERVSRDPEIVSILQDPVMQGILGQARENPAALQDHMKNPEVSKKINMLIAAG
FT                   VIRTR"
FT   gene            complement(<718579..>721659)
FT                   /gene="HAL9"
FT                   /locus_tag="PICST_1028"
FT   mRNA            complement(join(<718579..718774,719060..719971,
FT                   720008..721224,721381..>721659))
FT                   /gene="HAL9"
FT                   /locus_tag="PICST_1028"
FT                   /product="Fungal Zn2Cys6 Cluster domain"
FT   CDS_pept        complement(join(<718579..718774,719060..719971,
FT                   720008..721224,721381..>721659))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="HAL9"
FT                   /locus_tag="PICST_1028"
FT                   /product="Fungal Zn2Cys6 Cluster domain"
FT                   /note="2nd gene in HAL9 repeat unit, weak similarity to
FT                   HAL9 factor involved in salt tolerance; go_component
FT                   nucleus; go_function transcription factor activity; zinc
FT                   ion binding; DNA binding; go_process regulation of
FT                   transcription, DNA-dependent; transcription"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_1028"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68304"
FT                   /db_xref="GOA:A3LZA3"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZA3"
FT                   /protein_id="ABN68304.2"
FT                   /translation="KKRIRVACDHCRRKKIKCDGNLPCGNCSSAKERNCHYKERPVKKK
FT                   MKPLKSGDKKDGLKRNSKTRTIEVLDTRLSTLENVIIRLTDKLEDITRNNTVDEQENDL
FT                   DRTTSETEDEDDDDDEEDDEEEEDDEHEHARDSSQHNLKESSSKSKAEPISSSKDSSTA
FT                   ASTQSSSSKTKILLNNRTLEQYFGIHSMMCIFSDKSLAWIERTLGTEGEDLITPIKNVP
FT                   IVFYSKFKTFMLKWIDPPLIDSKGRRRLLENPFPENSKLVFDFIDTHYKDVNDINSLCE
FT                   QSEMRGYFEEYYNNFREPNHSKRKKFKLSEYLIMTAGLLLCISSRINLESAPSLKSTPV
FT                   GKEQTQSSEISLSDDELLSWQNTLFDDAIYYYHRVSVISDGITTIEGILLLIMYIEMDW
FT                   LTSHVNYMLSSVAIRYAQEIGLHRAETYEDLEFEEQHKRRKIWMFCHYFDMEICFRGGK
FT                   PPLINANDVTANNDEDLMRFCMLKMKHKVNDKQLMNIDVNIADDPLTYHLYFLLLTRIR
FT                   SKSYTKLFVASVENETIQKVADTLNDLNNEMFELASSMHEADRPRFFNDPEFSFIPDTM
FT                   PYYRRETVIAVQITFFFHLMVMNRLPTMVNAEELDNSSSMKFRNLHLDSARTILVLVRQ
FT                   LNRENTGVSYYYWILFFPVSAFLCLAAAILNHPNLPESYSDLKLLIDCSMNFFSSKKNS
FT                   HVEGKSRFKIYSKKDLVVSLIIKLMLKIVIKFYEQTTKISVLNGDEKLQRHLDSAKKMF
FT                   PDIFKDRAEFNSKVSSVFGFSPFTNSQNFSASNSMSGSNSSHAGAPGRTVSMESAPLFD
FT                   NSINGDNSINGDLNANFINNGSDMFPESHNDDGISSLFYTQMNSLPNFFFDNNLGI"
FT   gene            complement(<723959..>726199)
FT                   /locus_tag="PICST_15419"
FT   mRNA            complement(join(<723959..725735,725790..725886,
FT                   725911..726073,726095..>726199))
FT                   /locus_tag="PICST_15419"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<723959..725735,725790..725886,
FT                   725911..726073,726095..>726199))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_15419"
FT                   /product="fungal Zn(2)-Cys(6) binuclear cluster"
FT                   /note="go_component nucleus; go_function transcription
FT                   factor activity; zinc ion binding; DNA binding; go_process
FT                   regulation of transcription, DNA-dependent; transcription"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_15419"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68305"
FT                   /db_xref="GOA:A3LZA4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZA4"
FT                   /protein_id="ABN68305.2"
FT                   /translation="RTKTACDYCRKRKSKCNGENPCSNCLTHSKDCTYTKRVSKSSSNS
FT                   KDKKHNPNSIQGLNSRLSTLEGLLSKLVKRLDSKSLLDLGNSRSDTVSLNSLPSESNSE
FT                   DEQEEEDFSKELVLNEKSSCQIVTSARDRILQYFGSHSMFCIFSAKSIKWMKGRIEGKG
FT                   DDSLLLPIRNLPYALNSVVQSNMKVWAQSLPTSPSNSKFFFNKNEKNLIFELLEYYYDD
FT                   INIAPYLCSLHTIRELFQLYFYALSSHDVDILNGISQSEFLIMNVSIALCLTNKSGDVK
FT                   DNHNFPALSAASSSDLAQFKQKMFSNAVACYERVSVVCEGIRTIQGIALVTLYIEASFI
FT                   TDFQINHMLVSVMVRFACDLGLHSTVSVSKYDAEEHAHLKRRLWWFCEYMDSEVCYRSG
FT                   KATLINRANVTILTEEDDYFLSVPLDPFKNDVCKKNSSELVANCRKWGYQNYYIYYTLM
FT                   LCRLKEKSYNNLFKPQVAHQSQEELLKSLQDINEDMFRMARLMEPEIRPTLYYVKRPES
FT                   PSRSCFAELSESNNNFFQYSSLLLQLSFFAHLLSINRVPFMNNMFESNEKTIKFGNLSL
FT                   ESARTILHLVVDLDRTKVPNSILNWVTFYPFMAYCSLIGHCLSFPQENSTHMDCTLLIR
FT                   VSLNFFAYRGLNEEDIRTFGESKTYDNKSMMYDLITRLLLRVLVNLMDKESEHHYANEI
FT                   KGLSDHMEACANIYPDLFKK"
FT   gene            727596..730055
FT                   /locus_tag="PICST_73563"
FT   mRNA            727596..730055
FT                   /locus_tag="PICST_73563"
FT                   /product="predicted protein"
FT   CDS_pept        727619..729967
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_73563"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73563"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68122"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR021183"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZA5"
FT                   /protein_id="ABN68122.2"
FT                   /translation="MVAKKGNPIFANKEDGNFREALKLYDAKQYKKALKLVETNLKKNS
FT                   NHAESLALKGCINHNIGNKSEAESYVLKAIQKAPANYLVNHLAGIYYRSVENYVEASKW
FT                   LKAANDNGSPNKPILRDLSLMQTQIRDYKNLKDSRQQYLEFQPGYRANWTGVAIAHHLN
FT                   KDYAAAVSTLTKIEGIIKEHLTDADRYEQSECVLYKVDIIAKSGDIAKALATLEEDSSE
FT                   IKDRLSFLEYKARFLMLLDKKHEASLIYRQLLQRNPDNMQYYNLLELSLGTVGNSVDLR
FT                   LKLYEKLDSFYPRSDPPKFLPLTFTPSSHARFEEKVRSYLVPQLKRGIPATFVNVKPLY
FT                   KNHKKLKVIEKVVLDFYAAELPKIDNPTVFVWTNYFLAQHYLYLNELDTANKYIDDALK
FT                   HSPTLVELYTIKARIVKHQGKFEEAADIMNAGRELDLQDRFINSKATKYYFRANKVDEA
FT                   IDCISLFTKLEDGVINGCKDLHVMQVNWVLVESAEAYKRLYHEYEAKLKEFKESSPLES
FT                   EESKELENELVENIETYKGLALKRYNAVLKIFKIYYNDQYDFHSYCMRRGTPRDYIDTL
FT                   EWEDRIHSTPIYTRVLKGMAEIYFEIYNEQQVKQSSESPSIEEGKTTKKQNNKKNKKKS
FT                   QINKKKADFIARVESEKDDEDPLGAKLLSDLTNDDQIIDKLFQLYKPLIEEGKDLRLTH
FT                   EVLYKTYLIEGKYVLALQSVKSLNKVLGGSSDVKLRSIGERVVELSETAQNDKNANAAI
FT                   VKVVGKGLVSAFPEFGELSKEDFLNVYSK"
FT   gene            complement(<730106..>730741)
FT                   /locus_tag="PICST_49572"
FT   mRNA            complement(<730106..>730741)
FT                   /locus_tag="PICST_49572"
FT                   /product="predicted protein"
FT   CDS_pept        complement(730106..730741)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49572"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49572"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68306"
FT                   /db_xref="GOA:A3LZA6"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="InterPro:IPR011691"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZA6"
FT                   /protein_id="ABN68306.2"
FT                   /translation="MSFFKAFRSQNSSNYSPLSQQDGSSLPPPVTQPSSNSFSARLSKL
FT                   NPFRGDSVYLEDDENYVTSEPGYFELSKWDRMLIFALTFAGSVCCYLICIFLFPVLTLK
FT                   PRKFAILWSLGSIFFIVSFGVLQGFKPYMEHLFSSTRIPFTIAFVTSIVMTLVSALKLK
FT                   SIILSLIFSVIQLIAAIWYTVSYFPMGRQTLNLAGTVARSQVDTWINS"
FT   gene            <731201..>731848
FT                   /locus_tag="PICST_33473"
FT   mRNA            <731201..>731848
FT                   /locus_tag="PICST_33473"
FT                   /product="predicted protein"
FT   CDS_pept        731201..731848
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33473"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33473"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68123"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZA7"
FT                   /protein_id="ABN68123.1"
FT                   /translation="MSVVTIQEDKQFVQTYIQLIGLSENAPLDKFNSTTDYNKLESLGP
FT                   SLPRFKVPFPVASSGAISEQTISLKFKSIKPPFRFTVDSSAVPTSSTIFKIKTDLIESV
FT                   PILKEAGVTPANLKLMLKSKVVHDSSALSSLPNVESEVTFNVMVSAPDASKTVPVAEPV
FT                   TAPVVETVADTKEINPLQITESTWNKISDILKEDLGEERGGQALDKLKTNWK"
FT   gene            complement(<732040..>732195)
FT                   /locus_tag="PICST_63528"
FT   mRNA            complement(<732040..>732195)
FT                   /locus_tag="PICST_63528"
FT                   /product="predicted protein"
FT   CDS_pept        complement(732040..732195)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63528"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63528"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68307"
FT                   /db_xref="GOA:A3LZA8"
FT                   /db_xref="InterPro:IPR024242"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZA8"
FT                   /protein_id="ABN68307.2"
FT                   /translation="MQYPYLISRTIDPIFAISIGVASYYLHERRVGRPEGRTLNELVAK
FT                   KFFKSS"
FT   gene            complement(<734130..>735503)
FT                   /locus_tag="PICST_63274"
FT   mRNA            complement(join(<734130..734329,734354..>735503))
FT                   /locus_tag="PICST_63274"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(734130..734329,734354..735503))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63274"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63274"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68308"
FT                   /db_xref="GOA:A3LZA9"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZA9"
FT                   /protein_id="ABN68308.2"
FT                   /translation="MTIPKEIPLFLFTYNCNKRELNHDLFIQKVVESFPTDLAALYVFG
FT                   LEELCPILDGSFHDIAHKHMIRFNEVFLHSLRKKYGHNDHRFQTIAMHHIGATGLIVIT
FT                   PFPSKFHSIKKAQSSCGSGYSSLKGAAGVRLTYAPDGKYANDNSVQLTFANAHLSAYEG
FT                   EFYYRRRNDNVTTIMRSLDFGDGYGLLKDGSHTFFMGDLNYRTTKNFDPTSDANKRLIS
FT                   LSDQSLVTNESVEELVKDCDELTWAIENGQIFTGFTEACIDFQPTYKYHVNTAVYNSKR
FT                   SPSWCDRILYQMTYEDSDDEDQVVMLRLRKDSNSQNKRKRLPIIHEYNSIKSLLQSDHQ
FT                   PVFLHITVPFTAPKSIVSSSGYLQILPNENANRHLHHNEVNVDDADEPIGGPTQIYMRP
FT                   TKYDYIIQNYVRLVPDFLIGYGLWFTITRTGRLILLVLALVLGGAYRYLV"
FT   gene            <735541..>737679
FT                   /locus_tag="PICST_33476"
FT   mRNA            join(<735541..735565,735894..735895,736114..>737679)
FT                   /locus_tag="PICST_33476"
FT                   /product="predicted protein"
FT   CDS_pept        join(735541..735565,735894..735895,736114..737679)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33476"
FT                   /product="predicted protein"
FT                   /note="go_component nucleus; go_function nucleic acid
FT                   binding; zinc ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33476"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68124"
FT                   /db_xref="GOA:A3LZB0"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="InterPro:IPR024598"
FT                   /db_xref="InterPro:IPR031590"
FT                   /db_xref="InterPro:IPR031774"
FT                   /db_xref="InterPro:IPR031776"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZB0"
FT                   /protein_id="ABN68124.2"
FT                   /translation="MEMLQRNVARSILEELDVIELESSRRFRKDPLLYPQNENKEKLQI
FT                   VRTKRPQKEVKLQQHELAVFQQKYKKHCNSLRNHTANDSDIIQSILGTLDDSKATFSNF
FT                   DSALAQIQEKHNKTNNGEIEVAESIRNMYTMFSSILFSGEESVLLDDDIKRVRKEGKEK
FT                   TKVKRKHIISITASHLDPDGIYSTEEVYGKYLDLTKFHEIYRNQTSSNVSYLEYLKVFD
FT                   IFPYAESFRSSSIYLQYLRDLSEYLVDFVSRTEPLQNFNEVFESIKKSYSPKEEPATRD
FT                   GVENESGEVYCSVCQKVFAKISVYQGHLNGKKHKKNAKELQTATPKESIISESDLQEHI
FT                   NTELGKFLSNYKEATIQNTERKSAMTERERLIENTTIVGDESDYTTVYDSSSDSGNDSS
FT                   DEEENENLKHLPLGADGKPIPFWLYKLQGLHKTYNCEICGNVTYKGRVTFEKHFSAPKH
FT                   QYGLKCLGITEQFVSYFKDIISINEAQDLWKRLKRDKRIKEGDIENAVEVEDAEGNVMS
FT                   EKDYLDLKKQGLL"
FT   gene            <737974..>739731
FT                   /gene="RIB2"
FT                   /locus_tag="PICST_33477"
FT   mRNA            <737974..>739731
FT                   /gene="RIB2"
FT                   /locus_tag="PICST_33477"
FT                   /product="DRAP deaminase"
FT                   /note="Has EST support"
FT   CDS_pept        737974..739731
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RIB2"
FT                   /locus_tag="PICST_33477"
FT                   /product="DRAP deaminase"
FT                   /EC_number="4.2.1.70"
FT                   /note="N-terminal part related to RNA:pseudouridine
FT                   (psi)-synthases C-terminal portion contains the deaminase
FT                   domain implicated in Riboflavin synthesis; go_function zinc
FT                   ion binding; hydrolase activity; RNA binding; pseudouridine
FT                   synthase activity; go_process RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33477"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68125"
FT                   /db_xref="GOA:A3LZB1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZB1"
FT                   /protein_id="ABN68125.1"
FT                   /translation="MSERVEVSQDKGVKRPASPSPAAQDSKLRDSQGFRMKRQVIDKVT
FT                   LTAYEQLGGEDASDSTIQQGKTIEEEEAEGASYIIDGRLRRVHPYYFTYLTYCKMRWRD
FT                   RKLLDIFVDEFRDRSAEYYKKAIDAGQVTLNKKPANLDSIVRNGDLISHRTYRKEPPVS
FT                   SREIKIVYEDDDLIAIDKPSGIPVHPTGRYRYNTITKIFQHEMGKVVHPCNRLDRLTSG
FT                   LMFLGKTAKGADKLVKQIRERSVRKEYIARVKGEFPLEEVEVDQPMRTIAHKLGLNRID
FT                   LKEGKDAKTAFKRVSYDPEHDTSIVKCIPLTGRTHQIRVHLQYLGHPIANDPIYSNKFV
FT                   WGNNLGKDNEGDSNEIIQRLDRIGKDKAASSWAHPEEDGELITDEIDEISGMPVYSDPG
FT                   PNDLDLWLHAYKYEAADKSWSYKTEYPEWAIGPHRKFMELSLEMANKCDETQTQYNVGA
FT                   VLVNRGKVLATGHSRELPGNTHAEQCALEKYFEETGKREIPKGTEIYTTMEPCTLRLSG
FT                   NIPCADRIIGTTIKTCFVGIVEPDTFVKNNSCSAKFAENGIEYIHIPGYEEECLKIATK
FT                   GHEKLSKDS"
FT   gene            complement(<739954..>741537)
FT                   /locus_tag="PICST_49923"
FT   mRNA            complement(<739954..>741537)
FT                   /locus_tag="PICST_49923"
FT                   /product="predicted protein"
FT   CDS_pept        complement(739954..741537)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49923"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49923"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68309"
FT                   /db_xref="GOA:A3LZB2"
FT                   /db_xref="InterPro:IPR014844"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZB2"
FT                   /protein_id="ABN68309.2"
FT                   /translation="MYWRNAWWHEKMFPSCENILLPEGMLVSHNLEATVHHISKAIYKQ
FT                   VCYEGRTPMMDTNAGVVIDKFTQPLPIVSQSWHEFTTENLNGSFAYSVVSIIYAIAVSA
FT                   VITWFLTIFVLTNYTIKPSVLLQASTSLSSVYILVIVIKSIVILHQQQRNGYLHGAKLL
FT                   DQINGSTAVNVFDLIVVLLLQINQVQVIMRIFSRQGDKRMTFFVGVLASIASQVIWGVT
FT                   KFHNFSPKDEAGDILPAFIYLVRIAMGICYAAIISVFLLTKIHYILANKKIWLLSLLTF
FT                   ILIFSPVAFFIADVSNAFVYELSEIFSVVTYVICVVIPWEWCNKFNLIMRAKEKEGVLG
FT                   RRFYEDELYEVDRAQLFIEEDEEDENNDDQHNDTNSNDLGSNSSNALGKSASASAGGKE
FT                   NYTDEELTNAKKVLLTLSKTKRAFLTLTDGIIAAGFAIPRSVSVTTASTDTPRPRNPNL
FT                   DESTPHFNNLRFRDAEEANPARDYHETGPQETDPQETETNTVPAGSRNRRNVYVYSRKE
FT                   VVINFSDDDD"
FT   gene            743165..745187
FT                   /locus_tag="PICST_85313"
FT   mRNA            743165..745187
FT                   /locus_tag="PICST_85313"
FT                   /product="predicted protein"
FT   CDS_pept        743189..745165
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85313"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85313"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68126"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZB3"
FT                   /protein_id="ABN68126.2"
FT                   /translation="MATDPDIVISMPALSYPKARAKENGKHIQNDIHNEDNDNEQDNNR
FT                   DNNNNNNTNDNSIDDINNSNDDFNNSNNDNSIDDDDESTTPSSPPRRRLSYLDPSTPSR
FT                   HLRTPSSYSHNYSLLDIYDSPSSERSSMAPLATGGLIDTSIMKGLDDLEFKELSNDTTI
FT                   FARHTIDSFPELDISDQESESYVQPTDQDTIDRILASPYDRYGFKKTSTHHNISLEDYN
FT                   KWFSEYAQDAIRRKKKWNLLMKSNGLQLDSAQAIPTRFPPKSDKVKKMIRQGIPAEWRG
FT                   SAWFFYAGGYDKLNKHVGVYSKIVRDTKDIQNKDTEVIERDLNRTFPDNIYFNSHIGTD
FT                   ANTSVTTLGTENSRSSETAMVKTLRRVLVAFAHYQPQIGYCQSLNFLAGLLLLFMEEER
FT                   AFWMLVILTERIIPKVHSANLEGVHTDQGVLMLCVKEYIPQLWAILGKNFEGESLSEDK
FT                   ILTRLPPVTLVTSSWFMSVFVGNLPIETTLRVWDILWYEGSKTIFRISLTICKMCLEDP
FT                   EFQNSRSSKGSGEMDQIELFQFMQNYPKTILEPNVLIDNCFKKIGGYGFGSLSQDEINK
FT                   CREFVSKQRAKLNYKKSNITAEMTEEERQALISSSDSTFGAEDQSIHDVYGFHRSIMSG
FT                   VVWNKSISNKMKRRFVRRTSSRS"
FT   gene            complement(<745779..748370)
FT                   /locus_tag="PICST_66087"
FT   mRNA            complement(<745779..748370)
FT                   /locus_tag="PICST_66087"
FT                   /product="predicted protein"
FT   CDS_pept        complement(745959..748370)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_66087"
FT                   /product="predicted protein"
FT                   /note="go_function dihydropteroate synthase activity;
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   diphosphokinase activity; dihydroneopterin aldolase
FT                   activity; go_process folic acid and derivative
FT                   biosynthesis; folic acid and derivative metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_66087"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68310"
FT                   /db_xref="GOA:A3LZB4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016261"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZB4"
FT                   /protein_id="ABN68310.2"
FT                   /translation="MLNDKVFAKDIAATAITGKDAWNRPSPQPITISVSLDTDFHQASV
FT                   TDNLKYSLNYAVISRNISEFMKANEHRNFKSLGNIAESVSEIVLDQKKGGGSKAEVVVK
FT                   SVKSEIRADSVEYRLSRSKTDSEPIPDEIAVRGLRLLTIIGVFTFERFQRQIVDIDLQL
FT                   KLHKESDVSIHEIIDDVVSYVESSNFKTVEALVMKIGQLIFQNHQKGVTSVFAKVTKPN
FT                   AISYTEGVGVSSLMTKASFEGVEPIPKSDGFSTHLHPSEKFNLPTAAEDAESQANEEHV
FT                   AYIAFGSNEGCQVENIQTALKLLEKYGVKVQSTSSLYISKPMYYLDQPDFYNGAVKVTF
FT                   KNKSPHDLLAILKKIEYEDINRKKEFDNGPRSIDLDIILYDDISVNHEDLIIPHKLMLE
FT                   RTFVLQPICELLPPDHIHPVSAEPIHNHLSQLLLSKPNESVQESSDLLQLIPVPRLDNK
FT                   DTILKFDQLKNSHSTLIMGIVNITPDSFSDGGVNFSKSVDEVLKTAKSLIGDGAHILDI
FT                   GGVSTRPGSKEPTEEEELRRVVPLVKAIRASSDKQLSSCLISVDTYRAKVAEECLKAGA
FT                   DIINDISMGLYEEAIFDVVAKYGCPYIMNHTRGTAATMSKLTNYESNTNDDIIEYLVDP
FT                   ILGHQELDLTPEVNNLINGVSRELSLQMLKAFDRGVRKWQIIVDPGIGFAKDLSQNLQL
FT                   IKHASLFKQYSVQVNVDISDSNHRNASNGIKHMYVSFNGLATLLGTSRKKFLGSIVNQP
FT                   EASKRMVATAASVIACIQQKTDIVRVHDVKDIKEAVLTGDAIYRDSYKKS"
FT   gene            complement(<748776..>750005)
FT                   /locus_tag="PICST_33482"
FT   mRNA            complement(<748776..>750005)
FT                   /locus_tag="PICST_33482"
FT                   /product="predicted protein"
FT   CDS_pept        complement(748776..750005)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33482"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33482"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68311"
FT                   /db_xref="InterPro:IPR028094"
FT                   /db_xref="InterPro:IPR039024"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZB5"
FT                   /protein_id="ABN68311.2"
FT                   /translation="MFESKRKYGSLKRNSSPNQGSRISPPENESPTRIATHSQQLFESR
FT                   PDHINVKTYKRRNTAKKPYIHISKKSDPILRTRDSSSFLDLEGETNSSIYSKYDNELRS
FT                   DSDIDDFDAGLIDLEDIGKTQNIQKSHDYSDEVEGLIQVVEDENTDRVPSVSDSFALKI
FT                   ANGNVLQVMKEHQESKTDAVIDKFKKYAFPSPIRSRKELMRRADKYFDVLPLILKGKQA
FT                   PSAYYLLAKNQANSSVHETLSATEKWQINWDKFCGGYYGFKRQSLIGNSISVKLAKELR
FT                   AAHRNKTVSYWTTSGFATHVLANEVIIRMAMEDLSCDFDSAERIVMESVEYGKVIADAT
FT                   EIEDDLQADELVSKQSKKFMKQIDIVSKVNEHMEEKEQEEEIPSAKSQGTRDFLDQLVD
FT                   SDSDSDPESE"
FT   gene            complement(750325..752627)
FT                   /locus_tag="PICST_66088"
FT   mRNA            complement(join(750325..751243,751340..752627))
FT                   /locus_tag="PICST_66088"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(750381..751243,751340..752321))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_66088"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_66088"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68312"
FT                   /db_xref="GOA:A3LZB6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZB6"
FT                   /protein_id="ABN68312.2"
FT                   /translation="MSSVEEFESILKELPTLKAPGVSGTRIKKLTELAVKNIDQESSLI
FT                   TLLYSNCKAAPSSHKLGTLYVVDSIVRAYLEEAKKQNQVVESSAPEGTFASGVFKISEL
FT                   IESLIDDALELSITQAQNIKISKLVDIWERAETFSHDIIVRIRQKHFTSTTPPGSPPRA
FT                   AGEIAKPTGEATSATAEKTDSTSILSALASLAKTSSPGSQNTQPAENKANTILSQLSAL
FT                   SAPQGASQPNFAPRPQQGQGGNEQLIFNMLQQMQQGGSGSAPPPNIPSIPQQPPRNDYG
FT                   SDRRRREQDNGYSRRNRSRSPPGNRYGGVRSPPRQHESMSYNRSGPGGDLNVPGTPHYR
FT                   PRNVGFDQSLPQGSFKVLSRTLFIGGVPRNMDDQALAHMLSPFAEVQSVILNSERKHAF
FT                   VKVYSRREAEQVIGQFNKDNAMPLRTRWGVGFGPRDCCNYQHGISIIPIQRLTDADKTW
FT                   VVNAQWGGTGGQPLSSGMVIDEPDIEIGAGISSKAMSKKMPTNSARNGPKSNRPGEPDE
FT                   EYAKTTLLPHQAGHMSHGAQPDFNTFTQSSVNPLSGLFANSESDSQSQSRPPQGFNQPS
FT                   QPQGQGFPDFLNNLQQQGGNPNLSATLANLFQQGGNQQ"
FT   gene            753092..754019
FT                   /locus_tag="PICST_79554"
FT   mRNA            753092..754019
FT                   /locus_tag="PICST_79554"
FT                   /product="predicted protein"
FT   CDS_pept        753110..753964
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_79554"
FT                   /product="60S ribosomal protein L17, mitochondrial
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_79554"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68127"
FT                   /db_xref="GOA:A3LZB7"
FT                   /db_xref="InterPro:IPR021757"
FT                   /db_xref="InterPro:IPR040008"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZB7"
FT                   /protein_id="ABN68127.2"
FT                   /translation="MKSVLGRSFTRAYATQSSTAPKISSTLLLSRNPVVTADLNPFQAQ
FT                   YYKYQNELWRRLMWTFPKWFYFRVGTISEQRFRQLNKDPVSNNPDIEFPRGRPEIRHQR
FT                   DRRFKQELRLPKTYKEEVEVDDAGEDTGAPGAPANDDLARKIVPNSRITKADEANDKTS
FT                   LERKLSRTLYLVIRNDNNKWALPNFGEKTEELQALHDLAEEGLYKIGGEHINYFNVSNT
FT                   PCHLYNNEVENKKEYFIKSHILSGEFEPQDKSLQYLWLTKEELKDHLNEDYYKDIAHLL
FT                   NDV"
FT   gene            complement(<754133..755437)
FT                   /locus_tag="PICST_85013"
FT   mRNA            complement(join(<754133..755079,755092..755437))
FT                   /locus_tag="PICST_85013"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(754202..755079,755092..755437))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85013"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85013"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68313"
FT                   /db_xref="GOA:A3LZB8"
FT                   /db_xref="InterPro:IPR012936"
FT                   /db_xref="InterPro:IPR039542"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZB8"
FT                   /protein_id="ABN68313.2"
FT                   /translation="MSGQRPKLLTFDAFAKTVEDARIRTTSGGIITLFCIFVVMFLIRN
FT                   EYSDYTSVITRPELVVDRDINKPLDIYLDVSFHNLPCDLLSLDIMDEAGDLQLDILKSG
FT                   FEKFRIVKDSEEEIIDRESTPINADLSIEEMAKGLKEGEDGECGSCYGALPQDKKQYCC
FT                   NDCETVKLAYAEKLWGFYDGENIEQCENEGYVQRVQSRINGKEGCRIKGNARINRISGT
FT                   MDFAPGASFTSSGHHVHDLSLYDKHPHLNFDHIVNKLTFGPIPDESVPTAESTHPLDNY
FT                   GVALNDKNHVFTYYLKVVATRFEFLNGASKALDANQFSVITHDRPISGGKDNDHQHTLH
FT                   AKGGIPGVVFHFDISPLKIINREQYAKSWSGFVLGVVSSVAGVLIVGSLLDRSVYAAES
FT                   AIKGKKNM"
FT   gene            <756084..>757109
FT                   /locus_tag="PICST_49400"
FT   mRNA            <756084..>757109
FT                   /locus_tag="PICST_49400"
FT                   /product="predicted protein"
FT   CDS_pept        756084..757109
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49400"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49400"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68128"
FT                   /db_xref="GOA:A3LZB9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040132"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZB9"
FT                   /protein_id="ABN68128.2"
FT                   /translation="MSKVISKTNRSFFNNLAPVQIKDKPLAGHTSSSSEIILISINNTG
FT                   TRLVTSRTDKSIRIWKCNPDRLSDPLIIEDAHTRPIESVAWNPKTEHSFVTVGRDTYVK
FT                   LWKGHTGSLERQIKVEKTLKQSDATMLIHVSYSPDGELLAVVDRDSTLFLYSVAQNYKK
FT                   VHETRLAEHVYEIQWFHEGHSYFICALHDGTLPIYKVTDVEDSDGDVHLELKTQLTGHR
FT                   SSATAVKIDPRGTYLAVGSSEGVISLWNTATMLNSKVITDVDESISSLGISRDGAYVAS
FT                   SYDNGSNIIIYDNEAGKKVYEVPNSMSGKMAFSCITWFPNKTSFAYTSDFGTTLTLMKK
FT                   P"
FT   gene            759108..>761793
FT                   /locus_tag="PICST_91075"
FT   mRNA            759108..>761793
FT                   /locus_tag="PICST_91075"
FT                   /product="predicted protein"
FT   CDS_pept        759307..761793
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_91075"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_91075"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68129"
FT                   /db_xref="GOA:A3LZC0"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR001331"
FT                   /db_xref="InterPro:IPR010481"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR033511"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZC0"
FT                   /protein_id="ABN68129.2"
FT                   /translation="MEVNSQPAPPFRSVSTTSNLSINSSSTSITRVASGPLIAMNQNFN
FT                   KLSSPSDHLYFQCQSLKQKLGRIHGMEPFLASAYSAAEQCAEQQALALSQQMAETSNGR
FT                   NDFRSSVGSSGFSIHSDHSNSSNSFAANKDKTSNNIFTFTAGILPANISVDPATLMWKL
FT                   FQQGAPLCLAFNAVVPGYQIPVVGSDDLRICKKSVYDFLFAVKSQLNFDDDMIFTISNV
FT                   FSDSTEDLLKIIKVVDSVLSVKKDNPHFSFELESSPSAVGEVIISNERSKVFKEIIDTE
FT                   RKYVTDLELLSRYKSELVNAELIPNEQIHSLFPNLNEIIDFHRRLLNGLECNINVPYKY
FT                   QRIGSIFIHAAAGPFKAYEPWTIGQMSAIDLIYKESSNLKKSSTLLDPGFELQSYIIKP
FT                   IQRLCKYPLLLKELIKASPESLDPSIPPSASFNEMIVARNAMKEMANQVNEAQRRAENV
FT                   EYLHQLVNRVSNWRGFNLRDQGELLHHGVVGVKDSDTEKEYVAYLFERIIFFFVETDKP
FT                   DQSKDKKKILSSRKKSSASSSTANLLESITKAKSLKSSPLELKGRVYISEIYNISAPSN
FT                   LGYSLVISWSGKKESGSFTLRYRTDEIRNQWETCLRNLKTTEMNSQIQRKLRDSSGSQD
FT                   SSIYDVTAYSTNNASPNNTLTGSNENGSSRSSNGSSYQRHHSSSSTFSMMRQSRSRSLG
FT                   GQDSSTRLSTSSGVPNYNSSNISTPITPSIEDFGNDIRIRLIYNTTEIPDWLIVSTTIQ
FT                   FNELYSKISGKIVTSEVVTDDILVNKLKYKDEDGDFVVMDSNDDWVLAMDMLNEMSESD
FT                   SSDSIGMRRDLTIWVS"
FT   gene            <762835..>764607
FT                   /gene="ETF4"
FT                   /locus_tag="PICST_49344"
FT   mRNA            <762835..>764607
FT                   /gene="ETF4"
FT                   /locus_tag="PICST_49344"
FT                   /product="ETF-ubiquinone oxidoreductase"
FT   CDS_pept        <762835..764607
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ETF4"
FT                   /locus_tag="PICST_49344"
FT                   /product="ETF-ubiquinone oxidoreductase"
FT                   /EC_number="1.5.5.1"
FT                   /note="Electron transfer flavoprotein ubiquinone
FT                   oxidoreductase; go_function
FT                   electron-transferring-flavoprotein dehydrogenase activity;
FT                   go_process electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49344"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68130"
FT                   /db_xref="GOA:A3LZC1"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZC1"
FT                   /protein_id="ABN68130.1"
FT                   /translation="NNEVPYEKLSNEEKELLAEPRASDVVDVCIVGGGPAGLATAIKLK
FT                   QLDNETGSGELRVVVLEKAGDFGSHTVSGAVIEPGAFRELFPNSEYTEQTGGIPLPPDM
FT                   VTKVTHDAMKYLTEKKAYWLPEPPQLANKNKNYIVSLSNVVRYLSEQAEELGVELYPGI
FT                   AVSELVYNEMGDAIKGVATKDLGISKKGVPKSSFERGMEFHARVTVLAEGCHGSLTKEA
FT                   VAKFDLRKDSDPQTYGLGIKEVWEVDPKKFNKGYVGHSLGFPLSTQEYGGGFMYHFGDG
FT                   LVAVGLVIGLDYANPYVSPYLEFQKMKTHPYYANVLEGGKCISYAARTLNEGGYQSIPQ
FT                   LHFPGGILVGCSAGFVNVPKIKGTHTAIKSGIVAAQEIFNTVKELDPVEEETFEDEVYN
FT                   PIDLVAYENSFKDSWAYKELYAVRNCRPAFNTALGFLGGLSHSGFSTMISFGKEPWTLG
FT                   IHHTDADATHRADNYKPKEYPKPDGKLTFDILTSVSRTGTHHDEDERCHLRIPNQDYTR
FT                   HAAMTFPAYKGIEQRFCPAGVYEFIEDDSELGIKFQINNQNCIHCKTCDIKSPMQDVTW
FT                   TVPEGGDGPKYYMT"
FT   gene            complement(764823..767762)
FT                   /locus_tag="PICST_85432"
FT   mRNA            complement(join(764823..765957,765997..767411,
FT                   767634..767762))
FT                   /locus_tag="PICST_85432"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(765325..765957,765997..766881))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85432"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85432"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68314"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZC2"
FT                   /protein_id="ABN68314.2"
FT                   /translation="MALADRRPIGFPVASTPASPAFNPKTLSLAKTPKSAIGSDKDLAA
FT                   NLQANEDDSDLDSDSPSSPVSILKHSGDMSAYTNDKSLSPEAMSPTSRSISPDSLMNGD
FT                   SKKLNSRGSTPPTSLSTPPSSQSASAGLPLKKPKNTSRVPIATGISTTIPVTGEKPKPE
FT                   QKGDPSLEDDVLFAIFLILYEKDPEGAGMTVKQICDILIERHPDMANLSTKTSNLVSAK
FT                   LNAYVKRVEKGDSSLKYALSRDWADASPKRMVYVYRGLLTDDFHIHVKNMMETQKTTQE
FT                   EEPSPTSSFSGSLPDSLEAGKQATLKPRRQTMFDLGVTKATFLDTPIEKSNLFVPYSSA
FT                   PVAASLTEAVDPTDDDKNLNDSDLEFEDFEVFHDDEDDDLISGAGDLYIDSMKKNGKRS
FT                   KSLSYLSLNKKSKIMTAAAAAPRAPRTPSSHSPNAAAAAAALHAAALKAISDSTDTSDS
FT                   VRSGSEGSTGSVHSNKKWLNVIRSGFMTQDIGTPEDISLSDLDKFFA"
FT   gene            complement(<769524..771281)
FT                   /locus_tag="PICST_91178"
FT   mRNA            complement(join(<769524..770749,770846..771281))
FT                   /locus_tag="PICST_91178"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(769596..770749,770846..771281))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_91178"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_91178"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68315"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZC3"
FT                   /protein_id="ABN68315.2"
FT                   /translation="MSSSQDSATKFKRRATVSSLYTNYQIANGAVLPEITLQDGKDNVD
FT                   SEQFFNEYIRLRKPVKLVSGSGSTQTPVDLKAFDPSRILDTLDYSDELQIERKINDGFG
FT                   SGEKRVKMTLHKLLDVFKQGNSDYYLTTQYDFDDPDFEDSYKEDEEEEHEDDEDDEDED
FT                   DEDEDLPKITFNASFSDTSSVDSIDMNNLRDDFLDSEDDQEPVIDEDLNINQSEYEQRL
FT                   KDLLQPPLTKLVNKPQTLPIIPELFSTLIPQQINLWMGHAKSGQASKIQLNPQDPKTYG
FT                   LGKSIPGSRNGTSSGLHHDHADNLYILVSGIKRFTLFSPADALKLYTVGTIYKIYNSGI
FT                   IDYENNEFAPEWKHIRDDGAMVEDVLNWRLKCDQSDSTEIKSIEKQLQSLSKQSALKLN
FT                   NKDEKEDPPNFSRIPPALLHIEEFTDPEMRKKLTAFANEKFPGFLDLNSFTVWLNPGEM
FT                   LYLPAGWFHEVSSFGGDDISQSESGLHNIHIALNYWFVPPNGDSASQCYNDTYWQEDWK
FT                   RTETCIAHALQK"
FT   gene            complement(773427..775733)
FT                   /locus_tag="PICST_91093"
FT   mRNA            complement(join(773427..773950,774011..775733))
FT                   /locus_tag="PICST_91093"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(773831..773950,774011..775264))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_91093"
FT                   /product="G1/S-specific cyclin"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_91093"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68316"
FT                   /db_xref="GOA:A3LZC4"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR014399"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="InterPro:IPR039361"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZC4"
FT                   /protein_id="ABN68316.2"
FT                   /translation="MTTYSHSPDAFHQVRMYNSSVKSSNFHLQSMEFQCHSAAVCDYQM
FT                   EMLHHLLSMETKTLPSLMLIEQQPEIKLGMRPLLLDFLMEVITILNLSKSTFPLTVNLI
FT                   DRYCSTRIVKKQHYQLLGLTSLWISCKNLDSKFKIPTLNDLRKICVDSYHKELFIEMEK
FT                   HILKSLEWMVNSPTFDSFIDLYLSILINNSSNPNVANLIKKSNHRVKLLATYFGELFQF
FT                   YPNIYFDYTSSQIALISILVAILTLKIPVNLISLLNYFNDLLKTKEYKSNVTNPAEDFD
FT                   EILSVSTFQSLFTKAFFKNLIKIIDNPPKSLVIKYFSENGKYTQLMTASVRCATESLAT
FT                   MLEPPVTPRIYSGNSKDALKRNVNIITTMLPLTPISNSTSPRRFDAEQIFSDNESSTST
FT                   STSIATSNAIAAVTGTGHSKRSFDCVAETDISTSKIGQSDSDLKRSKSLSTKPVFFIP"
FT   gene            778958..779919
FT                   /locus_tag="PICST_79547"
FT   mRNA            778958..779919
FT                   /locus_tag="PICST_79547"
FT                   /product="predicted protein"
FT   CDS_pept        778975..779868
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_79547"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_79547"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68131"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZC5"
FT                   /protein_id="ABN68131.2"
FT                   /translation="MSTSPELPSTRDDLVARQKKESKDLIATVTGMKKQATKKTRKAVL
FT                   QRIQELQDNLDRKHKEELQQLDSVSNTDINAEDDDEFSPEQLLAQMEIKDEAPAESTEP
FT                   TPPTQPKAKRNRQKERLERRKAEIEKIREEAALEAADTVDYRKIEIESMDKLLTLNNLK
FT                   LHEIKPDGHCLFASIQDQLLVRHEEQTTIQGLRQLAGDYMLANRDDFTPFLFDEKTFEL
FT                   RDIEPYVEELVSTAMWGSDMEILALSKHFDCPISIYMAGASTHKINESGHNSELKLGFY
FT                   KHSFGLGEHYNSLRDI"
FT   gene            <784032..>784889
FT                   /gene="CYC3"
FT                   /locus_tag="PICST_33494"
FT   mRNA            join(<784032..784058,784158..>784889)
FT                   /gene="CYC3"
FT                   /locus_tag="PICST_33494"
FT                   /product="holocytochrome-c synthase"
FT                   /note="Has EST support"
FT   CDS_pept        join(784032..784058,784158..784889)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="CYC3"
FT                   /locus_tag="PICST_33494"
FT                   /product="holocytochrome-c synthase"
FT                   /EC_number="4.4.1.17"
FT                   /note="Cytochrome c heme lyase (CCHL) (Holocytochrome-C
FT                   synthase); go_component mitochondrion; go_function
FT                   holocytochrome-c synthase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33494"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68132"
FT                   /db_xref="GOA:A3LZC6"
FT                   /db_xref="InterPro:IPR000511"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZC6"
FT                   /protein_id="ABN68132.2"
FT                   /translation="MGWFWAEKKEKPSGCPVDHGSFKKAPAAECPVKGGDEVLNPLNNM
FT                   PMAISSERLPGQKVSLSTERTISTIPRGESDDQGLWEYPSPQQMLNAMVRKGKAKDIPE
FT                   DAVESMVDVHNFLNEGAWQQILDWEDEYTKETKIEPRLKKFTGRPNDLSPRAQMYLWLG
FT                   KLFPDTFNTQPPFDRHDWTVLRSMGLNKGFKEVRYVIDYYSAPDDEETGMPAFMLDTRP
FT                   ALDSPASVRDRFVHWSYPLYKRAMGEFDEK"
FT   gene            complement(<785147..>787372)
FT                   /locus_tag="PICST_33495"
FT   mRNA            complement(<785147..>787372)
FT                   /locus_tag="PICST_33495"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(785147..787372)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33495"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68317"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZC7"
FT                   /protein_id="ABN68317.2"
FT                   /translation="MIPLRQTVFRNLTRTNIVKLRRSGQFLSRFQSTAADTLKATTSTS
FT                   SPIVKNDKNVSEKAPEGSTKNGNHSKKAPHRNVKLRDISNQIQDLVKSSKSDLTEAIEI
FT                   LEEGLSYLREIQLAENISDNSIYFRFQPIVTELLFKALDPATSLGNKSVEDVLEIFTKY
FT                   GVCHKYHYTVVASRYFKSGEDKAVIYQNVLKLWLQFLEFEKSNNATGMASVKAGEIEYR
FT                   PYYLPNLVYFAYSQTCSLQGVKFSFEDASKLLNQTLPNPVLIRNSLMDLRIFDGYKKEF
FT                   QSFQKSIHELSAESLDPNGPEVYRKIREAGEKKNQVALNIIQKEIQEAAARNNNPINED
FT                   TLIRLMDGYYEADRPDEVFAIFQNLLSHGIEKPSIRAWDVVLRTMGTPSYISKISSAQR
FT                   GKLIKSIESTIETILNNGTEITAKTLSIIIGSFANLNKFDKVDEYLQRFSIEGEGKLPV
FT                   IAPTKNNILIGLALNKKISEAEEKLKEFVRAGGYVPSTSVMNTFLGYYAKINNYAAVEG
FT                   ILEFMKKHNIPEEVGTYTSVIDIYFKMHREKGLVADVDKVLDNISASKSIPLNDFTYTA
FT                   LIDGLVKNGANIEAARSIFEKASKKYPASAHLYTAMLRGELDQGSVSSAEKLFDVYIKK
FT                   IRNDARIWNTMINSLLSKREELALQYYENLKNDAHSSPNHFTYYFLFHHFIKRGNKETV
FT                   QHLIDDLSQKPLRDFGNELPKMLGKLTGEYKFGPELINILSNQKKQN"
FT   gene            <788786..>789469
FT                   /locus_tag="PICST_63651"
FT   mRNA            <788786..>789469
FT                   /locus_tag="PICST_63651"
FT                   /product="predicted protein"
FT   CDS_pept        788786..789469
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63651"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63651"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68133"
FT                   /db_xref="InterPro:IPR019383"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZC8"
FT                   /protein_id="ABN68133.2"
FT                   /translation="MNDPNSKYECQNDTSKESSVKPPLQFFNPHEFMVTNENPILPKEN
FT                   EAKLVINHFPNIYEPRDSLAYATTRIIRIPRIYSTVRDSDFIPQFSTYVPGSEPAAISN
FT                   EDITVFEAKGRYDDAEFGYTSLTPLVPGLISETEFETIVKTINQHLYDSLNPYNGHLFI
FT                   ENVLEFLTGGVYSKVINKYLFTGYSKRRLQDLEAYIEHLNTEVFKGRDGLKIINPRLSG
FT                   FLSVC"
FT   gene            <789857..>791050
FT                   /locus_tag="PICST_63360"
FT   mRNA            <789857..>791050
FT                   /locus_tag="PICST_63360"
FT                   /product="predicted protein"
FT   CDS_pept        789857..791050
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63360"
FT                   /product="predicted protein"
FT                   /note="go_function pseudouridylate synthase activity;
FT                   go_process RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63360"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68134"
FT                   /db_xref="GOA:A3LZC9"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZC9"
FT                   /protein_id="ABN68134.2"
FT                   /translation="MNGVFAVYKPSGMSSAKFISDIQEVFTKSGVFEEDLNKAKSKAFA
FT                   DLSTNARWSKQKVQNRVRNLKVKIGHGGTLDPLASGVLVVGVGLGTKKLQYYLSECNKT
FT                   YETKALLGLSTTTGDSEGEIITKNPVNHITKEMILETAPKFVGHVKQTPPIFSALKVDG
FT                   KPLYEYAREGIPLPKAIKTRDIQIFDIKVHEENSLSTEHEFEKLKSELDADGNPKENGL
FT                   ANNPTLNDSPLYFSDEYMEKAESENLPKTVDKPLVFGEGEDLPEKLPLIHFTSDVSSGT
FT                   YIRSLISDYGRALRSSAYMVELIRVRQSEWSLDKNVFKFEDFTENDERIWGPVLKRVLD
FT                   NGGEVNVAEAFDEVRAKVLPVIEKEKELLAESETKSDEQQNGDSELPKKRNIDELES"
FT   gene            <791341..>792492
FT                   /locus_tag="PICST_49608"
FT   mRNA            <791341..>792492
FT                   /locus_tag="PICST_49608"
FT                   /product="predicted protein"
FT   CDS_pept        791341..792492
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49608"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49608"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68135"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZD0"
FT                   /protein_id="ABN68135.2"
FT                   /translation="MIRSLGIRTFSSSSKCLAELYTRTTLRPVTYKLEVPEKFQPQSVL
FT                   VLATPSNLPSVIDEAISIHQQRGLQVIVAGVDSVVPNSCRNGVSEMWLSEPAAIKSSVL
FT                   LDSRDDLNDKPRESDGIRIVVARKNWKNMNSNLSLQLSTKAKVDLKLANSVFTTDNLVT
FT                   LFYFQSSSLAEQLENSGQTLCELSLELPKGTVPENPLLKYEDKWTALYDSQEEPFVITN
FT                   CVGNLVKQINKQPASSYLENNKRLMGLGSKDTEVYVKLYKKNDPQTAFRYKVVAGGGGW
FT                   GAKASIIALSTDAKLEKGDRIEFFMLTPTDRFTMSDSEVPKEELVGKLVFESTYEEQSY
FT                   GSDSAGETETLEYVFGSGSEGEFKFNDVKHNSAGERLIIDIEK"
FT   gene            <792793..>793314
FT                   /locus_tag="PICST_49619"
FT   mRNA            <792793..>793314
FT                   /locus_tag="PICST_49619"
FT                   /product="predicted protein"
FT   CDS_pept        792793..793314
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49619"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49619"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68136"
FT                   /db_xref="GOA:A3LZD1"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LZD1"
FT                   /protein_id="ABN68136.2"
FT                   /translation="MIRYIKGDLLGHLPPSKSSVAVFAHACNCQGVWGGGIAAVLRVKF
FT                   PSTYPLYSGHCQEKGCDPHRLLGTSVVVPSQASDPGNIAGYPPKYIACLFTSDFAQTQE
FT                   EIVAYTDSAIEALVDQLKELQKTTAIETGQSGKIVVNMPKINAGIFAVPWEKTEAVLKK
FT                   YDVEFNVYVI"
FT   gene            793676..796005
FT                   /locus_tag="PICST_73603"
FT   mRNA            793676..796005
FT                   /locus_tag="PICST_73603"
FT                   /product="predicted protein"
FT   CDS_pept        793703..795784
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_73603"
FT                   /product="predicted protein"
FT                   /note="go_function GTP binding; GTPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73603"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68137"
FT                   /db_xref="GOA:A3LZD2"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR003130"
FT                   /db_xref="InterPro:IPR019762"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030381"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZD2"
FT                   /protein_id="ABN68137.1"
FT                   /translation="MDESLIATINKLQDALAPLGGGSSSPVDLPQITVLGSQSSGKSSV
FT                   LENIVGRDFLPRGTGIVTRRPLVLQLINRRASVKPQSDLLDINTTSENGKASENNADEW
FT                   GEFLHLPNKKFYNFEEIRREIVRETDAKTGKNLGISPVPINLRIYSPHVLTLTLVDLPG
FT                   LTKVPVGDQPKDIEKQIRDMVMKFISKPNAIILSVNASNTDLANSDGLKLAREVDPEGS
FT                   RTIGVLTKVDLMDDGTDVIDILAGRVIPLRFGYVPVINRGQKDIESNKTIRDALIDERN
FT                   FFEGHPSYKAKAHYCGTPYLAKKLNGILLHHIKGTLPDIKMRIEHSLKKYQSELSMLGP
FT                   EMAESPASIALNMITNFSKDYNGILSGEAKELSSQELSGGARISFVFHEIFKNGINSLD
FT                   PFDQIKDGDIRTIMHNTSGSAPSLFVGTQAFEVLVKQQIHRMEEPSVRCINLIFDELVR
FT                   ILSQIISQQQYSRYPGLKEQLSQYFIQFLREELIPTTKFVTDIIQAEETYVNTAHPDLL
FT                   KGSQAMAIVEDKFHPKPQVAIDPKSGKPLPPSQQNQHPPQSTSPGPKEDSNGFFGGFFS
FT                   SKNKKRLQSMEAPPPVLRATGTMSERETMETEVIKLLISSYYNIVKRTVADVVPKAIML
FT                   KLIVRSKEEIQKELLEKLYNSPDLADLVKENELTVQKRKECVRMVEVLRNASEIVSSV"
FT   gene            796491..798950
FT                   /gene="SPE2"
FT                   /locus_tag="PICST_85160"
FT   mRNA            796491..798950
FT                   /gene="SPE2"
FT                   /locus_tag="PICST_85160"
FT                   /product="S-adenosylmethionine decarboxylase"
FT                   /note="Has EST support"
FT   CDS_pept        797373..798698
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SPE2"
FT                   /locus_tag="PICST_85160"
FT                   /product="S-adenosylmethionine decarboxylase"
FT                   /EC_number="4.1.1.50"
FT                   /note="go_function adenosylmethionine decarboxylase
FT                   activity; go_process spermine biosynthesis; spermidine
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85160"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68138"
FT                   /db_xref="GOA:A3LZD3"
FT                   /db_xref="InterPro:IPR001985"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR018166"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZD3"
FT                   /protein_id="ABN68138.2"
FT                   /translation="MVAPAYHQDSYVDHQLSANLDSTYAFEGPEKLLEIWFWPSEDHLP
FT                   KGYSSEGLRCIPLAKWVEILDLVSCKILSMNSSKFMDAYLLSESSLFVFPHKMILKTCG
FT                   TTTTLSCLEELFQIVNKEFFGKLHTLSSHNIYKIFYSRRSFMFPDKQIQVHQDWKNEVS
FT                   LLNKHFDNGKSYVVGDFTSSDHWYLYVGGELDEEQLASETPHDQTFEILMTELNPDCAA
FT                   KFITSRKPGAESYIASEVEDHDLGHDFGIQTMKETDLDSIFDPSGCTHLKHSTQLPSPT
FT                   LSDNLELSEDDEMSTEKKEVSAPKPKRAIFDFVHDAFSFAPCGYSSNSICSNQGGFYYT
FT                   LHITPESGWSYASFETNYPFSEKSEVSITDVLLRVLRIFEPRKFSMNLISENTEGNNSA
FT                   SHEGLRNSHLLLKDLGYKKQERVKYDLRGEYKLLYLNFEKNT"
FT   gene            complement(<799351..800435)
FT                   /gene="ADT1"
FT                   /locus_tag="PICST_85436"
FT   mRNA            complement(<799351..800435)
FT                   /gene="ADT1"
FT                   /locus_tag="PICST_85436"
FT                   /product="ADP,ATP carrier protein"
FT   CDS_pept        complement(799533..800435)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ADT1"
FT                   /locus_tag="PICST_85436"
FT                   /product="ADP,ATP carrier protein"
FT                   /note="ADP,ATP carrier protein (ADP/ATP translocase)
FT                   (Adenine nucleotide translocator) (ANT)(ADT2); go_component
FT                   membrane; go_function binding; go_process transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85436"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68318"
FT                   /db_xref="GOA:A3LZD4"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR002113"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZD4"
FT                   /protein_id="ABN68318.1"
FT                   /translation="MDNSFFIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGRL
FT                   AKKYDGIAECFRRTAAEEGVVSFWRGNTANVIRYFPTQALNFAFKDKFKKMFGFKKEEG
FT                   YWPWFAGNLASGGLAGATSLAFVYSLDYARTRLANDAKSSKGSGEREFKGLFDVYKKTL
FT                   ASDGIAGLYRGFGPSVIGIIVYRGLYFGLYDSLKPVILVGPLEGNFLASFLLGWTVTTG
FT                   ASTASYPLDTVRRRMMMTSGQAVKYDGAFDCFRKVVAAEGVASLFKGCGANILRGVAGA
FT                   GVISMYDQLQLIIFGKKFK"
FT   gene            complement(<804187..809530)
FT                   /gene="DNF1"
FT                   /locus_tag="PICST_85147"
FT   mRNA            complement(join(<804187..809288,809463..809530))
FT                   /gene="DNF1"
FT                   /locus_tag="PICST_85147"
FT                   /product="phopholipid transporting ATPase"
FT                   /note="Has EST support"
FT   CDS_pept        complement(join(804347..809288,809463..809530))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="DNF1"
FT                   /locus_tag="PICST_85147"
FT                   /product="phopholipid transporting ATPase"
FT                   /EC_number="3.6.1.3"
FT                   /EC_number="3.6.3.1"
FT                   /EC_number="3.6.3.8"
FT                   /note="Drs2 Neo1 Family Adenosinetriphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85147"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68319"
FT                   /db_xref="GOA:A3LZD5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR026871"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZD5"
FT                   /protein_id="ABN68319.2"
FT                   /translation="MPESETSPFSDPDESFHSSNDNSQNAATTPSRKGSLRFELPANQQ
FT                   THTPPSSSASSSNHNHSHNHKITSPFLDQNNIIKEDEVFSQPLSPFAQESFNLSSTYKS
FT                   DESDVVYDVDITGSENGVDRKETVMKRNRWGTTRNKHGRPNKEHVSRSRTLKGLLGSRT
FT                   NSVRHRSDSIRKPNTNDEDPEGDSFHDVDEDASVTASNDPFDPKDRKDEKRSVVFNRIL
FT                   PEEFLDPESGKPDTDYPRNKIRTTKYTPLSFLPKNITHQFIHNIANIYFLTLIILGAFQ
FT                   IFGVPSPILAAVPLIVIVCITAFKDAIEDSRRTVTDLEVNNQITHILSQNEDSQSGYVY
FT                   KNNNVNDEKVSLWRRFKKMNTRLVIRFWGASKRNLTKEGRANKERQKRNLELNRITSNA
FT                   RKSFDSDIIEPSPRNSLNPTASENPFSDQLRKSFQQQRREEHQSKEKTLKFAKKYWKDV
FT                   KVGDMLRIYNNDEIPADVIILATSDADNCCYVETKNLDGETNLKVRQALKYSSVEQKIQ
FT                   RADDLKSHDFQIDSEGPHANLYSYQGNLKYYDSNGSGEKEEPITINNILLRGCSLRNTK
FT                   WVIGIVVFTGDDTKIMMNAGVTPTKQSRMSRELNYYVVLNFILLFVICFVSGLVNGLWY
FT                   RTSGNSRDYFEFGTIAGSPFKNGLVGFFVALILYQSLVPISLYITIEIIKTAQAFFIYS
FT                   DLGMYYERLDYPCTPKSWSISDDLGQIEYVFSDKTGTLTQNLMEFKKCTINGVSYGKAY
FT                   TEALAGLRKRQGVDVETEATVERELIAKDKIEMIQSLRDISSSSAKYEDELTFTSSEFV
FT                   HDLQGASGDVQKKCNEHFMLALALCHSVLTEEDPKNPGKTLLKAQSPDEAALVGTARSV
FT                   GYIFKGETKKGLLIEIHGETKEYQVLNTLEFNSTRKRMSAIIKIPAEDPDGEPKALLLC
FT                   KGADSIIYGRLSKNGNNRTMLDTTSKHLEEYATEGLRTLCIAQRELSWKQYTEWSKRHN
FT                   AAASSLDDREAKMEAVADSIERELILLGGTAIEDRLQDGVPESISILAQAGIKLWVLTG
FT                   DKVETAINIGFSCNLLGNEMKLLVLKSKYNRHEIAENMISNYDAMSEDEIVNFMISRYL
FT                   DMYFQMSGSEEELEAATENHSPPDEGFGVVIDGDALKLALLNPDTKRKFLLLCKQCKAV
FT                   LCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQAADVGVGIAGEEGRQAVMSS
FT                   DYAIGQFRFLARLLLSHGRWSYKRFAEMIPSFFYKNFIFNIALFWYGLYNDFDGSYLFE
FT                   FTYLMFYNLAFTSLPVIFLGVFDQDVSAKVSLLVPQIYRTGILRSEWTQKKFWFYMADA
FT                   IYQSVISYFFPFLLYRISFQDSSGKPVDHRFWMGVVVTCISCISCNLYILMHQYRWDWL
FT                   STLIIAISILIIFIWTGLWTVSTYSGEFYKAAPQVFGAASFWACMFIGVLCCLLPRFLF
FT                   DFIRKMYWPKDIDVIRECVQRGDFDAYPFNYDPTDPNRIKISNYTSDTVKRMSVTSSKA
FT                   PNPGSPYKKATANSSSSGSDVDHQKRGTFQNADDEDTMVSYNTHGNSVSHNYKSSSTQA
FT                   EAGGSGAPVQQRKSIIDLFKRKNQGISSTSFYDNGSLIDNYKNGNQSTDELSNIHTEEI
FT                   AMQDFNRSQERAARISSENRRLSNQYSTHGN"
FT   gene            complement(811229..812191)
FT                   /locus_tag="PICST_68363"
FT   mRNA            complement(811229..812191)
FT                   /locus_tag="PICST_68363"
FT                   /product="predicted protein"
FT   CDS_pept        complement(811467..811925)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_68363"
FT                   /product="predicted protein"
FT                   /note="go_function ubiquitin conjugating enzyme activity;
FT                   go_process protein modification; ubiquitin cycle"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68363"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68320"
FT                   /db_xref="GOA:A3LZD6"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZD6"
FT                   /protein_id="ABN68320.2"
FT                   /translation="MAALPKRIIKETERLVSDPVPGITATPSEENLRYFEVTIDGPSSS
FT                   PYANGVFQLELYLPDDYPMCAPKVRFLTKIYHPNIDKLGRICLDVLKDNWSPALQIRTI
FT                   LLSIQALLGAPNPDDPLANDVAEDWKKDEKKAIQIAQEWTQKYAVKKD"
FT   gene            <812444..>812737
FT                   /locus_tag="PICST_49538"
FT   mRNA            <812444..>812737
FT                   /locus_tag="PICST_49538"
FT                   /product="predicted protein"
FT   CDS_pept        812444..812737
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49538"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49538"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68139"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZD7"
FT                   /protein_id="ABN68139.2"
FT                   /translation="MSKVPPTPPFKHRLIVGTLAIIAGAWVIKDAGKDFEFIKFEPHST
FT                   EEVERRKREHVKTTFKALETRTLEYTPEAKERLRKLIEEKDDASSSEPKSHN"
FT   gene            <818020..>819614
FT                   /locus_tag="PICST_68364"
FT   mRNA            join(<818020..818168,818231..>819614)
FT                   /locus_tag="PICST_68364"
FT                   /product="predicted protein"
FT   CDS_pept        join(818020..818168,818231..819614)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_68364"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68364"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68140"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZD8"
FT                   /protein_id="ABN68140.1"
FT                   /translation="MSLIFPVFSNLSQSSDFAEQESSLYPLKEKILPTPGYPRIFFFNT
FT                   MEHKPHNMVLPPANGKKLWRVKRTVSGSHGSHTSTNDANDTQTDSSLECLNNSLKIAAA
FT                   AGKFSMRRPPLRRPKNKPGKPKDFVFVDLSPVKTEDSEASSGEYSTTSSPTLVNTQLPS
FT                   PTLSINDANIKLDYTTNNDTINSTVSKAGLEMAPLNESFNNSISSEDDSLFSSFNNSEI
FT                   LESALSAYMQVQPQVSMVPRSAPVDSYGLGIMNMGSMNWDQPQVMKQQQTVQMSPQQQA
FT                   NQKTLTEQLFGYQQAMLQQYQQIQLLQQQLQQQQEMQKNIISPQSSPEEPVEIETKIAN
FT                   SNKRSKSTGDVGSSAKRRASGQFQFKTYTGPNKSKQQIRHRHTVSEPIKKNSASKKEVE
FT                   NAAAVSIPTTPKQEQTQSQQSSIKSTVGLEDFMMLNEQISIELPYEELSTDDALSMKSG
FT                   KYDTYSPVSDYSDEDDYFAKSKGLDPNLLSNCGIDQYLIPRADDFVFSGFAM"
FT   gene            complement(<821827..>823758)
FT                   /locus_tag="PICST_63283"
FT   mRNA            complement(<821827..>823758)
FT                   /locus_tag="PICST_63283"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<821827..823758)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63283"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63283"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68321"
FT                   /db_xref="InterPro:IPR041805"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZD9"
FT                   /protein_id="ABN68321.2"
FT                   /translation="MSDEELIKRAVNEFHSVDAVNDIDECARCKTRLQIGKFLALTRPD
FT                   LVPQIFSIWCLESGFDETECHMNYGFHTEEYSSTGTDFTKVLSLMNPEGIDGDYFCYFH
FT                   DSQCHVLPESPTLDLEKLWPPKPKLYEAPENSGNTFNVLHISDVNIQLDYKLLSEANCS
FT                   QTVCCSPMSRNLVPTPPEYDYSLIHDPAVGLSFYSSSYSKGHFEKGQYIDQYSPKEPAW
FT                   LPAHEFGSYNCETPPLLFNNSLGVIRDFHQNHLNFEFALFTGGVVGHSDRIFVDKESVL
FT                   EAQEFVYRNIQSYLPQVPVFPAIGVRDGFPMNQLPQNELTESYLYQCNFDFLADLWQEL
FT                   GWLDLESAKEVRYNHFGYSLVTDRGLKIISLNSNVWNQKNLYSFWDVLAFDKSGIWEFL
FT                   INELLDSELNEQRVWIIAHLPTSQQSLPIPSKIFTEIVHRFSPKVIAAIFFGHSQKESF
FT                   ELLYAGDGCDEKKLENAINFAITAPSISPFSGVNPAWKYYSVDENSFNIVNSFTYFTKL
FT                   NETFVNGGAEPVWEFGFSARDAYDPEQQWPMERSLDTEWWHHVSEKIRDMPEIDQLYNK
FT                   FEFRSSPFATPNTSEDCEESTNYCKVTSFTLEDRKQCMLTEDQDNYICPRKSIDFRPHI
FT                   RPYDPIEYI"
FT   gene            complement(<824548..>825924)
FT                   /locus_tag="PICST_33508"
FT   mRNA            complement(<824548..>825924)
FT                   /locus_tag="PICST_33508"
FT                   /product="predicted protein"
FT   CDS_pept        complement(824548..825924)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33508"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33508"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68322"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZE0"
FT                   /protein_id="ABN68322.2"
FT                   /translation="MSNTTSIAMPHDPQPPTAATPSTISTSSAIAPPHTGPSVLHSRSI
FT                   KHQWSGAASLLNPLPADDVRSGSETVETAVSVVQADAHSAGSIEAVAAARSLEAQEVAQ
FT                   AVESVDAETVDINGESYGPDEQDSSSSSPSNSTNFLLGAKNAHRTKLTTHDIRLILYFI
FT                   VQIKPFKYVGDRSLSQTKKWELIQQKFASHKHSDHEKDRKNDDSPVVVPTVRTLQRQLA
FT                   TAIRKASIRRHERKQAGIIDSSPSRSQDDEYYLFKHISADSSLTELEAALLDLNDLSDK
FT                   LKTGKLANTSHLFQGSMDTEVQRGVTNLTSMTSSLRALIDSTNSANGAIDTRLTSTLRE
FT                   LSDIKDDIGALYANDRYSYSSISQSMQAFDDFLAKSADFQSQVINENHSLFLELDKLIK
FT                   NHYDKLEAINKNYADYRDEVSEKIVSLLADKIQHSTEVKKDVQDRILSKLTSLRDTVRR
FT                   "
FT   gene            complement(<827604..>831391)
FT                   /locus_tag="PICST_73544"
FT   mRNA            complement(<827604..>831391)
FT                   /locus_tag="PICST_73544"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(828023..831088)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_73544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73544"
FT                   /db_xref="EnsemblGenomes-Tr:AEF13567"
FT                   /db_xref="GOA:F5Y6K2"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018999"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040812"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:F5Y6K2"
FT                   /protein_id="AEF13567.1"
FT                   /translation="MSHFLFHGADADTKEEDPIYGHESEDDAFGSVSRESTIEFPTQDL
FT                   ESYDGDDELQRRLEELIDDADDAQLALDAAEYSHTNLPEHACAYCGVHSTHSVVKCNTC
FT                   NKWFCNSKSNGNSSHIVTHLVMSRHNQVSLHEDSDLGDTTLECYNCGNKNVFILGFVSA
FT                   KQESVVVILCRLPCAQSKDVNWDTSHWQSLIEDRQFLTWVAAVPSEEELVNAKLITPNQ
FT                   ISKLEAQWRLNRDTTIDDIENNNDEQEEVLPILMRYNDAFQYQRSFAPLVKLEADYDMN
FT                   LKESQALEHIQVKWALGLNNRHLTSFTLSTYESNDLKVAVGDEIILRYTGAHDEKWEGR
FT                   GFIVRLPNAHQEEFTLELNAAKTAPPTHLSTDFTAEFVWKGTSYERMQDAMKLFAVDEE
FT                   SVSGYIYHKLLGHEVEPVEFDVKLPQRFSHPNLTELNVSQINAVRSVLQRPLSLIQGPP
FT                   GTGKTVTSATIIYHLTKLNKEKILVCAPSNVAVDHLAEKLDSLGLKVLRLTARSREDVE
FT                   SSVSHLSLHNLVNRTAKGELKKLLRLRNELGELSLSDSKSLIRLIRTSESKILAQCDVV
FT                   CCTCVGAADRRLSNIKFRTVLIDESTQASEPEVLIPIVKGAKQVILVGDHQQLGPVILD
FT                   KKAGDAGLRQSLFERLVILGHVPIRLEVQYRMNPCLSEFPSNIFYEGSLQNGVTSAQRR
FT                   IESSTFPWPVYDSPMMFWANYGREEISGSGNSYLNRVEAMNVEKIITRLFKDGVKAEQI
FT                   GVITPYEGQRAYLVSYMSINSTLAEFKEQYLEVEVTSVDAFQGREKDYIILSCVRANSS
FT                   HQIGFLSDPRRLNVALTRAKYGLVVLGNPRALCRNRLWNQLLIHFREKGCLVDGPLDNL
FT                   QLSMVQLNSNNTRPGLPQQNQPRRKFAQESTIAPSSTEFDSASIVSYDPGSTINGKSET
FT                   SRASRWPTLGHNKQENVYDASSNPIHANFFSKLNKLNSTYEGRYNNKLEAPGSSTASWQ
FT                   QFQSRLQESDSHNNIEDDIRSVTSSFAAGLNF"
FT   gene            833148..836942
FT                   /gene="BUD2"
FT                   /locus_tag="PICST_68367"
FT   mRNA            join(833148..833500,833567..836157,836215..836523,
FT                   836569..836942)
FT                   /gene="BUD2"
FT                   /locus_tag="PICST_68367"
FT                   /product="GTPase-activating protein"
FT                   /note="Has EST support"
FT   CDS_pept        join(833197..833500,833567..836157,836215..836523,
FT                   836569..836862)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="BUD2"
FT                   /locus_tag="PICST_68367"
FT                   /product="GTPase-activating protein"
FT                   /note="GTPase-activating protein for Rsr1p/Bud1p in S.
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68367"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68141"
FT                   /db_xref="GOA:A3LZE1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR039360"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZE1"
FT                   /protein_id="ABN68141.2"
FT                   /translation="MVSRKYQSPFHKIISRDKGLFEGKNFLVSTDSINWIHSHTLSITE
FT                   QGQLYSSDENDSHYLLLQSLQSCHVQIFSSLASSQQHHQTLQPRRLNRASVSPMDKQPP
FT                   VVFIKTYENDRLYIRVLSKNNFGQLLSSLIVWQNFKPQGLVKKWYCENKVEYSTSATSV
FT                   PHELLVCRFKIFGPIPSRSKNLTIVSGPKAPVYQPKAESTAADFVSVDGNGNANGGVDH
FT                   VHEGWFYAIGALKSNGSLNFLSELDGTLLYTIDVKSIMSSEIREIHNSIFDNSNVLFIG
FT                   QLKELRFNNVIKTTSSLSTDQLVTSFLTRDGKMVQNNQRILIEFPLHIDLEDWFVGLNY
FT                   FAKREYIGSYYFQPKQLVLKKGEFDITHPPPLTDFTRENFRVSKKITIDIIEAKFENFE
FT                   RQHARHHEKHEDPDGKIYAEVRMWGYPWSRTAIVNHTNNPFWKEEFSTDLPISTQMIHI
FT                   LIKKCAYNDSYSAADKLIGTVYVTPDILTKKVKSSSTVMTGTNSGNVIDVNGYSAAGTS
FT                   SQNNTISFYNNNEIVRLSIYDASNLPIGKLLLHVNLKEHHILPPPYFRSLESMLGNAPM
FT                   KDLIHYCNVNVPTSDFEDVSLMMLDIFQSLGVEDQWFKALMEAELVNVDILTRKLYKKK
FT                   NSDHKEAQTSASNNAFNTLFRGSSIFSKSLERYNLRIGQEYLEKALAGFFTKISMEKKN
FT                   CELDPRYVSLQEKKLRQGKEIDDSDSDSEFTSDSEDEVVDEEEREKNVNKMLEDNFENL
FT                   YDYVEEVWHKIYITSNDLPAQIKIQLKNFRTKVELACDPDDKTTPLNCLSAFIFLRFFC
FT                   PAILNPKLFYLTKNHQSGTTQRTLTLIAKILLNFANRQEFTKHKEPHLLRMNKFLKKHR
FT                   KEIYDYFDKITGRKNDFNEKILDLSHDVKRFDLGLGNDSTSNELPTTPYLIDKYLRLTE
FT                   LIHLLDFNRFGNSSAITSPVSLFATSAGNNESADSENGPEPNGEKNGNGAKDEYQIGTL
FT                   EFEKNEFLDSAAVNETEGFSKSLRRGNENIFSFITSNITLRDLQKQSTKITAKVHQLET
FT                   VLENFEFPNNLLPNQNNPDPSFTNDILSRCYLDVSRACLVYLDKDLPYNHNYRKVVEQN
FT                   ALSSLKLKFSTESRASHVRNASVVSTSASISTSFTNNSLGSALRNGARSSIRRWLRKN"
FT   gene            complement(<837074..>838024)
FT                   /locus_tag="PICST_33511"
FT   mRNA            complement(<837074..>838024)
FT                   /locus_tag="PICST_33511"
FT                   /product="predicted protein"
FT   CDS_pept        complement(837074..838024)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33511"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33511"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68323"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZE2"
FT                   /protein_id="ABN68323.2"
FT                   /translation="MVTLNDLSTNKHSKKSKKMTKDEKMVDATDAGNGSDYCSDSESWS
FT                   ETEEEESSDDDDNELIERKSVRHLVSTEMIVHKEKLKNLPDLDCSPRTISKYKMVLDGI
FT                   FDRFPTFKKTVLNDFNIDSIKDVTMLLVAYNKESTIFFYRYLADSIERILMTKTRDIRN
FT                   ELGRPTLKEINQYIEDHYDASEEIINYFKGFRKNRKVLKSSERERNIERLISTTDKHIV
FT                   SFFRTLEPHYFHEYALFIDYSSEDNVEVLGRQLNEQFQAYRKDPSKGAASMEQTYIKMR
FT                   DYAAFTEPSKVNINKTKKKSNQHGFRKNQSAESIN"
FT   gene            839899..841244
FT                   /locus_tag="PICST_85298"
FT   mRNA            839899..841244
FT                   /locus_tag="PICST_85298"
FT                   /product="predicted protein"
FT   CDS_pept        840127..841029
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85298"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85298"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68142"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZE3"
FT                   /protein_id="ABN68142.2"
FT                   /translation="MTVSEQDILASYPQVNAPSEITGYTSNLTEEQKQQLEQFRKELTE
FT                   LGFVDRLDDASLLRFLRARKFDVAKAKLMFVNCEKWRKDFGTNTILEDFHYTEKPLVAS
FT                   MYPQYYHKTDKDGRPVYYEELGKVNLPEMLKITTQERMLKNLAWEYESMTHYRLPACSR
FT                   KAGVLIETSCTIMDLKGISLSTAYQVLGYVREASVIGQDYYPERMGKFYLINAPFGFST
FT                   VFKLFKPFLDPVTVSKIFILGSSYSKELLKQIPPENLPKKFGGNSTAVEQELYLNDEGP
FT                   WRDTQYIGPEGEAPRSFPL"
FT   gene            <842612..>844060
FT                   /gene="KRE6"
FT                   /locus_tag="PICST_63619"
FT   mRNA            <842612..>844060
FT                   /gene="KRE6"
FT                   /locus_tag="PICST_63619"
FT                   /product="Beta-glucan synthesis-associated protein"
FT   CDS_pept        <842612..844060
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="KRE6"
FT                   /locus_tag="PICST_63619"
FT                   /product="Beta-glucan synthesis-associated protein"
FT                   /note="go_component cell wall; go_process beta-1,6 glucan
FT                   biosynthesis; cell wall organization and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63619"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68143"
FT                   /db_xref="GOA:A3LZE4"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR005629"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZE4"
FT                   /protein_id="ABN68143.2"
FT                   /translation="NLGQFLAVIALISIIVFGSIGYVIMTARSYYKPLEPEVYEVLSYY
FT                   KYPTLSAIRTSLIDLDTPKEAHTKNSFHDNEPWKLVFSDEFNVEGRTFHEGDDQFFTAV
FT                   DLHYAATNDLEYYTPHMAETINGSLRITIDAYQTNGLDYISAMLQSWNKLCFNKNAMVE
FT                   VSLRMPSYSQSKGLWPAVWSLGNLARPGYMATTDGVWPYTYDECDYGITPNQSSPDGIS
FT                   YLPGQRLSKCTCLGQDHPNLGVGRGAPEIDIIEGTHAGYDDWALGAQTLQVAPFDPWWR
FT                   PDYDFLTIENYNHTSMKADTGTPQQESIASTTVLNSEWFESLRNRSNYSQSLQNHTHFQ
FT                   TYGFEYRSEKTEERDSYIQFFVADEKTFGVYGDSLHPAGNVGWRQITREPMSLIFNLGL
FT                   SPTWQTIDFASLDYPATLEIDYIRIYQREGEEEMTCDPPDYPTVDYINSHIAAYSNVNF
FT                   TSWEQAGYKTPRNSFMHGCLAPIK"
FT   gene            <844623..846898
FT                   /gene="FET3"
FT                   /locus_tag="PICST_79365"
FT   mRNA            join(<844623..844676,844701..846898)
FT                   /gene="FET3"
FT                   /locus_tag="PICST_79365"
FT                   /product="multicopper oxidase"
FT   CDS_pept        join(844623..844676,844701..846542)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="FET3"
FT                   /locus_tag="PICST_79365"
FT                   /product="multicopper oxidase"
FT                   /EC_number="1.10.3.2"
FT                   /note="multicopper ferro-O2- oxidoreductase; go_function
FT                   copper ion binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_79365"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68144"
FT                   /db_xref="GOA:A3LZE5"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZE5"
FT                   /protein_id="ABN68144.2"
FT                   /translation="MLILRVVYALVWALLSVSPKTHVFHFNLTYVDADADGTFSRRMIG
FT                   INNQWPLPTIRVKKNDRIQIHFTNLLETKASLHFHGLFQQGTNAMDGPEMVTQCPVAPG
FT                   STFLYDFKVTKQAGTYWYHSHSGSQYADGLRGILIVEDTEQDYHFHFDEEVVLSVGEHY
FT                   HQESSEVLSKFMSRYNPTGAEPIPQNSLFNETKNVTWHVEPGKTYLLRIVNMGLFTSQY
FT                   LSIEDHTFTIVEADGVFVEPQEVDSLYIAVAQRYSVLVKSKKSTKKNYRFLNIIDQEML
FT                   DVLPADLQVISTNWMVYNDDVEMPSPLENNDKSFENQLAKMHPFDDFYLVPLGKEALLP
FT                   DADVVITLDFTMDVLGDGVTYASFNGVSYVPPKVPTLYSVVSSGKYANNQQVYGSNTNT
FT                   FVIQNNEVVDIVLNNMDPGKHPFHLHGHTFQVISRSPEGMDEEDPIKFDPNNSSHTNYP
FT                   EYPMIRDTVQVHPNGFFVLRFKADNPGVWFFHCHVDWHLEQGLAITFVEAPFEIQKQKI
FT                   IPNHYDNCKSSNVSTIGNAAGNYGETKESWLNLQGENVQVAPLPAGFTTKGYVAMILCT
FT                   LVAVYGVWSIYKYGMEDVNSEDTEAVIRKLYDILRTNGALEPEYDDGDEELLIAS"
FT   gene            <846915..>848100
FT                   /gene="IFG3"
FT                   /locus_tag="PICST_33517"
FT   mRNA            join(<846915..846937,847077..>848100)
FT                   /gene="IFG3"
FT                   /locus_tag="PICST_33517"
FT                   /product="D-aspartate oxidase"
FT   CDS_pept        join(846915..846937,847077..848100)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="IFG3"
FT                   /locus_tag="PICST_33517"
FT                   /product="D-aspartate oxidase"
FT                   /EC_number="1.4.3.1"
FT                   /note="go_function oxidoreductase activity; go_process
FT                   electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33517"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68145"
FT                   /db_xref="GOA:A3LZE6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZE6"
FT                   /protein_id="ABN68145.2"
FT                   /translation="MTKYVIVGSGIIGLYTAYNLLLRGVSPREITIVAEHLPGDESINY
FT                   TSPYAGGNFSCITDDDPKTLFYDKHTYTNLSRLQKELGGAPCGLDRYISTEYWDTKPSK
FT                   EKIESLASYLQEYEIIDQMNLPMGVAYGIKFRSWNFNCPKFLLNFQKYLQEKGIRFIKR
FT                   KLTHITQAYLTSSTKTVFNCTGIGAHKLGGVNDTNVYPTRGQVVVIKAPHIVENVMRWG
FT                   EDYATYIIKRPYSKDQLILGGYMQKDNWTADTYKHETEDILKRTTELFPKILADNPYGN
FT                   DLKDLEILRVVSGLRPSRYGGVRIEKSLVEHNKYLVHNYGASGYGYQAGLGMGYEAVRL
FT                   ALARDNNL"
FT   gene            <848416..>849114
FT                   /gene="DID4"
FT                   /locus_tag="PICST_63022"
FT   mRNA            <848416..>849114
FT                   /gene="DID4"
FT                   /locus_tag="PICST_63022"
FT                   /product="class E vacuolar-protein sorting and endocytosis
FT                   factor"
FT   CDS_pept        848416..849114
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="DID4"
FT                   /locus_tag="PICST_63022"
FT                   /product="class E vacuolar-protein sorting and endocytosis
FT                   factor"
FT                   /note="go_function molecular function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63022"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68146"
FT                   /db_xref="GOA:A3LZE7"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZE7"
FT                   /protein_id="ABN68146.2"
FT                   /translation="MSSLFEWAFGKKLTPQERLRKNQRALEKTQRELTREVTKLQQQEK
FT                   KLISEIKKSAKAGQISSAKIQAKDLIRTKNYIGKFNSMKAQLQAISLRIQSVRSNQQMA
FT                   TSMRDATRLLSGMNRSMNLPQLSRIAQEFAKENDLMDQKQEFMDDAIDDAMAMDEDELG
FT                   EDEQIDEILGKVLDEIGVDLNTSLKETPNSINVHTEEKLNSGRVAEAIGGGGDHADEDD
FT                   LQARLDSLKK"
FT   gene            <850011..>852266
FT                   /gene="LACS1"
FT                   /locus_tag="PICST_49655"
FT   mRNA            <850011..>852266
FT                   /gene="LACS1"
FT                   /locus_tag="PICST_49655"
FT                   /product="Long-chain-fatty-acid--CoA ligase 2 (Long-chain
FT                   acyl-CoA synthetase 2) (Fatty acid activator 2)"
FT   CDS_pept        850011..852266
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="LACS1"
FT                   /locus_tag="PICST_49655"
FT                   /product="Long-chain-fatty-acid--CoA ligase 2 (Long-chain
FT                   acyl-CoA synthetase 2) (Fatty acid activator 2)"
FT                   /note="go_function catalytic activity; go_process
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49655"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68147"
FT                   /db_xref="GOA:A3LZE8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZE8"
FT                   /protein_id="ABN68147.2"
FT                   /translation="MSLYPANNRSKEEALASLPISSISITNSVVVSGASADGNYSAVYR
FT                   NSASPDKLISSIHPDLDTYHKLFNNAVARYGNRPCLGQRPFNYQTKQSASYYKNYTYNQ
FT                   VNQRKKNLGAGIIYSLQNNAFTNYNLESHRKIRDHLKNWLSYGVTTNATENTNEQIEKS
FT                   ASFIVSIFSANRYEWILTDLACTAFSITNTALYDTLGPDVTKYILELTSSPIVVCSYDK
FT                   ISTILDLKEKYPIELESIISIVSMDPFSTINNSLLAKASRLKVEISDLGQIEDVGASHP
FT                   LDELPPSPDTLYTISFTSGTTGAKPKGAMLTQRNATCGMSFLSCAETHSRGRDRAFIFL
FT                   PLTHIYERETSGFALVTGYYLGFPQLTIGHDKVDPFTNLIQDLRIFKPTYFSNVPRILT
FT                   KMEALVKNLINEMSAEDAAEVKKIIEFKQLEHKRYDGSEAKNALYDNFPAYKSLQEAMG
FT                   MTKLKWMQTGSAPVSPTTITFLKAALNIGIRQLYGLTESFGGITSTPEYEAEPGSCGSI
FT                   SPTIEARLRNVSEMGYKINDNKGEFVIRGHQIFKGYYYNKEETDKVFNSEGWFHTGDIA
FT                   RVDKNGRFFIIDRVKNFFKLAQGEYISPEKIENRYLSSNPIISQLYVHGDSLQSFLVGV
FT                   VGVDFEKGLKFLNDVCGYNRIDMSSEEMIETINRVDIKKKFLDIINENVKDKLSGYEKL
FT                   HNIHIEINPLTVERNVVTPTLKIKRGFASQFFSDVFHRLYNLEQSLLSEANYLKSKL"
FT   gene            complement(852416..853486)
FT                   /gene="KAP1"
FT                   /locus_tag="PICST_90976"
FT   mRNA            complement(852416..853486)
FT                   /gene="KAP1"
FT                   /locus_tag="PICST_90976"
FT                   /product="Adenylyl-sulfate kinase (APS kinase)
FT                   (Adenosine-5'phosphosulfate kinase) (ATP
FT                   adenosine-5'-phosphosulfate 3'-phosphotransferase)"
FT                   /note="Has EST support"
FT   CDS_pept        complement(852473..853072)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="KAP1"
FT                   /locus_tag="PICST_90976"
FT                   /product="Adenylyl-sulfate kinase (APS kinase)
FT                   (Adenosine-5'phosphosulfate kinase) (ATP
FT                   adenosine-5'-phosphosulfate 3'-phosphotransferase)"
FT                   /note="go_function ATP binding; kinase activity;
FT                   transferase activity, transferring phosphorus-containing
FT                   groups; go_process sulfate assimilation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90976"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68324"
FT                   /db_xref="GOA:A3LZE9"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZE9"
FT                   /protein_id="ABN68324.1"
FT                   /translation="MASNITWHPNLTHAERASLRKQKGVTVWLTGLSASGKSTIACALE
FT                   QSILARGLNAYRLDGDNVRFGLNKDLGFSEADRNENIRRISEVAKLFTDSCCVTLTSFI
FT                   SPYKQDRDLARQLHEKDNLPFVEVYVDVPVEVAEQRDPKGLYKKAREGIIKEFTGISAP
FT                   YEAPEKPEIHLKNYEGVSIEESAEKIIDYLIENKYI"
FT   gene            <853745..>854110
FT                   /gene="MRP17"
FT                   /locus_tag="PICST_63765"
FT   mRNA            <853745..>854110
FT                   /gene="MRP17"
FT                   /locus_tag="PICST_63765"
FT                   /product="mitochondrial ribosomal protein"
FT   CDS_pept        853745..854110
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MRP17"
FT                   /locus_tag="PICST_63765"
FT                   /product="mitochondrial ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63765"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68148"
FT                   /db_xref="GOA:A3LZF0"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZF0"
FT                   /protein_id="ABN68148.2"
FT                   /translation="MYYELFAIARITDPVQTSKEAKKIVSTIGKLILNNRGIIRDITSM
FT                   GARPLPKIMSKEQERHFQGYHFLMGFDVSATVQSQLLRTLRSDPRILRANVVKHDLTKK
FT                   LNSGSSIQQAVEAIKSS"
FT   gene            <855916..858538
FT                   /locus_tag="PICST_85046"
FT   mRNA            join(<855916..856090,856145..856763,856872..858538)
FT                   /locus_tag="PICST_85046"
FT                   /product="predicted protein"
FT   CDS_pept        join(855916..856090,856145..856763,856872..858483)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85046"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85046"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68149"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZF1"
FT                   /protein_id="ABN68149.2"
FT                   /translation="MDSSEGYNKENAITLISQSHPSTPPGLPLSSKRSLNSLNSLNGSP
FT                   LAYYTKKTDGSPSRSVSTSSASSTSLGSLQKEYNSLERRYTDLVLQNKSLLVEFTALEQ
FT                   DVHIKTTQLKEQAEKNRNYELFIKSIQDEHNKSSDLLTREISFYKELLQEVQSNLDKLT
FT                   AEFDSYRQKSIANSPSQEHDSQNDISYERLSKEYRALQSNFELEKTSKTVLIDQIDYLT
FT                   KENEALRMEQQRDSLASQNFISDDILDSSVIHDITHTIHTMNDYNDHNEINNNNSSNNN
FT                   NSNMISYLADELRNNHSSPIKAEYNTDESMEISRNFQFPPPEFAESNFLPKTEKLESSS
FT                   KIQFPPSPEPGVKEKRQSLPLHLRGSQCDEEFVLSPFKLANATISLIGNDDRVVPSVKR
FT                   YSSSKPNHNRYNSHEIVPIMVEFEPLESALRSTSVPEKAHHNNNSHKFDIINESSEGSV
FT                   ENSKTASARDGAFFALNGYDSKSNRNSATMMSSKRSSLISENYSNDITRHEITKLKFEL
FT                   QSLRLHNEKLLSYIGFELQKQKKNIKKLTKKQSTRTLRSYPSKKKMEYSDAKLIERSKE
FT                   MLIQKKRVLRSVSINAILSKKYHDNSGMRPTNAIGIIPTGLSPFANSLFTTFENEFEQD
FT                   EDGLSLHNDLGEDEYGFLTHNDRFSSRVFSNGLYAYLNFDENELDGDETADCDKERRIK
FT                   KYRSQVFEKSKFASSDDEAGEDGTDEATEVEKDDWEEISGESSSEEELGMITQIKYLMF
FT                   GASALSAKQKRKKDQHSLVDDGLKYKFFTIALGIMIIGLKFSHQHYDN"
FT   gene            <859633..>860166
FT                   /locus_tag="PICST_33523"
FT   mRNA            <859633..>860166
FT                   /locus_tag="PICST_33523"
FT                   /product="predicted protein"
FT   CDS_pept        859633..860166
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33523"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33523"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68150"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZF2"
FT                   /protein_id="ABN68150.2"
FT                   /translation="MYAKHIDDSVTKARINMVDTSNPDSAKIEASINRLHHHSHCNKEK
FT                   VEKLGAKQVRHRRRRLSQTVAEASSQVKPNPDTIPRTISSVSPTLSSSSTSGCGSGREI
FT                   SLEDGTKVCRNCPDCDKKKTPVEESHFPKVNIEVQEASTPMAELQRETEKLSLDTTNSI
FT                   NSIHTTEIDFTNVF"
FT   gene            complement(<860508..>861605)
FT                   /locus_tag="PICST_63020"
FT   mRNA            complement(<860508..>861605)
FT                   /locus_tag="PICST_63020"
FT                   /product="predicted protein"
FT   CDS_pept        complement(860508..861605)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63020"
FT                   /product="predicted protein"
FT                   /note="go_function 2-dehydropantoate 2-reductase activity;
FT                   go_process pyrimidine base metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63020"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68325"
FT                   /db_xref="GOA:A3LZF3"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZF3"
FT                   /protein_id="ABN68325.1"
FT                   /translation="MTKVLSIGLGGVGVMVAYTLHRNNGSKIDLTAVIRSDYDKVTKEG
FT                   YTISSVDYGGRRENGDANEAANQITGFKPHNVVKSLEEIESGPFDYIIVSTKVIPKDDA
FT                   NNVWDQVEKNKAKLLKPDSKTSIVLIQNGIDIESYWSNLKDEATFISGVSYISSTNNKG
FT                   TITHFSHDSLVLGLFDISKIHDDTASAALEKLIKLYSNDINTTKLDHNARYTRWKKLLY
FT                   NATYNTVCCLCDLDVGKVYELKDTDNIIDEVIYPLMKEVQLVANRDLSKYDYGEYNQII
FT                   EERQVVNMIKDTEFYDAPTYYQPSMLVDSRNGRLIELDIILGNIIKLYKKNSEDNRGKI
FT                   VQEIPYLNFLFLLLTMVQHRLRGNQ"
FT   gene            complement(<862199..>864136)
FT                   /locus_tag="PICST_33525"
FT   mRNA            complement(<862199..>864136)
FT                   /locus_tag="PICST_33525"
FT                   /product="predicted protein"
FT   CDS_pept        complement(862199..864136)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33525"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33525"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68326"
FT                   /db_xref="GOA:A3LZF4"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR026305"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZF4"
FT                   /protein_id="ABN68326.2"
FT                   /translation="MPPVKLPRATLEQKIQILDFYHQSNRPQSETVDRYKNEISISTSS
FT                   FSEWLKNEDDLRERLSSAGSSFSKKSRRKVKFKYEEINRAMDMLVKRRLERNEPINEPI
FT                   LREHWSIFAHQYGVEDPKRLVGFSHGWLSQFKKRHGLNKKRMSGTTVGGAGGMNHDSSS
FT                   SSSSPRPGNQQPAEEVYENYAGAEQESNEMTDGNTANGNLTNPNNTNATTAASNTNNNT
FT                   TVSNSSATNNTSSSNNRSNDHSVNGNPPSNSPATEFASATAANSSISSGSTQGPGYDLL
FT                   NPQLANPANASGTNSTGASNQFRPHQGLSFSNGNGNLNLNYVYKQQQQLQSHSQQAQAQ
FT                   RPAQTTSQSQKSHPSRLPQRFSDASDTTAPASYDYQQQLRARYERHQIEQRLTRSGTRG
FT                   TSSSKSQTSNRAGTASTANTGNTNNNNSTPPTTQAPTTHASLDTAPTAGTSTGSSLDVT
FT                   STISGSDIERFIYMFADRFFHDHQYEYPQTVAIFQEFKNSFFNERMINLRSIQQQQQQQ
FT                   QAQHVQHHAQQQQAQQQEKQQQAQQQHQQLLHQVQQMQQASSQQHITNIDDFFLRNVPP
FT                   TQTSPPSNSLAPVNGFVQSSHHHQLRGRNGNTLDPLMNSSLPRTRNPVIMNSDVPAVPH
FT                   GSKGWKDKLN"
FT   gene            complement(865576..866639)
FT                   /locus_tag="PICST_73864"
FT   mRNA            complement(join(865576..866048,866380..866390,
FT                   866594..866639))
FT                   /locus_tag="PICST_73864"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(865637..866048,866380..866390,
FT                   866594..866596))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_73864"
FT                   /product="predicted protein"
FT                   /note="go_component intracellular; go_function actin
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73864"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68327"
FT                   /db_xref="GOA:A3LZF5"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR017904"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZF5"
FT                   /protein_id="ABN68327.1"
FT                   /translation="MSRSGVAVADESLTAFNDLKLGKKHKFIIYTLNDSKTEIVVEETS
FT                   SETDYDVFLEKLPENECKYAIYDFEYEIGGGEGKRSKIVFFTWSPDTAPIRAKMVYASS
FT                   KDALRRALNGVAADVQGTDFSEVAYESVLDRVTRTSH"
FT   gene            <868528..>869910
FT                   /gene="XDJ1"
FT                   /locus_tag="PICST_49395"
FT   mRNA            <868528..>869910
FT                   /gene="XDJ1"
FT                   /locus_tag="PICST_49395"
FT                   /product="DnaJ subfamily A member"
FT   CDS_pept        868528..869910
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="XDJ1"
FT                   /locus_tag="PICST_49395"
FT                   /product="DnaJ subfamily A member"
FT                   /note="Molecular chaperone (DnaJ superfamily); go_process
FT                   protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49395"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68151"
FT                   /db_xref="GOA:A3LZF6"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZF6"
FT                   /protein_id="ABN68151.2"
FT                   /translation="MGLYEILEIESSASSADIKKAYRKLALRYHPDKATEEERHIAETK
FT                   FKEISHAYEILSDEARREEYDFYGTTDGIHGQSHMYGEPDGNPFENFYGGGGQQYDPRD
FT                   FYNFFNDMNGANGHRQSAGAKARTEDAEIEVDVTLEDLFKGKIIRTTSTRNIICTLCKG
FT                   KGAKKNAVPKKCNTCDGEGIVRKIRRVGPGLVTQEYVDCSACEGIGKFYRTKDRCKKCE
FT                   GKRVIEETKILEFEIVKGSHSGEKIVLSKESDEYPGKETGDVKLTFTTKDHPVFTRKGD
FT                   DLYAKYKIPLVEALCGFSRVLVKHLDGRGIKVSTPPGKVIRPGDYIKITGEGMPVKNGS
FT                   SGWFGGSSSKRGDLYIEMEIEFPTDNWYLERNDILKMKNLLPSAIKSKSDMSRQTVDND
FT                   SLPEANIEVFTDFTIAKQDALPDYKEDSPTPAPEEEHHNGYNGYNGYSGFDGSAQPECT
FT                   QQ"
FT   gene            complement(<870072..>870941)
FT                   /locus_tag="PICST_63748"
FT   mRNA            complement(join(<870072..870629,870672..>870941))
FT                   /locus_tag="PICST_63748"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(870072..870629,870672..870941))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63748"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63748"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68328"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZF7"
FT                   /protein_id="ABN68328.1"
FT                   /translation="MVSSKKSNVNRRRIPLGSKDQNQQIPSLNRAKTSLNTSAKHEATA
FT                   PVRKAIGPKKLPVLTKANSSLGFIHRKNEHIEVSKSRPPTTKITPQLNSDLFENSSGHS
FT                   SSNIVTDSLLKKSILPKDPVVDLNSTLSSATAQLHASNIINRDINANNVDPVKKTTMKT
FT                   KFEDRIELPEGIEDVEVETIADRPLPLESYPVDMVPFDDVDLEFFSKPSRTVVTDENRI
FT                   VYPEVVEAEKELKSMAIGDLQLEFDYENNDDDGEEMDITTVGLSIDDMKDLLD"
FT   gene            <871626..>880874
FT                   /locus_tag="PICST_49353"
FT   mRNA            <871626..>880874
FT                   /locus_tag="PICST_49353"
FT                   /product="predicted protein"
FT   CDS_pept        871626..880874
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49353"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49353"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68152"
FT                   /db_xref="GOA:A3LZF8"
FT                   /db_xref="InterPro:IPR029636"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZF8"
FT                   /protein_id="ABN68152.2"
FT                   /translation="MAFLSQFINVTSTSPEESSSWIYLVDWILALILSLTFVFYFNRFV
FT                   GYIISSLLKLLFWKSLGLRINVESIKISPLGGRIFAKNVTIISQDMAISVLNLTLTWRY
FT                   WLFKLTKLSNYYFDEGFPDSTTSRRVSRSENEELPCRLFLMVDGLEVFMYNRTFAYDNI
FT                   MDMLRGEEKDRKESTSDENSKNTASTMSADSGSTTNNLKYRGNTRTATVPEASTSDWSQ
FT                   NEKSQTQQPPQYRTKSAETTLFFLLGMLPLKVRVKKGAVVLGNVTTPSILVVSYKSANG
FT                   ILDISKSPNPLDKWRFLHDLNFENFQLWLKPNIGYEKHRYVSPDDLRHETKSTKNMNHY
FT                   KRYKYWYKFERAASVVQKAFHKLKRRKKGPDLDEDYGTSQWRGLRRYVGEDDRRMYAML
FT                   NMEEEYAKVSLILDSQNTRIVYYYDTPGAIPLGPVPYKNSGLHPEHGVELEVTQGTIHY
FT                   GAWADRQRVPLQGMFFPAIAKDAVETQLPTSPGEARQYAGFKLAIVVKDEVIFRVPTRE
FT                   LSKDKALLRKTASGATPKTSRSFGWIEVKMGAGSTISSFTSYIASKKEGWPNTLNVLFN
FT                   EPELRTSVNHDVLYAADSHEINARIGFPLQWNGRCNWKFDMVSENARIFFLREHTMLFS
FT                   DLFSDFASGEPTPYESFRVFVYNIGWELHDYKLYLNVNDANIINNPLDFNNNKYLSFQG
FT                   EKLNVDLNIPLLGKFSRSTEIGFKICTSYFDLVLDTPPWHTANAFMKDSKLMGKANNFT
FT                   VDGSYTFFNTVEVNTSDYIEIRCIGDYISVKFYGFVIKYLFLIRENYFGETIHFKTFEE
FT                   YTNEEQADTDGTSTLTTNNEAKTSASQEFDYWKILKTDNDIDIFFTFQVRHGLVILPYN
FT                   LYSCTSHFGLSFDSLDVDIRFSNYYMDLECDVSPINTVFVRECKATETDILFNIPKYRE
FT                   MYLSSKTPDIQFDGLTIHAHRMFGPPPEEITYYCKWDFAISDILFDSGMLSLAAVVTCV
FT                   RNFIFCYKDIENAMQVEIPLLWDATHLSFRCPHMEFKITPEKSSQDTSVACPYIMVTLD
FT                   SFIFNFNDNCNKRYNKLIEASLPSIDVKIIEPSNSSDGQDLILGYLKTSLVFSDICQKP
FT                   DMVERTRLQQHHIKFNDAPFHRSPFLIFPEGRDVEYNDPYGCLVSTLTLPDVSHPLSAS
FT                   FPGDLDEEEFNNYVYDSESSSNVTLQSEEDNTYFSKMPPRQDYDDADYNPSYKVDPLYD
FT                   YDNIVLELGEVQSFFTPKSLTCIARVASSSSDHSVDVLMDDFHIQIVKHLKVLLTSFHT
FT                   VVNLRLISPDISIQFGRFDTTDTESILCKSHNIPIAHFQLSELSLALNIKKSKTQIGSL
FT                   DDLDKEVSFAFHLKELLLTISNPSEFEIPLLFNIKEVEFWSSTHDDSIVSASVDTINLE
FT                   VNDDQVEWIIDFAESMRTEIETAMDEFEKNSFSEHDAFAELAYKLTLASIDYQIDHDPG
FT                   VLTKPAYILRSRKEHIRFIEGWQITARLRHVLNYLPCEWFETEGNNIGSRDWKLPESAY
FT                   DEVSMIFSRWRSWEANNEQRTNFFNKVFLADSSSDTNPVGLTTSVSEANFKIKKSRSEF
FT                   DYISAQEIGAILRFRENLSLGDLVPSLSTVDPVLGLEGVFNMSGYKSKISDISMNYLKR
FT                   ILAQIKVIEANNNEESQSDEKPKKFDTRPSFKLSIITNVNNFHQHVILPSTTFEIVGAS
FT                   INSSVDLALLQEFPDSIFLSASNGSDFYELNTWSGESRLVSLRSSNYFVLFSNVGEVIE
FT                   GIKNCKLSLGKFTFRILDENDILLHAIDNFLNVDLKYLQGLSNESDNFKKVNSTPRTEY
FT                   NMGLLEQIGDISLNINVGEFVWLFELLKPLNFGGIILDNNFSLSKVGSTITMDSLIGKI
FT                   NMNASLDTIQLLELQNSQILTKLKFSKVVDLYICSISSGVGYTKLFSPQLFRTIEKLAE
FT                   KSPDLMQRVNQLQEYLKFENKDRRGNALEKIEKKEPLEKDRLNILDKIAFKVKFTNDYI
FT                   GVSSFVENTKYSLEVENTSIRVSDVLGVFMEDDFGISHKVVPIYGDLIIPTARIYILDR
FT                   TVPVGLSNIMDVNFAVKLFNDHDSVQRKGRNFQLESQYCRICLGPSTLFKIVDLTDMLK
FT                   SSGTRLVNAISKCRPSESVPNKTESSSGSNGIQFSGIQILSYNFCLGWIFNNKSNEYPG
FT                   IILGAERFFAITENGLGKFTLMDAFLSVANGSRSSNFYSKQSERTNLNRAFLPRMQLTF
FT                   TTQKRDEKKTMEILIQGDELDVKFLSTSIVMTEYAVSSGNEVSKYFNARAERIAELTKQ
FT                   SQENSSSRSDNDEAKEYINTLKSAFDSIEVVAKFAGSTVLFHRLDNDEHGNTPSLFLHS
FT                   PAVKIAFKYDHHKFEKKKHVIKGEVLTSSSSNTLYAFCVPVVVDIVTGIKRMMRRANIG
FT                   DSNREKGKRIETVPASKGSMEFASLLGEMDIHFGLRIEKQELTLSCEPTAKVAAIVGLD
FT                   GIFIQLNSGDKVIPSLMLAVLFDSVSASLQHIYSREISGSVSIKKVLLSSAFEFNEIPS
FT                   VLSSGCIVDVDAYVNVKQYQDLELFKDIWFPSHYVELYSSFVASTEEQHKEVKQHRSEL
FT                   ASNKNLSTRFKEVSTSYAMPWIVTFFVTNFCVQVDFGPSLCNSKLKFDRFWAVSKKSTD
FT                   WSQDLKAGINCISLEAEGRLGGHFSISQMNIHTAISWKLESGATLDVPLILISAGTEKL
FT                   QLKLSFDYHVFAIANIEDFSVDVFNQKSEISISKDHLSVATKFNTAEVYITSLTASNCL
FT                   DIYNTISRMIQENRRSYKETLVDSSRERNVKDKRTAEVVSDAILETVKKLETKIEVIAG
FT                   HLLIHVYPTSFDDSKVLVVKLDESKANFQQNEYSSGISNELEIKFNDLVVSLSITSPVS
FT                   ESFIAQCSVDEFVDYAYKARGGTIFIFPSFKISMRTFQKYDELLIEYLYQSSFDGTVDI
FT                   RWNLGSVNFIREMFAIHKKALESRMEYKKHATEGFREDIFATQGTKTSSLLQEDDESED
FT                   PTDAIKEAINESIDKVSQGSKYIYSPLAPPIIEAPQLKELGNATPPLEWFGLNRDKFPN
FT                   VTHQLGIVTLQKLIHEVESRYSKVLGKA"
FT   gene            complement(<881149..>881331)
FT                   /locus_tag="PICST_23459"
FT   mRNA            complement(<881149..>881331)
FT                   /locus_tag="PICST_23459"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<881149..>881331)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_23459"
FT                   /product="predicted protein"
FT                   /note="go_component intracellular; ribosome; go_function
FT                   structural constituent of ribosome; go_process protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_23459"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68329"
FT                   /db_xref="GOA:A3LZF9"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZF9"
FT                   /protein_id="ABN68329.1"
FT                   /translation="SSPLQTFMGLVQRRFKSRGNTYQPSTLKRKRTFGFLARLRTKNGR
FT                   KILSRRKAKGRWYLTH"
FT   gene            <881797..>882381
FT                   /locus_tag="PICST_37052"
FT   mRNA            <881797..>882381
FT                   /locus_tag="PICST_37052"
FT                   /product="predicted protein"
FT   CDS_pept        881797..882381
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_37052"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_37052"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68153"
FT                   /db_xref="InterPro:IPR013239"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZG0"
FT                   /protein_id="ABN68153.2"
FT                   /translation="MSSTFRPRRVVPNAVNTPILTKIQTSSSINNSEAEQILSEFIYAS
FT                   EAVAASFTSSSLVDNEAGSATGFSDSAGSNALLSQLKRVQRDLRGLPPLVAEPTAVVTS
FT                   SRDNKKIKFDDDDVEVEEPKNKKIKFDSEEPAEEVPEYEEEQEEKQEEHEQEEVTVIEE
FT                   EESEKKHKKEKKEKKQKKEKKEKKHKKEDKE"
FT   gene            complement(<887320..>888429)
FT                   /gene="DUS4"
FT                   /locus_tag="PICST_33532"
FT   mRNA            complement(<887320..>888429)
FT                   /gene="DUS4"
FT                   /locus_tag="PICST_33532"
FT                   /product="dihydrouridine synthase"
FT   CDS_pept        complement(887320..888429)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="DUS4"
FT                   /locus_tag="PICST_33532"
FT                   /product="dihydrouridine synthase"
FT                   /note="go_function oxidoreductase activity; FAD binding;
FT                   go_process tRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33532"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68330"
FT                   /db_xref="GOA:A3LZG1"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZG1"
FT                   /protein_id="ABN68330.2"
FT                   /translation="MTSLSDDLQNLTITEDLQLHEPSSKTKHTISPRNPEHNPLYILKN
FT                   VRKTQNRPAFVAGPMVRYSKLPFRELVRNYNTDIVYTPMILAREFVRNDIARSSDFTTN
FT                   DKDRCVIVQVGSNNVEDLLKFVEMIHPYVDGIGLNCGCPIKEQVREGIGAALMSEPDLV
FT                   ASMVKAVKEKYGNTVCIETKIRIHPNLDETIAFVKKVEASGVDFITVHGRTKNTRSSQP
FT                   ANWDAIKLIKETVSVPVVANGDCFSLEDAYSIAEHTGVDGVMSARGILSNPALFAGYKK
FT                   TPWAAVEFFWDLATSYGLPFRIIQHHLSEMLDKVIPRKSLKEMNETTCLIDMIDWFDTH
FT                   FILKRRGDKGFATATEPSWKINREEAAHI"
FT   gene            complement(888704..891604)
FT                   /locus_tag="PICST_73625"
FT   mRNA            complement(join(888704..891020,891351..891604))
FT                   /locus_tag="PICST_73625"
FT                   /product="predicted protein"
FT   CDS_pept        complement(888934..890844)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_73625"
FT                   /product="transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73625"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68331"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="InterPro:IPR027353"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR038336"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZG2"
FT                   /protein_id="ABN68331.2"
FT                   /translation="MSEVVPETNTPVQTPSSETHFHKSDTAIVNEYKKMTPEEPEKPLS
FT                   PPNPSPSPEKRKLEVDENEESKRQKYDSEAPEAVANEAAPNSINVEESKEASPVVPATA
FT                   GTAVFSEPAPKPAAEPDMDNLPANPLPPHQAKFALNTIKAIKRLRDAVPFLHPVDIVKL
FT                   NIPFYYNYIPRPMDLSTIETKVHVNAYEDSNQIVEDFNLMVANCKKFNGENAGISKMAD
FT                   NIQAHFEKHMLNFPPKVLPSAVAAAKPSATGLASKRRTEADAVKQQQRESVAAHRPKRT
FT                   IHPPKSKEIPYDTKPRKKKFAAELRFCSQTVKELMSKKHNGYNFPFVAPVDPVALNIPN
FT                   YFKVVKEPMDLGTIQSKLTNNQYENGDEFERDIRLVFKNCYIFNPEGSEVNMMGHRLEA
FT                   VFDKRWAARPVPEPTPVNSEIEDSEEESSDGEDEESEINESMLSDVPAIQFLENQLLRM
FT                   KKELDELKKEHLKKLREQQAARKKKRKSKKAAAKKSSAPPRAPSISSTPVVTYEMKKQV
FT                   SEMVPNLSDKKLQSLIKIIKDDVEISNEDEVELDMDQLEDRTVLKLYNFLFGKKASAKL
FT                   AKKPKKPVITNSVDELAHLRSQLALFDDDNNNGSTNGFMNIGNDHESSEDDLSSESSEE
FT                   E"
FT   gene            complement(894477..>894887)
FT                   /locus_tag="PICST_79344"
FT   mRNA            complement(894477..>894887)
FT                   /locus_tag="PICST_79344"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<894477..894746)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_79344"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_79344"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68332"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZG3"
FT                   /protein_id="ABN68332.2"
FT                   /translation="MATYKQRCQSLSRDLAKLDKQYESSSRKLHILSSWYEQILNLFAS
FT                   KVTQNGEAIDEKLLVKLSDNDDDELKTRRSLLLSVLTPLIENSKA"
FT   gene            <896020..>898857
FT                   /gene="ROT2"
FT                   /locus_tag="PICST_85073"
FT   mRNA            join(<896020..898561,898604..898708,898769..>898857)
FT                   /gene="ROT2"
FT                   /locus_tag="PICST_85073"
FT                   /product="glucosidase II"
FT                   /note="Has EST support"
FT   CDS_pept        join(896020..898561,898604..898708,898769..898857)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ROT2"
FT                   /locus_tag="PICST_85073"
FT                   /product="glucosidase II"
FT                   /EC_number="3.2.1.20"
FT                   /note="Reversal of tor2 lethality. Involved in
FT                   Beta-1,6-glucan synthesis Glucosidase II catalytic (alpha)
FT                   subunit and related enzymes, glycosyl hydrolase family 31;
FT                   go_function hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds; go_process carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85073"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68154"
FT                   /db_xref="GOA:A3LZG4"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZG4"
FT                   /protein_id="ABN68154.2"
FT                   /translation="MRLQSVLLWIFCFSSVLAVKEYLFKNCDNSGFCHRNKHYANQIKS
FT                   LGSAFVPHYAIDPSSVHLQESGQDFHIAGTIIKKVPNIPDLQVELPITVSLLEGNNVRV
FT                   QIDESGRNQITVKNKYVNHRRYNETGQWAFASEELPYISKKDVKLDISSDKLSFTYGPA
FT                   QEYTAELQFLPVKLTISYKDEPQVVVNDQNFLNLEHWRVRDANAEHLSDEQVDFDMFTD
FT                   SFGDSKEDKLPLGPESIGLDFTFKNYKNLYGIPEHADSLNLKDTTGSNQPYRLFNVDIF
FT                   EYETDSRLPMYGAIPLLLAVRPELSVGLFWINSADTFVDLDKNSDSGDSRTHWISENGV
FT                   IDFMIIVDKTPAAINKNYGLITGYVQLPPLFSLGYHQCRWNYNDEKDVLEINSLMDKHR
FT                   IPYDTIWLDIEYTDSKKYFTWQNDVFPDPEGMMKELDATGRNLVVIIDPHIKTGYPVSD
FT                   QFRKQKICINDATNTSYLGHCWPGESVWIDTLNPNAQALWDSQFVWDKKNKFTGGLSTN
FT                   LHIWNDMNEPSVFNGPETTSPRDNLHYGGWEHRSVHNIYGLSYHEATYNSLKKRQSHTT
FT                   RERPFILTRSYYSGSQRTAAMWTGDNMSKWEYLQISLPMVLTSNIVGMPFAGADVGGFF
FT                   GNPSKELLTRWYQAGIWYPFFRAHAHIDSRRREPWVAGEPYTSIMTDAVKLRYSLLPML
FT                   YTAFYESSVSGIPIMKPVFYEALDNLESYSIEDQFFVGNSGLLVKPVVEKEADDIEIYL
FT                   PDSEVYYDFTNGNITGDITKFQLNKPGYVKRAVTLNDIPVFLKGGSIIAQKNRYRRSSK
FT                   LMVNDPYTLIVAPDSNGNANGKLYIDDGESFGYTKGLSAKVSSIDVNYVGSLSSIEIEK
FT                   IVIISQPQSQINKLIIHNPKLKVAADWSATFATDVEHDEL"
FT   gene            complement(898914..>900156)
FT                   /locus_tag="PICST_90954"
FT   mRNA            complement(join(898914..899381,899451..>900156))
FT                   /locus_tag="PICST_90954"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(898914..899381,899451..899993))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_90954"
FT                   /product="predicted protein"
FT                   /note="go_component intracellular; go_function nuclease
FT                   activity; go_process DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90954"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68333"
FT                   /db_xref="GOA:A3LZG5"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR027520"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LZG5"
FT                   /protein_id="ABN68333.2"
FT                   /translation="MPRRPSTGTQSDTPALHVVPSFYGVYLLQSEPKPSSFYIGSTPDP
FT                   PRRLRQHNGDLKAGGAYRTKRAGFRPWRMLLVVYDFPSKVSALQFEHSFQHCHETRHIK
FT                   QEERISKNKLSGRTLHHKVANVALLLRSSYFRHLPLKVLVFEEAVYNSFMNNKFVTCSH
FT                   VDLLNTNFNEYFSVMEKDLDSTVDSWKTRHTNENEIWSMAKEAVILGSPRCALCLEPIE
FT                   QVPETSSPISKRSDLQRYLQSESLPLVTMCYNPQCRDVFHLSCLGHRFTNSDGFQSLIP
FT                   ATVNRCCSCNAKLEWRTLAKIATKLRYYVLKDSLQLPSQVLENDDNYESQNVNDS"
FT   gene            902241..904543
FT                   /gene="SKN7"
FT                   /locus_tag="PICST_66106"
FT   mRNA            join(902241..903440,903855..904543)
FT                   /gene="SKN7"
FT                   /locus_tag="PICST_66106"
FT                   /product="Protein with similarity to DNA-binding region of
FT                   heat shock transcription factors"
FT   CDS_pept        join(902701..903440,903855..904380)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SKN7"
FT                   /locus_tag="PICST_66106"
FT                   /product="Protein with similarity to DNA-binding region of
FT                   heat shock transcription factors"
FT                   /note="Sensory transduction histidine kinase; go_component
FT                   nucleus; go_function two-component response regulator
FT                   activity; DNA binding; transcription factor activity;
FT                   go_process two-component signal transduction system
FT                   (phosphorelay); regulation of transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_66106"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68155"
FT                   /db_xref="GOA:A3LZG6"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR014402"
FT                   /db_xref="InterPro:IPR027725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZG6"
FT                   /protein_id="ABN68155.2"
FT                   /translation="MSHPIKSEPSLSASVSSTASSNQSGSNDFVKKLFLMLQEDSYKDV
FT                   VRWTANGDSFVVLNTNEFTKEILPRHFKHSNFASFVRQLNKYDFHKVKVSNEEKMVYPY
FT                   GEDAWEFKHPDFKINDRGSLENIKRKGPSSKKISSANTITNGGDFTSSSSVACNHNLSQ
FT                   ITTAQSHLKDQVEQLRAENKQLHQDVNVLQTKYKTLIENIVAINTFDERYHRSMGILIN
FT                   CLLQAGIKLPPLDFPNPALMSLQQPTTGLVAQTTTTNIPNPKFHVLLVEDDNVCIQLCR
FT                   KFLVKYGCQVTVVTDGLNAISTVEHTKYDLVLMDIVMPNLDGATATSVIRSFDTKTPII
FT                   AMTGNIEDNDLVTYLQNGMSDILAKPFTKDDLYSILSKHLLTDESKTAAAVGVTSRNIS
FT                   ISGPTLPAESDEDPLLKKQRLQ"
FT   gene            complement(<904609..>905211)
FT                   /locus_tag="PICST_49748"
FT   mRNA            complement(<904609..>905211)
FT                   /locus_tag="PICST_49748"
FT                   /product="predicted protein"
FT   CDS_pept        complement(904609..>905211)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49748"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49748"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68334"
FT                   /db_xref="GOA:A3LZG7"
FT                   /db_xref="InterPro:IPR012942"
FT                   /db_xref="InterPro:IPR040044"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZG7"
FT                   /protein_id="ABN68334.2"
FT                   /translation="FTTIRCLALGSPSNSRNALYQLAYVVEIAKFFDIDRVSMYDPVFT
FT                   SKDVYLLESMKYVVEESTESEPKETLYFIPHAPLELTNVILNNEKPAYILGNDIVSHTD
FT                   RYTKQKLYDTYPTISYLVHLTQKSRDKSHVVDDNEDFVPVTKRKKRGKKAFQEPTLNYD
FT                   GQEWYFMTATVSRFVESFRKNDDWGNSFSDLAYHVLE"
FT   gene            906238..907808
FT                   /gene="PRS2"
FT                   /locus_tag="PICST_66107"
FT   mRNA            906238..907808
FT                   /gene="PRS2"
FT                   /locus_tag="PICST_66107"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /note="Has EST support"
FT   CDS_pept        906397..907650
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PRS2"
FT                   /locus_tag="PICST_66107"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="go_process nucleoside metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_66107"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68156"
FT                   /db_xref="GOA:A3LZG8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZG8"
FT                   /protein_id="ABN68156.2"
FT                   /translation="MRKCKIFVGSSHPELGRLVCERLGVEPAPCTLKKFSNGETSVQIG
FT                   VSIRDEDVYIIQSGSPEINDHIMELLILISACRGGSANKITAVIPQFPYSKQSKMKKHR
FT                   GAITARMLANLLVMAGADHVVSMDLHASQMQGFFTKPVDNLFGAPTLARWIRHNIPDWE
FT                   SAVVVSKNPGGTKRVTALADSLKINFAMIHTDRRRTQDGYARRKALKNSFRKNDDDDDE
FT                   EEDNIVSEIQTARIVQGHVVNDDYPVSNGTSNGIKDNSDSLDKTSILDSDVLGGSYDAA
FT                   NSDDEDEPTSINQEKLITLVGDVKDKVAIILDDMIDKPSSFIAAAEHLRLNCGAKAVYV
FT                   VGTHGVFSDLCLEELTNSKCIDKIVVTNTYPIGRERMEKYKSKLTVIDVSPIFAECIRR
FT                   DHFGESISVLFDSLAAIE"
FT   gene            908621..>910066
FT                   /locus_tag="PICST_85324"
FT   mRNA            join(908621..909565,909581..>910066)
FT                   /locus_tag="PICST_85324"
FT                   /product="predicted protein"
FT   CDS_pept        join(908939..909565,909581..>910066)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85324"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85324"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68157"
FT                   /db_xref="GOA:A3LZG9"
FT                   /db_xref="InterPro:IPR037446"
FT                   /db_xref="InterPro:IPR040557"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZG9"
FT                   /protein_id="ABN68157.2"
FT                   /translation="MSPLSLNNSGQYHDTTEGSSAGTDTSISEKLTAASPYVAAEAPAA
FT                   SPATSQPAATDSTNTISPTRISLPPPAVPASLPLPGSSSSSSTTTGVYGVSNLPLNPYP
FT                   LPSPATEKAIASIAPMLESFAPKTSAEESGVPTSTINSSSSSPQYSRVGSYSNEFIMDH
FT                   QPKLTSDNLNAAFRSRNNSTNAGTVASDTVKLDKTMSNSSSTSRKSEFEGPKLPKIGKI
FT                   GVCAMDAKVLSKPCRRILNKLIENGEFETIIFGDKVILDEAIENWPTCDFLISFFSGGF
FT                   PLDKAIAYVNYRKPYIINDLVMQKALWDRRLVLTLLNYANVPTPERLEISRDGGPQLEA
FT                   QLREKLTEVGMSESQLEELTNQSEPEWEMVD"
FT   gene            complement(911831..919523)
FT                   /gene="FAS1"
FT                   /locus_tag="PICST_85125"
FT   mRNA            complement(911831..919523)
FT                   /gene="FAS1"
FT                   /locus_tag="PICST_85125"
FT                   /product="Fatty acid synthase subunit beta Includes:
FT                   3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase;
FT                   Enoyl-[acyl-carrier-protein] reductase [NADH];
FT                   [Acyl-carrier-protein] acetyltransferase;
FT                   [Acyl-carrier-protein] malonyltransferase; S-acyl fatty
FT                   acid synthas"
FT   CDS_pept        complement(912978..919205)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="FAS1"
FT                   /locus_tag="PICST_85125"
FT                   /product="Fatty acid synthase subunit beta Includes:
FT                   3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase;
FT                   Enoyl-[acyl-carrier-protein] reductase [NADH];
FT                   [Acyl-carrier-protein] acetyltransferase;
FT                   [Acyl-carrier-protein] malonyltransferase; S-acyl fatty
FT                   acid synthas"
FT                   /note="go_component fatty acid synthase complex"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85125"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68335"
FT                   /db_xref="GOA:A3LZH0"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR013565"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016452"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR032088"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="InterPro:IPR040883"
FT                   /db_xref="InterPro:IPR041099"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZH0"
FT                   /protein_id="ABN68335.2"
FT                   /translation="MPSTTSFHRPFSLNHGSIEHTLLVPNDLFFNYSQLKDSFIKTLPE
FT                   VTEGFADDNEPSSPAELYGKFLGFIASLVTPNQPGQFDQVLKLSLQDFTSRFLKSHNDN
FT                   IHAFAVTLLADDVNYPTTPAKIKDNIIKNYYNAVINSNTKIDKVVSNLLYQAEAGDAKL
FT                   VAIFGGQGNTDDYFEELRDLYKLYKGLIHDDLIEPFAAKLAKLVKQDSAFDKIYTQGLN
FT                   ILSWLSNPEQTPDQDYLLSVPVSCPVICIIQLCHYAITCKVLGLTPGELRSYLNAGTTG
FT                   HSQGLVTAVAIASSDSWDSYFENSLKAISLLFFIGSRCLMSYPRTTLPPTMLQDSLENG
FT                   EGRPSPMLSIRDLSASQVEKFIDETNKHLPQEKHITLSLINGARNLVVSGPPESLYGLN
FT                   LTLRNKKAPNGLDQSRIPHSQRKLKFSNRFLPIFSPFHSPLLDNATIAILEDVEAENLN
FT                   FPKKDIKIPVYDTFNGENFQDYDESSTSIIERVVRCITQLRVNWELATAVQATHMLDFG
FT                   PGGVSGVGILTHRNKEGTGSRFIIAGSLEASAFDDEYGFKHEIFHTSPSKNVKRAQNWL
FT                   TEFKPTLIKNNSGKIFVNTKFSQLLGRAPLMVPGMTPTTVNPEIIAASINAGYHIELAG
FT                   GGYFHGPGMEAAIDEVVSNIKPGFSFGINLIYVNPRMLQWGIPLIKELRERGYPIQSLT
FT                   IGAGVPSLEVCTEYIEELGLTHLGLKPGSIDAISQVISIAKAHPNFPIVLQWTGGRGGG
FT                   HHSFEDFHQPILQMYSKIRRCSNIVLVAGSGFGSDEDTYPYLTGSWAAEFNYPAMPFDG
FT                   VLFGSRVMTSKEAHTSLEAKKLIAQCDGVADSHWENTYKKPSGGIITVRSEMGEPIHKI
FT                   ATRGVMFWKELDDTIFNLPKNKLLEALNKKKDYIIDKLNKDFQKPWFGKNSQGVCDLQD
FT                   MTYQEVANRMIELLYVKKSDRWVDISLRNFFGDFLRRTEERFTSSSGSISLIQNYNQLA
FT                   TKPQQFSDDFFNHFPVAKDQLISEEDCDFFLMCALRPTQKPSPFVPVLDERFELFFKKD
FT                   SLWQSEDLETVVDEDVQRTCILHGPVAAQFTNKVNEPIGEILDSIHEGHISKLVKDYYN
FT                   GDATKIPVVEYFGNTAPVKFESLANVDINRSSDKIVYKIGATLPAKKCWLKLLAGEQIN
FT                   WLQAFISTDRIVQGSKHISNSVHDILTPAANSVVEISHPLDATKTTLTVSEPVKGDLKP
FT                   VVEIKLAKANTIQLSLIEHRTADSKPVALPFLYTYNPNDGFAPILEVMENRNDRIKNFY
FT                   WKLWFGADVPYDLNINVQEEIIGEEITITGQDISEFTHAIGNKCDAFVTRPGKVTLAPM
FT                   DFAIVIGWRAIIKAIFPESVDGDLLKLVHLSNGYKMIPGAAPLKKDDVVSSKAEIRAVL
FT                   NQPSGKMVEVVGTIYREGKPVLEVTSQFLYRGDYSDYENTFQKVTETPVQIAFKSPKDL
FT                   AILKSKEWFHLEKDVELLDQTLTFRCKSTYKFKSAQVYSSIITTGQVYLELPTKEVIQV
FT                   GTIEYEAAKSYGNPVTDYFARNGKTIEEAVKFENVIPLSSGEELTSKAPGTNEPYAIVS
FT                   GDYNPIHVSRVFAAYAKLPGTITHGMYSSASIRGLVEEWAANNVASRVRAFSCSFVGMV
FT                   LPNDTLQTTLEHVGMINGRKIIKVETKNVETDIPVLVGEAEIDQPITTYVFTGQGSQEQ
FT                   GMGMDLYKSSEVAREVWDKADRHFVNNYGFSILDIVQNNPNELTIHFGGAKGRKIRDNY
FT                   IGMMFETIGEDGAIKSEKIFKDIDHTTTSFTFVSPTGLLSATQFTQPALTLMEKAAYED
FT                   IKSKGLIPSDIMFAGHSLGEYSALSSLANVMPIESLVDVVFYRGMTMQVAVPRDELGRS
FT                   NYGMCAVNPSRVSPTFDDAALRFVVDEVSDKTKWLLEIVNYNVENQQYVTAGDLRALDT
FT                   LTNVLNVIKLNKIDIVKLQQTLTLDQVKEHLSEIITEVSAQSIAKPQPIDLQRGFAVIP
FT                   LKGISVPFHSSYLMSGVKPFQRFLCKKIPKSSVKPNDLIGKYIPNLTAKPFEITKEYFQ
FT                   EVYELTKSDKIKSILENWDSYEKA"
FT   gene            complement(920602..921668)
FT                   /gene="PNU1"
FT                   /locus_tag="PICST_79520"
FT   mRNA            complement(920602..921668)
FT                   /gene="PNU1"
FT                   /locus_tag="PICST_79520"
FT                   /product="Mitochondrial nuclease"
FT   CDS_pept        complement(920687..921664)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PNU1"
FT                   /locus_tag="PICST_79520"
FT                   /product="Mitochondrial nuclease"
FT                   /note="Nuclease 1, mitochondrial precursor (NUC1);
FT                   go_function nucleic acid binding"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_79520"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68336"
FT                   /db_xref="GOA:A3LZH1"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR018524"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR040255"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZH1"
FT                   /protein_id="ABN68336.1"
FT                   /translation="MSKVLVNTLGLGTVGVASFFWGRSSTPADVATESKTDSKNLPAIV
FT                   NGGNGAPDKALFNPELVKPSQFFKYGFPGPIHDLQNRSEFVSCYNRQTRNPYWVVEHIT
FT                   KESVQRGSGVDRKNSVFKEDEAIPAKFRSRLRDFFRSGYDRGHQAPAADAKFSQVAMDE
FT                   TFYLTNMSPQVGDGFNRDYWAHFEDFARRLTNRYDNVRIMTGPLFLPKRCDDGKYRVTY
FT                   EVIGSPPNVAVPTHFFKLIVGENNGDDRISVGAFVLPNERIDNTDDLTKYQVPVEALER
FT                   STGLELLQKVPFSKKKDLCREVKCEILVREFPKQAKNVLALPGK"
FT   gene            <924063..>925325
FT                   /locus_tag="PICST_63754"
FT   mRNA            join(<924063..924129,924154..>925325)
FT                   /locus_tag="PICST_63754"
FT                   /product="predicted protein"
FT   CDS_pept        join(924063..924129,924154..925325)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63754"
FT                   /product="predicted protein"
FT                   /note="go_function pepsin A activity; go_process
FT                   proteolysis and peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63754"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68158"
FT                   /db_xref="GOA:A3LZH2"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="InterPro:IPR033876"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZH2"
FT                   /protein_id="ABN68158.2"
FT                   /translation="MVSVLSFTRQVFLTLALSLLVNDSVALDKRSPGFLKLDFTVARGQ
FT                   GKESLNLTSTNKPYFVYHEKSKRATGEPEVTLINEKTFYATDLEIGSNKQAVTTLIDTG
FT                   SSDLWVVDKSAKCQVTETGQSSTYCYEYGVYDHTKSSSYHSLGSKFSIEYVDGTSSTGT
FT                   WVKDDVYFAGTTTGVTQLQFGDVTTTSSGFGVLGIGYEANESTNTEYPNLPVLLKTQGV
FT                   IAKTAYSLYLAQEDATSGSVIFGGIDQAKYSGSLITLPVTSSRELAIHLGSVAINGKTI
FT                   SANLNPVLDSGTTLTYLPTKIVASIASALSGTADSSVGYIINCNQPSNKYLTFNFDSGA
FT                   TINVPLSELAIDLYLTNGQKYQYCALGVFATSSTPILGDNFLRSAYVAYDLDDNTISLA
FT                   QVKYTTAENIVPF"
FT   gene            complement(<925507..>927063)
FT                   /gene="GPI17"
FT                   /locus_tag="PICST_33544"
FT   mRNA            complement(<925507..>927063)
FT                   /gene="GPI17"
FT                   /locus_tag="PICST_33544"
FT                   /product="Glycosyl Phosphatidyl Inositol 17"
FT                   /note="Has EST support"
FT   CDS_pept        complement(925507..927063)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="GPI17"
FT                   /locus_tag="PICST_33544"
FT                   /product="Glycosyl Phosphatidyl Inositol 17"
FT                   /note="Glycosyl Phosphatidyl Inositol 17 GPI transamidase
FT                   complex, GPI17/PIG-S component, involved in
FT                   glycosylphosphatidylinositol anchor biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33544"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68337"
FT                   /db_xref="GOA:A3LZH3"
FT                   /db_xref="InterPro:IPR019540"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZH3"
FT                   /protein_id="ABN68337.2"
FT                   /translation="MTETESENGLKVQNQEVPESDTIAYIRRLIVFIVALTVLGLGYPV
FT                   LQFTTAIYRADLPVDEITSLASTLHNDISFKIPVYLDIPTTLDVFIPDSQEKLNQFVNS
FT                   KYPELANFWSLDLKKITPGIDPEIDYVVKLVQDENENGDDAVDMSPFSKETTLKVSQNW
FT                   IDSKLVDQVLSSVLVDMVFKEEISELVSIINNRAKELDKNIVVPYSPNYNLVFSLLVEN
FT                   GRTVKWDIETALKQMKPFLNKLTHYTNFSISTQVQYYSKTEKPVVFDEKKNAYILKESD
FT                   LSTFINFGDWNLNTHDMDPSINFLVYFPESNYENKPWVIDHLDNGAFLVKQWGGVYIFN
FT                   KEKPILEGYDVNITELELIPILEIFTSQLFQLLGLATFPKSPSMRVDTLTRLTLFKNLK
FT                   KTLENLHSLVKLTVSLNEISIPDETKEHVLKSIELVKLAISEINQKQNYHNSMTISSKA
FT                   LTISDRAFFDKEMVQQAYFPNEHKMAVFLPLLGPVTSILAIALIKILVSFKTGLKKKKA
FT                   D"
FT   gene            <927376..>929103
FT                   /locus_tag="PICST_49944"
FT   mRNA            <927376..>929103
FT                   /locus_tag="PICST_49944"
FT                   /product="predicted protein"
FT   CDS_pept        927376..929103
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49944"
FT                   /product="predicted protein"
FT                   /note="go_function translation initiation factor activity;
FT                   go_process translational initiation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49944"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68159"
FT                   /db_xref="GOA:A3LZH4"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="InterPro:IPR036885"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR039757"
FT                   /db_xref="InterPro:IPR039759"
FT                   /db_xref="InterPro:IPR041366"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZH4"
FT                   /protein_id="ABN68159.2"
FT                   /translation="MFKKDPQPKASANIKSSERRKLLQNICNVYGLVQDELAKEATVAL
FT                   LPNNTKQAAFKSVQGYSGTIYSDDNETPTWFKSRDSQIYPSLFTVWKCPYLLPTVKTHP
FT                   HVIGVLEGGADLMLPGTIPPFDKRCVKGVVVGVVDSANPTVIKAIGRCKLNLTQFDTVV
FT                   GRTGVAVEILHHIDDELYKLNKFVDIDIPEELDTKIPLKEAESELAPENEDNEEIAQEN
FT                   KDEIVPEPKETAVSQGTQSYNIDDVAEQVSSLTVEEVDNFFTRSLLQTIKLEDIELPII
FT                   SSTFMSLYIYKNLPVIDSSYCNIKRTSWKKTSKFLKAMVKLKYLDVKGKDEDLTIIKLL
FT                   DKKNPLVENFVPHKTMGKLNSASQGPTQSKKANELSVVSLYKPTNKSRMFFNKVDQVFN
FT                   NYFTSSELRSLLEKYIKSENLSNPKNPKTIVLDDNLLSITGGERVSPRDQVFKAFLANF
FT                   SPHYQINEPGASGKKGEVKRGQPPKILIITEMKIGRKVITRVSNFEDFYIKPHLLSEEL
FT                   KVKCSGSSTIGPYVQNPKITEVTVQGPHGKLIIEMLKEKGVPVTCIEFQDKVKKGKKR"
FT   gene            complement(<929333..>932245)
FT                   /gene="FBX1"
FT                   /locus_tag="PICST_63653"
FT   mRNA            complement(join(<929333..930651,930709..930817,
FT                   930926..931566,931708..>932245))
FT                   /gene="FBX1"
FT                   /locus_tag="PICST_63653"
FT                   /product="Leucine rich repeat protein, contains F-box"
FT                   /note="Has EST support. strong"
FT   CDS_pept        complement(join(929333..930651,930709..930817,
FT                   930926..931566,931708..>932245))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="FBX1"
FT                   /locus_tag="PICST_63653"
FT                   /product="Leucine rich repeat protein, contains F-box"
FT                   /note="F-box F-box domain"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63653"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68338"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZH5"
FT                   /protein_id="ABN68338.2"
FT                   /translation="DNTKNSNNANGNVPPDFFNRLQTFPLFNKAPKSFHTKVASKLTLM
FT                   QYHPQEYIIKKGDPSKSMYWILKGTVSVTSTDGESIYAELAAGSFFGEIGILFNRPRTA
FT                   TVVARTKVLVGVLTSDALNTVLKHYPLIERRIRDEAQERLAMQDKKNKYDLPNLISNKM
FT                   IESAPSLPPIRNGINANATISIQDFIKNLPIFQNLPSTIIHQLALGVEPINFNAFEYII
FT                   HKGDTNSDIYFIINGEVEVIDYSRNQEGAHIERILARLSSGSYFGEMSFLSFLNDKHSD
FT                   CVRSASIRSISTVELMVVKSDKLEDLCEKYPFIVDDMRKTAEERNKLNNSINSKGSEHD
FT                   NKTRLSIDYIIHKQDKDRSDEEESSHDTSEKSSPEKSPSSQPNLQHPQSQRVGSPSVSP
FT                   ISSDAKMSTSTRNTSFADEPFSRKRKSVSNIVPSVNYFQNFQFANSTSNRNAFQYMPHN
FT                   KRIRLASISGTGRRRSSILSNNGPLPDRILLRVFEFLSLPELMKLRIISRRWRQLLSVA
FT                   SNLCTNLDLTPWNTSIDDQALISITDFVGTRPQQINISNCFHITDEGFSYMVNEIGISG
FT                   NIKVLKMKSNWEVSAMAIMDLTVPSVGGYLEEIDLSNCRKVRDIVLERLLGWDSSAIKE
FT                   ELSQQQNINGSSPEIDHDLDQIGCKSLKILNIGYCKHLTDNVMQHIANHASQRLESLDL
FT                   TRCTAITDRGFQYWTYKSFPNLKKLSLKDCTFLTDKSIISIANSATNLEILDLNFCCAL
FT                   SDIAIEVLCLGCPNIRELDLSFCGSAVSDSSLVAISLHLRSLEKLILKGCVRVTRAGVD
FT                   ALLSGCSPLSYINISQCKNAHIYPGNIPAQKLNVNPQTKSAFVTAGSNQNIIEIVI"
FT   gene            <934449..>935258
FT                   /locus_tag="PICST_33547"
FT   mRNA            <934449..>935258
FT                   /locus_tag="PICST_33547"
FT                   /product="predicted protein"
FT   CDS_pept        934449..935258
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33547"
FT                   /product="predicted protein"
FT                   /note="go_component intracellular; ribosome; go_function
FT                   structural constituent of ribosome; go_process protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33547"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68160"
FT                   /db_xref="GOA:A3LZH6"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZH6"
FT                   /protein_id="ABN68160.2"
FT                   /translation="MLSTVTKSRSVATCVRGFASSAIAYKPKDAQQEAKRKLRREQAVK
FT                   QRNKQAPESHPLYMTVPQAMRYLRAAEVGQPAKKTTVSILMTVLPERGSKPLAGSVYFP
FT                   KPIKESHVMIFSLQDEKVKIAKELGATHVGGLDLIESISKGEIKLDKITHAFATPEIVK
FT                   DLRAIARQIGPKGLMPAAKKGTVSEDIESLMQSSVGAYPFKQKEQHLSIPIGRCDFSDE
FT                   EIIKNLKAASEAIYGLQPPGTRKPNLIGQTCLSSTLGPSLVINFKKT"
FT   gene            <935620..>937599
FT                   /locus_tag="PICST_50092"
FT   mRNA            <935620..>937599
FT                   /locus_tag="PICST_50092"
FT                   /product="predicted protein"
FT   CDS_pept        935620..937599
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_50092"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_50092"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68161"
FT                   /db_xref="GOA:A3LZH7"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR024789"
FT                   /db_xref="InterPro:IPR024790"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZH7"
FT                   /protein_id="ABN68161.2"
FT                   /translation="MTSTVPFSVVSQNKFMGFADGNIIKWFPTLNLLAVSMNKMSIWVY
FT                   RLNGERIYSVNNKSPINSIGFIRNGAYFCLGGLDGLIKIHDSNNGQLIKVLAKTFVDIK
FT                   LVDWSRHEITFDGKFDNLFQIDILNSMPKLNSTDEVLSTVMEDTSPTLNYLVVVDSTCV
FT                   SIIFNNFLTIDEISFPQTKPVFLRHLDSDDLFNQYFLTKSGDSLQLLRLRNTLGEDHVY
FT                   RKYFVNIISKLCKLMGIIDYIHDQLALIQAEIKPLFVTLDRYLSNLKDSLGDDTTKEDL
FT                   IDYFVQVLLTNLIPESTKDFWLNQFGERGFKRILKLGNSTYDSAKEILFSQLIASVERM
FT                   IVILNEISGLSQWLKDSECKYHFGLDPESIALVLDKAKELLRISYRFIWDINEEKTSFN
FT                   TFMEWVKIELIDKLAKEDDMEGFLDLHECFVIKESKIMNYIEYGLFESRTWKYLNLDLS
FT                   TNEILNCSKNYPNDIFNSFDELKKSFRDGVEIKLSEFIRQSFYFDTNICPLDVPLGVDV
FT                   YDSNTKLTHLNNDAGLFSTFDEIKSRLFLVGFSFKDPLEKVTKSIYMDTKIIGYDFRSN
FT                   QDLVLLLGTKSDYEVCSINLREVLDRIEENIEFNSIKKVSVLHQNLLSLKDPKLLRVNQ
FT                   DENSSYACVLDSNRQNYVVLGLGS"
FT   gene            complement(<937572..>938657)
FT                   /locus_tag="PICST_63481"
FT   mRNA            complement(<937572..>938657)
FT                   /locus_tag="PICST_63481"
FT                   /product="predicted protein"
FT   CDS_pept        complement(937572..938657)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63481"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63481"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68339"
FT                   /db_xref="GOA:A3LZH8"
FT                   /db_xref="InterPro:IPR031455"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZH8"
FT                   /protein_id="ABN68339.1"
FT                   /translation="MTYRQPYLPAHYRQLCRRVYKLPLSRAMISRLMDLSKHKFTTINP
FT                   YSPRFSSTKFHNYMTLLDDILVEEKYSRVHDLLDLIYKLPASSQSWKDKFLTIDYKELE
FT                   NHWPQVHAIDEITSDPKYLEAYREKQRAEKNEEVSVVKHFGLKSKRDNQSPALTMIRKY
FT                   SDVDQDDSIPQVLKNVQELHKFLFKNQAVFDVKIPPLEVFYPTNKVALPIHPRERNKLL
FT                   KKKVASIRNVFKSLRPIAEDDLRQLYEFAIHRPSVSHKPEYNINDKFYKYMIKKHNHEK
FT                   DNLAPVIRHYLRQKKLIPNDHNIRKLFREYVMKQFYQTSNSKNENIEEYRMSWMQNYFE
FT                   NETSILESAIPSTQLPKPSTT"
FT   gene            <939433..>940131
FT                   /locus_tag="PICST_63700"
FT   mRNA            <939433..>940131
FT                   /locus_tag="PICST_63700"
FT                   /product="predicted protein"
FT   CDS_pept        939433..>940131
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63700"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63700"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68162"
FT                   /db_xref="InterPro:IPR012470"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZH9"
FT                   /protein_id="ABN68162.2"
FT                   /translation="MSTPSDESITTSATASDNPLLQKLGADQFRASVRFYEADQKLTET
FT                   DREQIAEDLKSILLKTNFVGYGSSIVGFLLPTAYYRFKGIKIQPIAAPGMKPYTPLVQR
FT                   PFLSFLMGLTTLLVANQQAAKYQFQQKLNSYRDTYTESNQADAWKAMDYHQSGLFYLYY
FT                   LRTAKDPSFIIKDPRTYSKEQQHQVRVVPPRENRSHFSESLGLGHRKSEDHASNEPHVL
FT                   SQWDKIRVANG"
FT   gene            <940588..>941532
FT                   /locus_tag="PICST_63174"
FT   mRNA            <940588..>941532
FT                   /locus_tag="PICST_63174"
FT                   /product="predicted protein"
FT   CDS_pept        940588..941532
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63174"
FT                   /product="predicted protein"
FT                   /note="go_function protein transporter activity;
FT                   go_component cytoplasm; membrane; go_process intracellular
FT                   protein transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63174"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68163"
FT                   /db_xref="GOA:A3LZI0"
FT                   /db_xref="InterPro:IPR006822"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZI0"
FT                   /protein_id="ABN68163.1"
FT                   /translation="MDAFADSGELYTIRNQFYTNQHHKVRSYSLNQFSPENQLKALEYQ
FT                   IRSIIALEDDASSVIDDGKARFPGNEGLFQLLSAWNDLKSFGTDDSTYFDDVKTATYEL
FT                   QAVLTTLYVVKLDKDIDQAITFLTSYIDNTNTLNKYNEIEPFLILIQLHLVKGNFAAAN
FT                   KIFVNFANFPDSSRDNIIYQVMESWIEAIKGESDNINRSYSLYDELLSSDFDDDPQGKF
FT                   KLLNVLFVLTIQLKHYPEAQELLLQIKALNQKPNADFIANQITFDYLVNGGANVDGLLN
FT                   ELKSLDITHPLVVDLEEKTTVFNDIVAKYQVEA"
FT   gene            complement(<941845..>943029)
FT                   /locus_tag="PICST_19189"
FT   mRNA            complement(join(<941845..942077,942093..>943029))
FT                   /locus_tag="PICST_19189"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<941845..942077,942093..>943029))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_19189"
FT                   /product="cell division/GTP binding protein"
FT                   /note="go_function GTP binding; go_process cell cycle"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_19189"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68340"
FT                   /db_xref="GOA:A3LZI1"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZI1"
FT                   /protein_id="ABN68340.2"
FT                   /translation="NYSVDNNASSSALRKRKTLKKSINFSVMIVGESGSGRSTLINTLC
FT                   GGNSIVPTSSTVNQDPFTKKLTLRHENVELEDNEGHKISLNIIDTPNFANSINCDEDFK
FT                   VVVDFIRHQYDEVLLEESRVKRNPRFKDGRIHVLIYMINATGHGLSEIDVKFMLHVNNL
FT                   VNIIPVIAKADSLTPSELKLNKELILEDLTNYGINFYKFNEYEYEQDYIDDEIVEYNKY
FT                   LNSLVPFAVIGANEYQESPNEDDDLLKLRILNPKFSQPINVENPDINDFTILKNVLLIT
FT                   HLNEFKELTHDQIYENYRTEALSGKKFEYVGNSSKPSDEKADPESNYLLKEEQIKLEEE
FT                   RLKKFEERVHQELINQRLELLEKENELKEIEKRLLAEGLQLDEEGEVVKI"
FT   gene            <943979..>944725
FT                   /locus_tag="PICST_49396"
FT   mRNA            <943979..>944725
FT                   /locus_tag="PICST_49396"
FT                   /product="predicted protein"
FT   CDS_pept        943979..944725
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49396"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49396"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68164"
FT                   /db_xref="InterPro:IPR031818"
FT                   /db_xref="InterPro:IPR038744"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZI2"
FT                   /protein_id="ABN68164.2"
FT                   /translation="MVISTRVSIQWPPEEAEELSHTMAFTSPQGHYVDIRILKTHYPYV
FT                   QHKNQPFFDEVFQWCLCGTEQPIEGTNKIRFINEIDSQAIAKSVRSGKYVAPGEDIGDF
FT                   SAIEGSHDRKEVGSMVNPATGRVQDYIEIWRSLDPLRSTPTEEVREPAESEPESITGFS
FT                   LEIKDNSRYLGKLIRLGFWIQGIVYDKQSENIHVIRSHFNSAVAEWQNQIEYGQIDQFP
FT                   LTFAGEVGDKVSVSSSFSWSCVEREK"
FT   gene            945086..946234
FT                   /locus_tag="PICST_85407"
FT   mRNA            join(945086..945136,945553..946234)
FT                   /locus_tag="PICST_85407"
FT                   /product="predicted protein"
FT   CDS_pept        join(945120..945136,945553..945949)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85407"
FT                   /product="predicted protein"
FT                   /note="go_component membrane; go_process intracellular
FT                   signaling cascade"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85407"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68165"
FT                   /db_xref="GOA:A3LZI3"
FT                   /db_xref="InterPro:IPR003377"
FT                   /db_xref="InterPro:IPR033466"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZI3"
FT                   /protein_id="ABN68165.1"
FT                   /translation="MNGESWLFILAVIINAINLFSQVFFTIMYSDLECDYINPIELCNK
FT                   LNPWFIPESGLHAFITTLFLVNGYWFPFLLNLPLLAYNVNKFLNKNHLLDATEIFRTLS
FT                   KHKKESFIKLGFHLLLFFFYLYRMIMALVSDDA"
FT   gene            complement(<946233..>948277)
FT                   /locus_tag="PICST_33555"
FT   mRNA            complement(join(<946233..947898,948225..>948277))
FT                   /locus_tag="PICST_33555"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(946233..947898,948225..948277))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33555"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33555"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68341"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZI4"
FT                   /protein_id="ABN68341.2"
FT                   /translation="MAVDDRVSRKKSRVRGSGKRNVLVDDFFVLNKQSTSDKPSKKRRL
FT                   TDSLKSALNHWDNIESLPRLRNRKVSAIGKADLDNANSKTTTPVPQDRGEQEESQPQNK
FT                   SVHSVALHSEEAGELLTPSHLINQSIYDEIEYTGNHNQDESLQVTNSDVSVRKSATDKT
FT                   NSGRGRPKKRARVNVGRPRKVDKPKNNLNSTTEAAQKDTIENNEHDSSAETSFRRESLR
FT                   KTRRISYKEMVSDNEKEESSEDEKIEYAFRSLAARTLRQKSRLKQFLGGVDSPEEAEIV
FT                   EEPHTRIRKIRDNVKKRQNELRESQERNKVSNGKTLRKSKSSDRTTTSDNTKSNGNKSR
FT                   KAKSKSRVESTETGPESRIERVPSRVRERVAPIPLSRKRRNERQKPMNIDVERLRDEEN
FT                   KDKRVKIHTIDVLRHLVKEYEPEETASEVIREQVVQEDFKAHLVHQLDYLMDVHSAIND
FT                   ITTRINEVQKLKNEYRQRIYTLKQNHVDVGTKLNTLRSQYNRDKDRHAEVQMVETEMKS
FT                   LQQIGNTTEDAKSSLSQQVTVALSRASSIVNPSAGVLRKLQIVNQKLVDLDKELL"
FT   gene            complement(948749..949339)
FT                   /locus_tag="PICST_91009"
FT   mRNA            complement(948749..949339)
FT                   /locus_tag="PICST_91009"
FT                   /product="predicted protein"
FT   CDS_pept        complement(948871..949305)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_91009"
FT                   /product="predicted protein"
FT                   /note="go_component ribosome; go_function structural
FT                   constituent of ribosome; go_process protein biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_91009"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68342"
FT                   /db_xref="GOA:A3LZI5"
FT                   /db_xref="InterPro:IPR000530"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZI5"
FT                   /protein_id="ABN68342.1"
FT                   /translation="MSDVEQEQIVEEVAVEQTEAGSISIEDALKVVLRTSLVHDGLARG
FT                   LREASKALSRREAQLCVLCDSVTEESIIKLVEALCNEPEEKIPLIKVSDAKLLGEWAGL
FT                   CQLDREGNARKVVGASCVVVKNWGADSDERNILLEHFSQQ"
FT   gene            complement(949918..952729)
FT                   /locus_tag="PICST_85246"
FT   mRNA            complement(join(949918..950215,950261..952729))
FT                   /locus_tag="PICST_85246"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(950127..950215,950261..952070))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85246"
FT                   /product="predicted protein"
FT                   /note="go_process regulation of GTPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85246"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68343"
FT                   /db_xref="GOA:A3LZI6"
FT                   /db_xref="InterPro:IPR017230"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZI6"
FT                   /protein_id="ABN68343.2"
FT                   /translation="MMSRTERRKSMAERRPSVSYTPSVIPHLAGLEKPQEPSLKIDQCD
FT                   VLIMGTGLVESILAASLSWQGVQVLHIDNKNYYGDSSSTLTIDQLKKWCMEVNSGRLQH
FT                   FQDAQIYIPGGKSTNKFNSKDYGIDLSPKVMFCKSDLLALLIKSRVYKYLEFQSLSNFH
FT                   VFENDDFSQKITTQTSKEDIFTDKSLSLITKRNLMKFLKFILTDNKDPVKKKILVDNGK
FT                   VKVQDFLVKQFNLELPQINELVYSIGLCINEGTETREAMAKIKRFLVSFDVYGSFPVMV
FT                   SKYGGPGEISQGFCRSAAVAGTTYKLNTSLVDYDPRSKIAKFNDGSHVKINEKLVISPT
FT                   QVPKFLQSNYNEVTENLKQFSITRLITVVRRDCKEWMAEQDSSAIVVFPPHSLPTNNEQ
FT                   SVQVIIQNGNTGVCPEGQSIWFSHTSEQDLNRAKQDLESAYEKMEASLLREANADLEGA
FT                   FDDQDFVLSAQGTPVFVNSFKLGESLQNFVPKEKLEIVCKVGYVQKTYANPDLSNIFHA
FT                   TAEDNVVLKNVADAENDILFSNMPSAELSYDGNISEAKLIYQKITGSDEDFFDVDFEDD
FT                   DDDYDNNDPHDSSNLGSSTTLKSSSSNALASDNEDVIVDSSDDDDHNPFGADEMEL"
FT   gene            <954762..>955640
FT                   /gene="MET8"
FT                   /locus_tag="PICST_63116"
FT   mRNA            <954762..>955640
FT                   /gene="MET8"
FT                   /locus_tag="PICST_63116"
FT                   /product="Protein involved in the expression of PAPS
FT                   reductase and sulfite reductase. Also executes last 2 steps
FT                   in the biosynthesis of sirohaem"
FT   CDS_pept        954762..955640
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MET8"
FT                   /locus_tag="PICST_63116"
FT                   /product="Protein involved in the expression of PAPS
FT                   reductase and sulfite reductase. Also executes last 2 steps
FT                   in the biosynthesis of sirohaem"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63116"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68166"
FT                   /db_xref="GOA:A3LZI7"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR028162"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZI7"
FT                   /protein_id="ABN68166.2"
FT                   /translation="MSSSGLSKPKASLLLAWQVQNKHCLVIGSGEVALSRINHLLRADA
FT                   KVTVVAGKDDKKVHKDIFELDQQEKLHKFIRRDYLTSDLTLYENIHLNIGDLDNIEPTN
FT                   YEQIQNQVCNEVFAVVCCCIDDYELSTKIYYQCKYLRLPVNIADKPQLCDFYFGSMINQ
FT                   DNLQIMVSTNGKSPRLSKLIKDNIAKEFVGIDLNMAVENLGMVRTRLREQIVIDDDLVS
FT                   IDTRMTWIKNLTDMFSLKQWSELELIPPSSAPPFDNRHKYVDNIIKFFPDYPPADFDEF
FT                   KKVVCTLEEQN"
FT   gene            complement(<955762..957135)
FT                   /locus_tag="PICST_90997"
FT   mRNA            complement(<955762..957135)
FT                   /locus_tag="PICST_90997"
FT                   /product="predicted protein"
FT   CDS_pept        complement(955804..957135)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_90997"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90997"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68344"
FT                   /db_xref="GOA:A3LZI8"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZI8"
FT                   /protein_id="ABN68344.2"
FT                   /translation="MTSAAETIAKDGNAAFAILKTLSNEQRSAALKAIHDGLQSQKSRI
FT                   LDANKIDMQNARDHNLSASLVKRLDLSNADKFDAMLSGILDVAALDDPVGQVTLARKLD
FT                   EGLNLYRITAPIGVLLIIFESRPEVIANIAALAIKSGNSAILKGGKESYQTFKVMSEIV
FT                   NETLASSTDVPAKAVQLIESREEVGDLLSQDRYIDLVIPRGSNALVRNIKDNTKIPVLG
FT                   HADGICSIYVDDEFDLQKAKRIVVDSKTNYPAGCNAVEQLLLHRNISEEDIKSLVQALL
FT                   DAKVTVHVTPEVKKILAQTSEYIQDAAEDAFDKEYLSFDITVALVDDVDAAVQHINTHS
FT                   SKHTDSIITQNEAKANKFMKGVDSAGVYWNASTRFADGFRYGFGTEVGISTNKIHARGP
FT                   VGLEGLMSYQYQLRGDGHIVGEYVGGGGNKVFVHEDLNPKSVKL"
FT   gene            <958087..>958573
FT                   /locus_tag="PICST_33560"
FT   mRNA            <958087..>958573
FT                   /locus_tag="PICST_33560"
FT                   /product="predicted protein"
FT   CDS_pept        958087..>958573
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33560"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33560"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68167"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZI9"
FT                   /protein_id="ABN68167.1"
FT                   /translation="MSYNQPNSGGNSQQNPFADNLIDLDQGSSSGNAVDNPYGELSGQT
FT                   EYHSNYYSNENYDSNQSYEYNNRNNVNSSNRNGNRVTNDTHNPFDDDFIISDDEYDHDA
FT                   TTETGIGGSSASGYRHGSTGRRQVPLLNTANPASKQKNGFFGASRKNQEYIGMNGNEF"
FT   gene            <958705..>962094
FT                   /gene="DRS2"
FT                   /locus_tag="PICST_33561"
FT   mRNA            <958705..>962094
FT                   /gene="DRS2"
FT                   /locus_tag="PICST_33561"
FT                   /product="membrane-spanning Ca-ATPase (P-type)"
FT                   /note="Has EST support"
FT   CDS_pept        958705..962094
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="DRS2"
FT                   /locus_tag="PICST_33561"
FT                   /product="membrane-spanning Ca-ATPase (P-type)"
FT                   /EC_number="3.6.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33561"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68168"
FT                   /db_xref="GOA:A3LZJ0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZJ0"
FT                   /protein_id="ABN68168.2"
FT                   /translation="MDHSANSHYGYFGNHISTTKYNFATFIPKFLFEQFSKYANLFFLF
FT                   TSIIQQVPNVSPTNRYTTIGTLTVVLLVSAIKEISEDIKRANADKELNNTKVLVLDSQT
FT                   GSFALKKWIQVQVGDIVRVDNEQPFPADLLLLSSSEPEGLCYIETANLDGETNLKIKQA
FT                   LENTAYLVNPRDLVSDMSKSEIMSEPPNSSLYTYEGNLKNFGSNGDIPLSPEQLLLRGA
FT                   TLRNTQWIHGVVVFTGHETKLMRNATATPIKRTDVERIINLQIVALFCILIFLALVSSI
FT                   GNVVKIQVNSSSLSYLYLEGVSRARLFFQGLLTYWILFSNLVPISLFVTVEIIKYYQAF
FT                   MIGSDLDMYFPDTDTPTGVRTSSLVEELGQIDYIFSDKTGTLTRNIMEFKSCTIGGRCY
FT                   IDEIPEDGQAQVIDGIEIGYHTYDQMQRELLDTSSQHSAIINEFFTLLSTCHTVIPEVD
FT                   DTTGHIKYQAASPDEGALVQGAADLGYKFIIRRPKGVTIENTITSVKSEYELLNICEFN
FT                   STRKRMSAIFRCPDGIIRLFCKGADTVILERLSQDEPQPFVDATLRHLEDFAAEGLRTL
FT                   CIASRIVSDEEYQNWASQYYEASTSLDDRSGKLDAVAELIETGLFLLGATAIEDKLQDG
FT                   VPETISTLQTAGIKIWVLTGDRQETAINIGMSCKLLSEDMNLLIINEETKSDTRLNLQE
FT                   KLTAIQDHQFEMDEGALESSLALIIDGHSLAFALESDLEDLFIDLGSRCKAVICCRVSP
FT                   LQKALVVKMVKRKKKQSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISIGQ
FT                   FKFLKKLLLVHGSWSYQRISNAILYSFYKNITLYMTQFWFVFTNGFSGQSLIESWTLTF
FT                   YNVFFTVFPPFVLGVFDQFVSARLLDKYPQLYQLGVQRKFFNVTIFWGWIINGFYHSAL
FT                   IFLCSFFIYRFGNVLPTGLIADNWTWGTAVFTTCTLTSLGKAALVVTMWTKFTLIAIPG
FT                   SFLFWLAFFPAYASIAPNINVSQEYRGVLRATYPTIVFWSMVFGLACLCLLRDLAWKYY
FT                   KRSYTPESYHYVQEIQKYNIQDYRPRMEQFQKAIRKVRQVQRIKKQRGFAFSQVENQDQ
FT                   EKIVRLYDTTKKRGVFGELSES"
FT   gene            <962402..>963979
FT                   /locus_tag="PICST_33562"
FT   mRNA            join(<962402..963343,963404..>963979)
FT                   /locus_tag="PICST_33562"
FT                   /product="predicted protein"
FT   CDS_pept        join(962402..963343,963404..963979)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33562"
FT                   /product="predicted protein"
FT                   /note="go_component eukaryotic translation initiation
FT                   factor 2B complex; go_function translation initiation
FT                   factor activity; GTP binding; go_process translational
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33562"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68169"
FT                   /db_xref="GOA:A3LZJ1"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZJ1"
FT                   /protein_id="ABN68169.2"
FT                   /translation="MTEENKANIKAEGSTASTGAGSETAANSGEKVLSNKELKELKKKE
FT                   KAAKRAAQKEAIGISPEQQKQNAEQKIDKRKNQTATNTNLKKQLDQTVIKDGAKRIPSL
FT                   FSHLETREQRNASSPSISHIVHPAILSLTLKYSTYKVVGSTSRLRNMLQVFKIVIQDYH
FT                   TPENTTLTRHLSGHLSHQIEHLKTARPLSVSMGNAIRWLKQEISHISIDTSESKAKETL
FT                   CSKIDDFIHEKIDLSDRVIIENASQHITNDCTIMTYGHSEVLEKLFKYCVIEQNKRFNL
FT                   IIVDSRPLFEGKRLLSNLVSTNYHPEIEESESEVHYVLINALSSTLLEDVDCVFLGAHA
FT                   MLSNGRLYSRVGTGLIAMMCHSRNIPVLTCCESVKFSDKVQLDSVTTNELADCEDLVHS
FT                   INSKKPPQKKSFAMEQFIKQCDEEKASNNKNNKQQQQQHKKKEGSAEPEQESDEAPLKD
FT                   WKSYPNLNILNIMYDLTPPEYIKKVVTELGALPPSAVPVILREYKNT"
FT   gene            <964332..969922
FT                   /locus_tag="PICST_73499"
FT   mRNA            <964332..969922
FT                   /locus_tag="PICST_73499"
FT                   /product="predicted protein"
FT   CDS_pept        964332..969890
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_73499"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73499"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68170"
FT                   /db_xref="GOA:A3LZJ2"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024372"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZJ2"
FT                   /protein_id="ABN68170.2"
FT                   /translation="MAEQELALINKVELRIALASDDSQFESALSLYLAPILLKLASPHA
FT                   EVRKAILKVIQHLIPRISAARTIKLPVGTLIDQVKNPKVAANTDSASVRLYSLLFISRS
FT                   VERLNAEERKQLIPQIVAGISTFPSSVSARLFNVLCKLLETWKSPARDTEEFNKMNEFL
FT                   SFDKSPEDEKFLADKIAKFLMLQPSSATGIPTPGLGQNDVNFFNLESGVVYKTQQEIFN
FT                   VKTYLLEFLKAGFTESSLAIPLMVASVDNSSAINDSSEILFRKLTLDLEDKAFVDTLVE
FT                   MFVGSEGIPPVKSTLQERILQVLIKSKIACTNPQISKIANLGLASDYLRLKQITVQFIN
FT                   WISSNNSEFASSEANVLKDFNIAMAAQLRESLLVEGWPQMDMTNVKNYSSSLNQRTLQY
FT                   EALGRILRTNPELFIQDIAYIEFLFQSLEGETPDLRATIQDALSSLTVHLPQLGEDSKR
FT                   RLKQLTRGYLLQNKAENTENIHPCRYVSIKYINSAFPFDDSEARYLCILGTAKVNRSDT
FT                   IEEARRGLHPHWFNILQSSNTLEFKSTSDLLGENSSVSFPTFVDFVATLNREIESSKDK
FT                   EGALIFQSLARAIKFALQILVMEAVMGVSTVIVPDQEWSVRLDKALEVDKVVQDLVIQK
FT                   IDDLSHKEIDMDTGVEVDNAFIVYTSICSLAFHGQYFDSTHISPDISYVDIYTKLVSLS
FT                   PPSVIQKLQPDVKKLLELLDGKVINDHAMAQVCKSLGIIASHPVNSDQEVLNLLEKLAV
FT                   KDVPVYLIKGRLLSTSYIIGRLYLRQRVAIVTTEFFKTLCEDLLKYIGDTGFYSIVLDS
FT                   LAQLSIFGVFGPALNSELTGYVFKFLEFIIPKVKKIDEKSVLTLAFLSLSLKRKDIDVD
FT                   EELSEYEKAVYETHISKQVEYTFTSGEALSVMVTGWQSKFLQRELDIQGEGIKFVPEDI
FT                   SRLPFLLNVVLKACANTKPSLRKAGCIWLLSLVQYCGHLEAVRSKASEIHVTFMRFLAD
FT                   RDELVQESASRGLSIFYEMVDSDLKDTLVRGLLKSFADSDSTAKFTSGTVEHDTELFEP
FT                   DLLKTNDGSVSTYRDVLSLASDVGDPSLVYKFMSLAKSSALWSSRKGMAFGLGSILSKS
FT                   SLDNLLASNKNLADKLIPKLYRYKYDPNLSVQKSMNDIWNALVKDTSKTIKDNFETILR
FT                   ELLKSMGNKEWRVRQASTAALNDLLQIVPVEKYESNMEDIWNMSFRVMDDIKETVRKEG
FT                   NKLTKSLATTLTRMIDAKNGVATQTQATEILESLLPFLLENKGLLSDSEDVRNFALETI
FT                   LKLCKVGGAPIRPFIPKLIENFINLMSTLEPEVINYLILNADKYNIKSNDIDAKRLQSL
FT                   GSSPMMDAIEKLIDGLDNSLMEDFIVRLESSIKGSVGLPSKVCGSRVLVTLVTKHLELV
FT                   KPYGDKLLKISSNQVRNKNDTIASSYATATGYLCRIATIPSIISYSKQIKEWYFESEDE
FT                   TFRERASVASESVSKYSGDKFEQVASAFLPLAFIGKYDSNKIVRKTFEREWIENTSGSS
FT                   TSIKLYLTEILEFFKIYINSNRFEIRKILARSISNLSNSIDNISQFSEEATKELIELLV
FT                   ESNKGKSWEGKELVLESLVSFSIKAESYLKKNAVFLEKLSKVVTTEAKRKNKEYQQHAI
FT                   KLMGRYIHIYHEDEELVETYIQIMSNVLNDKYFGPNGFRDDDDSDDEDAMDVDLKSKIN
FT                   VKQNVELEERKLSFLKNLFETFYVDSDNKYSSELLFFIFEQTTAIFHSKLIDFTWRSKQ
FT                   QTCEGLNKILLTSKSSLNPKECKEVFSVWKLLGDKCLSLENIENVKVQFIRLSSTLISQ
FT                   FEDVNEVEKVGAIKDELIQYKHQETSTVVQTELSKIV"
FT   gene            complement(<970006..>971231)
FT                   /locus_tag="PICST_33564"
FT   mRNA            complement(<970006..>971231)
FT                   /locus_tag="PICST_33564"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<970006..971231)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33564"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33564"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68345"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZJ3"
FT                   /protein_id="ABN68345.2"
FT                   /translation="MALKNLFRKKEPSEQELRDELRGAGIMTSTSGRKQEHFGQFRFSS
FT                   QRNDSNPYSSINTTSSTKPYTQTSSFFTNTTRGSSYTYGSVENSRIPTTSREGYTPPVA
FT                   RSNSDPYGIATSWTSPTVSQQSATYRDQHTVDLNELPTDMSNLRKKKKSTRRPPKGDDP
FT                   DLNSVSRRVEVDLNEDPNDVEVQTEETMDLEEKEIRSTKEEIKFVRKESLFSTKTTLNM
FT                   AKQADDSATNTMKILDSQSEKLYNTEQNLMLADVQNKIANEKAKELHRLNRSIFIPAYG
FT                   FNQKKSLAEQEQRIKSFNEQGKPSQEETPNNIKGNSDRLKNDISRSLSFEHGRRKPLSP
FT                   RYQFENESEDDEMEQQIEDNLEQIDYFSRKLSKSASVIGQEMDSQNATLEVLEQNADIV
FT                   DSNILRNTE"
FT   gene            complement(972781..973802)
FT                   /locus_tag="PICST_73878"
FT   mRNA            complement(972781..973802)
FT                   /locus_tag="PICST_73878"
FT                   /product="predicted protein"
FT   CDS_pept        complement(972847..973764)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_73878"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73878"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68346"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZJ4"
FT                   /protein_id="ABN68346.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLSDYNIQKESTLHLVLRLRGGQ"
FT   gene            complement(<974745..>975563)
FT                   /locus_tag="PICST_33566"
FT   mRNA            complement(<974745..>975563)
FT                   /locus_tag="PICST_33566"
FT                   /product="predicted protein"
FT   CDS_pept        complement(974745..975563)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33566"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33566"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68347"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZJ5"
FT                   /protein_id="ABN68347.2"
FT                   /translation="MELSLLTYNTKHLATICAILSKRLSAFVTKKELKRSNTTKPSEYT
FT                   GNISSSKMKRSSSLPVISDHSEKNDVVLLKTLTVILYLVQNGSYDFVNWVRGNIDNYIF
FT                   PLSTVAPVYGKHYDAIASKVAKLLLLFTDSEQLKAFRVNIHILRSDMTTPGVKRTSIDL
FT                   PSNITTEEMEVDHNIYSKRAKSMDINRNTNNTLTTLVEETFENGQSFNVTADPYIRNSR
FT                   SDYQLGSGSDRYDNSGRPKPAYAIDSYIPMGTTDSSNSNYEVVDKDTVFI"
FT   gene            <978183..>980021
FT                   /locus_tag="PICST_63040"
FT   mRNA            join(<978183..978352,978509..979803,979882..>980021)
FT                   /locus_tag="PICST_63040"
FT                   /product="predicted protein"
FT   CDS_pept        join(<978183..978352,978509..979803,979882..980021)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63040"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63040"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68171"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZJ6"
FT                   /protein_id="ABN68171.2"
FT                   /translation="KPSFNYDLDLFLLTKQYLDTKNHHGLALLARQKGIPPFLRFKVWP
FT                   ILLKYHPFVLNPSNSSNSSSSNSSSKNELEEIRQKIKKDLRKYIQRLKYSSSILNISEV
FT                   EHEMFNILESSVLKFTLKWGKIIKYDPSLTWIALNLAEWFPPIPKSAWVLRGRDSSSPD
FT                   NALIINIFDDYSNYIDNISDLQTYLHELVEDERISSMSFHDVYERLVLVLLHSPEQKKK
FT                   NSGSSKDHSFLPPKKINKSVLPINGGTIEERVSFFIYCLRKLLPELSQFFHEEQILNKF
FT                   GSSDDEWLIWWLKFGGAKVWSKYDRGRIWDLLLGWRLKNPKKNTLYYVEKLDNIDKKSL
FT                   AKLGPDIFWSLSNDESYGASKPNNDMRRNSFKDLVEELNNDLLLSKLDTKTDSSTLSSR
FT                   RASEASSTTSAVSQSTASSQTTIGDVAVPFSKLDAHIELIFISLALLKSKENLLVELDQ
FT                   HEIRQLLSRLPSKSYKYKQKKQFVKSSSDKTNDNTYNIIISNDSQHNHKVDFMDNIINE
FT                   AGELWRKWLWSEMIEDS"
FT   gene            <980471..>981727
FT                   /locus_tag="PICST_33568"
FT   mRNA            join(<980471..980578,980615..981493,981551..>981727)
FT                   /locus_tag="PICST_33568"
FT                   /product="predicted protein"
FT   CDS_pept        join(980471..980578,980615..981493,981551..981727)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33568"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33568"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68172"
FT                   /db_xref="GOA:A3LZJ7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZJ7"
FT                   /protein_id="ABN68172.2"
FT                   /translation="MGNTDKSAKSESKKEKRERKLEKKTKKRSIEEEVDKPSTEAENTQ
FT                   ASAPKHADFEELEIDLSAGVPLSKKQSRLLKKGKLDLERLAKKHPVPKPELTEEEKLAQ
FT                   EEEDKKKSKKSEFAVWIGNLSFDTTKEDLVRFIVGKTAHNGEDDSQLIKIEEADITRVN
FT                   LPKKENKIKGFAYIDLPSAVHVTSVVALSESPLNGRKLLIKNANSFEGRPAAAVAPLSK
FT                   NPPSRILFVGNLSFDTSEDNLEEHFRHCGEIVRIRMATFEDTGKCKGFAFIDFKDETGP
FT                   TAALKSKLAKKLINRPLRLEYGEDRSKRNPNHIRKAEVQEGEVDDFAPNSNYEKPQRAS
FT                   STPKKRVFRDDNHNHSNKRVKSSVALATAQRASAAIVPSSGKKITFD"
FT   gene            complement(981738..985496)
FT                   /locus_tag="PICST_85172"
FT   mRNA            complement(join(981738..982206,982267..982402,
FT                   982469..983350,983441..985496))
FT                   /locus_tag="PICST_85172"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(981980..982206,982267..982402,
FT                   982469..983350,983441..985120))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85172"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85172"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68348"
FT                   /db_xref="InterPro:IPR024527"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZJ8"
FT                   /protein_id="ABN68348.2"
FT                   /translation="MSETVSDTPAKQSRLKKLTSGSSWVSPFRSGSDKDKKTSALKQYK
FT                   ESNKLEHIKVPTKFTVHPTLEAEKKRLAEEKKAEEEKEAEEKEAEDKVAADGEADEEAD
FT                   GEDAEADADKEVKEPVEEGEPEAEVDGANEEEVAEEVEPETEAEVVEPETEATEAKTVE
FT                   QDAEAELPEVEPETEAAEAEADEIAEEPVAEAKKAFEPVDDKNKEVVEQLKDKPLLLNR
FT                   YEALNATAIDSVSRRIEDPNKVVDLGSGLKMSQEQLLAIAAARVAPVLANIDDEVKKTR
FT                   SEDEIKRQQEISGKVKSHENKLLAEFDKHVRKLGKKKEKFDKDIDDKIADITRLQRNAE
FT                   KNALDFKTQTEGEIETANTEYADREAKAIEKHGVDHETLLKNHEELEATKKQELEDAKL
FT                   NQEKTTTEIEELQEKKSGLDNKNSELSTQIEELTTAYNAEIARLDELKAKFTEKQEAVS
FT                   KNLATKDELDSNIAKSKQAVSAKKESHTKLTAEVGLLAGALAAYGAKLASLKGDREVRS
FT                   SRLSDAKKTFEDWTVEKKDIAAQVARDHEKQRIEAQEAAETKRKEAEERERQAKKDAEE
FT                   KERLEKEQAEWEEKEGLLKKQAEREEAERLKDDPEFQRQQRLKQREEEEQQLLTERDEI
FT                   ERKYKERKSREDAEYVQLLAEIEELKAKKQAQIDAEKLEAERTAQAKLDEIERLKEEHD
FT                   ARLNLYKKKLELEELQKDRLLEEVDNLRKIKNLREEKSRLASEVAKPTELDDIQHLIEE
FT                   RELEVARLTKQIELDDDELYRSVKKDEHKSFLGVSNDLPESGKRAIPEVRVEPEVAAEK
FT                   PISKSAVVGGVAGVAGVAGVAAATAAALGNGAVDTSKAVGNGRTGSLSNKIKHFGRRLS
FT                   GFGGEKEAKEPKKDVKAGVQKVSKKEPLAAAEDPSNHLHKVKDVTDQERKQSVTKTTAV
FT                   VEPESDYDTYSIYEEVDDEEFEANKGNPDYFEVNSAEYAKHVRA"
FT   gene            <987596..>992392
FT                   /gene="MDS3"
FT                   /locus_tag="PICST_14132"
FT   mRNA            join(<987596..989154,989221..989654,989907..989966,
FT                   990081..991853,991938..>992392)
FT                   /gene="MDS3"
FT                   /locus_tag="PICST_14132"
FT                   /product="negative regulator of early meiotic expression"
FT                   /note="required for growth at alkaline pH and in high
FT                   concentrations of lithium chloride"
FT   CDS_pept        join(987596..989154,989221..989654,989907..989966,
FT                   990081..991853,991938..>992392)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="MDS3"
FT                   /locus_tag="PICST_14132"
FT                   /product="negative regulator of early meiotic expression"
FT                   /note="required for growth at alkaline pH and in high
FT                   concentrations of lithium chloride"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_14132"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68173"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZJ9"
FT                   /protein_id="ABN68173.2"
FT                   /translation="MSTLIPTSSACHNLQLPHTEKDDRLNLNVRTGSSSTLYNSLVLTS
FT                   GGLTIGLELGDTTIEEIYTTFRQKVSSSVMKFKSLDKYLSGELFYLSLIDKVWSRVPYN
FT                   RDTDGPRPKPRLFHQICALNNCVYLFGGLVIPEDANPTSEDDTTIKDFLVPCNDLWSFN
FT                   LESNKWRLLSDGSEYETNRAIPQPRFNHKMTTINSLSFVNKKDHYGIFIAGGKDGNSNP
FT                   IYDNAVFDLVENKYVGSEPIKLKTTTGNVEKDSKSGLDNIVANDKHELNVDYNNSMIVT
FT                   FTEDIDHQHHQQINDKGKIHHEYRKSTSQEQSFIIYTPTIDKSQDQNNNPLVSFRAGRK
FT                   IHNGKPLPMHRKKLFTNGQNSEGPTIDRRGLNHTIPFNLRYPTGGLFGQNIVITGFLPG
FT                   DFDISIFIYNKPTGKWSRLNIFCNHDYGSHRFWGGFAWQSHHKVVLIGNYLTSRTTSSI
FT                   RFFTVMITVSLPITNILASSELAGGHHHGPDGRRIPHRRVRLSNASENASNRKNIEEEL
FT                   SDDSSPEVLTEEEFLKKTSDRRPSSISQASDKTSPTAISFSEYVHYAAPKTNFTSIRSV
FT                   FPPAAITLGRNAFDRYGDLISDFELVSCNGDRIPVSLIVLMERWGRYFIQLLARGYVSA
FT                   VDKFESDQALGVYNSDKQRLRTSKSGGSGKTNKEPSNPLEQNESEASPEAIPRKDSVSS
FT                   FSSSNSLLASQLQDIPPQLPLPSDQIPGIPAAPASFKSSTSRKGSQDLGSPRASLIHTL
FT                   TALRNIPISKSPRESPFASPRASVSAQGASVVGGGDLYSSPVPNLRPGRFSPTSEVMGR
FT                   SKSIDYSLSAFNEESAEQGNKTEPSQEMEREQKNASLSSTHSEALSATSSGRDSNDDDF
FT                   SGASEADLLSQACKAAKESHGMFDNALLNFENLDAATFTMEPSLIPRKLYVPFPSITLK
FT                   GFCEYLYTGQVGNKWLLVPTTLDNLLMSKFFKVPLLYDLISEVLFGIIGRKEAYIVKEG
FT                   NRLKRKYFNALEEMGKSYDNSFKFPLNEYEGFMDTVDDGYLDIALLKKTSKTHQSSSVV
FT                   SMSRRRRYQAEHGNSRRPSTATELTEPDEEAEDENEVDDEKEKEKEESQGSNLHSESAE
FT                   DSSDRKTTSTSEDDGIELGFLNVHERNSTTVGPRSKSVFDRSNTVYNDFFQHAYEQAHA
FT                   GDDNGEKAVGLTIEQLVSPDSDIPNDYVIDLVYEASSIVTDLKLMLRAANVRLMNKILN
FT                   QSRVEVEAEIERLKNSQMESDLEDSDDGGISTSKANDNFVAPKAHTSVSATHMDLNPST
FT                   SASSLVSSGSSKAPKDLEKMKSNISFRTVGSLTPFKHSKTENKIGGNKDIDKRFSKLMK
FT                   KDEKLRTKEGLLKKKVMSKSSTSLNEIGQSTASSIMSKSTTQPKKHHGLFHRSHKKKDT
FT                   DDSSLESTKLSRTQSTTASIESAHS"
FT   gene            <993816..>994700
FT                   /gene="GCY1"
FT                   /locus_tag="PICST_63050"
FT   mRNA            <993816..>994700
FT                   /gene="GCY1"
FT                   /locus_tag="PICST_63050"
FT                   /product="aldo/keto reductase"
FT   CDS_pept        993816..994700
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="GCY1"
FT                   /locus_tag="PICST_63050"
FT                   /product="aldo/keto reductase"
FT                   /note="aldo/keto reductase [EC:1.1.1.2] [KO:K00002]
FT                   galactose induced transcript"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63050"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68174"
FT                   /db_xref="GOA:A3LZK0"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZK0"
FT                   /protein_id="ABN68174.1"
FT                   /translation="MVALTNDSVVYTLNNGVKIPAIGLGTWQASAPGHASNATKVALQN
FT                   GYRHIDTAAIYKNEEEVGQGLKDSGLKREEVFITTKLWNGDHKNAAKALDESLKKLGVD
FT                   YVDLYLIHWPVSTDPATGKDYEDWDYVDTWKQLQKLYKETKKVRAIGVSNFTKSKIERL
FT                   LADPEVDVVPAVNQVEAHPLLTQPELYDYLKEKNIVIEAYSPLGSTDAPLFKNETIAAI
FT                   AKKNGVEPGHVLISWAVQRNTVVLPKSVTNSRIISNLKTFTLPEEDFEALNKLSEKDGI
FT                   HRWADPSWNDFST"
FT   gene            <996148..>997128
FT                   /locus_tag="PICST_33573"
FT   mRNA            <996148..>997128
FT                   /locus_tag="PICST_33573"
FT                   /product="predicted protein"
FT   CDS_pept        996148..997128
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33573"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33573"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68175"
FT                   /db_xref="GOA:A3LZK1"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZK1"
FT                   /protein_id="ABN68175.2"
FT                   /translation="MSSNWTQPSYTPADVDDFIIADDDDEGSTQHGSSGRNDLNSTSNG
FT                   INASNNNGSGGSNIFSQFGLLPKVDLSQTFAPFTNSSNLPGNNRVRERQYSGGDTLDEP
FT                   VWATLKRDLLQIARRLGIVIWPMQLAKLAKQQQSRLVDFAASNGITLPPSITNNRRIDV
FT                   SHTPDDEEQVAGLGSSVFVKQDNLEWDLWGPLIFSLVFSVTLGLAAPKSETNSVFSGSF
FT                   SFVWIFFIVIGLNIQLLGGSISFMSAISAAGYSMFPIVVGALLSCLVLKWKLIRLALML
FT                   VLNVWSIYAGVLSLECSGVLPGRVTLAIYPVALMYSIMSWLVVIT"
FT   gene            complement(997139..999021)
FT                   /locus_tag="PICST_68393"
FT   mRNA            complement(997139..999021)
FT                   /locus_tag="PICST_68393"
FT                   /product="hypothetical
FT                   beta-1,6-N-acetylglucosaminyltransferase, contains WSC
FT                   domain"
FT   CDS_pept        complement(997233..998951)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_68393"
FT                   /product="hypothetical
FT                   beta-1,6-N-acetylglucosaminyltransferase, contains WSC
FT                   domain"
FT                   /note="go_function pepsin A activity; go_process
FT                   proteolysis and peptidolysis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68393"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68349"
FT                   /db_xref="GOA:A3LZK2"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="InterPro:IPR034164"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZK2"
FT                   /protein_id="ABN68349.2"
FT                   /translation="MKVSLLLGFLHLGAVHALWPVKDFRVDDLPSTSDIDLKSNIKNEN
FT                   IDTLVHKDVATSSNATEGPVFIDNVNLQYLFTDNASSIYYLYANISDSRNEYNDQFALL
FT                   LDTGSSITWLYNETCTENGCSKSGVNKFDDFSDSIVPESDFHLSYTGETVAGDIVSLEE
FT                   NNLSLTFGNSRVEFSNLSIGLTSNSPEMFKGYAISGLLGISSSNNNDPVRNIVSQYYAS
FT                   NRISKEMFALFLKSNNQTITHVDSNNKEFDPLPNDFGGMVIFGAGAQNYLDSFPGKTIY
FT                   TKVIDNDNAYWLINITQVDTTNSTAKKTFTFDSRGAIIDTGTTGIVLPVTDADALHESL
FT                   FGNTFVTDGKGNYAFPCNTENSSIFFSLDDGQLEVSSSFFMGDSYDQPGLQGLCASKIQ
FT                   GIDGYNNWVLGASFLNKFYTVFDLEKKQIGFVDADVSSVILKQESILTDTSFVGSDVSA
FT                   VIDPPSSSDSSESSGSKDSKESNTTSNESTDSSKSTVRSKQTHSSTILVSSATSTKTSS
FT                   SSIVNSDTSSSSSAPSTESNNSKSHNVNNGTSTLIPKSFTVFMSVILSLFVCVLI"
FT   gene            complement(<1007826..1009330)
FT                   /gene="HYR5.6"
FT                   /locus_tag="PICST_79415"
FT   mRNA            complement(<1007826..1009330)
FT                   /gene="HYR5.6"
FT                   /locus_tag="PICST_79415"
FT                   /product="hyphally regulated cell wall protein"
FT                   /note="similar to HYR5 of Candida albicans"
FT   CDS_pept        complement(<1007828..1009330)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="HYR5.6"
FT                   /locus_tag="PICST_79415"
FT                   /product="hyphally regulated cell wall protein"
FT                   /note="similar to HYR5 of Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_79415"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68350"
FT                   /db_xref="GOA:A3LZK3"
FT                   /db_xref="InterPro:IPR008440"
FT                   /db_xref="InterPro:IPR021031"
FT                   /db_xref="InterPro:IPR033504"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZK3"
FT                   /protein_id="ABN68350.2"
FT                   /translation="MLLRKYILVAFALISAAMAATITQNTISRGTITLGVGDTTINNGV
FT                   YWSIIDNAISAFAGNVNVGTGSGLYITGTSPLISLQVGVASGTFTNNGIVSFNAVKSLL
FT                   APTYNIAGLSFTNNGEMYLGADGSVGVPSISIISPSWNNNGLLVFYQNTRTTGPVTLGA
FT                   PLGTINNNGQICFYNELYTQTTNIAGTGCTTLDNDSSIFFSNTVLNIANTQVFNLADSA
FT                   SSIRATAISAPKTYNVAGFGNGNKIGLDIPLVNAPPLLTAYSYDTKTGILTLNGAGLLS
FT                   MKFNIGLGYNPSLFSIVTDDNVGLASVPFGAVTYSGPPPNPVPSVCQPCKLLPPAPGTS
FT                   ATESTTTATSTNSAGFPCTEVDDVIISTDSNYSWFTSTSTITAGCASNPTTTVTSTWTG
FT                   TDTTSLTVTDTVGGTDTVIVEVPSNAQSTITSTWTGTDTTTVTISDTQGGTDTVIVEVP
FT                   SNAQSTITSTWTGTDTTTITVSDTQGGTDTVIVEVPSNSQSTI"
FT   gene            complement(<1012996..>1014273)
FT                   /gene="VAN1"
FT                   /locus_tag="PICST_63364"
FT   mRNA            complement(join(<1012996..1014155,1014222..>1014273))
FT                   /gene="VAN1"
FT                   /locus_tag="PICST_63364"
FT                   /product="Mannan polymerase I complex VAN1 subunit (M-pol I
FT                   subunit VAN1) (Vanadate resistance protein)"
FT                   /note="Has EST support"
FT   CDS_pept        complement(join(1012996..1014155,1014222..>1014273))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="VAN1"
FT                   /locus_tag="PICST_63364"
FT                   /product="Mannan polymerase I complex VAN1 subunit (M-pol I
FT                   subunit VAN1) (Vanadate resistance protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63364"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68351"
FT                   /db_xref="GOA:A3LZK4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZK4"
FT                   /protein_id="ABN68351.2"
FT                   /translation="EDSYEFFSVTKDGVTQHIRNSGSEPVDHYASEVEYFDLQDYRGSA
FT                   DGLSQGDVVLFLMPLRNAEAVLPMAFYNLMNLTYDHSLIDIAFLVSDCSPDDRTLETVF
FT                   DYSVSLQNGTLVDKLRAEDEERKKSDVRGSSDLYKNYMDKNYMDGVRRAYSNPEHHKGY
FT                   RKPFRSVSIFKKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTSSSLKPYHSWVYW
FT                   RDVDIETCPGNVIEELMQHDYDVMVPNVWRPLPTFLDEQEQAYDLNSWIESDPALELAK
FT                   KLDEDDVIVEGYAEYPTWRVHLGFIRDANGNPKEVVDLDGVGGVSILARAQIFRQGVHF
FT                   PAFTFLNHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSEDDLEKVSKLERKKRRQRW
FT                   KISS"
FT   gene            complement(1016690..>1018609)
FT                   /gene="PGM3"
FT                   /locus_tag="PICST_91072"
FT   mRNA            complement(1016690..>1018609)
FT                   /gene="PGM3"
FT                   /locus_tag="PICST_91072"
FT                   /product="Phosphoglucomutase/phosphomannomutase"
FT                   /note="Has EST support"
FT   CDS_pept        complement(1016690..1018579)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PGM3"
FT                   /locus_tag="PICST_91072"
FT                   /product="Phosphoglucomutase/phosphomannomutase"
FT                   /note="Phosphoglucomutase 2 (Glucose phosphomutase 2) (PGM
FT                   2); go_function intramolecular transferase activity,
FT                   phosphotransferases; go_process carbohydrate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_91072"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68352"
FT                   /db_xref="GOA:A3LZK5"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZK5"
FT                   /protein_id="ABN68352.2"
FT                   /translation="MAEAYDVARLDQLVQDWLAVDINPESRNEIALLLKNKQYAQLHSK
FT                   LANRIAFGTAGLRSSMESGFAHMNDVTILQASQGLIQYLLDNRTSPESPVSIVVGYDHR
FT                   YNSQRFAEITASVAIAKDIKVYYLGSIENLSEASIKFSSTAYAQNPETERGYVHTPLVP
FT                   FAIDLYGASGGVMVTASHNPARDNGYKVYYGNGCQIIPPHDEGIASSIEKNLAPWKADN
FT                   VWDVTGNFIRGIENNLLEVVRKDTSEAYVEAVKSKLILDSKLNFDFVYTPLHGVGLEIF
FT                   EKTVDLFDNARFKVVHEQAFPDPDFSTVKFPNPEEKGALDLAIKKAESLGYKLVLASDP
FT                   DADRFSAAIKTKQGNWKQLTGNEIGFLFAMFTIENIPKDQLANTYLVNSTVSSQILKSM
FT                   ADKNGFHFIDTLTGFKWIGNRAIELKNEGYNVPFGYEEAIGFMFNLVNDKDGISAAVIW
FT                   LQLYNRWFATGETDFDPVDKLNEGYAKYGWFKECNGYYKLNDLSKTREIFENVRSSFSP
FT                   QKYPKTIGNFDVLSWRDLTVGFDSTTENNIPDLPVDPKSQMITAILKPLNSQSDEHVRF
FT                   TCRGSGTEPKLKVYIEGKSSVSESGAVAVARACWNTLRDEWFKPEDNDLLEVV"
FT   gene            complement(<1019112..>1020656)
FT                   /locus_tag="PICST_85107"
FT   mRNA            complement(<1019112..>1020656)
FT                   /locus_tag="PICST_85107"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1019112..1020656)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85107"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85107"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68353"
FT                   /db_xref="GOA:A3LZK6"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013915"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR038959"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZK6"
FT                   /protein_id="ABN68353.2"
FT                   /translation="MICSISGQQASDPVISPKSGAIFDRKHIESYISTAGTDPISDQPL
FT                   TVEELIAVKTSVSEVIPPRISSATSIPALLSTFQNEWDALALEVFTLRKQLYKAREELS
FT                   AALYHHDAAVRVAANAIRERDEAKAALQELAISIGKSEVGETAEAVNNSENGNGKAIAG
FT                   SIDEIPAEEINQAREVLFSLHKSQKPVFDIAPDAQISVEFIEKKGQPFKKSTASFLDSE
FT                   TKSLLVGTSTGQLAKFAFAGEGDDILTKSTASKGTITAVNFVLVESEPLPIIAYKNKII
FT                   IGQNKRTFKNNHSGAILQILVHPKLTNLFITLGEDNVWALHDSIREQSLLYQSPMSDSN
FT                   IRTGDFHPDGALFAIGNDSKEVKVYGTSTAEQMTVLEPFYTNVIKVKFAPNGYWLLVGS
FT                   TDGEKSRLDVFDLRKSTLVHNITFEEPLRDFVIDPSSSIVVSLGGSNTIALHKYIKKGK
FT                   QWKNNYSMESFTNLSTLQAIHLLTNVNDESFKNENEIRFVGVAEDSTVQEFNLSYG"
FT   gene            complement(<1021003..>1022133)
FT                   /locus_tag="PICST_49689"
FT   mRNA            complement(join(<1021003..1021862,1021908..>1022133))
FT                   /locus_tag="PICST_49689"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1021003..1021862,1021908..1022133))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49689"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49689"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68354"
FT                   /db_xref="GOA:A3LZK7"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZK7"
FT                   /protein_id="ABN68354.2"
FT                   /translation="MFTIFRIILIFFSIACTVLTAFAVTGSFKNERFLTNTYLVNVHLT
FT                   SLNTSALINMAASGANIQKRATSTIPQVAAVWQSAQNGDISGAESSIIQTIDAAIPDIS
FT                   YRELGLPDVYSFSYWGYCRGYIIGDITASNNHPFDNNKVNYTWCSPAQVGFQLKPIDLF
FT                   KTELNNTLNNRVNGLPAGIQTAASTYSNQLQLLLNSIGDDNLQLPGNLNENIDRLNTVT
FT                   VVSFGFLLTACVLSAISVIIQLLAFFFSPNSCCLTFLNFLFQVLVLIVVLVASATATGV
FT                   FFFVRGQINDHTNEFGMKSFLSINFYAFAWSAAAAALLVVLFGLLGHCCGLFGTGRRRY
FT                   RAVQPPVAYDHKEDMVESDSD"
FT   gene            complement(<1023892..>1026279)
FT                   /locus_tag="PICST_63097"
FT   mRNA            complement(join(<1023892..1023969,1023985..>1026279))
FT                   /locus_tag="PICST_63097"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1023892..1023969,1023985..1026279))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63097"
FT                   /product="predicted protein"
FT                   /note="go_component intracellular"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63097"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68355"
FT                   /db_xref="GOA:A3LZK8"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011947"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR039189"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZK8"
FT                   /protein_id="ABN68355.2"
FT                   /translation="MSDSTPITLPQSVPFPVTITSIDCSVGQTVAKHKPIFKYKYWEYQ
FT                   DDPNSQEAVPPKIRVERIGTFESPIEGEVQQINIAVLDEVAHSGIELCSIREPCSHTVQ
FT                   YGGLCALCGKAVEDEKDYSGYTFEDRATISMSHDNTGLKISLDEAAKIEQSTTDRLNEE
FT                   KKLILVVDLDQTVIHATVDPTVGEWQSDPSNPNYPAIKDVKTFCLEEEAIVPPGWTGPR
FT                   LAPTKCWYYVKVRPGLSDFLEEIVNLYEMHIYTMATRNYALAIAKIIDPTGKYFGDRIL
FT                   SRDESGSLTHKNLKRLFPVDQSMVVIIDDRGDIWQWESNLIKVVPYDFFVGIGDINSSF
FT                   LPKKNGQLTGPTKKRKSIAKLEAQATAELQVEEEPSFDDDEDKAAADLDADSASPVDRI
FT                   LELGGGEGNTDLLIEQSITRNQSIEQQQSERPLAKLQHDLEKMHHHEQDGHSRSNSPDG
FT                   TSADEEEDDDDDEDDNLLYDDDNELTALNKVLINIHNQYYKILGENILKNSSLKPDLTK
FT                   IIPYMKSQTLEGITVLFSGIIPLGINFENADIVIWCKQFGVKVVNEVYPEVTHVVCRDP
FT                   SNGQGPTFKARVARKILPDAHIVNPDWLFACLSAWNKVDEADYLIPLGDEKLWVVRSKD
FT                   IEKYQKALENQKQKEADRSIQRPRFGSIDSIEEYDLEQANQEVDEFLAGISDDDEDDED
FT                   DLEATLVDEIRNGGNYKNVNEEDEYDEELENGKSADSFIKELYSTKKRKHEQEEEDESE
FT                   NEVVEEPESNGQKPSKDEDLDELEQELLDGFDDLEED"
FT   gene            <1027420..>1028436
FT                   /locus_tag="PICST_50114"
FT   mRNA            <1027420..>1028436
FT                   /locus_tag="PICST_50114"
FT                   /product="predicted protein"
FT   CDS_pept        1027420..1028436
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_50114"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_50114"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68176"
FT                   /db_xref="GOA:A3LZK9"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZK9"
FT                   /protein_id="ABN68176.2"
FT                   /translation="MSNISIALSLADSHCHIGIDCTDSDIDALADQFNNGLVDKDDFFH
FT                   IMTTYHLDVGFVDRLLSQLKSSVVVAYFGVHPWYSHLFSTEDHGDVDLLQLKKLHYNKV
FT                   LVPAPSEDLLSVLPVPISLEEHMTKLERLIEIHGHKFKCGIGEIGLDKLFRVPSNGYFG
FT                   SQLAQNNGATKLSSCKVSMEHQTAVFDRQLQLANKLKKHISVHCVKAHGLLYDIIPRYT
FT                   SISSVILHSYSGSSDQAKRWITTYKGKKSKLFFSFSNWINGTDNKRCLLEDIIGYAEDN
FT                   QILVETDVSVDDYLVRGKHEDYFLHLEGIFEKVGTILGRDQDEMVELLRRNMCRSIE"
FT   gene            complement(1028545..1029406)
FT                   /gene="TPI1"
FT                   /locus_tag="PICST_91105"
FT   mRNA            complement(1028545..1029406)
FT                   /gene="TPI1"
FT                   /locus_tag="PICST_91105"
FT                   /product="Triosephosphate isomerase (TIM) (Triose-phosphate
FT                   isomerase)"
FT   CDS_pept        complement(1028593..1029339)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="TPI1"
FT                   /locus_tag="PICST_91105"
FT                   /product="Triosephosphate isomerase (TIM) (Triose-phosphate
FT                   isomerase)"
FT                   /note="go_function triose-phosphate isomerase activity;
FT                   go_process metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_91105"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68356"
FT                   /db_xref="GOA:A3LZL0"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZL0"
FT                   /protein_id="ABN68356.1"
FT                   /translation="MARQFFVGGNFKMNGTKDSVTKIIDNLNSAELPTSVEVVIAPPAP
FT                   YLALAVAENKQPTIAVSSQNVFDKASGAYTGEISPAQVLDLGAKWTLTGHSERRTIIKE
FT                   SDEFIADKTKFALESGLSVILCIGETLEERKAGITLDVCARQLDAVSKIVSDWSNIVVA
FT                   YEPVWAIGTGLAATPQDAQDTHKGIRDHLVKTIGAEQAAAVRILYGGSVNGKNAPEFKD
FT                   KADVDGFLVGGASLKPEFVDIIKSRL"
FT   gene            complement(1030004..1030914)
FT                   /locus_tag="PICST_85057"
FT   mRNA            complement(1030004..1030914)
FT                   /locus_tag="PICST_85057"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1030081..1030911)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85057"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85057"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68357"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZL1"
FT                   /protein_id="ABN68357.2"
FT                   /translation="MFYTSPYSRARQTCNNIIEGIKDLPGVDYTIREETRMREQDFGNF
FT                   QATPEEMERIWEERAHYGHFFYRIPHGESAADVYDRIASFNESLFRQFQQDDFPNILVL
FT                   VTHGIWARVFLMKWFRWSYEEFESLKNIPHCHYLIMKRHDGGKFFLKTRLLTWDDVDED
FT                   DIDAQVVKEVGDEVCFNSQNKLTNPEDLDISGIIEAQKIAIRQLREKNKKIKEAYDKIH
FT                   SNGNGYTDYREKMVSRFKLDNQSVVNSVENLSGQLSPTRNFSPSISGTLSPPSR"
FT   gene            complement(<1032289..>1033406)
FT                   /locus_tag="PICST_85399"
FT   mRNA            complement(join(<1032289..1033279,1033390..>1033406))
FT                   /locus_tag="PICST_85399"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1032289..1033279,1033390..1033406))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_85399"
FT                   /product="eukaryotic translation initiation factor"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85399"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68358"
FT                   /db_xref="GOA:A3LZL2"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR027524"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZL2"
FT                   /protein_id="ABN68358.1"
FT                   /translation="MATKQTKKYQQPTATSINVESSVLLSLIRHTSENYPSLFSGALLG
FT                   FEDDEGSIDVTHAYPFPYPDQYEGGSFRSRSGAKYQQEILESLKKLEYGVEFQGWFQST
FT                   VSGNFVTTQLIEGLAQQQLTNKNAFILIHNMASVGKEVELKAFRLSEGFIGAYIDGKWK
FT                   SKDLEANKLTYLNIFDELPINIHNQHLVNLYLAGLDNEAKGEKEFDVLNLSSNQNVTAQ
FT                   LLESLYSQVDSYNYDQNNFNYYQRQHQKEVSKITQWKQQRKLENLERAKRGDKELDTEE
FT                   WRGIFKLPSEPSRYNNMLHSNAIDVLADDILKKCDEELTKSFAIERKLTAGDSQ"
FT   gene            <1034396..>1036966
FT                   /locus_tag="PICST_1946"
FT   mRNA            join(<1034396..1034891,1035204..1036010,1036092..1036221,
FT                   1036486..1036707,1036843..>1036966)
FT                   /locus_tag="PICST_1946"
FT                   /product="predicted protein"
FT   CDS_pept        join(<1034396..1034891,1035204..1036010,1036092..1036221,
FT                   1036486..1036707,1036843..>1036966)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_1946"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_1946"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68177"
FT                   /db_xref="GOA:A3LZL3"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014012"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZL3"
FT                   /protein_id="ABN68177.2"
FT                   /translation="SSVKSLKTALEAAQDELDSFLDRDIAEMEILSVPEHYPTKPHTVS
FT                   SLAELYYLTQTLPLIKLLPGSHKVLMTDNFESALLEGKIAVLYSRIEELKRQGKWSLRQ
FT                   PSKFYDPFTYKKKSKKITFYWDNLLAEAKWMATDFHESAKFKRACCVMLAQAVSDYWTY
FT                   GKRPFKMFVDLNDLKKIDQSIIKNLPKFTAFDDDSNVAPVSALKPSESPLASISRLIHP
FT                   FEDDNNWHKIILKDTNSSSKNVRTEGPPEYQKGLFGIQSHRRFNYLKPPKPPLIKNIEY
FT                   RSPTIWLPQDDKYLIHYVAEFSFNWELISEHLSTSSSASSLKKYESNIERRTPWQCFER
FT                   YIQLNEKFQFSDMKGVYAYHAQQWLEQAHKAQSTTKRRISPLGVGAESIQRGHRRLRWA
FT                   SMFDAMRKCMKKREIAVAKVSQRRTTNDYSAANTNTGASVVKRPMDRVPNPAELSKLKF
FT                   ERDKSIQEAYLNQQATRSRISGAPISGQSSPVPGNQQLGQLPNGIRRPTTPNGTPYTNE
FT                   QIQQLIQLQKQRRLMQQQNQQNKTSIGSSSSSGGLIHFAPAQVSAIINSIQQKNPGFSK
FT                   EQVTKLAAQYLANLQQQ"
FT   gene            <1037787..>1042415
FT                   /locus_tag="PICST_68402"
FT   mRNA            <1037787..>1042415
FT                   /locus_tag="PICST_68402"
FT                   /product="predicted protein"
FT   CDS_pept        1037787..1042415
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_68402"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68402"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68178"
FT                   /db_xref="GOA:A3LZL4"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024986"
FT                   /db_xref="InterPro:IPR026003"
FT                   /db_xref="InterPro:IPR033031"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZL4"
FT                   /protein_id="ABN68178.2"
FT                   /translation="MVGEGVHPRDMREALSIAPFLHLIPKQEIAPLISSTSITISPDPQ
FT                   EFNSQLYDSECKERRKVVNSDETSFGEVLKDLASEFTDCQDEEVDQIRFRKPEIIQNGE
FT                   KQPQELTGITLPALERRIFNSTKIESRQIILSSRSADTRTYTGRLSVRKTYQAEDKQTK
FT                   AHNDRYLRKYERELGFLFAEDKEFSKELPNSYANRKRYLEDDEEYNAKRPHRIVTMTYD
FT                   QVADRANVNMAILLQQIEREEAEPEISANWMILDDTKILTNYALLHIHDNLIRNLNHRV
FT                   LHTEDNDISYLSKIQDLCLRTINASENIDFSELSLRVIAPDLQDNDLASLIISLETCLN
FT                   FTKASKIMLLLLTSHYSEKLMFYDAHTNSVIQLMDSVVDLLIIPLASFENVQPITNTLK
FT                   PILARLLVEVCDLFQLFNSYKHPNRFDDTLITKLEYLCIHAVFAEYRSKGNNSFFGLSQ
FT                   FELLKLRSCEMIISLFSNISDQREFILGELISNFDKLSPNRTVARQYKLAGGGNVQLVS
FT                   ALLAKLIESSSADFDVSSLSESFIDSPALSNNVKESILNCKKTGDNISRMLISKFSGTT
FT                   STMSKQSLELMVEDLLSLMLSPVWAGSTVLLTSITNSFLIMINAEADPPLETTMLDMLG
FT                   LIVLKIKCISCKKELKRITPRASSEDLNICKSMMINVLHELKSISGNVFSIASSQFLLL
FT                   KYLSYFLSLVGDSENNSLLANTEVENLEVVAKQACRDLINATSDGQTNISKDASAYTEN
FT                   EYLSIMNSQELEVLYEGFLGSVVGLMDSNKVKVRAKCIKILSSLIEQNDELLLSPKIQE
FT                   SVSNRLFDNSPLVRDAVIDLIGRYMSSNPVLVDRFYKSICECLVDESVQVRKRVAKLSG
FT                   QMYEKTTSKSVKVYISSKLIRKLNDEDDVVQDISRSILLSLWFPKSNNLEKVDSSKTTA
FT                   EVMMDIVKSGGRTSEGFESFIINYVNSNNSQAAKVAMKLKLAQVFDFIIEGGDAVASAM
FT                   KLVAMFVKCDSSIINQDQLVSLEPFFIEEKSTEGTSRLYGLEILSSALPSIGSLRPDFL
FT                   ASLVSNLLKKLTKYSVKELHHVVPSVWVLCQMNKDSIKLANATISCMRLIKPYFEFKED
FT                   KKFDVKLQKLLHLLGCFGRYCRLENHRDLFQKSSLGFKAKESVTSGIVKFLMYFCDSKM
FT                   PSTIRNTALANMIHVCRTHTKLFVSEAILKVFDREMNLKSNVESFNTIIRGLFDFLKDE
FT                   EIEVRRRVGSSSTSSDKLKIDISVFHGDSKSFLHDGICAGLIQRYENRILEMTLYDKGE
FT                   QSYLAVQFVELIVKIGFSNPKLCIPTIIALHSSPNPYVRNIARQVHKELFEKHESLIDT
FT                   SYAEGFTLSFNFSRRLSLDDSSSTEVFNSVYSIIQKTYSSRKKFINSLLRLLVVDLERT
FT                   SIVDALEKLQFARNKVCNIAKINFATLEEVLMIVHEIDHVVSRSGMDLVDKLKTQTDDV
FT                   AIDLVIAQSILAISALRSHLVNKFSLGRSLIDRFIPGKVDPDMRHAIKSSYQLPLEIPV
FT                   LPETLEKSSLIIIVQNEVDKYA"
FT   gene            complement(<1042951..>1043691)
FT                   /locus_tag="PICST_6407"
FT   mRNA            complement(<1042951..>1043691)
FT                   /locus_tag="PICST_6407"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<1042951..>1043691)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_6407"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_6407"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68359"
FT                   /db_xref="GOA:A3LZL5"
FT                   /db_xref="InterPro:IPR029184"
FT                   /db_xref="InterPro:IPR038988"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZL5"
FT                   /protein_id="ABN68359.2"
FT                   /translation="RKLRSNDHLKKEPNQLLFNFENLSRLLYRNDPISVSSETDYGKLF
FT                   VSGADPGLPLPSAISKKSDVQIRSELLPRSKKNIADPLPDKCYDVFHRKMKKEEKVMTN
FT                   EDRLRILSEVDNLQTQLALLNQYDWIRHLPGIAFINDPRDYEELEQKKLLTISEIERLI
FT                   RKHENWRRRLDAITAAIKEFEIYGDDEKETDEYDVPIDVLKERRQAERRRLYGPRIKLR
FT                   LNNLYSLIIDPILPPKIVHTSELTK"
FT   gene            complement(1044089..1048293)
FT                   /gene="SEC10"
FT                   /locus_tag="PICST_90882"
FT   mRNA            complement(1044089..1048293)
FT                   /gene="SEC10"
FT                   /locus_tag="PICST_90882"
FT                   /product="Exocyst complex component SEC10"
FT                   /note="Has EST support"
FT   CDS_pept        complement(1045657..1048095)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SEC10"
FT                   /locus_tag="PICST_90882"
FT                   /product="Exocyst complex component SEC10"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_90882"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68360"
FT                   /db_xref="GOA:A3LZL6"
FT                   /db_xref="InterPro:IPR009976"
FT                   /db_xref="InterPro:IPR033960"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZL6"
FT                   /protein_id="ABN68360.2"
FT                   /translation="MNFSIYDLDENIKKLLNLDNFLNGITVNDFIEEISKDHFLKEAEV
FT                   NKLGYLDPKPYIRTFESTLRELKQLNSQSSEQTQMSERHVDNYELKHSENVLQLSSNID
FT                   RSVKKFDVLDAKISEVTNRINPLGHSLNKITNSRDRSLETIFLIRAYHGFYTKEKFDAL
FT                   ETLRTSSKYDDKTKCAKTVANLLTLAKKIESPDLPKTTKCLQVIEKYSEVMERNLLNKF
FT                   EVASEEGHFDIMREIAKILFEFNGGANVVQTFVSKNDITLDPAQDEEGSILDEESTWQK
FT                   LSDPNFGEVIKDKSTENILDTLRFEIKSRARVIQQVFEDPVPVLKIFIQRVYAQIVQNK
FT                   VNTLLQFSLSVSTLAHVRVLHVLYILVGDFTKDVKEFLTMNEFDKENELNSILDQSFYD
FT                   IFIEYTSETVYFSREKKNLEEIVYDIVHKFNTYNEAELSSQALATKIENLDNFEYNQKS
FT                   TEHASNDRFSFHFSERKRLNQFKAYVKSKLTDKPRNSVSERNDLEAELYKNISITKVET
FT                   VLKSAIESVARILELTPTKAPELALEILEIILFDFGKLYIGGGLEVAYDHLKQENVSSK
FT                   INSNQEFNFDYLYTFSLVSEILFLVSSTIKKIILPCAVNFPNIKNRMINLTNSYVSRCE
FT                   VSLNILLQETLDLIAGRLAFCLTKQKKKDFFCDNIEDDTEACESISEFLNVVYSTFIGT
FT                   LNNDNLENVLVKVGMNLLNQLLEHYKKFTVNSIGGIVLTKDVIRYQTCIDEWDIPELTE
FT                   NFQLLKEIGNLFTVQAKLINSLVTEGQLANLKPYTIRQYVAKRADFNPSYIERFFNLKH
FT                   "
FT   gene            complement(1048626..1049149)
FT                   /gene="RSP27"
FT                   /locus_tag="PICST_73842"
FT   mRNA            complement(1048626..1049149)
FT                   /gene="RSP27"
FT                   /locus_tag="PICST_73842"
FT                   /product="Ubiquitin/40S ribosomal protein S27a fusion"
FT   CDS_pept        complement(1048666..1049121)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="RSP27"
FT                   /locus_tag="PICST_73842"
FT                   /product="Ubiquitin/40S ribosomal protein S27a fusion"
FT                   /note="go_component intracellular; ribosome; go_function
FT                   structural constituent of ribosome; go_process protein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_73842"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68361"
FT                   /db_xref="GOA:A3LZL7"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038582"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZL7"
FT                   /protein_id="ABN68361.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGGKKRKKKVYTTPKKIKHKHRKHKLAVLT
FT                   YYKVDNEGKVERLKRECPAPTCGSGVFMANMKDRQYCGKCHLTFKAN"
FT   gene            complement(<1051062..>1051733)
FT                   /locus_tag="PICST_37090"
FT   mRNA            complement(<1051062..>1051733)
FT                   /locus_tag="PICST_37090"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1051062..1051733)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_37090"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_37090"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68362"
FT                   /db_xref="GOA:A3LZL8"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZL8"
FT                   /protein_id="ABN68362.2"
FT                   /translation="MDSKQSALIERFQDSKLNQIRGNNDDNDDDVHSESEDDLLATLDD
FT                   DDDDVMAKYRESRIQQLSKEFSKINDTVKSTNESELGNVILMESEKQVMDYVTSNEIVL
FT                   VHFFQPNFAKCKLMNSQLDQLAEKHLELNVVKIKAENAPFLVVKLEIRVLPVVVIYRDA
FT                   KVISRIVGFADLGSNPDSFTYEQLENYMAWKNVISRKTISYKHIRSNKKEESDDDFDYF
FT                   E"
FT   gene            complement(<1052484..>1053209)
FT                   /locus_tag="PICST_33591"
FT   mRNA            complement(<1052484..>1053209)
FT                   /locus_tag="PICST_33591"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1052484..1053209)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33591"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33591"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68363"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZL9"
FT                   /protein_id="ABN68363.2"
FT                   /translation="MKHKLGCDDLEIPTAKKTHTSQLPDELDLIFSDMLPAESSIYLSS
FT                   SERLAIDAEIDQALSGFDFSTVDQQEQMSENQTETSTKEESHEELDTLITASNESKPQS
FT                   SNVSSSSENSTPFDSPETITTSITYNEEDIKKHTTEINKETLASIKHSMVNTSKVMSLF
FT                   TTLKVTYLKLCKEFNYLLQKFNENEKIKIELINENNELRKLLTEIITKRELERKRAKEL
FT                   ESKNGVLELKLMEKELKTN"
FT   gene            complement(<1053868..>1054512)
FT                   /locus_tag="PICST_63739"
FT   mRNA            complement(<1053868..>1054512)
FT                   /locus_tag="PICST_63739"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1053868..1054512)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63739"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63739"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68364"
FT                   /db_xref="GOA:A3LZM0"
FT                   /db_xref="InterPro:IPR006797"
FT                   /db_xref="InterPro:IPR037365"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZM0"
FT                   /protein_id="ABN68364.2"
FT                   /translation="MKLFETDHYFHYPWDQVTAANWQKYPNELSTHVVSVDVLNRTIDE
FT                   ERKTLRTERLIACKQSIPKWLTFIVGGEQKSYVREVSEIDLVNKTLVMKTHNMTMSHLL
FT                   LVNETVVYRPDPELPSRTLFKQSAEFTAYASISKICDKIEEWSVERFGQNAKTGKLAFE
FT                   HVLQSLTEKWDESGLFVNDVSNTIMKEVNDVSKKTSNVITEVKKLGIFTNN"
FT   gene            complement(<1055288..>1058566)
FT                   /locus_tag="PICST_33593"
FT   mRNA            complement(<1055288..>1058566)
FT                   /locus_tag="PICST_33593"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1055288..1058566)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33593"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68365"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZM1"
FT                   /protein_id="ABN68365.2"
FT                   /translation="MANTVLDYFLKLHIFNSEVNIADLVDMAVQFQRMFELSLLPEDKA
FT                   RLYDVISGKCASFNSYSSEDAILTPQGEYRRLNEFFKNYSPNDTYYFDEIHINVGSKNF
FT                   TVSVSGNLSASGFLDPLVVSNLPSKSFNYYPTGLLNSTHLHAYLARINLQMRLRGQKIL
FT                   LVLHNNVVVDSRQFSNIELLYISPEVDKYFQNNPDNCIKFPDEYGLKSWIRSHIIDRLS
FT                   KLKTFDNPSLLINSILYSYSTCISKLLHDPLYFQFNQLNLMSSNFMGNNMPAPYYVNEN
FT                   IKITDGNLIVMDEAPEIGQYSAREDNFKKLNNYNYNVKDIYFILSSLLSYQNSDIGHDY
FT                   GFDAKEIMDFLVQKVHPFLIQREFPFVGHFHRFLDEFINEYARIGASDDTDETDNAFSV
FT                   SEKFHLGPLQEAARIEKILVSAFDQDGDNLASMSFPHIDSIEVANSEASFLKASARNLS
FT                   NGNSLPLPTLDEYDMFTPKKRRSSTNSIPTIKKSKIIEIMKKDKLSFVNSAQGSVFSDD
FT                   SDYSEDSFSSKIKQFKDKVDSNGSVLSQNGNGKVVEENDANAYENEKSGDEDEESSEEE
FT                   NDSAKEEERKDDDREEYYMHRELINPVGGDENGDIEEEVYGQDDDIEMEKVQQEETISI
FT                   QPEAKASSIQMEVEPNSTEESSNSDSNSSSDSNEVADSNNGEKTYIKEAHMNEPTSRED
FT                   NPSDSSESQSSDSSESDAEDSAEEEETHPESNSKVPLSSSTISPSQLPIPVPNPVPAPV
FT                   KTSSISATPSTQIKLPRRSLGTLSSLVPPKSTVESKDTPKTNSDRSKFKGKLDFSSDDS
FT                   FSSVDSDSSDESNDDRNVSQLAQVKVTSTKAVPKTDSTKSTTITNTIRSKPSSIPANST
FT                   ALTKHISTKAVLSKPVSPLLKKVLDAGSSRDPKLAPSAILEHVSKPKEKRINPSQLKSI
FT                   ERRQYDSSSEDEMSDPINESSDESEDELFGTSPNVSTSTQRTQTQNSTQIQIQTSNSTT
FT                   KSPVRKPGSPLQFSFDRNSPGQSALSPREKLQFSSQSTPASAGKGRPTILSMKLKELEA
FT                   RQASPSKKEIPKKGQRQTSQAKERQLSASDSDSSSEDSDDSIGF"
FT   gene            <1059319..>1060602
FT                   /locus_tag="PICST_33594"
FT   mRNA            <1059319..>1060602
FT                   /locus_tag="PICST_33594"
FT                   /product="predicted protein"
FT   CDS_pept        1059319..1060602
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33594"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33594"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68179"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZM2"
FT                   /protein_id="ABN68179.2"
FT                   /translation="MMNISFSPDRNESPFTLKLYPNSKTDSSPNSNTLESANDSDSKTS
FT                   YPWSSVTEGAGESSPGFIRGVFKLKRRASTTLSPPPSPPHIEEKLEEPEPVHLELYNKF
FT                   KQEPLGISFPVVNYDSVGDPGGLGINFDHPSLDFDIKLPKFESSSTILSSAGTPPSSKT
FT                   PTKQKSSSPFERVKQLLYRNHWSHHDMNKQSAEFSVASSEFRSPVNMRIPVKEDWKTGV
FT                   GVPIDISIFQNNGFGSPISEQCVQDNKSIKFKQYVDMLVYNNKFPYSSSTSSEKIDRSC
FT                   ASPVSNDSYQDNSNWSNAWPKKRLRKSKSAPFKRMVPLESSYEGSENPSTRRKRSISLS
FT                   LTRRTIKNISNIPETPASRPVSSILKNKINSNFDIERQNTVRDDTVNIEAFLKNFERFE
FT                   MEKYEKESQLEHLRHQQIQHYYENEEFA"
FT   gene            <1060895..>1061905
FT                   /gene="GRP3.4"
FT                   /locus_tag="PICST_49223"
FT   mRNA            <1060895..>1061905
FT                   /gene="GRP3.4"
FT                   /locus_tag="PICST_49223"
FT                   /product="protein induced by osmotic stress"
FT   CDS_pept        1060895..1061905
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="GRP3.4"
FT                   /locus_tag="PICST_49223"
FT                   /product="2,3-dihydroxybenzoate-2,3-dehydrogenase"
FT                   /EC_number="1.1.1.195"
FT                   /note="NADPH-dependent cinnamyl-alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49223"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68180"
FT                   /db_xref="GOA:A3LZM3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZM3"
FT                   /protein_id="ABN68180.2"
FT                   /translation="MTTVFVSGANGFIGQHTVQQLLEAGYTVIGSVRSQEKGKKLSTAL
FT                   KSDKFSFVVIPNIADVGAFDKVLDDNKQITTFLHIASPFRFNVQDIEKEILIPAIEGTR
FT                   NVLTSIKDHAPQVTKVVVTSSDAAARENDDKNPDLTLDESVWSKATYESSKHDPVAAYL
FT                   GSKPLAEKLAWKFVEEEKPNFKLITVLPSYTFGPQIDDSLVLKDLNSSSKVFEEIITSN
FT                   PDSQLYTHNGSFVDVRDAAKAHLVAFQNDEAIGKRLILSSNRFTSQTIRDILLKEFPQF
FT                   KGQIFEGVPGEDIEDIKQMPVLNYSQTNNILGFKFRDIKTSSVDAVAQLLRVRDA"
FT   gene            complement(<1061986..>1062570)
FT                   /locus_tag="PICST_49425"
FT   mRNA            complement(<1061986..>1062570)
FT                   /locus_tag="PICST_49425"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1061986..1062570)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49425"
FT                   /product="O6-methylguanine DNA repair methyltransferase"
FT                   /note="go_function methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase activity; go_process DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49425"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68366"
FT                   /db_xref="GOA:A3LZM4"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3LZM4"
FT                   /protein_id="ABN68366.1"
FT                   /translation="MKNLFYSFVSGSEYLVLVALDTEGCVYYASAGELNSQASMVELME
FT                   KDFLKAPEFRVNSLNSASSSLVNKKSEVKIKDTLEKFKSLIDFENKDEKIPYKVVFGTP
FT                   LQRKVWDYLVNELPVGSISTYQKIAQHLGMPNSSRAIGNCVGANRIAVVIPCHRVIGSS
FT                   GKITGYRYGTNIKKTILQNELGSKYGSTITN"
FT   gene            complement(<1062634..1063326)
FT                   /gene="CTR3"
FT                   /locus_tag="PICST_85023"
FT   mRNA            complement(join(<1062634..1062978,1062992..1063021,
FT                   1063051..1063326))
FT                   /gene="CTR3"
FT                   /locus_tag="PICST_85023"
FT                   /product="Copper Transporter integral membrane protein that
FT                   functions in high affinity copper transport"
FT                   /note="Has EST support"
FT   CDS_pept        complement(join(1062757..1062978,1062992..1063021,
FT                   1063051..1063326))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="CTR3"
FT                   /locus_tag="PICST_85023"
FT                   /product="Copper Transporter integral membrane protein that
FT                   functions in high affinity copper transport"
FT                   /note="go_component integral to membrane; go_function
FT                   copper ion transporter activity; go_process copper ion
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_85023"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68367"
FT                   /db_xref="GOA:A3LZM5"
FT                   /db_xref="InterPro:IPR007274"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZM5"
FT                   /protein_id="ABN68367.2"
FT                   /translation="MGGGSGCKISMLWNWYTIDSCFIARSWHVKSKGGFAGSCIGVFFL
FT                   VVAAQWLHRFCRELDKSFVRKHLANKLASENFSSEDELERSKIGESAFCFLRCFTPVGY
FT                   GDITADFFEHAVRTFLYTVEWGLSYIIMLLFMYYNGYIIISCILGALVGKFIFSYKEPL
FT                   TVDDAEDRKCCR"
FT   gene            complement(<1063648..>1064374)
FT                   /locus_tag="PICST_33598"
FT   mRNA            complement(join(<1063648..1063686,1063796..>1064374))
FT                   /locus_tag="PICST_33598"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1063648..1063686,1063796..1064374))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33598"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33598"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68368"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZM6"
FT                   /protein_id="ABN68368.2"
FT                   /translation="MGIPYPFYVDQPGTLEAEMYHHPTTAATTATTSCRQQLNTEEGKV
FT                   VRSFICNECHTPISVCAYNQNFDNQNPNVSDFSFVNVKPEDHLEVLNQQIVVNNMFCCT
FT                   CNSFVGFRIINFIPVQPKLIEYEVPKIAQDSNSQPSDDVPDIDLIRFKNKLINIENDLT
FT                   IKSQRLNYLHFLKANEKLIGRYYLALSRVKLTDIRYGTIQAD"
FT   gene            complement(<1071670..>1072743)
FT                   /locus_tag="PICST_33600"
FT   mRNA            complement(<1071670..>1072743)
FT                   /locus_tag="PICST_33600"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1071670..1072743)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_33600"
FT                   /product="histone H4"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33600"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68369"
FT                   /db_xref="UniProtKB/TrEMBL:A3LQY3"
FT                   /protein_id="ABN68369.2"
FT                   /translation="MAKEDNFIDPNSEVGKQLQKLKDEFKQELLVQSAKYDALMEAMKA
FT                   QSSSGVPPPQINKSEDRNEEIRKDAKKDSELAATAFKGIVPLARNIDAITKWEKAFLKL
FT                   FRRYGGLQKIWDEDLGHDSKDFNIKNIPWRGKELETFIHRLSDELISRIIDINEKAFSE
FT                   IDEVNYETDLKTMYIFVKTYKMENLPHRIGQVLTYLRYTGDFRTDTDRAVDGLSHIKQW
FT                   VEGTNEEILDFLCKMKLYYIIVFDRYLNEVETRNMFYKSLAWFFQEHKKDGKTPTIDDV
FT                   IQRMRNHHDYEPPDSSDKRTIESLISERIKNAQEREKTKSNGNRGNFAKSHTTGESHDG
FT                   NKSGFKSKTSGAKRHGQ"
FT   gene            <1073390..>1074184
FT                   /locus_tag="PICST_49723"
FT   mRNA            <1073390..>1074184
FT                   /locus_tag="PICST_49723"
FT                   /product="predicted protein"
FT   CDS_pept        1073390..1074184
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_49723"
FT                   /product="Phosphoadenosine phosphosulfate reductase"
FT                   /note="go_function transferase activity; go_process
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49723"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68181"
FT                   /db_xref="GOA:A3LZM8"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011800"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZM8"
FT                   /protein_id="ABN68181.2"
FT                   /translation="MTSTPSVVLTPEHLKFLNEKLQFLEPQEIIRWAQITFPNLFQTTA
FT                   FGLTGLATIDMISKIATRYSEEKYPIDLIFIDTLHHFPQTYDLVENIKIRYNPQIHVFK
FT                   PKDVETESEFSVKYGEQLWETDDSYYDFLVKVEPSQRAYKQLGVSAVLTGRRRSQGGAR
FT                   GTLPVIEIEESSGTIKINPLCNWDFKQVKSYIDENKVPYNELLDLGYKSIGDWHSTVPV
FT                   AEGEDERSGRWKGKAKTECGIHETSKFAQFLEKANEAKKEVV"
FT   gene            <1074672..>1076363
FT                   /gene="CYP559"
FT                   /locus_tag="PICST_63000"
FT   mRNA            join(<1074672..1075130,1075227..>1076363)
FT                   /gene="CYP559"
FT                   /locus_tag="PICST_63000"
FT                   /product="cytochrome P450"
FT   CDS_pept        join(<1074672..1075130,1075227..1076363)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="CYP559"
FT                   /locus_tag="PICST_63000"
FT                   /product="cytochrome P450"
FT                   /EC_number="1.14.14.1"
FT                   /note="go_process electron transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63000"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68182"
FT                   /db_xref="GOA:A3LZM9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZM9"
FT                   /protein_id="ABN68182.2"
FT                   /translation="ILGVFLAYHLILYPFFLSPLRDVPGPYLHRISSLSSLNKQRKGRW
FT                   TMTVYELHKRYGDVVVLSPTEVSVNGNSKYVHDIYIKNFPKAKFYENFRNHGFKDNMFA
FT                   SLENDRHIAYKKLIMNLYSKSAIFNKKNGTHSIIVQKVGQLVDDIRQSSSGKTQNLGIE
FT                   VYTLFASLAMDVVSAFELGMSNGTDLLLHPEKRHIIISHRQVASMVFWTTLMPRFWNWA
FT                   ASSTILKASYDITKWQLGLYAQAEENVPDVKEDENKSTLETLKQKGLKGEYAYSFLTDN
FT                   IFAGHETTAIQLAYMCYELSRPKNLHLQESLRKELIREFGHPKSEKDIIDDMSKVDVLP
FT                   YLNSVLDENSRVHASIPGSEPRLVDSPYKVEVGEGKVVELPKGTGISCVVYALHRQSDV
FT                   FAEPDQFIPERWLQYENEPDEVFRQRIKRMQRYMMPFGKGIRMCLGMNLALIEMKMAIA
FT                   NLYWHYNSKICSDWCEITEYTEDSKKLNPILMGETRKGENRTDEEKMTMYDSYTTRPLN
FT                   DECWLEWYDNQFEN"
FT   gene            <1077136..>1078035
FT                   /locus_tag="PICST_63351"
FT   mRNA            <1077136..>1078035
FT                   /locus_tag="PICST_63351"
FT                   /product="predicted protein"
FT   CDS_pept        1077136..1078035
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_63351"
FT                   /product="predicted protein"
FT                   /note="go_function hydrolase activity, acting on
FT                   carbon-nitrogen (but not peptide) bonds, in linear amides;
FT                   go_component Golgi membrane; endoplasmic reticulum
FT                   membrane; integral to membrane; go_process ceramide
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63351"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68183"
FT                   /db_xref="GOA:A3LZN0"
FT                   /db_xref="InterPro:IPR008901"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZN0"
FT                   /protein_id="ABN68183.1"
FT                   /translation="MLPFAVPYPPEQEDGFWGIPTSTIDWCEENYVVSVYIAEALNTIT
FT                   NSVFIALAGFAIYHAYSNKLEPRFIFTALGFLLVGVGSWLFHMTLRYHFQLLDELPMIY
FT                   ATCIPFWSVFSEFRTKRESVYVAIGIFTAANTLTVIYLYFKDPTIHQAGYAMLNAFIIF
FT                   KSLHLTSLHVHDNLAKKQLYRTMFFGVSIFLLGYFLWNMDIHFCDYVRGKRREWGMPYG
FT                   FVLEGHGWWHILTGTGIYYYLVYEEYLRCFLTGTEKFFTFKWVAGLPIVSCVDAVGLEK
FT                   YKANQHLKQLDAEVKKDI"
FT   gene            complement(1078049..1081148)
FT                   /locus_tag="PICST_68406"
FT   mRNA            complement(1078049..1081148)
FT                   /locus_tag="PICST_68406"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1078116..1081115)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_68406"
FT                   /product="predicted protein"
FT                   /note="go_function damaged DNA binding; ATP binding; DNA
FT                   binding; go_process mismatch repair; DNA repair; DNA
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_68406"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68370"
FT                   /db_xref="GOA:A3LZN1"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR011184"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032642"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZN1"
FT                   /protein_id="ABN68370.2"
FT                   /translation="MSSTRPDLRFTDTVDERSFYRKYAGLSTKDASTIRFIDHNNKDYF
FT                   TALDEDADLVAENIYKTQSVLKYNNSNKNRYVTISPQVFLNNVLKFCIIDRHMKVEIYH
FT                   NKTFQLLSTATPGNLEALANEYGVNLEGMFQDCSTPMVASIKFQQTGSARKVGVCVIDT
FT                   SNSTIQVSEFEDNDLFSNLESLLLQLGVKEVVLPSNYSAKDENTESIKLFQVLDKIGYL
FT                   VVSSVKSSFFTTKDIEQDLRKLVSSENQKDDDDVNVDLLLASKGINTADFAHSLACCNA
FT                   LIAYLQLLSDDVQNSFTIEQYNLSSYMKLDSSTMKALNIFPSSNSGVSNALVKSSNISS
FT                   IFELLNKCRTAAGSRLLSQWLKQPLTSLSMIEERLDLVNYLVDGTNFRVYANQEFLSQV
FT                   PDIRRLLKKISNGLSKSTGNENKKLEDIVVLYQLVLALPAFIDMSKMVIADIEEKDSLP
FT                   VANLIKKHWLEPVEKSLESLSKFQEMIETTIDLSPLESSSAYDQLHSDFNVRPEFDESL
FT                   IEINDKLQASLAEIKQLHIEVADDLNMELDKKLKLEKHIQHGWCFRVTRNDSTVLRNTG
FT                   NKYSQLQTVKAGVFFTTKRLTLLSQEYAEALQEYNTKQRELIKEILSISLSYQSVFMNL
FT                   SLTLAHLDVLVSFANVAIVAPTVFARPKLHPLSNDIDSDQFKNRKIKLREARHPVLEVQ
FT                   DDINFIANDVFLSNDACDKGKPFVIITGPNMGGKSTYIRQIGVIALMAQIGSFIPANED
FT                   DFPELPIFDAILSRVGAGDSQLKGLSTFMIEMLETSSILATATQNSLIIIDELGRGTST
FT                   YDGFGLAWSISEHLIKEKSCFTLFATHFHELTQLSSKYEDKVDNLHVVAHVENKDENDD
FT                   DITLMYRVEPGVSDKSFGIHVAELVKFPSKIINMAKRKASELQDMNVTEEDKFIQNKKT
FT                   KCSAEEIDRGVDTLKTILKKWKDECYDPETSKSRFESGEAVNKLKQLVEGEFSGVVAND
FT                   KFINEVLTAL"
FT   gene            complement(<1081732..>1082100)
FT                   /locus_tag="PICST_37097"
FT   mRNA            complement(<1081732..>1082100)
FT                   /locus_tag="PICST_37097"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1081732..1082100)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /locus_tag="PICST_37097"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_37097"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68371"
FT                   /db_xref="InterPro:IPR022234"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZN2"
FT                   /protein_id="ABN68371.1"
FT                   /translation="MFGFGEDDHEKVYGDKHEGKFSHELLAGAASFEAAKLFEDKQRKE
FT                   GKPVSHKFAKELLAGFAGAEVDKLVETKGLDYLDRDKAKEQATQRAVDNYDQHYGGSEQ
FT                   WHPDSQPPFDYQSNKYNY"
FT   gene            complement(<1083126..>1084070)
FT                   /gene="ANG1"
FT                   /locus_tag="PICST_20969"
FT   mRNA            complement(join(<1083126..1083266,1083300..1083979,
FT                   1083998..>1084070))
FT                   /gene="ANG1"
FT                   /locus_tag="PICST_20969"
FT                   /product="pH-regulated antigen precursor"
FT   CDS_pept        complement(join(<1083126..1083266,1083300..1083979,
FT                   1083998..1084070))
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ANG1"
FT                   /locus_tag="PICST_20969"
FT                   /product="pH-regulated antigen precursor"
FT                   /note="pH-regulated antigen precursor (PRA1)(58 kDa
FT                   fibrinogen binding mannoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_20969"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68372"
FT                   /db_xref="GOA:A3LZN3"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR029482"
FT                   /db_xref="InterPro:IPR039124"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZN3"
FT                   /protein_id="ABN68372.1"
FT                   /translation="MKFSSVLLFTSTALAAPASPDSFSQVRVPAYDWSSGWVKDFPIHS
FT                   SCNETQYNQLRSALEETEELAAHARDHTLRFGNNSDFFRLYFGNETASAEVIGWFDSIV
FT                   SEDKSALTFRCDNPDGNCDLEGYAGHWRGENGSDETVICDLSFSSRLSLTKLCSAGFTV
FT                   GRYKNTNYWSADLLHRIWHTDAFGKGAIGHYADTYEDVLELAKTNGSRAVRNSASLILY
FT                   ALDIYAHDISVPGVGCNGIYEFRNGKMIQTEDKTTTTAADIKATATNAMTSNAETADAE
FT                   TEIASNCHTHDDGSTHC"
FT   gene            <1084761..>1086737
FT                   /gene="ZRT2.3"
FT                   /locus_tag="PICST_63210"
FT   mRNA            join(<1084761..1084991,1085670..>1086737)
FT                   /gene="ZRT2.3"
FT                   /locus_tag="PICST_63210"
FT                   /product="Zinc-regulated transporter 2 (Low-affinity zinc
FT                   transport protein ZRT2)"
FT   CDS_pept        join(1084761..1084991,1085670..1086737)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="ZRT2.3"
FT                   /locus_tag="PICST_63210"
FT                   /product="Zinc-regulated transporter 2 (Low-affinity zinc
FT                   transport protein ZRT2)"
FT                   /note="go_function metal ion transporter activity;
FT                   go_component membrane; go_process metal ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63210"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68184"
FT                   /db_xref="GOA:A3LZN4"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZN4"
FT                   /protein_id="ABN68184.2"
FT                   /translation="MKFHTLVLIAASISVALAEVTSLGQCHFHGLSQFCIDNEGEEGTI
FT                   SPAPTNTENAPLSYTGCHSHGSDIYCLHGSSEVMFLLESEADTHQSSSAGRKCHFHAGV
FT                   EHCDGGSEAEVEPTCERYDRDYNIPLRIGLLFAILVSSIIAAFGPLFLKNLFKLSLEGY
FT                   IATVIKQFGTGVIISTAFVHLLTHAALMWGNSCIKLKYEATGNAISMAGIFLAFLVEFI
FT                   ASRVLRGRSKMIESSTRVQKGNDDEKNSATSSDEIRPQPVVGYDHCHGVSPQDKFSVYI
FT                   MEAGIIFHSVLIGVTLVVAGDSYFITLFIVILFHQVFEGLALGARIAEIDNANIVTKMI
FT                   MAGLFAVITPVGMAIGIGVLNKFNGNDPSTIIALGTLDSFSAGVLIWTGILEMWAHDWI
FT                   FGHLARAPLLKTGVALISLVAGMILMSFLGKWA"
FT   gene            <1087719..>1089434
FT                   /gene="SUC1.3"
FT                   /locus_tag="PICST_63238"
FT   mRNA            join(<1087719..1088000,1088067..1089324,1089340..>1089434)
FT                   /gene="SUC1.3"
FT                   /locus_tag="PICST_63238"
FT                   /product="Probable sucrose utilization protein SUC1"
FT                   /note="Has EST support"
FT   CDS_pept        join(1087719..1088000,1088067..1089324,1089340..1089434)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="SUC1.3"
FT                   /locus_tag="PICST_63238"
FT                   /product="Probable sucrose utilization protein SUC1"
FT                   /note="Probable sucrose utilization protein SUC1 (MAL33);
FT                   go_component nucleus; go_function transcription factor
FT                   activity; zinc ion binding; DNA binding; go_process
FT                   regulation of transcription, DNA-dependent; transcription"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_63238"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68185"
FT                   /db_xref="GOA:A3LZN5"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZN5"
FT                   /protein_id="ABN68185.2"
FT                   /translation="MASVNTSVRSRKSKRSRPCDGCALRKIKCSDSRPCTRCLNNGIPC
FT                   TNNRIRKKCGPKSKKLQDPQYFPVEPIQFFAGTTTPIDKIPNNTEYLPFELIPMNILLP
FT                   CLQVYQTWYYSLWPVLSVTHLVTKLSTIPPGEQLNDETSISYALCLAVCAAISKQIAFI
FT                   SENSNIIKLPSGVQARDYALAALRIRNEYEHPLNPTSETLLTSFFLYVYYINNKGGTAA
FT                   AIMYLREAISMAQIMHLQDADTYMGKPPAEVHRLRKIYYLLLVTERYMCIQDGVPVILD
FT                   SSIPFPMSDGEEYSDLLTGFTELVKIFSIPDRLFFEKMSASHSNNTFGGNFDNLKNFFH
FT                   LPINNITEGWVVDVDNRIKGISITTKASDIQKVNLLLSKHWMRSLVWHISFQNGLLSIN
FT                   REENDCLSVRYPVAIAYEFLTSTSNLPMYAFESNGPGVVVKLLEIANGLADTMNDLTYI
FT                   RNGVDTFACSNALTSIFWLISKFKTDVTLPLNLYNKIEGIVNASPIPRMRFSPVSRVLE
FT                   EEIAKITSDVSSSSESSEEALGIVAWT"
FT   gene            1089944..1091675
FT                   /gene="KIN3"
FT                   /locus_tag="PICST_79384"
FT   mRNA            1089944..1091675
FT                   /gene="KIN3"
FT                   /locus_tag="PICST_79384"
FT                   /product="G2-specific serine/threonine protein kinase"
FT                   /note="Has EST support"
FT   CDS_pept        1089974..1091590
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="KIN3"
FT                   /locus_tag="PICST_79384"
FT                   /product="G2-specific serine/threonine protein kinase"
FT                   /note="go_function protein kinase activity; ATP binding;
FT                   go_process protein amino acid phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_79384"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68186"
FT                   /db_xref="GOA:A3LZN6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZN6"
FT                   /protein_id="ABN68186.2"
FT                   /translation="MSYTNISEEYEPLEVIGKGSFGTVRKVRSKTTGKLLVRKEIEYTS
FT                   MNPQERNQLISELRILRELDHPQIVKYYRHDHIIENKSIHIYMEYCDGGDLAQIINNFK
FT                   KNKEQVPEEFVWQVLVQILLALHRCHYGIDAKKVNLFSNSSGIEPSINSETVVIHRDIK
FT                   PDNIFILNSGKSIKLGDFGLAKMLTSQNDFAKTYVGTPYYMSPEVLMDNPYSPVCDIWS
FT                   LGCVLFELCTLQPPFQAKTHLQLQTKIKRGIIPEVPEIYSSQLRSIIKECITVEPEARP
FT                   SCFELLETLSIKFLRKEMEIKETSSNLNEFQKQLLKKNDELKKKESFLLNLEAKIMRQR
FT                   DELEDEYENMQIKCNAQKKLLEEELIGEFEMRKRAMDLEAKEVRLGYQREFRLVVEQEV
FT                   QQRVKDILAKQQYSSDLRRKSSDPTSNSPIKQQTPTSTPQLKSHSYHNQQYSTTDQQLS
FT                   PLKPKGPRDLDDTQKRVPLKNRNNDDHDPYYSHQMKSQSPSRNAQAIYQKRVTDEFERL
FT                   SLERRQIPEIEDSYSRKNFRH"
FT   gene            complement(<1091703..>1092623)
FT                   /gene="PUR7"
FT                   /locus_tag="PICST_49451"
FT   mRNA            complement(<1091703..>1092623)
FT                   /gene="PUR7"
FT                   /locus_tag="PICST_49451"
FT                   /product="Phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase (SAICAR synthetase)"
FT                   /note="Has EST support"
FT   CDS_pept        complement(1091703..1092623)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="PUR7"
FT                   /locus_tag="PICST_49451"
FT                   /product="Phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase (SAICAR synthetase)"
FT                   /EC_number="6.3.2.6"
FT                   /note="go_function
FT                   phosphoribosylaminoimidazolesuccinocarboxamide synthase
FT                   activity; go_process purine nucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_49451"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68373"
FT                   /db_xref="GOA:A3LZN7"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZN7"
FT                   /protein_id="ABN68373.1"
FT                   /translation="MSLHTTELDNILPLVTRGKVRDIYQVDENTLLFVATDRISAYDVI
FT                   MDNAVPEKGKLLTKLSEFWFEFLSQTIPNHLILSKNDDESLFAKLPAQLSEAKYKLQLS
FT                   GRSLLVRKLKLIPLEVIVRGYITGSAWKEYKKTQTVHGLSVEAGLLESQEFATPIFTPS
FT                   TKADQGEHDENISPEKAAEIVGQELCDKLAKAAIELYTKAKEYAKTRGIIIADTKFEFG
FT                   LDTDHNLVLVDEVLTPDSSRFWNASAYKLGKSQESYDKQFLRDWLTSNGIAGKDGVKMD
FT                   EDIVARTRAKYIEAYEAITGDKWTS"
FT   gene            1094535..>1096497
FT                   /gene="HYR6.5"
FT                   /locus_tag="PICST_79414"
FT   mRNA            1094535..>1096497
FT                   /gene="HYR6.5"
FT                   /locus_tag="PICST_79414"
FT                   /product="von Willebrand factor (VWF2)"
FT   CDS_pept        1095262..>1096497
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="HYR6.5"
FT                   /locus_tag="PICST_79414"
FT                   /product="von Willebrand factor (VWF2)"
FT                   /note="Exo-alpha-sialidase von Willebrand factor similar to
FT                   hyphally regulated cell wall protein"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_79414"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68187"
FT                   /db_xref="GOA:A3LZN8"
FT                   /db_xref="InterPro:IPR008440"
FT                   /db_xref="InterPro:IPR021031"
FT                   /db_xref="UniProtKB/TrEMBL:A3LZN8"
FT                   /protein_id="ABN68187.2"
FT                   /translation="MLLFRCLARAFLFASVALALTISHPQVTRGSINLSFGDLTIKSGS
FT                   FWSIFDNNISIFKGDIRVKKNAGLFITSTNKLIGLKVELYAGKGSIKNEGLIVFNSLVS
FT                   LTPSFYKLIGKSFTNKGEIFLISSGCALPTAALLAPKWKNTGSITFYQAKRNNGIVSLG
FT                   SPGSKIENKGQICLFNQLYKQTTRIVGSGCITADQDSSVFFSNCLMDIDRKQTVYLADS
FT                   KSSVRAVAIAKPRTFRIAGFGNGNKIGLDLPLFKLLSSPFSYNSRTGILSLRIKGNWGQ
FT                   DFDIGLGYDSRLFKVTTDTSLGLLSVPWGAVKYEGPVPNKQIPSNCRPCKPFPPAPTTT
FT                   TTTKACSPKSTTSLTTSKTSSPKPTTTSTTSNAQTTITTTWTGTTTRTITETDTPGGTD
FT                   TVIVEEPTTSNTQ"
FT   gene            complement(<1106224..>1112574)
FT                   /gene="VCC3.3"
FT                   /locus_tag="PICST_33612"
FT   mRNA            complement(<1106224..>1112574)
FT                   /gene="VCC3.3"
FT                   /locus_tag="PICST_33612"
FT                   /product="Vesicle coat complex AP-3"
FT   CDS_pept        complement(1106224..1112574)
FT                   /codon_start=1
FT                   /transl_table=12
FT                   /gene="VCC3.3"
FT                   /locus_tag="PICST_33612"
FT                   /product="Vesicle coat complex AP-3"
FT                   /db_xref="EnsemblGenomes-Gn:PICST_33612"
FT                   /db_xref="EnsemblGenomes-Tr:ABN68374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A3GES6"
FT                   /protein_id="ABN68374.2"
FT                   /translation="MNTQALGYSIHNPITLDSDSDSDSDQNFEDALDDFSQVDIKCENS
FT                   NLISTDEHIWSSPQSFRQSSPFSSIQATPLRTNSFKHELDYLAKNYFVFVEPLGYFYSE
FT                   KRHFFISSDSKYATSKLYIKSKERFLDLISKLTKQSPYYNQIERESNIVNVATIPSPIP
FT                   GIEIEEFAFCDSCKYTSCIGRVPVKCTSHGYMRRGEGYRVESGGFFLLKEFPRMPSLPD
FT                   TPPPSTPNMYDRSPTIPCSSPIRRRSRFTNRDLQVEFKGPLITEIRVRESENMTADAFL
FT                   QKYANIKFIPDVGLYWHEHERVFLDRNSEIVHKSLSSIIDKCKFLETHMHAVMSNSYYW
FT                   YLLASANTSSEVHICLEWLKEPLSGIEPSKIQYCPDCINSAIIDDHCEVDNLNVLTGMG
FT                   YRMESGSIFLLASGGGMTDILEDQREEAPDLEYYASDSGAVFSSDEQEAEGSVDYASDM
FT                   ENLTVDGQEGDELTAVNGESESDTLLEDEVQEGDFRSFDDSSDSDNLFVDDAQEDDEEM
FT                   IDIAIDNDTESDNDESDISAYDTTDDGLDNERDSEENILYDEDPVRISTVSGWSQLKKK
FT                   GICQISNLLWSRGQQHFLDITSRAFRSFLMGTVSNAQYTQMLEDVEEWVDLMPQYYRIP
FT                   KDTKGRTFEIPSPFSRLPPKIHTYCSECGFVIGFNENNENLRSSSRHAKNTGHDRFISR
FT                   QGYAIRAATGFNLLVIFGSNETVSTCESEDGDYDDEDIVIPSFEEGSGSPFTPPEFIVE
FT                   PYSTDEEASDYEQEPESLPPPSKEEQYEVSELLKHSHGLVYDPIFYLYYYITEERYVDV
FT                   NSKFFKNTLEDIGDHKSRIRNLVDRVISTQIIDSRKFEKKVTRGHIHWAKELSEVARWK
FT                   KLCFCKQCYQVFKTKTAFSKHRREYANMSEREHAGHDISADFKGYLLERPKGLYYAIGI
FT                   PDDVAQAEAAEAEATATAEEIASSKSQWVMGGPGWTVEEYDIKVQWLEGKLGMPPDQFL
FT                   AKHNYLLVKEVGLYYDFTQKWFRSITHRLSRKVFFGDLISTVRRELISYMLHNMDRKYE
FT                   YMLAPRHQQQVATLEAAVKYDGPMVAVESGNEEHLDFELVDNCIQPTKYYMCHVCKFIA
FT                   HHSSVSAHIKQAKHQREEGPEKHVVYGYSVRNVEAKTNYFRIQHNLASSFHEPTDSTAD
FT                   SQIVDPFLSRYKAHEYTKFRSFLNMSNDKRWPRLVQLCKKYVTKKRLALSIGSSLSALI
FT                   KNPRFCSTPNSASRYGPMLARFLFVAMKMCELKEHKAMEEFEQVFCANKKQGLRRFFGQ
FT                   MTKFGAFWLLSPVLVLQEDDSNAMEDVFMSSLMVCLLDEGGIGFKIKSYRCDFCSGLSF
FT                   AFKCIAVDVMKKDKSYVRPFVEDCNRAASIALNFGRFCKFSADVHSLSPRTFGRTMNVL
FT                   HVGDKIRINTFEVGLDDIKKWVHTAIQQYVLEVEELFMDINITPTMAMNEMMAAQKPRV
FT                   VGMPQTSYNWDQRDIDRCLEINSVDKYDIKSLQYFRRRLSRLNDLFFYMILLTCGSPYR
FT                   LTELYSVLIRNEERLGSNVFVADGMLGLFTNNGKNSMKYSRERPILKMLPEEVSECLAH
FT                   YIYFVRPFEHTLVEYQEQTGSLSHIEFKKLSDKYKLHLFVGEKQIKNSTTLGKSFRKFI
FT                   NKTTPKLRGIMYGEIRQVLSYFVGANVSGMIGLQIKIDNTLAEQAGHSFSRFVESYATN
FT                   RDGYNHVMLQRMRDCSAAWHTCLEMSTLQIFTPSVFTRNEPPKLTGEELIEAGRQMFGQ
FT                   HFKFKEGQQQATSDVANCFSMMVAIDSGKTTCCIIAMLAERTHSLRQTDRGKKTHCVTI
FT                   FVVPYISTLNSTIRQLTENFNVRTFDGSVGQVNDYDVLLMSLEDGHLRYLNQVVRHFQS
FT                   TNYQGKTYLRRVVVDDAHILQMKQYVVDGNKNVPVVFLTSFLPQKEDATMSRLFNINSL
FT                   VRVSSQEPLLPHKEFTLFKKPNTTSICQTVLEKVRSFGSAIVIAESSDKVSYLVSQMAD
FT                   EVPCIGIYGSPVSRTAALNKMANENIRVVVTTAEAMVGLHMLKPTTVLFAYSINNPIEL
FT                   LVGSQMSSGKVDMVLLNFYSSEFQRDLLDTCVNLMVTRHMRLTEQTCYEAGKERCHACV
FT                   KKRRHA"
XX
SQ   Sequence 1114415 BP; 330298 A; 228277 C; 229262 G; 326578 T; 0 other;
     accgcaagac gtgaaaagat ccataccgca agacgtgaaa agatccatac cgcaagacgt        60
     gaaaagatcc ataccgcaag acgtgaaaag atccataccg caagacgtga aaagatccat       120
     accgcaagac gtgaaaagat ccataccgca agacgtgaaa agatccatac cgcaagacgt       180
     gaaaagatcc ataccgcaag acgtgaaaag acccgtgccg ctattataca tccgtgccgc       240
     aactattaac tcacacccct tcggtcacgt tatatcctat ttgggtcgcc tcaattaact       300
     tccgtgcctc aaccaatagc acgcatcagt ggtcacgtta tgtcctgccc gtgcaacaat       360
     cctaatatct cgtatctttg gtcacgttat gtcctatttt gggagtgtta aatacaggac       420
     tgttggtcga actgatctaa ccatatctcc gctgcagcaa tagatacgaa tcttgtcagg       480
     tcacgtgaaa gacgcttttt ccgcgaatcg gtgcaggtct gctgcgaaga atgtcgtagc       540
     tcacattcct tcctcgcata gaataccgca atacttatga aaatgagata acatagaccc       600
     taggaatgtc cagctattga ggactatgaa ttgttcattc cttatatctt cttatattat       660
     gttattccct aaaaatcaag aatatccccc ttcaaatgaa ccatactttg tttaattata       720
     aactttaata attttttcaa actttgggga tctcgcctct cttttatacc tctcagatct       780
     cattttggta atacacgcac atcaaatgcg cctatacttg tatccacgtc tatattgact       840
     gcacataatt ccctgtcaat caattctact catgtgattc taaatggata atcctccctc       900
     caaattcaca acaactcaat aaaatacaac ccaatataat acaatatcac tttcacatta       960
     atcctacatc atgatatcca caataactaa cattaaatat ccatattctt acaatcttaa      1020
     cttttccctt acctttatta cttctctcaa ttttcttgta tacagagatg tactgattgt      1080
     ctttctggaa agaatgtgaa aaataatata aaaatattta ttgctgcaaa aaattccact      1140
     tacactaaaa gtagtaccat ttgaaaaccc tcattaaatc aagaaagaat tcatcacatt      1200
     tgaatcttac aaaattctaa tgctctaatg ataaccattt agaatatggt cacatagttc      1260
     ttggtcacat gacacaacac actaatattg gagcccaaat gtctttaatg ttgttagtgc      1320
     acgaacatta atcctgcacc agttaagagt atcgtcagag aatgttcatt acaatcctac      1380
     ttagggcggt tatggacata cactctgatt aaagggatcc cattggacag ttgaaaacca      1440
     gtgaaaaatt ttcaagatgg actctgcctt gcgacaggcc ctatatttaa attgtagcga      1500
     ctagccacgt cttggttcat cgatcggaac aaacaacgag ccacctaggt tcatcgatcg      1560
     aaaaactagg ttcattgata ggaataaata gacagcgaga agagaaggtt taagattagg      1620
     cacatttttt aacgtcaaca ttacaattct gcaagtaatt tatgtattat tcccgattag      1680
     gtgaattccc taaactcttt gtatatatgg cccaaaatcc cacttttctg ctttatttta      1740
     ttaataatca atctctttta taattgaaac agtggcgact ttagttacaa cttcaagatc      1800
     atcctccaga ccttcctgtg ttcaaattag ttagtaacgt atactaaaag tagaatgaat      1860
     actcaagcac caggctattc aagtcataat ccaataactt tggatctggg tctggacctg      1920
     gacctggacc agaacttcga agatgctcta gacgacttca gccaagtaga tatcaaatgc      1980
     gaaaactcca atctcgtttc taccgatgag catatttggt cgagccctca atcgtttaga      2040
     cggagcctgc catgttcttc aatgcaatct actccagcga ggacaaatgt caaagacgaa      2100
     cttgactact tggccaaaaa ttactttgtg tttgttgagt ctctaggata cttctatctg      2160
     gaaaaaaggc attattttat ctcttcggat tcgaaatatg ccagctccaa attatatata      2220
     aagtcaaagc aaagatttct tgacctcatt agcaaactaa caaaacaatc accttattac      2280
     aaccaaatag aacgcgagtc aaatattgtg aatgtggcta ccattccaag ccctatccct      2340
     ggcattgaag ccgaagaatt tgccttctgt gattcctgta agtacaccag aaacattggt      2400
     cacctcccag tgaaatgtgc aagtcatgga tacatgagaa ggggagaagg ctatagagtg      2460
     gaactggggg gtttctttct attgaaggaa ttcccacgta tgccttcttt acctgctact      2520
     cctccaccaa gcactccaaa tgtgactgcc ctgagtccaa ccataccttg ctcttctccc      2580
     atccatcgtc gatctcgctt caccaataga gacttagaag tagaatacaa gggccctctt      2640
     atcaccaaaa tctgtgtgag agaatctgag aatatgaccg ctgatgcctt tttgcaaaaa      2700
     tacgccaata tcatatacat tcctgatatg gggttgtact ggcacgaaca tgaacgtgtg      2760
     tttttggata gaaactccga aattgttcac aactcgttgt cttctatcat tgacaaatgc      2820
     aagtttcttg aaacacacat gcatgcagta atgctgaatt cctactactg gtttttgtta      2880
     gccagcccta atacgctgtc cgaggtacaa atatgtcttg aatggttgaa agaaccccta      2940
     catggcttat caccttcaaa gatccagtac tgccctaatt gtatcaattc ggctatcatc      3000
     gatgaccatt gtgatgtcga taaccttaat gttctaactg ggatgggata cagaatggag      3060
     ctggggacta ttttcttatt agcactgggt ggaggaatga cagacatttt ggaagatcaa      3120
     cgagaggagg ctcccgatct cgaatattat gcctctgatt ctggtgctgt cttcctgagc      3180
     gatgaacaag aagctgaggg gtcagtagac tatgcttctg atatggaaaa tctcacagta      3240
     gatggtcaag aaggtgacga attgacagca gtaaatggag aatctgagtc ggatactctc      3300
     ttagaagatg aagttcaaga aggtgacttt agatcatttg acgattcttc tgattcggat      3360
     aatctctttg tagatgatgc acaagaagat gatgaagaaa tgattgacat tgcaatagat      3420
     aatgatactg aatcggataa tgacgaatca gacatttcag cttatgatac ctccgatgat      3480
     ggtcttgata atgaatatga accagaagca gatttattat atgacgaaga aactgttagg      3540
     atttccactg ttagtggatg gtctcagtta aaaaagaagg gtatttgtca aattaacaat      3600
     cttctttggc tgagaggaca acaacacttc cttgacatca cctccagggc tttcaggtcc      3660
     tttctcatgg gaacagtgtc aaatgcacaa tatacccaga tgttggaaga tgttgaggaa      3720
     tgggtcgatc ttatgcctca gtactataga attccaatag ataccaaggg tagaacattt      3780
     gaaattctcc gtccctttcc caggcttcct ccaaacatac atacgtactg ttcggaatgt      3840
     ggctttgtaa taggattcaa cgagaacaat gaaaacttaa gaagctctgc ccgtcatgca      3900
     aagaatactg gtcatgatag attcatcagt cgagaagggt atgcaatcag ggccgcaacg      3960
     ggattcaatc tcttggtaat attggggtca agcgaatcaa tcagtacgtg cgaatcggag      4020
     gatggcgatt atgatgacga agatattgtt attccttcat tcgacgatgg actgggttca      4080
     ccagtcacac accctgaatt catagtggag ccgtattcca cagacgaaga ggccagcgac      4140
     tacgaacaag aacctgaatc tcttccacct ccatccaagg aagaagaaat cgaggtctct      4200
     gaactattga gatactccca tgggttagtt tacgatccta tcttctactt gtactactac      4260
     ataacagaag agcggtatgt tgacgtgaat tcaaagtttt tcaaaaacac attggaagat      4320
     attggtgacc acaaaagccg tattcgaaac ttggtggacc gtgtcattag cactcaaatc      4380
     attgactcca gcaaattcga gaagaaagta accagaggac acatccactg ggccaaagaa      4440
     ttgtccaaag tagcttactc gaagaaacta tgcttttgta aacaatgcta tcagatattt      4500
     aaaacaaaaa ctgcgttttc caggcacagg cgtgattatg cgagcatggt cggaagagaa      4560
     catgctggtc atgacacaag tgcggatttc aaaggatacc ttttggagcg accaaagggc      4620
     ctctactatg caataggtat tccagatgat gttgctgaag ccgaagctgc agctactgtt      4680
     gaagaaatta caggtctgag ttcacaatgg gttatgggtg ggcctgggtg gacggcggaa      4740
     gaatatgaaa gcaaagtgaa atggttagag gtcaagctag gtatgctccc cgaccaattc      4800
     ttggccaagc acaactactt gctagtgaag gagcttggct tatactatga tttcacgcag      4860
     aagtggttcc gaagtataac acacaggttg ctgaggaagg tcttctttgc cgacttagtg      4920
     ctgagcgtga ggagtgagtt aatatcctac atgctccaca atatggatag aaagtatgaa      4980
     tacatgttgg caccccgtca ccagcagcaa gttgccactt tgcaagcagc agtaaaatat      5040
     gacggtccag tggtggcggt ggaaaatggc aacggagagc atctcgattt cgagttggta      5100
     gataactgca tacagccaac taaatactac atgtgtcatg tgtgtaagtt cattgcccac      5160
     cactccagcg ttaccgctca tatcaaacaa gccaagcacc aacgagaaga gggacctgaa      5220
     aagcatgttg tgtatggtta cagtgttcgg aatgtagagg ccaagacaaa ctacttccga      5280
     attcaactga acctagccgc tgggtttcac gaaccaacag atagctctgc ggaattgcaa      5340
     attgtagatc catttttatc cagatacaaa gcgcatgagt atacaaagtt ccgctcattt      5400
     ttgaacatgg ctaatgacaa aagatggcca cgtttggtac aattgtgcaa gaaatatgta      5460
     acgaagaaaa gattagcttt gagtaccgga tcttctctct cagcgctcat cgataacccc      5520
     aggttctgta gcactccaaa ctctgccctg cgatatggac tcgcgctagc cagattcctc      5580
     tatgttgcca tgaaaatgtg cgagttgaag gaacacaaag caatggaagc gtttgatcaa      5640
     gtattctgtg ccaacaaaga acagggatta cgaagatttt tcggtcaaat gaagatattt      5700
     ggcgcgttct ggttgttgtc tccggtgcta gtgttgcagg aagacgacct aaactacatg      5760
     gacgatatct ttatgagcag tctaatggtg tgtcttcttg atgaaggagg aataggattc      5820
     aaaattaagt cgtaccgctg cgatttctgc agtggcctat cctttgcatt caaatgtata      5880
     gctgtggacg tgatgaaaaa agacaagtct tatgtccatc cttttgttga ggattgtaac      5940
     aagtctgctt ccatatcact caatttcggc cgatttcgca agttcagtgc cgatgtacac      6000
     tcgttgagtc ctcgaacatt tggaaggacc atgaatgtgc tacgtgttgg agacataata      6060
     agaataaata catttgaagt tggactcaac gacatcaaaa aatgggtcta tgatgccatt      6120
     cagcaatatg tacttgaagt cgaggaactt ttcgtggaca tcaacatcac gccaactatg      6180
     gccatgcatg agatgctggc agcacaaaaa ccaagagttg ttggaatgcc tcaaactagt      6240
     tacaactggg atcaaaggga catcgacaga tgcttggaaa ttaatctggt tgataagtat      6300
     gatgtcaaaa gtcttcagtg tttccgtcgc cgactctcta gattgaacaa ctattttttt      6360
     tgtatgatct tgttgacgtg tgggtctccg tatcgtttaa cggaattata cctggttctt      6420
     attcgtaacg aagaaagatt gggaagtaat gtatttgttg ctgatgggat gcttggcctc      6480
     tttaccaaca atggaaagaa cagtatgaaa tatagtcgag aacgtcctat tctcaagatg      6540
     ttgcccgaag aggtgtcaga atgcttggct cactatatct attttgtccg gccattcgaa      6600
     tacactcttg ttgaatacca agaacaaacc ggttcattga gcctcacaga gtttaagaaa      6660
     ctaagtgata aatacaagct ccatttgttc atgggagaga agggaatcaa aagcagtact      6720
     actcttggaa aatcgttccg taagttcata aataaaacaa ctccaaagct tagaggaatc      6780
     atgtacggtg aaataagaca agtgctttca tattttgttg gggcgaacgt ctctgggatg      6840
     attgggttac agatcaagat tgacaacacc cttgccgaac aggctgggca ttcgtttagt      6900
     aggtttgtcg aaagttatgc cacaaataga gatggctaca atcatgtcat gcttcaaaga      6960
     atgagagact gtctggcagc ctggcatacc tgtttggaga tgaggactct tcagatattt      7020
     acgcctagca tatttactag gaacgaacca ccgaaattga caggagagga actcttggag      7080
     gcaggcagaa agatatttgg acaacagttt aggttcaagg agggccaaca acaggccaca      7140
     tcggatgtag ctaattgctt cagtatgatg gtggctatta atctgggaaa gacgacttgt      7200
     tgcattattg cgatgttggc agagcgtact aacagtcttc gccggaccaa tcgaggtaaa      7260
     aagactcact gtgttacgat atttgtggta ccttatattt ctacactcaa ctccaccatc      7320
     cgccaattaa cagaaaattt caaggtgcat acgtatgatg gttctgttgg acaggtcaac      7380
     aattatgatg ttcttttgat gctgcttgaa gacggccacc ttagacatct tgattcggta      7440
     gtcagacata ttcagtctac taattatcga ggcaagacct atctccgccg ggtggtggtt      7500
     gatgatgcac atattttgca aatgaaacaa tacgtgatag aaggaaacaa aaatgtacca      7560
     atagtatttt tgacgtcatt cctttcacag aaggaagacg atacgttgag tacattattt      7620
     aatctcgaat ccttggtgag ggtgtcgtca caggaaccac tcttgcctca taaagagttc      7680
     actcttttca agaagcctag taccacgtca atatgtcaga cggttataga caaagttagg      7740
     agtttgggtt cggcaattgt gattgccgag tcttctgata aagtgtcgta cttgttaaat      7800
     agaatggccg ttgaggttcc aagtataggt atctatggat ccccagatgc cagagcagct      7860
     gctttaaata agatagccag tgagaatatc agggttgtgg ttactacggc agaggcgatg      7920
     gttggtcttc atatgttcaa acatacaacc gtcttgtttg catattcgat taacaacccg      7980
     atagaattgc ttgttggcag tcaattgagc agtgggaagg tagaaatggt attgctcaac      8040
     ttttattcga ctgagtttca acgagactta ttggacactt gtgttaattt aatgataatg      8100
     agacatatgc gtttaactga acaaacttgt tatgaggctg gtaaggagcg gtgtcatgct      8160
     tgtgtcaaca agagaagaca tgcatgaagt gtattcgttt tcataatcgt atgtatgcta      8220
     ttctaaataa aaaacctctt ctttcggtaa aaacaactca atctttttac aacattcatt      8280
     gaagattagg tacgtaagta atactactgt ctctgtccca gggtgttcaa cctcaattgc      8340
     ataattatac tgccacagcg tgaaacgtca acactgcaat ttgaaagccg tgccaacgga      8400
     gcgcaaaatt tttcaaaatg tcaaatagac gcaagcgaga ttgtgcaacc tcgcctatcg      8460
     caacgaattt gtatgcgcca tagttaaatt atccacatag tgtgcaggcg aggtgcgtag      8520
     tgcgcctgtc acgggcaaaa aatcacactt gctgtgcagt tccgaggtgc gtacttttgc      8580
     ctgtcacgac tcaaaaaata cgacattccg cgacatccac aacataaatg tcgtttcgca      8640
     cccattattt agcgcatacc ttacgtcact tccacaaaca tccatgaaaa cttggcccgt      8700
     cagatccata ccgcaagacg tgaaaagatc cataccgcaa gacgtgaaaa gatccatacc      8760
     gcaagacgtg aaaagatcca taccgcaaga cgtgaaaaga tccatgccgc aagacgtgaa      8820
     aagatccata ccgcaagacg tgaaaagatc cataccgcaa gacgtgaaaa gatccatacc      8880
     gcaagacgtg aaaagatcca taccgcaaga cgtgaaaaga tccataccgc aaggcccgtg      8940
     ccgctattat acctccgtgc cgcaactatt aactcacacc cctttggtca ctttatatcc      9000
     tatttgggtc gcctcactta acttccgtgc ctcaaccaaa atcttacata tttggtcacg      9060
     ttatgtcatg cccgtgcaaa caactagtat ctcgtaaatt ttgtcaccct atgtcctatt      9120
     tgggtcgatt ccatacagga ctattggcaa aatatgacgt aagcatttta catctgcaga      9180
     aatagataag acaacactcc ggtcacgtga atggctgctt ttgggcgatc cgatacttct      9240
     actgcgaaga atgtcttagg tcacattcct tcctcgcaca aaacactgga atacttatga      9300
     aaacttagat aaaaatatcc tacctcaaag ccttcttcat acaactggtt gtcaatacac      9360
     aatggagcag tctgttcgac tggatcaaac ttgtccaact tttcgtagga gtgacgagtt      9420
     tttgaggggt atcaattgtt cagacaatat tctcttgacc tgtcgctact gttctgacca      9480
     ccgatttacc tatggcaatg ctttgctaat ttggtacatc tgctagacaa gacgcccacc      9540
     tggtctaata gaatcctact gttgaacatt atgtaattcc ataaaaatcc aggatatcct      9600
     acttcaaatg aatcaattga tgatcttcat aattattttc aaactttggg gatctcgcca      9660
     tccttttata cctctcagtt ctcattttag taatacacgc acatcaaatg cggttaaatt      9720
     gtttcacctc tatattgact gtacataacc ccctatcaat caatttcagt catgtgattc      9780
     taaatggata atcctccctc caaattcaca acaactcaat ataatacaac aatatcacat      9840
     tcccactaaa tcatacatca tcctatcaac agtaaccaac accaaatatc catattctta      9900
     caatcttaac ttttccctta cctctattac tttttaattt tcttgtatac atgaactgct      9960
     tgtctctcta gaaagaatgc gaaatatact gtaaaaatac taattgctgc aaaaaattgc     10020
     acctgtccta aaagtaatac cattcgatta ccatcattca atcaagtaag aattcatcac     10080
     ctttgaatct taaaaaattc gaatgctcta attatatcta cttaaaatat gttcacatgg     10140
     tatccggtca catgacacaa cacgcaaata tggcaaccca gaagtatagc tattctgaag     10200
     aagtgtccga gtgcttggct tacggtatct gttcgaacat actctagttc agtacctaga     10260
     acaaactggt tcattgaaat tcactgagtt tgaagacctc agtgacaaat acaagctcca     10320
     tttgttcatg ggagaaaaaa acatcaaaag cagtactgtc cttggaaagt cgttgcgtca     10380
     gtttgtggct tcaacaactc caaagcttag tggaataaaa tacggggaaa taagacaagt     10440
     actttcatat ttggttgcgg agaaagtgtc tgggatggtt ggattacaga acattattga     10500
     caaaaccctt gccgaacagt ctgggcattc ttttagaagg tttgtcgaaa gttatgccac     10560
     agatagaaat ggttacaata acgtaatgct acaacgaatg agagactgtc tggcagcctg     10620
     gcatacgtgt ttggagatga ggactcttca gatattctcg cctagtatat ggatcgagga     10680
     cgaactaccg aaatttacgg gccaggaact tatagatgcc ggcagacaga tgtttgggcc     10740
     acactttaag ttcaagaggg accagcaaca ggctacttca gatgtggcca attgcttcag     10800
     tacgacggtg gctattaacc tgggaaagac gacttgttgc ctcattgcga tgttggcgga     10860
     gcttaatttc agtcgtcgcc agtccgatcg acacagaaag atttacttgg ttacgatatt     10920
     ggtggtacct tacgtttcta cactcaattc caccatccgg caattaacag acttggggtt     10980
     caaggtgcgt acgtttcatg gggctgatgg actggtcacc gactacgatg ttcttttgat     11040
     gctgcttgaa gacggccacc ttagatatct taatcaggta gtcagacatt ttgagtccgt     11100
     tgctcatcaa ggcaggacct atctccggcg ggtggtggtt gacgatgccc atattttgca     11160
     gatgaaagat tttgtggttg atggaaacag aaatgtaccc gtcgtatttt tgacatcatt     11220
     ccttccccag gtttcagaca attcgatgcg tacattattt agtctcaatc ggttgggaag     11280
     ggtgtcgtca caggatccaa tattgcctca caaagaattc actcttgtca agaagccgaa     11340
     tgccgcgtca ataaatcaga cgatttcata cagagttagg agtttgggtt cggcgcttgt     11400
     actcgttcaa tcttatgaaa atgtgttgta cttggaacat cggttggctg aggagggggt     11460
     tccatgtata ggtgtctgtg gaattccaca gcgcagaaca gctgccttag aaaagatggc     11520
     cagtgagaat atcaaggtcg tggttactac ggcagaagcc atggtgggtc tacatcagtt     11580
     cgaggctaca accgtgttgt ttgcatattc gattagaaac cctatagaat tgcttgtagc     11640
     cagtcaattt agcagtggga aggtggagat ggttttgtac aacacctgtt cgtctgcgtt     11700
     tcaacgagaa ttgtcaaaca attgtgtcaa cttaatacta atgagacaca tgcgtatgac     11760
     ggaagaaacc tgttatgatg ctggcaagga gcagtgtcat atttgtgcca acaagagaag     11820
     aagaggatag acactgtctg tttagacgtc gctgatccgg ccacttacta gcagattaat     11880
     atataataac tatagttcct cttccctgta acttaagtct agcttacgcc tgtattcaga     11940
     cgcctcaaaa tgctttggct agagaacaaa cagccagagg caccgtcgct cgtgacccgt     12000
     caagtgtgat ttgcgatagc ttttgcctgt atccaatcaa ataatcaacg cctcaaaatg     12060
     ctttggctag agaacaaaca gccagaggcc ccgtcgctcg tgacccgtca agtgtgattt     12120
     gcgacatttc tatttcctgt ctctaagcag tccatcctgc ctgtaagcag tctgtcctgt     12180
     ctctaagcca ttttcagggt cctcaacctc gacctcgtca ccgcacgcca tagttaaggc     12240
     ccatagttaa gcgaccgaag tgtgaaactg cccgcctgtc ctttcgcagg tggggcgaaa     12300
     gtacagaaaa tacgactaac gaaagaagta agttttggaa cctccaagat gataaattca     12360
     ataattttag acaatgtgga gaagcatcaa caagataaaa gtaattggag ataggtgaat     12420
     cctgatcgct cctccaacag cagcaaaaac ggttggaata gaaggggcat acgaagttgt     12480
     ggaggttgcc aaagtagtcc ctggtattgt gattacagga gtagaagcaa taggtccttc     12540
     atgcccggaa tcagaaccag aacctgaacc agaacctgaa ccagaacctg aacctgaacc     12600
     agaaccagaa cctgaaccag aacctgaacc agaacctgaa ccagaacctg aaccagaacc     12660
     tgaaccagaa cctgaacctg aaccagaacc agaacctgaa ccagaacctg aacctgaacc     12720
     agaaccagaa cctgaaccag aaccagaacc agaaccagaa ccagaaccag aaccagaaca     12780
     agaactagag ccactagttt cagaagtact tgtgcctgtt tccgtttcag aagttgaagt     12840
     agtgccagag gatggacttt cttctacaac tttcaaactt actggaatgc atccactgct     12900
     gttgacaagt tctaaagcag gtgcagtatc tgggcatgcg tagaaaacat cttgaccatt     12960
     caacaggagt gaatcaccat cttctctctt gaccaaagca gcaggagaac tagtctcttg     13020
     ccaattggca aacggttcat tacttaagtg aaacccatta ctatctgcag taacatagag     13080
     tccaccaaca gtaaggtatc caggtggaag agataaatgg aatgtatcac ctccagtatt     13140
     ggtaaaggtg atgaattggc catcatgtgt aaggaattgt tcaaaatcaa tatctgggtt     13200
     gattgagaat gcaagcaatc taaagtcgtt ctcttccaca acaggtgatg aacttgtaga     13260
     tggtagttca ctttgagaag taggaagcga actcaataaa gaaggtgtaa taatttcact     13320
     tggggaagta gcagaaactg aagccaaaaa tgctgattcc gaagaacttg gtaatgacga     13380
     tgatgtaatt gttataactg acgatgttga agataaggta taagtggtct cggaaatcga     13440
     gaaaaatgat gacgaagtat tgctgtaata tccgaaagat aaagagctca tagaagatac     13500
     gacaatgctt tctgaggagt atttctgagg taatgtactt gaactgacga tggccgagat     13560
     acctgattca gatttggaga ttgaactaac ttcggacacg gaaatagccg aagagcttac     13620
     cgcagatgca atgctcgatt cagatacgga gcttgaacta acttcggaca cagaagtagt     13680
     cggagagttt accgcagatg caatgcttga ttcagatacg gagcttgaac taacttcgga     13740
     cacagaagta gtcggagagc ttaccgcaga tgcaatgctt gattcagata cggagcttga     13800
     actaacttct gaactctctg atgtgacgga ttccgtactg gatatgctgg atgatgattc     13860
     ggagcttgaa ctaacttcgg acacagaagt agtcggagag cttaccgcag atgcaatgct     13920
     tgattcagat acggagcttg aactaacttc tgaactctct gatgtgacgg attccgtact     13980
     ggatatgctg gatgatgatt cggagcttga actaacttcg gacacggaaa tagccgaaga     14040
     gcttaccgca gatgcaatgc tcgattcaga tacggagctt gaactaactt ctgaactctc     14100
     tgatgtgacg gattccgtac tggatatgct ggatgatgat tcggagcttg aactaacttc     14160
     ggacacagaa gtagtcggag agcttaccgc agatgcaatg ctcgattcag atacggagct     14220
     tgcactaact tctgaactct ttgaagtgac ggattccgta gtggataggc tggatgatga     14280
     ttcaatcgaa gtgctgattg tagagctcaa ctcagacgaa gaagattgca gtggttcaat     14340
     accgtctatt agtagctcaa cttcttcaca acctatggta ttagtaagcg acaagggaga     14400
     gctttgatct ggacagtaga agaaggtagt tgttccgttg atcagtaatg tacctaaatc     14460
     tgctcgcttg atgaagatgt tgctaattga ggaaatgctc caacctccaa atggaatctc     14520
     actcaagtaa attccactat ggtcagcatg aacatataac ccatcaacga taaggtgtcc     14580
     ttcaggaaca ttcaaataaa atgtagaacc ggcgtgctct gcgacagtta ttacgttgcc     14640
     attgtgagta aggaacacgt ccaaacctgt atcttcatct ttaatttcta tcataaatcc     14700
     atcacccagt ggcactggaa gtgtatatgt gggtgatgtt tctgtgtaaa tggaagtagt     14760
     cgtgtaccag cttcccgaat cgtcggtagt gacaatcact tcaccagtca cagtgcttcc     14820
     gtcgtcctgg atgacaagag tgttgtactc agtttctgtg taaatggaag tagtcgtgta     14880
     ccagcttccc gaatcgtcgg tggtgacaat cacttcacca gtcacagtgc ttccgtcgtc     14940
     ctggatgaca agagtgttgt actcagtttc tgtgtaaatg gaagtagtcg tgtaccagct     15000
     tcccgaatcg tcggtagtga caatcacttc accagtcaca gtgcttccgt cgtcctggat     15060
     gacaagagtg ttgtactcag tttctgtgta aatggaagta gtcgtgtacc agcttcccga     15120
     atcgtcggta gtgacaatca cttcaccagt cacagtgctt ccgtcgtcct ggatgacaag     15180
     agtgttgtac tcagtttctg tgtaaatgga agtagtcgtg taccagcttc ccgaatcgtc     15240
     ggtagtgaca atcacttcac cagtcacagt gcttccgtcg tcctggatga caagagtgtt     15300
     gtactcagtt tctgtgtaaa tggaagtagt cgtgtaccag cttcccgaat cgtcggtggt     15360
     gacaatcact tcaccagtca cagtgcttcc gtcgtcctgg atgacaagag tgttgtactc     15420
     agtttctgtg taaatggaag tagtcgtgta ccagcttccc gaatcgtcgg tggtgacaat     15480
     cacttcacca gtcacagtgc ttccgtcgtc ctggatgaca agagtgttgt actcagtttc     15540
     tgtgtaaatg gaagtagtcg tgtaccagct tcccgaatcg tcggtagtga caatcacttc     15600
     accagtcaca gtgcttccgt cgtcctggat gacaagagtg ttgtactcag tttctgtgta     15660
     aatggaagta gtcgtgtacc agcttcccga atcgtcggta gtgacaatca cttcaccagt     15720
     cacagtgctt ccgtcgtcct ggatgacaag agtgttgtac tcagtttctg tgtaaatgga     15780
     agtagtcgtg taccagcttc ccgaatcgtc ggtagtgaca atcacttcac cagtcacagt     15840
     gcttccgtcg tcctggatga caagagtgtt gtactcagtt tctgtgtaaa tggaagtagt     15900
     cgtgtaccag cttcccgaat cgtcggtagt gacaatcact tcaccagtca cagtgcttcc     15960
     gtcgtcctgg atgacaagag tgttgtactc agtttctgtg taaatggaag tagtcgtgta     16020
     ccagcttccc gaatcgtcgg tggtgacaat cacttcacca gtcacagtgc ttccgtcgtc     16080
     ctggatgaca agagtgttgt actcagtttc tgtgtaaatg gaagtagtcg tgtaccagct     16140
     tcccgaatcg tcggtagtga caatcacttc accagtcaca gtgcttccgt cgtcctggat     16200
     gacaagagtg ttgtactcag tttctgtgta aatggaagta gtcgtgtacc agcttcccga     16260
     atcgtcggtg gtgacaatca cttcaccagt cacagtgctt ccgtcgtcct ggatgacaag     16320
     agtgttgtac tcagtttctg tgtaaatgga agtagtcgtg taccagcttc ccgaatcgtc     16380
     ggtagtgaca atcacttcac cagtcacagt gcttccgtcg tcctggatga caagagtgtt     16440
     gtactcagtt tctgtgtaaa tggaagtagt cgtgtaccag cttcccgaat cgtcggtagt     16500
     gacaatcact tcaccagtca cagtgcttcc gtcgtcctgg atgacaagag tgttgtactc     16560
     agtttctgtg taaatggaag tagtcgtgta ccagcttccc gaatcgtcgg tagtgacaat     16620
     cacttcacca gtcacagtgc ttccgtcgtc ctggatgaca agagtgttgt actcagtttc     16680
     tgtgtaaatg gaagtagtcg tgtaccagct tcccgaatcg tcggtagcga caatcacttc     16740
     accagtcaca gtgcttccgt cgtcctggat gacaagagtg ttgtactcag tttctgtgta     16800
     aatggaagta gtcgtgtacc agcttcccga atcgtcggta gtgacaatca cttcaccagt     16860
     cacagtgctt ccgtcgtcct ggatgacaag agtgttgtac tcagtttctg tgtaaatgga     16920
     agtagtcgtg taccagcttc ccgaatcgtc ggtagtgaca atcacttcac cagtcacagt     16980
     gcttccgtcg tcctggatga caagagtgtt gtactcagtt tctgtgtaaa tggaagtagt     17040
     cgtgtaccag cttcccgaat cgtcggtggt gacaatcact tcaccagtca cagtgcttcc     17100
     gtcgtcctgg atgacaagag tgttgtactc agtttctgtg taaatggaag tagtcgtgta     17160
     ccagcttccc gaatcgtcgg tagtgacaat cacttcacca gtcacagtgc ttccgtcgtc     17220
     ctggatgaca agagtgttgt actcagtttc tgtgtaaatg gaagtagtcg tgtaccagct     17280
     tcccgaatcg tcggtagtga caatcacttc accagtcaca gtgcttccgt cgtcctggat     17340
     gacaagagtg ttgtactcag tttctgtgta aatggaagta gtcgtgtacc agcttcccga     17400
     atcgtcggtg gtgacaatca cttcaccagt cacagtgctt ccgtcgtcct ggatgacaag     17460
     agtgttgtac tcagtttctg tgtaaatgga agtagtcgtg taccagcttc ccgaatcgtc     17520
     ggtagtgaca atcacttcac cagtcacagt gcttccgtcg tcctggatga caagagtgtt     17580
     gtactcagtt tctgtgtaaa tggaagtagt cgtgtaccag cttcccgaat cgtcggtagt     17640
     gacaatcact tcaccagtca cagtgcttcc gtcgtcctgg atgacaagag tgttgtactc     17700
     agtttctgtg taaatggaag tagtcgtgta ccagcttccc gaatcgtcgg tagtgacaat     17760
     cacttcacca gtcacagtgc ttccgtcgtc ctggatgaca agagtgttgt actcagtttc     17820
     tgtgtaaatg gaagtagtcg tgtaccagct tcccgaatcg tcggtagtga caatcacttc     17880
     accagtcaca gtgcttccgt cgcttgtaaa tgtagtagtg tactcagctg gattgattcc     17940
     aggtgcaact ggaagagcct gacattgaca agatgaagat gtgggccatt ttagtgtacc     18000
     tatgaattta attcccagct tcgtagagta tgaccaattc gggtttgtaa tggtgccggt     18060
     attgccatag cctgttccaa ttatgaaatc tacataatga gtagttaaat aataaactct     18120
     taaggttcct gcagcagctc cagcagcagc tccatcagaa gcagtactat aataataagg     18180
     tgccgtactc agaagttggc tcatagtaat agtattcaga ttaccaaaac cttgtatagg     18240
     aattggatta ggagtgacat atccagaacc ggaaggtgca gttacattga tcattgagag     18300
     cagatctaag tagtaggtct gaccagaagt cgtatatgga atgataatag ttgaacctcg     18360
     gtttgcagaa acacagccac ctgaacctga aatagtacta ctaaacgtga cactgttgta     18420
     gaaacacatt tgaccactgt ttgttatggc tcccatggta gcccctgagc cacttcctgc     18480
     gaaatacatt gtcccaccag cgttgtttgt gatggaacca agagtatagg tcacgcccgt     18540
     taaaaatgaa acagtaccag tattagctaa tgaccctgat atattaacaa ttgagcttag     18600
     agcattcaca actgttacat aaaacaggtt agcagagtcc acagtgagac tacctaagct     18660
     aaccagactc acatcaacaa tggaaagata agtaccacct gtgccatcta tagtaagagg     18720
     tccaagaata gtgaaatcaa attctcctct atagattgtg ctttccgaga tagtagcagg     18780
     ggttactagg ccagccaaca gcaaaactac tgccgttatg aacttgcgga ataacattga     18840
     ctatgagata atttggctat atgggttttc cttattcttc acttcttttg aggaaccagt     18900
     gattgatata actattttga ggaggagaaa ttggcgaatg tagcaccagc ttcaattatt     18960
     ttatgcaata aaacggtcca ggagtaccag aacattagca aaatatcttc tacgaccata     19020
     ttaagctact gtgtgcaata atcagtgtag tgggcttgat atttggtgaa gagaaaggag     19080
     acggaagtgg actaaatttc agtcaaaggc aaatattaaa ttgcatgcac gattattctt     19140
     taatgtaaag cataatctat aaatagtgca atctcatgta ggacatattt ctaagataat     19200
     aatcttatta tgatacgaag tgttttattt ttatgcttac cagaaacgac gaataataat     19260
     tttggtttta ctaccaggca ttttatactg gggctaattc atgttgtaca gagttatctg     19320
     aagaccatta gaagatgtac aacgtatact ccacccattc tagtcgtcca tctatgtctg     19380
     tgaaaggaga gcctcttcta agttatttct tgaacgttgt agtaaaattc agaaatcggt     19440
     gtagtccaca ggaaatataa attgatttag aaggaacacg aacctacgtg caggacacgt     19500
     attgcaacat ccatctgctt atcataccta cattgcgtct tgtcgcagag aagatctcca     19560
     agttttttga tagacctact gttggacggt catcaaaatg aggaaatgga tagtctgtaa     19620
     tttgtagttt ttgatacttt ttccatcctc ttagataata tcttggatat ttattaccgt     19680
     aattctacgt ttgtaattta cattagtctc aatgtcagga ttctgaatgt tttgaagtat     19740
     tattagatcc caaggtattc taaggatcta gggactctaa cagatatgac taagaaaaat     19800
     ttagcgaaaa cctcagggtg ttgtacaggt gcaaaacatt ttctgatcct ccgtacataa     19860
     taaacctgtg tttgttgaag actggggctg gaataatatt ctccatctac atgaaaaata     19920
     ttatttatgc aggatagatg agatcattgt aagttggaaa actgaggttg aggatgggga     19980
     tggatacaga aagaagagta aagggacaat taggagtctc taaagatgcg aagcatagac     20040
     taaattaata aattaattca ttacattaca tagatgatat atttatacga aagtgggtag     20100
     aagaatactg tcatagtgag atacgtatgt gaagttggca caagtgccat attgtattca     20160
     ttttgccatt gaacaaagtg gtcaaattgg acatccaatc aatcttcagc ttcttttcgg     20220
     taaggcatta gggtgtattc gtaaatgaga tgcacaccac cttcggatcg taacgcaacg     20280
     cttattttag gagtaataat acaattgcta ctcgtgataa tttctgtctt ggaaaatatt     20340
     cggctctttt gttgtatcac ttggctattt atacgaaatc gataatgtcc agttcgtctt     20400
     gtaaagtgag agtggacaaa tttatgcaac cgtcagactt cctgacgggt tcagaccgtg     20460
     gttctgaaca ccacagatct cccttggaat acagatatct tgtagcgaca cagattttcg     20520
     gttctgttcc agttctgcct aagaaagctc tagagggatt tgcaatagag gcttcataca     20580
     acgtgtatgc acattattaa agttgggggt aggacgcgac attatggtta taaaatataa     20640
     cagcaactct tcggacaaaa agatcaactt tcctgaaatt ttgctcccga ctttcgaaga     20700
     ccattgctcc gtatcgagaa agccgggcag ctcacaaacc ccacactttc aggaaaatgg     20760
     cacgccggaa atactcccta cagaacttga acatctccta tcataatgtc acaagcactg     20820
     ggttctgagc ctaaaacaga attgggttta cagcgggccc tttctgtcag acaagaataa     20880
     cttgtgtgtt tcgtgcgttc caaatagtac acaattcgag aaaaaagtta gaagataatg     20940
     aaacagtata caggaaacat ttttcaaaag cgcccggcaa aatttccagt aggtcaaaaa     21000
     ccaatcgcat tgttccagaa cgagagtttc cttcaaacag gttacccttc ttatctgaca     21060
     acaagcgcgt taacgtaatg agggtgtgac aactaatgat cgtagctata gtcttttttc     21120
     aacgtgttca atttctttgt ttatttgaga cagaacttta atttagttac tttcaagttt     21180
     actgctaccc tcgttaaaga gactaacgtt tagcacatcc tgactagagt tgaaagttta     21240
     agaaagtata agcttcttag aatatacttt cagtacttca accaaatgta actaggatag     21300
     aatgttccga ggtcgcattg gagctcgcca actggagttt tcgaaggtga agtttcatat     21360
     cgttaaagta ctgaagatct ataccaaaat aagcacatag tataattaca agagaaccat     21420
     aatacgtttg catgtttcaa taatgaacgg gaatattgta aattttgact tgaattgaaa     21480
     taattttttt gaagttgcga aatttaaagt caaatgtttt ctacattact tgtatataat     21540
     agtaaacaac aagaattcag tccgatctat gaaaactcat atctgattct tatgtattca     21600
     accaaatgct gaattcaatt gtaatgtata tagcgtgaaa ttagagactc tttgcatgca     21660
     gatgctcgta gacgcctttt tagatgttat tcggatgaaa ttcgagcccc atgttatcag     21720
     tatattgatc tttcccttcc catagtgatc ccacttcata aattgcctaa cttttcgatt     21780
     gagatatatt aataagctac aaaattcaag aagaaatctt gcaaattaca cgaattttta     21840
     gcgtagagac aaaataatct aactcaatgc attgaaactg agagaaattg tagcttaaat     21900
     atatacatca ctcaaccatt atttggtaat aaaagagaaa taatatttac acattttctg     21960
     tccgaaaata aatgaataca aaccacaaaa ggcaatcttt atccaccact taggaagacc     22020
     atgccaataa tattttctac ttcaatggag caagtgttca acatcagagg cttatcaaat     22080
     agggggggac caagaaaggt ctgttaaaaa tatttttgac gcaaataacc ttctggagac     22140
     aatttttttg taatgtcgca attctctaat acgaatccag tttcgacagg ttatcacttg     22200
     gtaactacaa aatattagca aaacaaaaca ggaatcgcgt ccaatcatag gaaagaaagt     22260
     tctaatggaa atagtatcgt accactcgca ccatcagcgg aagacccaag tctttctagt     22320
     ttgatatacg gagcgaagct atcaactgca aaatgcattt ccaagataca tatcgcttgt     22380
     gtaccttttt cttggcgtgg aatatgcagt tggtgaaatg gatggaatct acgttgagtg     22440
     cgacagtacg agataaaatt gaaaagcttt agctgcagca aaagatatgg tggcatactt     22500
     ttgtgactct attgcatcgc tttcattctg tcatttagtt tcctatcatc ttcgcacccc     22560
     cattaacaag atgtcgctca agtcacctaa ataaagatgt gatactacga agggtctgtt     22620
     tctaaataga agaacaattc tttgctacaa gaaagtgaca tacaatatga acaagtaggt     22680
     aatgaattat taatattggg attatatata tatgtttcgt ttcaaaattc gaattctttc     22740
     acaattgaag gctagaaaag attctctgaa cgaacgaaat ccgagatgtc gaagttaatg     22800
     atgtggttgc aaatggaact aatatttact aaccatctat gaaatatata catttggatt     22860
     cataatctaa gcgcttatga agagaacagc gaactgagat atttactttg cttccttcct     22920
     cgtggcaatt tcaaaacaat gaagagataa aatgaaagat atattcactt gggattgtat     22980
     ttacagcttc actgattcgt tttgttaata tatatccttc tgtagaatct cactcttttg     23040
     attctccttt tcaataaaat gaaatactat tcaattggaa tcaattgtgg ggaaaattgc     23100
     ggaagaaata cgcaaggttc tactattctg ccgatgtttt ctatttatgt tttggagctt     23160
     tatctataac caattatgag ttcacgtatt tagaatgctt acttaaaata gaatgaaata     23220
     acttgcttcc aaagcagcat ataacgtccc gtaagtggtc tctttttctc cttccatttt     23280
     aaaatataat accaccgcag acaatgatca acatcgtcaa catacttgcc aacgccgaag     23340
     aagcttagct gggcaatatg gtcgtaccca atagatagct cggtatttga agttccgtaa     23400
     gcatcccttc ttcatctgag aacattctcc taacagactg tcctctagtc tccgttcttg     23460
     aaagtgtaag acaagaggaa atagttcaaa ttagttgcat tcacgtcaat ttgtactgca     23520
     taagagcatt gtaccaagga agtttgtagt attagtagac aaacaagcaa agctaacatc     23580
     ttgaattggc cattgcgttg agcgtatttg taaatgtatt attccaagaa tgttatcaac     23640
     agttcgaata aagctaggta ctaaatatta caacgaagaa ttctttatca aaatacaaag     23700
     taactgaaac atacttatac atcagaactg atggaaaata agatacagga ttccaggtaa     23760
     ttcagatatc cggagacttc ctcccgagga atgctcccga atatccatgg tatccggggt     23820
     gagtcacccc ggattggaga agtctactat aaagagaaat ggttccagat ttttgtctcc     23880
     acttcagttt gttggctaaa agaaattact caacactcat gagaaaggag gggttaccaa     23940
     agtatataac taccagcaga ttgctgctga gttgaacaag aatttagata ctttagtgat     24000
     taatacaagt ccatatccat taatccaaaa ccctagtcca aaaaggaaaa ccggtcccaa     24060
     tatacaggtt tcccgtcaag aaccggaagt catgtgccac attttataaa attggtagtg     24120
     tgtgtaaccg aggttttgtt tgtatgtcct tctaatgaaa ctagctattc gctatcgctt     24180
     tgaacctaga atgcttttgg caaccgtcga tcccctcagt ttggtgtggt ttgcccgaaa     24240
     ctgtcatctt tctggggatc gtgacgctgt cccaatctta tctcgtcact ttttcaaatc     24300
     caactatttt attgtttaac cgaataattt agccggatag tttagcccac tcttcgagcg     24360
     gaatgagaca gcttaccttg tctaaagtcc gttacaatca cgtttacttg gtcacctgat     24420
     tgcatcttaa atgatggaaa ataagataca ggatctctaa taatggtttc cgaggtgacc     24480
     aacctcggat tggatccgat aaatatccga aacagaaatt ctacatttct tttgttgaat     24540
     aacgcaacaa actacagaga tgagatgagg atgaagaata tataaagccc agaggattcc     24600
     ctctagttta aacagatttt aaatagttct tcagtgatta atataactcc atatccatta     24660
     atccatttct aagtccaaaa ggaaaaccgg tctacccata tacaggtttc ccgtcactta     24720
     atcgtgctct tgtttcgttg atgtaacata agatacagga tccctgatta tctgcttagg     24780
     attgcacgta tataagtgcc caagagaatt gatggtattc gctggtcata acttgttaaa     24840
     tcacccaaaa aattgaaaag caagaagaca tgaaattcat tctggttcaa acagaattaa     24900
     ataactcttt ggtgattaat ataaggtcca aatccatttc cttatataaa aggaaagccg     24960
     gccggttgtc catcgtttgt tgtattctcc ctccaaaaat acaacacatc aatactactg     25020
     gcacctccaa caacacattc acaagaaacc tatgtctatg atattaatac tatgtgcatg     25080
     tacttctctt ttctctataa tttgaaactg ctctcattcg aatatctaaa aactcacaat     25140
     tttccaattc taacttctcc agaatcaatt aactccacta ccaatctttc aaatctgtaa     25200
     tagctcaatt gctacctttt atctactttg tgctacatta tgcaatcata acttttgcct     25260
     tgcatttata actcttcgca attactgaat aatatgtact gctagtcttt ttaagaagaa     25320
     tgcgaaaaat acttaaaaat cactaattgc agcaacaatt ctatttctac aagtaatacc     25380
     attcgattgt cctcattcaa ccaaattttt gaactttgaa tcttacaaat tttaatgctc     25440
     taaactttta aattatggac atatgatcaa ggttcacaag atactaaggc tcattcaatt     25500
     taaatgctgt attggcctgt ttcgaagatc tttcttatta tcaaatgcac tcacatgtaa     25560
     cccccatatt cttacaatct taacttttcc cttactttta ttacttctct caattttctt     25620
     gtatccagag atgtactgat tgtctttctg gaaagaatgc gaaatttact ataaaaatac     25680
     taattgcagc aaaaaatata cagctcttaa ctaccagttt ccgaagcacc tgctgcacgt     25740
     agtgagaaaa taatgcgaca ggattcatct ttaatttcgt ggccggtcac atattgagtt     25800
     ctataataag tataatcatg aaaattgaaa tgaaagcacc ttttttatgt caattcttgt     25860
     aaacttctgt tctgatgaaa tatttttggc aaaaattgga gtcctccaac aatatttcat     25920
     ccgagtatta actaattgta cgaaactgtt tgtgcaagag atgatcttat atgtaatgga     25980
     ttttgttgta agtaaaccac actaatctaa tatctaattt aatacatcca tattcttgca     26040
     ataaaaatag ctcctctcat tcagaaaaat gcgaatcact atttaaattt gcccaatgtg     26100
     ttccggacca ttatcaaaaa cagaacgtag ctttgcctga gacagaatga gcttgtgcag     26160
     gattttgcac accctgtcat caaaaagagt ctgtattgga tttaagaagc acaagttgcg     26220
     agtaaactac ggctctgatc caagcaaatg taataacctt tgtgctgctg ggaagctgat     26280
     atgtacaatt tctatagggc cttttattaa tatctcactt atttcattac agggtagaat     26340
     tcttttcact ccggcactga aagaatgtcg ccagaagaca acaaataaat cttcagagtg     26400
     tatccagaat ttaaaagaat gcaattggat ttgcctattc cgttgtttac tgaacaaaat     26460
     tctccggatt cgtcgatcct aattcattct atagcaaagt ttgataagaa atgtgcgcat     26520
     aaatactgct attaattgga tataaaaatt acttacagaa aataaataga ttaggagaaa     26580
     acgcaattgc tccgatataa caagtcggta atgtttaaaa gatttaaaat catgaaatca     26640
     aaaatggaat ctgaagtcga aagcgatcga aagcgaaact gcactagaag aacctaaagt     26700
     accctttagt cttcgtttct gtaactgtaa cagttgggag tgttgtacgt gctgtggtgg     26760
     tagttgtttc ggtaatataa actgatgtca ctgtataaat ggtatctgtc gaatgtggtg     26820
     gtttcatagt tggacaacta gtaacggtga ctgtgtcaat tggctctgca gtagttgtga     26880
     ctgttactgt aatgtaagat ggaacacacg atgcttctac agaacttgaa acttctgtgt     26940
     cagagcctga tggcgtttca gaagtagatg gtccctcaga agatgggccc tcagaagtag     27000
     atggaccttc agaagatggg ccttcagaag tagatggacc ctcagaagat gaaccttcag     27060
     tgtttgaacc tgatggacct tcagaagtag atggaccttc agtgttcgag ccagatggac     27120
     cttcagaagt agatggacct tcagtgttcg agccagatgg accctcagaa gatgggcctt     27180
     cagtgttcga gccagatgga ccctcagaag atgggccttc agtgtttgaa cctgatggac     27240
     cttcagaagt tgatggaccc tcagaagatg ggccttcaga agtagatggg ccttcagtgt     27300
     tcgagccaga tggaccttca gaagtagatg gaccctcaga agatggaccc tcagaagatg     27360
     gaccctcaga agatgggcct tcagaagatg ggccttcaga agtagatgga cctttagtgt     27420
     ttgaacctga tggaccttca gaagtagatg gaccttcaga agatggacct tcagaagtag     27480
     atggaccctc agaagatgga ccttcagaag tagatggacc ctcagaagat ggaccctcag     27540
     aagatggacc ctcagaagat ggaccctcag aagatggacc ctcagaagat gggccttcag     27600
     aagatgggcc ttcagaagta gatggacctt cagtgtttga acctgatgga ccttcagaag     27660
     tagatggacc ttcagaagat gggccctcag aagtagatgg accttcagtg tttgaacctg     27720
     atggaccttc agaagtagat ggaccttcag tgttcgagcc agatggacct tcagaagtag     27780
     atggaccttc agtgttcgag ccagatggac cttcagaagt agatggacct tcagtgttcg     27840
     agccagatgg accctcagaa gatgggcctt cagtgtttga acctgatgga ccctcagaag     27900
     atggaccctc agaagatgga ccctcagaag atgggccttc agaagatggg ccttcagaag     27960
     tagatggacc ttcagtgttt gaacctgatg gaccttcaga agtagatgga ccttcagaag     28020
     atgggccctc agaagtagat gggccttcag tgttcgagcc agatggaccc tcagaagtag     28080
     atgggccttc agtgtttgaa ccagatggac cttcagaagt agatggaccc tcagaagatg     28140
     gaccctcaga agatgggcct tcagaagatg ggccttcaga agtagatgga ccttcagtgt     28200
     ttgaacctga tggaccttca gaagtagatg gaccttcaga agatgggccc tcagaagtag     28260
     atggaccttc agtgtttgaa cctgatggac cttcagaagt agatggaccc tcagaagatg     28320
     ggccttcaga agtagatgga ccttcagtgt tcgagccaga tggactttca gtagaggaga     28380
     tttcagaagt gaattcaaca gaagtggagt ctgaagggac cgaagagtta ctttcagttg     28440
     cggattcatc agaactggaa caagggatca caataatgac tgtttcggta gatccctcag     28500
     tttcacttac agtaactgtt ttagttgtgt agcctgtcca tgtggtagtt actgtaactt     28560
     gagttttctc agtgcacgga acttccacaa tgacagtatc agtgccaccc tgagtatcag     28620
     tctcggtgat ggtagtggtg taagaaccgg tccatgtagt ggtaacggtg gtttgagggt     28680
     ttggagtaga tggaacctct acaatgacag tatcagttcc accctgagaa tcagtctcgg     28740
     tgatggtagt ggtgtaagaa ccggtccatg tagtggtaac ggtagtttga gggtttggag     28800
     tagaagaagc ctgatcgttt ccagatgttg gaacttccac aatgacagta tcagtgccac     28860
     cctgagaatc agtctcggtg atggtagtgg tgtaagaacc ggtccatgta gtggtaacgg     28920
     tagtttgagg gtttggagta gaagaagcct gatcgtttcc agatgttgga acttccacaa     28980
     tgacagtatc agtgccaccc tgagtatcag tctcggtgat ggtagtggtg taagaaccgg     29040
     tccatgtagt ggtaacggtg gtttgagggt ttggagtaga tggaacctct acaatgacag     29100
     tatcagttcc accctgagaa tcagtctcgg tgatggtagt ggtgtaagaa ccggtccatg     29160
     tagtggtaac ggtagtttga gggtttggag tagaagaagc ctgatcgttt ccagatgttg     29220
     gaacttccac aatgacagta tcagtgccac cctgagtatc agtctcggtg atggtagtgg     29280
     tgtaagaacc ggtccatgta gtggtaacag tagtttgagg gtttggagta gaagaagctt     29340
     gatcgtttcc agtactagtt gtacattcag taggtacaac aatgatgaca gtatcagtac     29400
     ctccttcagt ttcactgata gtaactgtag ttgtggtgat ttcagtccat gtgcttgtaa     29460
     ctgtgatctg actattacac gatttagaag atctggtaga gtgcttcttt gtcgatgttg     29520
     tacatggtgt cttggcagta gtctgggatg ttgtatgagg accatctgga acagaaggta     29580
     ctggcttgca tggtctacat gcagatggga tactcaggtt tggaactggg ccattatatt     29640
     tcaaagcgcc gttaaataca ctcaacaaac caagactgga atcagtagta atttgaaact     29700
     tctttttatc gtatccagta ccgattatga aattgtgtgc aaggtttcca agtgctctaa     29760
     gagtcaaaat acctctcttc tcatcataac cccaactacc aagaattgga agcgaaataa     29820
     gaggaagatc caaaccaatc ttgtttccat taccaaaccc atacacggta taggtctttg     29880
     acttagaaat tgcttttgct ctaatggagg attgggaatc agcaaggtag aatgattgct     29940
     ttggatcgat ctccaataaa caattcgata agaaaataga agaattctta tcagcagtga     30000
     tacaaccact accaacaatg ttcgtttctt gcttgaacaa ttcgttatgc aaacagattt     30060
     gaccatcgtt acgaatcgtt cctagtggtt taccaagcga aacaattgca ctagttcttg     30120
     agttttggta aaagaccaac aaacctgagt ttgtccaaga actcgacgtg attgcagtta     30180
     aacttccaag tgctccattg gtggccaaga acatttcacc tgagttatag aaagaagaac     30240
     caataagctc atatttggtt gcaagtttgc agaagatgga gttgaacaca acagtacctt     30300
     cgttctttat ggaattttga ccaaatgcaa gtgtaacgga taagtttatt aacctgtctg     30360
     tacctgtaat atagaaaccg gcgccctttt ttacccagag tgaacccttc aaagcagaca     30420
     cagagttatc aaagatagac caataagaat tttcttcgat ggttatatca ccaatggaca     30480
     aattaatggg gcccttatcg acttttgatc cagtaataac aacatctcta gtagcataga     30540
     caacagaaac aagaacaagt attcttgcta gaagacttga aagtaacatg gtcgagctga     30600
     tgggttgtat ggaaaggaga ttacaaacac ttgacttatt cgtatcgttt tatacttctt     30660
     gatgtatcca aaaggctccc tccattactg caaaatttcc aaattgaatt gaatcatatg     30720
     ttgggaattt gcagcattcc gaggagttcg cttgcattca agtttgtcag aaatgtcaat     30780
     gtaaggcggt tgatgtcgcc aagaagcaat actttcccaa ttcaatacac ttcaaatttc     30840
     cgcattttcg acttctcttg ggaattcata aagtacatac ggaagcagaa ctattcgtga     30900
     atcaactggt ctccattact cattcacagt ttagtgcatt cctatcaaat acatcaattc     30960
     attacataaa aactgttgcg ctggtttctc taacgagata gctttcacaa tggtatcatc     31020
     ttgactgatc tctgacagct gaagactaga tctgagagat gttccaactc tttcataata     31080
     cacagcatta ttctgtccag cagacaaaca atagtcggca acatactcgt catatgttcg     31140
     cgtagtaacg gcaaacaacg cgtgtgcctc aacaatgcca ttgtaatccg ataattattg     31200
     ataaaacttt cggaattttg cagtttctat gaaaatgcag gagaatcaag acattccttt     31260
     ccctatctta agagcattag gcgttcaact attagaaaca taatagtgat ggtaatagcc     31320
     caaccagctt ccaaaacgct ttcgcaacat aaaaattata agtcttgtgg aattactttg     31380
     aactcgatca aggtcccttt ttttataatt cagaatctaa taacaaccca aacaagtaat     31440
     tatcaatgat ctttttctgg actgatttgg aacattaatt ctctatatta agtgagctgc     31500
     tgtaagttgg aatacggttc ggctggggga gcctttgctg ggatttattt ttgcgtatct     31560
     gctggcagta ccaaatcatc ttgattcctg tgtactcaag attttattgc attgacactc     31620
     gtttctggtc taaattcccc ccttaaaaat aactcaacaa gtttgatgta cgcaacattt     31680
     aaagaatttc ttagtctagg acttcttcca atcgaacata tgcaagcaga ccctgagttt     31740
     caaggcagag ttcgtgggtt catatttcac atgaatgaaa ctgaatgtta caaatcctgt     31800
     gtaccgtagg gtgttgaatt ttgcaataaa caccttggaa ctaggcgctc ctcttgcatc     31860
     caaaagggaa tgttctgcca gattgttaca atgcgctatg gatttagagc accccgacct     31920
     atagaatcga cctatagaat gcgccagaca cgttgaacaa ttgccaataa ttataaatta     31980
     tcaaaagcag gggttgctat cttttgggga cagcagaaca atgaacattt tgcattcctt     32040
     tctacatatt gtattctcga atttcatata gaaaatacct attgtctcta tggtaacgca     32100
     atttcaacta cttcgcatcc agtatagttt ccatactaaa atggcataaa tatacataat     32160
     gttggacaaa aatgcgcagt ttgcccgttg gaaaacattc tgtgcatcga aaatttatga     32220
     accataaaat aaaagtcata atagcgcgtg cacatttcgg acgtcccctc cgataccttc     32280
     actaaagttt acgattgagt atttacgatt gagtgggctc aatagactta aattccggtg     32340
     gaataattct actactcttt ctacattcac tgatgtaaag tcatataaaa aaataaggaa     32400
     ttcatagatt gtgtaatgaa taaaatactg cactatttag aggatcagtc gcagtcttag     32460
     ataatttgaa attagacacc gaaagatgcc aactgctttt gaccctcatc tgtaaacaaa     32520
     agcttaccgc tgctgtagcc aacaaaagca atcattgggt aacgccaatg aaaccaaaga     32580
     ggatggtcag atgccccaaa gaaatgaaaa acaagatcta gattgtagca gagaatattg     32640
     cacccgccaa ggacaagaac gctgataacc gtcgttaagt aaattgcctt tgaaccatag     32700
     tatttgtcaa caataaaaac attgactata cctcccatcg ctcctcccat tcctagcggg     32760
     caaaaaacaa gggtccataa aactttgtta ataatatcat cagttccgga catgataaaa     32820
     atagcgacca aaaggaatac cacctctgct attaacgaat tgacgtagaa aagcaagaag     32880
     ggacggatat agatagcacg cctcttttca ttttgcaatt tttcatcgtc gcttacaatt     32940
     atattctggt ttgtggaagc tgtcattttt cacttttatt gtcagtttaa gttgtgagct     33000
     taaaaaagta gttgagcaaa tataattacc tgcaacgaac aagggatact tatacttttg     33060
     ctctcatggt taaggactaa ttgaataccc ggggaaagag acaatatagc tacccctgtt     33120
     tttatctcta aaagttgctt atgacgtaca ttcaaagtag cggttgtatt tttctgtctt     33180
     cttgcataaa agtggggctc cagaaatttt gagtaagcga ttttctatca tatgtccggt     33240
     tggaaaattt cttctaagat atattatcgc tgtggttgcc agtccattca aggaagtaca     33300
     tgggtactgt cactgatatc tcttctcatt cgttttgaac tacattattc tggcaatcat     33360
     gattgggcaa ccctgtgaaa ctatcatgtg gactgcgggg ttgtaccttt acattgagcc     33420
     gatcagtgag aatttgccaa aatgaaattt tgtatttccg acaattactc ttgcttgaga     33480
     tgagatttcg caagtaagtg tctcacataa atagcttcgc aacaaacagt gaatagaata     33540
     ttcgcccaat tgatttgtgc tgtatttccg acattatatt cttggttggt acatgatttc     33600
     ttaaaaaatc acagtattga ggctcatctc cttgcatgaa gacaaaaata ttgtctccaa     33660
     ttgacggtac tattcgttcg ttttctgggt tctttggcag aggttaacta taagaacttc     33720
     gagcatccga ctcaatatgg ggggaatgag atcggaagca accagtacct tttaattcaa     33780
     gcaatgtaca aaagtggaga tagttgactt ggcaagtgat ggtaccatga atatagtagt     33840
     ctccacctgc atgtgttcta aagatcaaaa agtgtacaaa attagtattg acattgaaga     33900
     atcaactgcg gacgacaagc tcggatattt aatatacgtc tgaactcgca tgagaatttg     33960
     cgacagtacg ttaatgtctt agtatagaag tttattcact cttacttgac gaaaacatca     34020
     tcaaaaatac gcgagtgctc agaaagttct gattgaagac tctggcacca gatatacacg     34080
     tatagccatt tcatcaaaaa gcagtggtat taactcggct gatcatatat agagttttag     34140
     tattgtaacc gtaacttttg gttatcattc aagaaatgca gaaataatgt aaaggaatgt     34200
     tgagaaggta atgtaagatt aatttctaca gtgagaatct ttccgatgag ctagagataa     34260
     tttgtgttaa tcattaatgt cccacagagt atagcaccat gtatatccag ctcaattgcc     34320
     agcgtaagta gttcaaggta cagtatggtt gcgcatacat tttcttccta attgggcaat     34380
     ggaggatgat gacaacaggg ggtgcggact tggtaaagcc ggccatcatt ggccaatgtg     34440
     cttgtcaaat aacacaaata gaaacaagaa aaagacttat tcctgccata gagtgcaagg     34500
     gcaacaaatt ctcgacatat tcaggtcgta ttcgtccaat catagttggt tcagtgcaaa     34560
     gagcggaaaa ctaggcttgc aaccacaagc tagccactgt acatcaggtg actaccttca     34620
     ataagtgcgg tgcaggaaaa cctggtcaat ccacactagg ggtgcagaga cttaatcaat     34680
     ggaaaacatg gtttgcttcc gaagttcgcg tattaggtgt gaaactatcc actggaacga     34740
     cttagcgact gagtagaaat gcaccaaacg gagagcacag cacaaaaaaa aagacagcaa     34800
     cagtgtagac atcaaaggaa tgtagtacta ataagcagta aagtcttgtg attgcaattg     34860
     caattgcaat agcttcagca gaagtactag cagtaccagc agcagcaaat gtcaatagtc     34920
     gttgacattt cgccgtacct atgcagtgtt ccctaagtgc actatctagg caaaaccagg     34980
     cgcaacctat ttcttgacct tttacgttgt aatactgtac attttcccca tagtaagtgt     35040
     ttgcggcatg ggcctcgcgc tcgttgagta gcattttttc ctcgttggct caatcgataa     35100
     attcaccaat ttgtttgtct actctggttc ttttgacctg ttttcaccac gtcttcccca     35160
     aatagacgct aatcggctca ggtaatccat ctgtcaatat cgacactgtg atagttgtgc     35220
     acataacccc gtccatcgtc ggatacttcg ttgtcaagaa atccccccag ttccttcact     35280
     cacacttggt tcaaatctca atttcagtat cgcgaaattt gacttgactt ttcgtgactt     35340
     ttttccacac agacaattga actagtgatg tccgtgtacg catcgaactc ggccgccgtg     35400
     gcagcccaac agcagcagca gcagcagcaa caacagcagc agcaacagca acaacagcaa     35460
     cagcagcagc aacaggcggc cgcacagcaa caacaggctg cccagcagag acagcagcat     35520
     cagcaaagat tgaacgagtt gttggacgca gtcaagcagg agtttgacta tgcattgaca     35580
     gaagcatcgt cgttcaaaca ggtcaaagag gactatgaca ttaaatacaa tcagcaaact     35640
     gctgagatgc aacaaataag acaaaccgtt tacgagttgg aaatggccca tagaaaaatt     35700
     aaggaggcct acgaggaaga gatcttgcgc ttgaaaacgg agttggagtc ccgggacaga     35760
     caggcccaga tccaacaaca gcaagtagct gctcatcaga cagctgccca gcagcagaag     35820
     cccaatggat tgtcgtactc aggctaccaa cagcagcaac agcctctgca accagcagct     35880
     attcaaaccc catcgcagca ggcattgcct ccacctatca aacagtctcc ccccaaacag     35940
     gaaatcaagc ctgtttctcc tcaagtcgcc aaacccgaag tagagactcc aaccacccag     36000
     tccaagcaag aagccaccac ttctgtttca gctactggaa tcaccaacgg aggtactact     36060
     tctgttcccg agacctcaac tgcattgact gtcatcgaca aatcgcagta cattgttaac     36120
     cccacccaaa aggctctaca cgtcaaggag attcccccat tcttgtcaga cttggatgtt     36180
     tccaaagcga acccagactt caagaaacag aagttagact attatgtctt gtacaacccg     36240
     gccttcgctc gtgatttgga tgtcgagttg attcactcgt tggaccactc ttcggtagtt     36300
     tgttgtgtgc gtttctccaa ggacggtaag ttcattgcta ccggttgcaa taagactaca     36360
     caagtgttca acgtcgaaac gggagaattg gtggccaagt tgatcgacga caacaactca     36420
     tctgacgctg cttctggtgc caatgccact aacggagaag gtaagaacgg cgaatccagt     36480
     gagtccactg atgctgcttc ttccgcagcc gttgccgccg ctaatggtga cttgtatatc     36540
     agatccgttt gtttctctcc ggatgggaag ttattggcaa ccggcgctga agacaagttg     36600
     atcagaatct gggacttgaa caccaagaga attatcaaga tcttgcgagg tcacgaacag     36660
     gatatatatt cgttggactt cttccctgat ggagacagat tggtctctgg ttctggagac     36720
     agaacggtga gaatctggga cttgagatcg tcacagtgct cgttaactct ttccattgaa     36780
     gatggagtga ccacggtcgc tgtttcccca gatggccaat tgatcgcagc tggttctctt     36840
     gacagaacag tcagagtctg ggattctact actggtttcc ttgttgaaag attagattcc     36900
     ggaaacgaaa acggcaatgg aaatggccac gaagactctg tctactctgt tgctttcaca     36960
     attaacggca agcaaattgc ttctggttct ttggacagaa ccgttaagtt gtggaacttg     37020
     gaaggaaagc aagacccaca agggaacaac agcccaggta agaagtccag ctgcgaagtg     37080
     acctacattg gacacaagga ctttgtttta tctgtctgct ctacgccaaa aaatgaatac     37140
     atactttctg gttccaagga ccgtggtgtt attttctggg atcaactttc tggtaatcca     37200
     ttgttgatgc ttcaaggaca ccgaaactct gtcatatcgg ttgccgtttc cttgaactcc     37260
     caaggcactg aaggcatttt tgctaccggt agtggagact gcaaggcaag attatggaaa     37320
     tggaccagaa aataattcta atagagagag actgattaaa attttatttt atctcagagg     37380
     cattgtattt tagcagtttt gactatcgag tacggtaaaa tgactccact gtcatttcaa     37440
     accgaactgg attgcaacat ttgaagacat gaacatgttc ctgtatttat gagactttcc     37500
     ttcacaatat cttgatttgt ttgttcgttc ttgataatat agttgttgat taccattatt     37560
     tttcttttta tcacttgttt tttatttttt tatttatatg tatgtattgt aatagtatac     37620
     cgattgtgaa agcgatgtag agattttcca aattatatac attaacattc cttagtgtaa     37680
     gctaagtaaa aagtgtgacg aaccatagag tagtgtttct gatcataggt actataaata     37740
     aaagcggata cttaaaagac accatgtatt tattccttcg ttgtgggtga ttcaaaacac     37800
     acaagtttga gcttgattca cggtggtaaa cggaacatga ttagccaata cgttctctca     37860
     cttactggta caggatacgg ccacggtgtt cagaaccaag gaatgatccg tcaaaacacg     37920
     gacaccttgt ttcttgaaag tagcaaaatt atccaaagat gtagttaacg ttgagcactt     37980
     gattactttc agactacttt aactatatag agaagaaaca taaaattact acaaatatct     38040
     acaacaatag ttaatattgc ctataatagt taacctatac catataccca ttcatgtcga     38100
     aataaatcac tgcattgaat taggggcctg ctctagacat ttcagccgta cccttatatt     38160
     agttgcatca cgtgcaagat cacacctgac tgtatacgac agaaaaatta tccaccgact     38220
     agtctatatt gaagaactct ggaaagtatt ccaaccagta ttacacgtcc ttttcccaac     38280
     caaaaagtgc accactgcaa tgtcaatctt caccgcttcc tcaactgcac ccgtcaatat     38340
     agcgaccttg aagtactggg gaaagcgcga cactctcttg aacttgccca cgaactcatc     38400
     gatctcagtt actctctctc agaatgattt gagaactttg accacagccg cagccagcga     38460
     agctttcgaa aaagaccaat tatggttgaa cggcaagtta gaatctttgg actccgtcag     38520
     aactcaagcg tgtcttgcag atttgagaag attgagagct gaagtcgaga caagcgacgc     38580
     ttctttgcca aaattgtctc aattcaagtt acacatcgtt tccgagaaca atttcccaac     38640
     agctgctgga ttggcctcgt cggctgctgg attcgctgct ttggtcagtg ccattgccaa     38700
     gttgtacaag ttacctcaga acatgtcaga gttgtccaaa attgccagaa agggttcggg     38760
     atctgcttgt agatcattgt ttggaggatt tgtcgcttgg gaaatgggcg aactagaaaa     38820
     cggcgaagac tccaaagctg ttgaagtagc acctttgtcg cattggccaa ccatgaaggc     38880
     tgcaattttg gtggttagtg atgacaagaa agatactcct agtacgtcgg gaatgcaaca     38940
     gactgtggct acgtccgatt tgttccaaca cagaattacc gaagttgtgc caaagcgttt     39000
     tgaagaaatg aaacgtgcca tcgcggctaa tgacttcgag acgtttggcg aattaacgat     39060
     gaaggactcc aactcttttc acgctgtttg tttggactca taccctccta tcttctactt     39120
     gaacgatact tcaaagcaga tcattaagtt agtacacagg ttgaacgaac aagaaggtaa     39180
     gatcattgct gcatacacct ttgacgctgg tcccaatgct gtcatctact acgatgaagt     39240
     caacgaagca aaagtgttgg gcttgctcta ctcctacttc ggtgctgttg gaggatggga     39300
     aaagcatgaa gaagtcgctg cctataagaa ggtaactatt gatggcacca atcccgacat     39360
     ttacaagggt atttctagaa tcatcttgac cagtatcggc actggtcctc aggagactga     39420
     agaatcgttg atcaatgctg acggtactcc aaaagtagca taatgataga gtagatagct     39480
     aataaataat attcgtgtat gtctgtcact cacaattgca gcagcttcgt atagttcttc     39540
     tattactgtt actattgtac ctacggctcc atttttctcg gtctacgact cagttccgta     39600
     ctgtaacatt cattcattct ataaaataca atctatcaat catgagatat ctttaatgtc     39660
     gatctcatct atatccttgt tgataaactt ccgtaatacc gataattcct ggtttccgtc     39720
     gttgaggtgt ttgactatag tcttattgta gaactctaca agtttgttga gtttctttat     39780
     cttttcctgg tcacgtttgt attggctctt catcttcgag atgttgcctt ggagctctag     39840
     ctgtgcctgc ttctttctct ctctacattt agaggccgct atcctatttc tttccaaaag     39900
     tctttctttc ttccaggctg cagtaccggg aataggtcca ttgttagggt tgtagataac     39960
     ctcgttgttg tatatgagct ggtggttggg aggaggcact ccggctacac ctgtgagttc     40020
     tggcacagcg gtggagtttt tgcgagagtg ggatttagag agtgatttct gtggacttgc     40080
     aacaggtgtt tggggatttg gagacacgga tatggatgtc gaagctggag caaatgtaat     40140
     ctgcggttga tactgaggcg gaaccgcctg gctgttgaag tttccgggga atacttgttg     40200
     cggctgttgt tgttgttgat cggcgatggc agcaatcagc gtattggaat tcatactgct     40260
     gagttgcgcc tgaggaggcg agctaatttg cgaatgtcct tgactgttgc cgaagccagt     40320
     gactcccaag tctgtatcga aaccagagtc gtcctcaaag agagcttcgt ggttgacgat     40380
     ctggccaatc tgcccattgg agatggatat tcttcttcta cgtgggaccc catcgtttga     40440
     atagagcggg aggagaaggg ttgagtcgaa tatgggtggg ttggtaatgg ggtatgactt     40500
     aaagtcgaac gggttgtgga acgcaaaaag cgacgatgtg gcattattgc tgttattgtt     40560
     attactattc aaattggagt tcgtgttgtt gttattggta ttgttgttca tctggtgaac     40620
     gtttgcgaga gtagccaagt catctgccag aaatggtttg gaaaaagtga gcgaaccatg     40680
     gttaccattc ctgtggcttt ggatttgatt ttgattctgg ctctggctaa cggagttctg     40740
     ttggacggga tcaataccca aagagtctat ttgcatacct accgagtttg tggaactcga     40800
     cgtagacgat gctgtagcgt gctgcaaggg agccgggact tcggcaaggt cttgcgatga     40860
     gggatggcgg agttcgttta ggaagtcagc tgtgtcagca tcaacacgat cacctccagt     40920
     ggtggaagga tcaaggttag ctgcaagggg gttctcgtag agaacgtcgt tggacgaaat     40980
     gtagttcata ttgtcaacga ctatggtaaa tagttgggtt aaggagaact agcgtttata     41040
     agcagtgaag ttctagggtt gtgctactag tggcgtatag gtggtggtgt gtggacgatg     41100
     ggttagtggt ctgtagtatt gactaattat tactttggaa ttcttactct ttggtagtgg     41160
     ttcaagtgtc catcatgaaa aaaatgtgat aactgatgat taaatttatc agttaacgtc     41220
     aacctgcgtg gggaagattt cgctagcggt tctaggggga atgagaatgt ccctcgatga     41280
     gaagcgaaaa atcctgctag tatggctgga ggaaataggt tggttatata gacgttcagt     41340
     agcagtagtg atctgacaca gaatacgtct tagtgtggct cgtaatatca actttctctt     41400
     ggaacaagaa tatcactaaa ttgctttcag caaagaatgg cgacgctagg gagaacaaag     41460
     gaaagtttag ggactggctt tggcgagcaa cgacaaaaag tatctttttt tcgactgcac     41520
     acactgcaac aagaagtttt tattgggtaa tttcgcgagg gaaattagag ttttgagatg     41580
     aggacctgcg ttgcaatgga taatacagac gccgataaat atctttcaat cggggtggaa     41640
     tttattggtt gttgaaatat cgtttgatat aagatatatt tcagtattag ttgtttcata     41700
     gtgataatca ccagcgaatc acttatctta tatgatcttt tatgtctccc actgagcctc     41760
     caagcgatgc cttttgtccc gtgacgatcg cagaaaatgg catggtttgc gagatattat     41820
     cttggcacta gtcacgttcc atacatggaa actactgcct cgtcgcgtga aaagtgtgga     41880
     aaaaccaaat tataatcttg accctttctt ggctactcgg atttctactc ggatttctac     41940
     tgagtgtgac aatcgcaata agagctatat acgactaatt acgatcggcg atcggcaacc     42000
     acttgcgtcc tggattaact atttttgcat ttgaaacata tttttcagct ctagcggcct     42060
     gagagtggtg cagcacataa cgaatgtcga gatcttccag atcttccaga tctcctaaca     42120
     atcctggatc tcctagatct cctagatctt ccagatcttc tacttagtcc gagaaatacg     42180
     ctataattca cagtgaggac taatatcttt agtggatgca ttatagatcc atgacttttc     42240
     atcaaccttg tgtttctaaa cgcggtgtct ctctagattc agcagtgcca ttttgaacgc     42300
     actgaatcac ttgcgcattg ataatacccc cagacaataa agcaagacca aagcatccaa     42360
     taatgactga aataattcga cctcaggatg accagcagtt tcgtatctgc agaaaataca     42420
     aggttttcgg ctcatacttc caggaacaat cagcgaccag gtcatagcca tgacatgcgc     42480
     accttttatt tttctgcagc ttctgcagct tctgcagctc ggtagaatgg catgcagatc     42540
     tgacacaaag caggtccgtt aactgcattg tagactctag gaaaaagatg ttagggtcag     42600
     tctgctacta ttttgcagca tgtagaaggc cgagttggga aatgcagtta gattcaaagc     42660
     aagcacaagc taacatttct ggagttacaa gtttagtttt agaccgcccg cctgccttct     42720
     tgtgattcag cgtgagcaat tcttaccacg tcgtcatgtc gacaatgcaa caattccttt     42780
     ggaaaagatg tgatgctaat gcaaatagca aactaaaaag tataaaaggc accaattcat     42840
     attgggagaa gtcaattctt tcgtccgctc cttcatcaat caattatcac aataattaaa     42900
     acaaatatgc ttgcaacact actattcttc ctatttttct cgttggtcca atcagcaaga     42960
     atcgacttca tccccccggg atgggattgg tggacttctg gttgtacagc acagaaagac     43020
     tggtatttgt ataagtgccc tcaaggaaat gcacaatccc caggaaaccc agaattctac     43080
     tccaacttcc aagatctctg gtggatacaa ggcaatactt acagagccga atttaacttt     43140
     ggattcaatg ttgacatgaa aagtcaacat ctagactact tagccttaga agggttacct     43200
     tcaccagacc ctcgtgtcat cgatggtact ctagtcttag tggacaaagc caatggaatt     43260
     aatttgttta ctcagagctg gaaccgtctt tcattgactc tccttatgtt aattgacgca     43320
     gttccagatg ataccagacc tgagccaaga cactgtacac caccttttaa tgttgttgga     43380
     agatggtgcc aaactccaga aactcaaggt ggacaatgcg atacatggaa gtacaacaag     43440
     gaatttacta ttgtcgtcga ctgtgctgct caagactgta acatatctca gaagtgtttc     43500
     aataagcatt gtccaggagg aacaccatca ttacctcccg tacccgaccc aacaccagag     43560
     ccaacagaaa cggatccaga agaaaccgaa actaaaccta catctgaacc agaaactgag     43620
     acaccaacag agacagatcc agaaactgag cctacatctg acccagaaac tgagacgcca     43680
     acagaaacag atccagagga aactgaaact gatccaacat ctgatccaga aactgagaca     43740
     ccaacagaga cagacccaga ggaaactgaa actgatccaa catctgaccc agaaaccgag     43800
     acaccaacag agacagatcc agaaactgag cctacatctg acccagaaac tgagacgcca     43860
     acagagacag atccagagga aactgaaact gatccaacat ctgatccaga aactgtgacg     43920
     ccaacagaga cagatccaga ggaaactgaa actgatccaa catctgatcc agaaactgag     43980
     acaccaacag agacagaccc agaggaaact gaaactgacc caacttctga cccaacttct     44040
     gacccagaaa ccgagacacc aacagagaca gatccagagg aaactgaaac tgatccaaca     44100
     tctgatccag aaactgtgac gccaacagag acagatccag aggaaactga aactgatcca     44160
     acatctgatc cagaaactga gacaccaaca gagacagacc cagaggaaac tgaaactgac     44220
     ccaacttctg acccaacttc tgacccagaa accgagacac caacagagac agatccagag     44280
     gaaactgaaa ctgatccaac atctgatcca gaaactgaga caccaacaga gacagatcca     44340
     gaaactgagc ctacatctga cccagaaact gagacgccaa cagagacaga tccagaggaa     44400
     actgaaactg atccaacatc tgatccagaa actgagacac caacagagac agatccagaa     44460
     actgagccta catctgaccc agaaactgag acaccaacag agacagatcc agaggaaact     44520
     gaaactgatc caacatctga tccagaaact gagacaccaa cagagacaga tccagaggaa     44580
     actgaaactg atccaacttc tgacccaact tctgacccag aaactgagac accaacagag     44640
     acagatccag aggaaactga aactgatcca acatctgatc cagaaactga gacaccaaca     44700
     gagacagatc cagaaactga gcctacatct gacccagaaa ctgagacacc aacagagaca     44760
     gatccagaaa ctgagcctac atctgaccca gaaactgaga cgccaacaga gacagaccca     44820
     gaggaaactg aaactgatcc aacttctgac ccaacttctg acccagaaac tgagacacca     44880
     acagagacag atccagagga aactgaaact gatccaacat ctgatccaga aactgtgaca     44940
     ccaacagaga cagatccaga aactgaacct acatctgatc cagaaactgt gacgccaaca     45000
     gagacagatc cagaggaaac tgaaactgat ccaacatctg atccagaaac tgagacacca     45060
     acagagacag atccagagga aactgaaact gatccaacat ctgatccaga aactgagaca     45120
     ccaaccgaga cgccaacaga gacagaccca gaggaaactg aaactgaccc aacttctgac     45180
     ccaacttctg acccagaaac cgagacgcca acagagacag acccagagga aaccgaaact     45240
     gatccaacat ctgatccaga aactgagaca cctaccgagt cagaatcaga agaatcagaa     45300
     actcctagca ggactttgga aacggtcacg accacatcga ctatcacatt aaccactgtt     45360
     gtcccttgtc ctactggcgg cgaggaaacc atcactgtga ccgaagtgac agttattaca     45420
     actgaaattg aaaagaccgt atcctcaccc acaactattg ttaccgagac tattacaggt     45480
     cttcctgttc cacctgagac gttaccaacc gaaattgtta ctacagttgt aacctcaatt     45540
     ctaccagttg taactgtgga tactattact actacttcaa ccattacttt gactaccgtg     45600
     gttccacatc ctactggcgg tgaagaaaca atcactgtga ctgaacagtc agtaatcact     45660
     tctgaagtcc agaagaccgt atcttctatt acaaccattg ttacagaaac cgtcataccg     45720
     aagccattgc caactccaat taccattgaa tctgtcattg tgactcctat taccgttaca     45780
     gttactaatg ttataacaaa cactgttgtc gttccatgtc caacgggagg atacaccaca     45840
     gaagtccaat tggaaaccga agagatcacc accgaagttc tgaaaactgt cgttgttact     45900
     actgtagtta ccaagaccga acaacaatcc acaatggaaa ctgtcatcgt ttcccaggca     45960
     ggaaaagtta ctactaccaa gtttataacc caaactgtta ctgagtgtcc agaagttata     46020
     caaacaacaa ttttcgagac aattgccggc gagacagtca caagaacagt tgatcattcc     46080
     gtttgtgaga cctatatagt tgtatgtgtt gaagagccaa ccaaagaact tgttgaagaa     46140
     atcattgatg acgttgtcca ctcatacacc actgagtaca cgaagacttc actgttcacg     46200
     ttagaacaat tggttactga tgaagctgaa gaacaacaac aattaccata tgaagatcac     46260
     attgatgaag aagaccaact agttgaagaa agtggaactt attcaatcga agaagccttg     46320
     gaaggtgctg gttcacaaat ggatcctgcg atgaatatga tcatggcaat aattgcttta     46380
     ttagtatcta tctaaatgtc tgtatatttg gatagtttct caacaaaatt agttctagca     46440
     actgattaat gagatacgtg tgaaagaaaa aatcaaaaag ttataaataa tttaatcaaa     46500
     tattgttgct ttatcgtcgt aagtcaatgt aacaagactt ctaagtatag caagatgaga     46560
     aagtgtgaga gttatgagaa tatcccttta ttcgcaactg cacgcctggc ggcattggga     46620
     caacgaatgg ctcttttcaa aaatgatttt tttcaaaaca aggtttatac aatggatgaa     46680
     tacgcagaaa gattttctcc tgaaaaatat acattttgca gattctgtgg attctgggtt     46740
     ggagtatcaa ttttcttgac tcgccgagag ggattctatt attaacatca ctgggcagct     46800
     tatgtctttc taaaacggta tgtcatgttt ctgttcgtgt gatatgcgct aaaatatttt     46860
     gacacttttc aaagcccata aaggctgggc tgcaacagtg cgataaaata tttttgcgcc     46920
     tacagctggc atcggtcacc gttgcgtacg tcaactcgaa atagatctcc atgggaataa     46980
     ttacgattag tcatctgtga tcggcagaat tggttgcact ttatacgata gtattttctg     47040
     actttatagc tgttggtatt ggcgcagaag gagttcgaga ttttcaatgt agttcaacag     47100
     aagtgcaacg gacccctgta ttaattgcat tgtaaatctg tctaattgat ttccctgaat     47160
     atatattatc caaaagtaga gattctaaat ccatatattc attctttaca taccctaaga     47220
     ctcgagatgg gcactttaca gttgggaaca gtacagttgg gagcagttcc actatttgaa     47280
     gactggataa gcctatttcc aacaatgtga gcatgcggag gcgtcatgca tgattatttt     47340
     gacacacttc cggaagcatc acgaaatcga cgtcatcaat ctgatgtcaa aaaaatggga     47400
     catgcacgtt tatgcacctc gtcataataa tttacttcgc agatcccacc atctatgtcc     47460
     agcacggttt ttttgacact gaaatacgtt cactatctat gtccattcgt ttttttttga     47520
     cactgttagg cgactccatc ttttagtatt ttcgtacgtc gtaactgtga tataagcgac     47580
     atataatcag taatcgttgt agaccgtatt ctcagctaca accattcaga gacctatgcc     47640
     cttttatatg atgaacaagc cagcagaaaa gtaattgaaa ataatcgttg acgattttca     47700
     atctataccg ctgaatgcaa gaagaactta ccaatcacat tagaaaattc agatactgaa     47760
     gactttgaaa aattgctacg aatatgaacc aagtcgaagt ttatgatgaa tcagcacaac     47820
     agccaagtga caaagaagtt actacaagaa gattatggtg acaaagacca gcaatcgtac     47880
     aagcattaga aggcagggtg taaagcactg agccatgaga taacgccaaa attggccaaa     47940
     attgctttat tatctattgt atagttttat gattgtttaa caaactttaa tatgtattta     48000
     atatgtgaaa taatgaatga atgaatttac aacagaatga tgtatacttc tgtacactgt     48060
     attgagcgta atttattcaa catagaaaac agtcagtgtc tatcaatata gaatgtagac     48120
     ctcattcacc aatcatcgtc gtcatcatct tcgtcatcac tgtcgtctct ggtagcaccc     48180
     tgtctcttct tcaaggcatc agctaaagag ccagccaacg tagtttcttc agtctttttg     48240
     gccctcaaag cttctgccaa cccattactc aagcttccgt tcagaacagt cgatgcaggc     48300
     gtgctactcg aaacagcagc actagcaacc gtcgactctc tggattggac cttcggctgt     48360
     gaaggtgcaa ctggacgaga aggagggtta gcagcaccga acaaactact aggtggttcg     48420
     cattgagata gataatcaat tggagaccag ccttctttag actcgtccaa agtcttcacc     48480
     aaaccccact ttccattaat gctctctaca tagtagacga catccttaac gagaggtata     48540
     gaaccagcta ctgaaccatc gtagtcatac attgccttgt aagtcgggaa cttgggctta     48600
     gcaggtgctg acaaagctgg aggtggcgga ggtggtgggg gagcagtttt tcttactgga     48660
     ggacttggag cagttttctt tactggtctt acaggctcga tagcttgagg ctgtctttgc     48720
     ggttgattct ggactacagg agctggcgga ggagctttac gttgaactgg cttagcttct     48780
     tctgggcgtg gagtctggta ggcaagaact tgaggctggt aagactgttc tactggactt     48840
     ttgtatgaag gttgagatgc agcagtaggt cttgcagaag gtacagggaa cagtttcttg     48900
     actcctcggt tataatactt ggaataatcg acctttccag actttcctct tggacgtttt     48960
     ggatttctac tgctagaagg taaacctggc ttgaccgtga ccgtaccaga cttgtaaaca     49020
     tctccgtact caggtacatc agatgaatta ccactgataa acttgaccgt gtgaaatttg     49080
     cctggctttt tctggtactg aaccgtagta ccaatattaa tggtcaaccc aggattgatt     49140
     ttcttcaagt gggtgacaaa ctcggtcttg aaatctaagc taatgaacac atcaggtgta     49200
     gaaggggtag gtgagtgaag tgacaaagca acccaattat cttgcaaatg agacaacgca     49260
     acgtagttca agccagaaat aggaatcttg aattctgatt gcaattgcaa tctcttctca     49320
     atcaagactt cagcaatgat aaatatggtt gttctggtga caacaaatat acgaggcaat     49380
     ctctttgacg atctaccaaa tttggacaac aaaatctcgc ctctccccga gaatacaact     49440
     ttttcgttaa tacctgtctg ggtaacaatg aatctaccat atccactggt atcgctacat     49500
     cccaagtagt cacccatgaa agcacgcgat cccaacatgg acattctacg acgttctttt     49560
     ctgccctgga cgagaccatt accataatca cgaagctgtt caaactggtt cccgtgcttc     49620
     ttgattctcc aggcactctg aattgtacga gcagcatctt ccttacgctt gacgtatctc     49680
     ctccatgctc tttggattct agcagccatg ttgtgccagt acttgtctct catgtcttct     49740
     aaaccaaata aggtttctgg tgtcttgatg aataccttgg tcgtaccaag ctgatactca     49800
     gtagcaggaa tgaaacaaga ttttaagatc tctttgacag cagaaatgtc gtctccacgc     49860
     cagatatagt caccagcata acctgtagcg ggagagagca aatagaaacg ttggacaaat     49920
     ttctcaaacg ttgtacggaa agcaaaaccg gctcttctaa ttctcacatt ttccttcaaa     49980
     cctaagtatt taatctggtg aagaacttgt tggttttcgt attccttagg acgtttggtc     50040
     tgatttggct tgatggttct gatatatgaa ggctgacatt ttgataaggt gcccaccaaa     50100
     tcgttggcac ttctcttgat cttgtccgac gctgtttctg gtctcttctt tgaatcagtg     50160
     atcgatgcca agagcagagg aggaaataaa acttggttga cgaatggatt ggctgatgta     50220
     gataacaatt ccaccaaatc acgcaacaac gcatccttgt tcttgtctgt catacctgct     50280
     acttcatagg tgacatcacc agcataatgt ttgatgataa acttgccctt acgatcttca     50340
     aagtgacgat tgctggctcc caccatgctt aatctttggg caaacacctg gtcggcagca     50400
     tctgagtcag cgtgagccgt tttgatagaa tcgttcaaag ctgcaaacaa gcccggctga     50460
     ggtctcgtgg cttcaatcaa gtcacagaca accttgttgt tgaagtagtc gataggtgtc     50520
     cacttgattt gctctttgac gtattcgtct tgttctgcct tcaatgtaag ctggataaag     50580
     atctgttgca acttctcatt gacatagtta atacaaattt gttcaaaaga gttgtgttca     50640
     aagatttcga acccgtagat atccaagata ccgatagtct tggacgattg cagtgccccc     50700
     ttcaacgaga cattgactct ctctacgatc cactcgaata aattgttata aatacccttg     50760
     gcaagagcat cacgaaccga cgtagcttgt acgatattca agggtacatg gtaggtagag     50820
     ccccttctca tgccatgggt tgtctctata accctttcta ctatggcctt ctttaatatc     50880
     tctgggttta cttccaacaa gtaagcaaca aattgggtga cactatcatc tctaatggcg     50940
     gcatttccac tttcatcctc gacaaacgac acgttaccaa tccacaatat cagagcgatc     51000
     attctgaaaa tgttgttctg ctcaagttcc gttaagccga tgatcttcat tgcgctcaat     51060
     gtttcgtcca agtccttgga atcgtcgatt ccgtctacat tgatacattt ggcgctagaa     51120
     gtatacacgt aagtctccgg tccttgaatg ccgaactgct gttgatactg cgtcggacag     51180
     tgtttggtga actgatagaa aatgtggaaa ttacgttcat tggtaatctg ggaaacgact     51240
     ctctgcttct ccaacaagta atttgtaata tgggcggcga tcggctggtg gtttgactca     51300
     gagaattgga tctcgaggta cttgccatgt cttgatgagt tgttgtttct caacgtcttt     51360
     gcacagccaa acgactccaa caaggggttg gtggctagaa ccatatcttt gatctttgaa     51420
     atttcggcat tgccactatc gacagagacg ttagcgatgt actgcatgat ctgtttggct     51480
     gcctctgtct tacccgctcc agattcaccg gaaataatca cacactggtt ctcgttgtac     51540
     gacttcaagt tgtagtacat cgactcagct atggcaaaca cgtgaggagg cacctccaat     51600
     ctgtttctgc cccggtactt cagcaaggtc tctgggccgt agatccctaa atcttgaaat     51660
     gggttcacgg agatcaaaac atggccgatg tacgtgtaga tggtgccgtt catgaaccgt     51720
     ttatgcaagt tgtcattgat agcctcatca gtgattttgg agagcaacgt caagtcggaa     51780
     actccgacct ctttcagttt gtggagatca aactccgcct ttttgatgcc agacttggct     51840
     ggcgcctgct gctgcgtctt attcttcgta cgtcctcctc gtttgacaat ggccatggtg     51900
     aagaatggaa gctgtgtaga gcagagaaag tgaatagaaa tctggaaatc tatctcaact     51960
     ttgaacgttg gctcggatat cggcggagtg gggtgcagga gcgaaaaaag actatggcgc     52020
     tgcgccagcg acctgaccag caaattatat aatctagata gtggtatagc tgtgttgtac     52080
     aagaataact aagtatggta atagaatgta gtattatagt gttaaagttg tgtgtagtta     52140
     tatagtattg aagtacaagt catattcttt gcattttgct cttttgtggt attaatattt     52200
     tgggagtatt gcaaacctca ctgtataaca taagcttaca gatatagtct catactatta     52260
     tgaatgagta tagtcttata tagtgttggg aaactataca tcttaatata aattctatgc     52320
     taatgcgacc acaatctcac catcttatct ttacctccac tggccactct ctttccgtcc     52380
     atactccagt caacagcata aacctcgtct gaatggcccg gcaagtccac acttaacttt     52440
     cttgttctga tatcccacac cttcaaagtg gtatccttag agcaactgac caaaagtcta     52500
     ttatcagcag accacgctgt ctggtatact ggtgctacgt gtcctctcaa ggtacctaca     52560
     aaaacgccct tcaaaccgtc ccagatcttg atggagttgt cgaacgaact cgacactatg     52620
     taacgaccat caggggagaa cgacacatgg ttcacgagtt tctggtgtcc ggtcatacgg     52680
     cacactggct tggacgactt gagtggctcc caaaagtaca tagtgaagtc gtctgaggct     52740
     gtgaccaaac gttcgctgat aacaccaccg actttagcaa ctttttcgta ctgctctaat     52800
     gccttagcgc gcaactcttc catggaaagc tttttgctcg aaaccttggt agacgtatgg     52860
     tcgaatccac ctttgcgcaa aacgtagtcg gttgaaatag acaaatggtt gacccaatgg     52920
     gcatggctct tcaacgtctg gatacacttg ccttgtgcac tgatatccca tgccttgata     52980
     gtcttgtcat gggatgcact gtagatgatg ttggaaccag accacttcac acaagaaacg     53040
     gcattggtat gaccactcat tgtcaacaaa cacactcttc tagtgctatc ccacactttg     53100
     acagtgccgt ccttcgacga tgtagctaaa cgaggtttct cgccaggctt aactagatgc     53160
     aatggctccc acgttaaaga tgaaacccac ttggaatggc cagtcaatgc tttccctaat     53220
     ggcttgccag tgtcagtgtc ccataacctt acggtattat ccatagatcc cgtagcaatc     53280
     atagtaccac atggagagta agctacacat aacacccagt tagtatgtcc tgataaagta     53340
     tagagagggg tctgggtgtt acagtcccaa attcgagctg tagaatcacc tgctccagaa     53400
     cacattctgc cactatcatt aggagcaaac tgacaacaca atatagtaga cccatgtcca     53460
     gcaatagcag catttgatct ggtaatagcc ttgaccttga acacagctcg tggggtatac     53520
     actaatgtca agaaatcttc agtagttttt attcctggtt gcaataccga agagtataag     53580
     ttgtccttga tatctaccaa actgcccgtt tcactcttgt catcgatggt cttgtttaat     53640
     aacgcaaatg tatacggcac aggttcatct atatctccgt gtaattggtt caataattct     53700
     tcaagctgct tctccgtgat accaccagga actctaatag acccacctac agattctcca     53760
     gtgtctgaag cctggaattt tatcaatacg ttgggcaaat cgtcaggtat caagttcact     53820
     tcttgaacct tttgtgcctc tttcttttgc ttctttgatg gtgggggtat aacggtagcc     53880
     atagtcacta attgctataa tctgttcaaa ataaactgaa aattacgaaa actgggatat     53940
     ctgaataaat ctagtagttt gaaatttaaa tttccaagat gagaagagtt gatatatgca     54000
     ggttgaaaat agatttgttg tgttgcggta tggatgtttc aagcccatac ttaagctgct     54060
     aagagagttc ctatcatttc gtcttcggac tcttctactt ccagagcatc tgattggttg     54120
     actatattgt cttgttcgtt ttgttcataa tgcagttcgt caataatttc tgtcgaattt     54180
     agattgttga gttgcgagat ttcttcaccg agatcttcaa gtacatttgc attaatgttt     54240
     cttgcacttg gagaagaata gtctgtcgtc tctgattggg ttccattcat tgcagaggtt     54300
     tctaattgca gaaacgtact agtcggttgt tctagactag tgatctcgaa accgttggac     54360
     aagtcgataa gttttccagg cagtaaatct atcagatcat tctcgttatc atcgtcaaga     54420
     tgatatataa tatcgtcgta gtcaaaatag ataggacaat actttgactt tgacaggaag     54480
     ttagttattt taatagcaaa tactgtacga agttgggctt ggttgatgac aactttattc     54540
     tgtttctcaa gtggaggata gcattcagca aagtatggcg aattatggta ccaatcttta     54600
     tagaaaatca accgcataca gaggtatgaa tctatacttt ttgagtttat gtcctctttc     54660
     ttttcttcgt tcagttcaga gtatgatggt accaaaacta ctcttccctt atcttggtat     54720
     gaaactgaag tattgtagaa atccgcatct gacatctgag aggttgtact atatggaatg     54780
     tactttgttt ctagatgtcc aagtaagaag cacatcaggt ttgtcttgta gcagaacttt     54840
     gacatcattg ttaataagct gtttagatga gtgttgaact tcgaaatggc actcattttc     54900
     aacaaatcag actgagcagg tatttctggc acaggtgtct ttgtgccctc taattcgtac     54960
     tgagtctggt tacttttgat gattgaattg acttccaaat gatgcttcaa gattgtttct     55020
     tcgtacgaag acgtctggtc gtgcaaatat atgtctaaag tttggtgaaa atcgttgatg     55080
     atcacaatgg tactaccgtt tatagctggc tctaacgact cataggcaaa tagaccatac     55140
     aacaatgcga aagtatctgg atcatgtagt gcgattcgcg agtcttgtcg ccattcttgc     55200
     tgaaaccgag aatgtgaaaa taataagtgc catggaaacg gtgtcaaagt gtctacaact     55260
     atgactttat tattggggct attagacaaa tgagaaacca tgaattctac cataaccgta     55320
     aaaatcgagc tgcaaccagg tgcacgttgc atgtcatata tgcgtttgtt tggtcgtcga     55380
     gtcgtagcat ggagtatcga gtctagggtc ggtatagccg atttaaggtg tacaaactgg     55440
     ctcagttggc tcataatggt atgaagagat accatcttta atctggaata ggtggaaata     55500
     tggaaaactc gcaaaggaaa atggaaaaaa aatgaaacta atttaaatat gaggaataca     55560
     tctgttgcac actcatcaac gtgagttaga tatgcttttg ctgttctgtt tattagagta     55620
     tacttcagta ttgatggtag aaacgtgaat ctgatataga cttgtatacg gacgtgttca     55680
     gtacggcata cagacaaaat atgtcagcgt gccagtagat tttgcaccta ctacattcat     55740
     ctacgatttg attggattgg accaacagat tcatcaggat ttgaaacaaa agaaatgaat     55800
     actagactat gtattatttc caaatgatga gtcaggagaa agttaagagt atgtgtgttg     55860
     tgtatgttta ttgaagaaaa tcgttttgca caacttcaaa agatgcaaat tattcaccaa     55920
     ttttttaaaa aagtaagaaa cacatcacta aaatatctat caatcttgga ctcacagaac     55980
     actaattagt ctaaatgaat cgttagaaag caagatccat ttttcacttt tatgaggtgc     56040
     aaaagttggt ttttattact cttgtgaccg attgctcgtt tcggaaactt ctacaggatc     56100
     cacattttcg acggcaaaca ttttgatttt aacttggaaa tcttcaaaag agcattcaaa     56160
     taaacctcca aaagctgtta caatacatgt tcataccact ggtagcagaa agcacagtac     56220
     tgtttcaatg gctacagccc acgaacacaa ctatattatc cagttcacga gatcgtggta     56280
     cttgactgaa ctaagtgaca ggaggcctgt gtatagagac cggttttcct ttggactttt     56340
     caggtaaatg gatttgaacc ttgtaaagaa gtacttcgtt atcaaactac tatgagtctt     56400
     cttatatatt tatacagtct tcttacaata tagttctatt gtattcaatt caaacctatc     56460
     gcttctgtgt ggtacgaatc tggtggtaaa tattcaacct gtcggaatac attcaatccg     56520
     aggtcataaa cccttactgt taggaatcct gcattctatt ttacgcaaaa aaaatagcgg     56580
     cacggcacaa atcaatttgc gcttccatcg ttatcaggct ccgcgcttat cgatttggtg     56640
     gagttgatct gacttcctta aacaaatgag ccatatgtag acccaagtat ataaattcat     56700
     ataaatttcc agcatcttaa acaccagttg ctgctcatac ctactcttcg acctctttga     56760
     agaccatttc ccattggttt cctcggaaca cagctatttc tagctcatct cagcacgtga     56820
     cacctgcatg tagaatcttc acttacttta tcatcgatag tctaccacgt caatctacga     56880
     gtttaaaatt agacaccagt tctttgttca gaagcccaaa aaggtggaga cttactttca     56940
     aaagccaata gcttgccgca agcgaactat gacttcggac taactttctc accatgttca     57000
     ccaacctacc ttatctcggc gacactttcc aggtgagtgc gaatcattca ctcatacggc     57060
     ttgctgggat ttcactttct caacgttcac caatatcgca aacgatgcaa atactccaaa     57120
     attcagcaac aaatggcgtt ttacccaccg aaaatagcgg tatttccaat ctaatatctc     57180
     tcgctgtgaa ttctactcat acaatattga tacagaattc cacgagctct tcacattcgt     57240
     atgagcaagc attatccact atatccaagg tctccggaat cctatcattg tcggtttggc     57300
     tctttgcgca attaccgcaa atcatcgaga accatttgaa cgagtcggtc tccggcgttt     57360
     ccttgctttt cttgatttgt tggatcggag gcgacgccac gaacctcata ggctgtatct     57420
     taacacgagc attaccattc caaacttgtc tcgctgcgta ctactgcttc attgattgca     57480
     ttcttagtct ccagtactgg tactacacca aggtatatcc cagacacaaa actcatcaca     57540
     atctcttgca gagtcccaac ttcttgagac cttctacatc caacaaaagc acaaatcata     57600
     gtactcgtag aaaccggttt gaccaggact tgagtcgttc gcccatggag atcagtactt     57660
     ccatcatgga tgtagcacaa ggaaatggac atcgtggtca cgatcagaaa cgaatacatg     57720
     agggctcttt catccacaag atcttgggcg ctaccttcat agccggaagc ttgcccaaac     57780
     aggcacattc catgcccatt cctaatccac agtctgcagc tgttgaagat tcaacttttc     57840
     aatcttggat aggattcgca aaatgctggc tccataagtt ggtgatagtt atactggcaa     57900
     ttcctcttca ttctttcaag ttcagatatt caccagagga tataggtatg atttctgcgt     57960
     ggacctgttc aactttgtat gtttcttcac gagccccgca gattatcaag aatttcaagc     58020
     tcaaatctac acgaggcata actgtgtatc tttttgtgtt tgccatgttg ggtaacatct     58080
     tctataccat ttccatcgtg ctggacttgt atctcctttc gcttaacaaa tcctattttg     58140
     gcgaggacgg agattccaag tttaaggaag tatttatgga tcagttgccc tttattgtag     58200
     gaagttctgg tactgttctc ttcgactcga tcatcatctt tcagtgctgg ttatactcat     58260
     ttaattctgg agactctcgt agatcgtctt gtactagcga gtattatgcg ggccatggcc     58320
     atcatcacca ccgcaaccac agctatggct caatcaacga agatggtcat cgtcctggtc     58380
     acagccataa aagaaacctg tcgaagaaga gaagaagcaa actgagcaag aggaaagttc     58440
     gggagcggtc gagaaatcca gtgacaactt ctctgcctac gcatttccaa cttccagact     58500
     ggtacactaa caccacccct aacttccaga atattgacga aacaacgtca ctcacaggga     58560
     atgagtctgg ctacaatatc aacttggctt caccacctcc ttcgcattac atatcggcat     58620
     ctcaaaatcg tagtattaac ctcgaacata ccatgaacca aggtgtgttg tccaatactt     58680
     tgagtgcaat agcaagatca ttctcgcaaa gtgggtcttt cattggacgt ggcagatctc     58740
     caacctccaa ttctattcat gttggatctt acgggcaatc tcgagctcct ggaattgctg     58800
     ttcctgagtc gtcgcaattg cctacctcgc taattccatc aatcataggc aactattcgt     58860
     cagtgtcgaa gaaaatgtca cacgactcca aaattccttt ttcgccaata gacttcctca     58920
     gtgatgactt cttccggccc cctactggct ctgtgggtca ccacagaact gacagctacg     58980
     atccacagac catgttcttt aatcctcctc ttcacgagga aaacgagctg cacttccagt     59040
     agtctctgca agtgaagatc aacacctaat catatagaca tataaactat gataaatatc     59100
     aaccaccaaa agtcaaccaa tactaaaatg tataactaat agaacactat tgccactatt     59160
     aatctgcgta ttttcaacat gtatgataat atgtatagaa tctactaatg ctataactta     59220
     tgaagtcttt taatccttat ttaccctcca agcactgtta ggcaaactct gtaagtatgt     59280
     agtctttctc tttacccata acaaggtaaa tatgccaatg attacacaga tggtattggt     59340
     atagtaatag ccatcgcgca aaacagtcaa ttttccgccc gacgatttac actgttgtct     59400
     caaatcttcg tctgtgatgt aataggagtt tgtgacagaa ggaactttac attcttcgat     59460
     ggtgagtttg tcaatcaaat atagcaagat taatctgggc caagttccac cgtagttaga     59520
     caacgtattc aacgtagtca tgtaggttcc accgatagct ggatctgcaa tcttggtgtg     59580
     gaaggcacag agtgaaacaa attggatagt cgacataaac gaacctaaca agtgctgcaa     59640
     aatcaccaaa agaaagtaga aagagcttat tttaccgtct tcaggaaaga agtacacaat     59700
     accctgagcc aaagctgctg ctaccaatct tccagcaaag ccaaagatcc acggctttaa     59760
     aggagacttt ccagtagacc aacggccagc ataatagcca aagaccattt cgaaggggaa     59820
     atcgatcaaa acagtgatgg agagatcttc tttagacaat cccttttcaa gtaatttcaa     59880
     gtttgtagca gcttcattta cttggaatcc aaacttggaa atcaataaga taatgacaaa     59940
     tgtctggacg ttgggcaatt tcaacacctt gaacatcgcc aagtagacgt tttgtaagtc     60000
     cttgaactta ctgtctttat tatagacaga ctcggtctta atcttttcgt tggacaactt     60060
     ggcctggttt ctcttagcca aatgaggagg atcttcaggt acaaaccaga gcaaagctgt     60120
     cactgccaaa aacatccacc cccagaaagt caaatacagc cccaaggaaa acaagcctac     60180
     atctaaaggt acctttctga ggtatctgtt agcgaaatca ggcgaactga gagccaagaa     60240
     aatcgtgaag gacgagaagt agcccgtatt gattccaata gtctgagccg tggaagcata     60300
     cgaaaggctc tctggtgaca agcaggtgag tgcccagccg tcgacggcga tatcttgagt     60360
     ggcacagaag aaaactagca tgaagaaaca aaaagttata gtaggcaagc agttctgggg     60420
     atcttccatc aagccatcga tcaacagtcc taagtagatc aaggttacac ctgaaatcgt     60480
     ctggataggg atgatccacg aacgtctacg accgagtttg ggcgaataca cggcatcaac     60540
     gataggggac catatcaact tgagtgagta tggatatgct gctagcgaaa agattccaac     60600
     ttgtgagtac gacaatttca gcttgaggat aaacggtata gagccaaatg ccaaacctac     60660
     aggcacaccc tggagcaagt agaggagcac caatacgaaa aacgccggtc tgtctacctt     60720
     gagcaaactg gcagacttgg tggaactcgg gagactggtg tttttcggtg caaaggtaga     60780
     gttcttggag gtgctggcct ctttatgctt attagtgaga tcctggagag aaatagggag     60840
     aagcccgtcg ttctcctcgt cgaacgcggc atggacgtag ttcaattggt tatcaagtga     60900
     ggacgccgtc attgacacat caacagaatg acccctcttg tggatttgag acatttcgtc     60960
     gatctaaata gggccctttc ggaaactagt tattggagaa tgtagtgaca cttgttaggg     61020
     ccaggtatgt ttttttttct cgcggaatct gagccgcacc gcggtgtgag agttgtgttc     61080
     tgaagtgcgc tagcgcaaac tgagaaacgt cgtaagagag tttgacatat tattagatct     61140
     tgtatattct tcgcagcatg tgaaacctta taagtgctgt acaatttgca agttaagtac     61200
     aacaaatgct atataaaata tgtcacttga gcatatatcc gtaaagtatg cttcaatcct     61260
     catttagtca ttatgatgac aataacacat tcattctagc tataatcttc tatcatacat     61320
     aagaattact gccataagaa ttactgctat attgcaagtt ctctacttct ccattttaaa     61380
     gctcacatta atatctacaa ttcatcatat agtacatatc cagatatcat ttagtatcat     61440
     tactaaaggt tacaacttat ggttatctga tatactatca tttctcttca ttatttctta     61500
     tatcatctac ctattacttg ccttctctac gtcactttac tatctccttt tcctattcgt     61560
     atatacatag atagtctacg aacactctaa gaggtgtgat ctataatgtg catgtcgtgt     61620
     tccgcttaca aagataacac ctttttggcg gctctgatta cggtaggttc gtctgggaaa     61680
     gcaaagtctt ccaattcctt agcatatgga gttggaactt cgcaaccagt gactctttcg     61740
     actggagcat ccaagtaatc aaaagcctcg gattccatga tctgggcaca gatttcagaa     61800
     ccaacaccaa aggctgggaa tccggcttca acagtgacca agtggttagt cttcttgact     61860
     gactcaacaa tggtaggaac atccaaaggc ttgatggatc tcaagttgat gacttcggcc     61920
     ttgacgccgt attccttctc caaggtttca gcggcttcca tacagaactt gacagatctg     61980
     gaatgcgata caaatgtcaa gtcagttcct tctctttcga cattggcctt gccgataggc     62040
     aaaacaaagt ctgtggagag agcttcctcg gagatatcga aggtttcacc gtaggcgatt     62100
     tcgttttcca aaaacacaac tgggttaggg tctctgatgg cagccttgat caaacccttg     62160
     tagtcctcgg cagagtaggg cgaaacaacc ttcaaaccag gaatagatcc ataccatgca     62220
     gcgtaacatt gcgaatgttg agcaccgaca ccggcagcag caccattggg accacggaag     62280
     gtgatgttac acggttgttt acctccggac atgtaatagg tcttagcggc agagttaacg     62340
     atttgatcga tagcttgcat agcgaagttg aaggtcatga actccaacac aggcttcaaa     62400
     ccatgaaggg cagctccaac agccaaacca gtgaaaccca tttcagtgat aggggtatca     62460
     atcacacgtc tttcaccaaa acgatccaac aaaccacgtg acaccttgta ggcaccgttg     62520
     tattgggcca cttcttcacc catgaggaag acatcgtcgt ccttgtccaa ctcctcggca     62580
     agcccggcat taagggcgtc tctgacggtg atggtctttg agcctacagc cgacgacgaa     62640
     gcggcacgcg aatccatcat tctcaatgcc tggtactggc cagcttgggc tacggatctg     62700
     gtagtgtttc cagtcacatt ggcgatgttg tgggctctag tggccgaagc ggccaagcgg     62760
     gccgtctggg cgatctggga taacttggga gccattggaa tctgacgtgt aagatgtggg     62820
     agaaaaacgt acaaggtaga atggctctgg atatttcaat tatttaaaca aagatgtgct     62880
     cacggacaga tgaggaccgg gtctggtgca cgacccggag gtgcacttcc atcgaatacc     62940
     gagtgcgaat tagagttggt atattgaata tatggtgaat agagcatctg tacgaggtca     63000
     gactgaggtt gaatgttgga gtatatatga ttggagaatg gtgtagtttg tctctgtcta     63060
     ctttatagag attacaattt tgttgatagt atttctttga aacatctgtc tgtgtagctt     63120
     agttttcaga acagttcatt acaaggaata tgtcaatgat gaacaagttc cagttccata     63180
     ccaagcgatt gtatcgttgc aatatccttg cttggatgat tctgccaatt tcgtcatact     63240
     taactgttgc gttttctcta aatcaatttg gtcttcttct tatcaatttc aaaatttcgc     63300
     agcctaatta attgcgaaaa cggaaatcaa gcaacaactg cggatatact ctgaagtaca     63360
     atccaccgtt catatttcta gtgataaatc tgctaagtat gtagcatgta acgtctaagt     63420
     ttatctctga cttttcacac ttttcatact tcgcagactt tccagatttt ccagatattt     63480
     caggatgttc accttcactt ttcacatttc tttaacaaaa tcttgcacca ttgctgttca     63540
     gctaaagcca tacaaacttg gcattcaaac ttggtacaca catatgtcaa caactttgtt     63600
     ttcgcttgaa tcgtccatct ataccacagt ttatcctcat atgtcttgtt ctatcttctt     63660
     atcttagatt cccgatgtgt cccggaaggt cgcggaaaat ctcggtggtt tctggctcac     63720
     acccaccaca aaacgagagc ccaaaacaga ccggaagttg cacaacattt tgccagttgc     63780
     acccacagac tcagctgccc cctctttaaa caacttctgt tgggagctac gagagaaaga     63840
     cagattctaa agataaccac atgctcatat taattagatc tccaacattt gggaaagctt     63900
     gagctttgtg tagaaaagtt caccagaagc caagttcagc attgttggtc tgaatcggct     63960
     ccatctagga atcgtcccta gatacgctcg ggcaatacga acctttcgat gacttcggtc     64020
     atgtgctcac tcacattatt gtccggaatt tggttatttt atatgcatgg cgcacatgac     64080
     tctcgcccat caaccatcca gaaccgtaac agaacccctc ccccgcccgg aaccacctct     64140
     atttcagtct caatcacctt tggctgtacg ataattggtt atatatagcc aggaaacctc     64200
     tcgtatcgtc ttattctatc ctccgggttt ctcttgtttt ccttgtacaa ttgcctggcc     64260
     tcttctgcga ccttctagaa tagttctcct agcgtgcttt gtccatatag catcttagct     64320
     ctttctagca ctatctggat ccaatatttt tcgctgaaaa attagccttt ccaccaaata     64380
     ctccccatca ccacattatt tatcaccagt cactactgct gcccaagttt tcatcagtat     64440
     tgtgtgctga tattgatacc aattgtctat ttattctact aattccatca ttgaaccaaa     64500
     ttgttcaaca tttccactgc tagtattcat taattcaaga tgttcaaagt ggctagaatt     64560
     cccagagtct cagcaaggct cttacccaag tgcaactcca tttcggtgct tcgcttcaac     64620
     tccaaccaaa ccaatttcca tcgtccagac aaggctggtt ctgaggacgc gactgaggct     64680
     gctgatgctg ctgctacgct tttagcagaa ttgagagaca agcagaccaa cccaaacaaa     64740
     gcctcatggc tagaagcctt gagagaacgc gaaaaacaga aagctgaagg taagatatta     64800
     gacagttaca gctatgtaac tcctgtgacc actgagatcg gcgaaaagac cagaggagac     64860
     tcgttcactt acttgacatt accttttaag gacgacaagt ggctttgcga tgcttatatc     64920
     aacgcctttg gaagattgag agctggtcag ttgttccagg acttggatgc tttggccggg     64980
     agaattgctt acagacactg ttctcctgca gaacctgtta atgttactgc ttcggtcgat     65040
     agaatttaca tggtgaaaaa ggtagatgaa atcaacaact acaacttcgt tttggctggt     65100
     tccgtttcat ggactggaag atcgtctatg gaaatcagcg taagagggta tgcttttgaa     65160
     gactccatcc cggaaacgat caccgaagaa acattacccc aggagaacat cttcttgact     65220
     gccaacttca cgtttgtagc tcgtaatcct attactcata agtcatttgc tatcaacaga     65280
     ctcttgcccg tttctgaaaa ggaatggatg gactatagac gtgctgagtc gcacaatgct     65340
     aagaagaagt ttgctgccaa gaatgctaaa gtccttgagc ctactgatga agaatccaga     65400
     ttgatctacg atatgtggag ttcatcccag gctttaaaga gtgcagatgg ccctccacaa     65460
     acaggcgtgg cattcatgaa agacaccaaa gtcagttcga ctctcttcat gcaaccccag     65520
     tacagaaata gacactcgta tatgattttt ggtggctact tgttgagaca aactttcgag     65580
     ttggcttatt gtgctgccgc tgattttgct tctgctggtc ccagattcgt ttctttggac     65640
     tccaccacct tcaaggcacc agttcctgta ggctctgtag tttctatgga tgcttctgtc     65700
     tcctatacgg aacatatcca caagggtcct tctgacattg atgccgattc tcctttcaac     65760
     tttaaattgc cagctacaaa caagctttca tccaatcctg aggctttctt gtctgagcca     65820
     ggaacgttga tccaagttaa agtggatacc aagatcaagc ttttggactc tagttctaag     65880
     gaatcaggta ctttcatcta ctcattcttc gtgcccaagt ctagctacaa gggtaaacca     65940
     ggatactctt ctgtcattcc ccagacttat tctgaaatga tgacatacat tgccggtaga     66000
     agaagagctc aggacacggc taatttcgtc gacaccttac ctaagtaact tttaaattta     66060
     tagaactcca attaatacaa ggctacatgg tactcttcta ctatatttgt agtggagatt     66120
     atggtgtttt acaatgaact atgtctgctt caaaatctta acaaaatctg cagaacgaat     66180
     ccactgatta ccaaaaatct gccttgcagt atctacacca tatgaatcgc taacttttat     66240
     tatagtacat aagtgtaaag attgacaatt agttgtaacg attggctgcg aaaaatgaga     66300
     acgtaattaa agtacagaga agtaaagaac gaaatcaagc ttttcttccg gataaatgca     66360
     aagtgattga cctaatcaat cagggctagt cgctgtcatt gctgtgaacc tgcgctgact     66420
     cctcatggaa tttgatatca ggttcatacg atgactctct caaactgccc tttctggtga     66480
     agttaaccaa tttcgccttg ctagtgcgcg atctggaacg cttggggatc tgaggactac     66540
     catcgtggtt gagcaacatc tgatcagagt tgccagattc tatcgaaatg gtagataaat     66600
     tggagtgtct catgggcaac gtcttagttg caatagccaa gtcatcatga ctcaagttga     66660
     agttcgatgc agtcttgtgc atcaagtcgg tattatcttc actgctgcgg tcagtacggt     66720
     cagacagcca ctggaagtct ccgttagaag tcttgacagc cttgaattca tcaaggtacg     66780
     cagagtcttc atgttggtat tgcgataaat ctctttcgct tcctgaagga gactcgttga     66840
     acttagacaa caaattcgat atacttgact ccgagaaatc gtgcctgctt gtgtggctgt     66900
     tgctattatt actattggtg ctgtggtctg cactgagata aacggtcgag gtatccgttg     66960
     catttctcac agagttggtg tactccctgg agttttcttc agggagaata gcaagaatcg     67020
     agcctgattt ggggaccgtc ttccagggac taggcgttga tgcattgctg gaggttgcag     67080
     agtcaacgat gtttccatca ctgtccaatc tttggagatt ggtagaagag tctcttctca     67140
     tgacttcatg caaggaagtg ctacttaaaa gttgacgggc gacaaaagaa gattgctgag     67200
     agtttctggc tgactggtcg tccacaagtc ttactgagaa caactgttct gtgttgactg     67260
     tgctcaagga aacttctgaa tttctattct gcttgtcgtc agaattgtct cttgctctcc     67320
     atgacttgac tggtaactcg atggcatcta catatctagc agcagagccg ttggattcca     67380
     catgggtgat ggaagatgaa gtactgtgga tgtcgtcgtc gtagtcgtaa ggtttggtat     67440
     tgtccaactt tctggcatta gcagcagcca actttctacc tttctgggaa tcgttgtcgt     67500
     aggtgttgcc gaagcctggg ccggtcaatt cgggaacagc agcatccttt tccatgtcct     67560
     ttcttgggtc ttgctttctt tcttttcttc tcttgataca gcagcagaag agaatgaggg     67620
     cagcgacaag aagcaagaag gcaggaatac ccactccaag accaattgca agtgccttgt     67680
     ggttcgtgga agccttggac tttacaggag tagaagagga agagggagag gaagttggag     67740
     aagaggagct agaagaagtc gcggtagcgg aagaggaaga ggaagtggag gatgtcttgc     67800
     tgtcgattcc aacaatgtca aagctcttat cttccagatc gtaatcggaa gaagcagaca     67860
     catcgacatt gatcttctgc aaatccttgg ggacttgacc ggtgaaggta ttgttatctt     67920
     catggaaagt aagccagctg ttggaagagt cgaacttgac agagacgtcg gtcaggttga     67980
     aatcagtgaa gtatgagttc atcaagtggt attcaaagaa ctgtccacgg gtagcattga     68040
     cgttggggag agtgctgaga gtgaacactg agccaatggc gttgaaagag taaggcaatt     68100
     caacctcgtt ctggaacacg tctttgacgt ttatggtgaa gttgtcaaaa gtagcatccc     68160
     cagggaagtt acctgtcaaa gtgtaatggt cggtgtcaag atgaatccaa gagggtaagt     68220
     cggttgaatc aacagaggag atgttttcgg ccgagataag tgatccgtcc aagaaaacag     68280
     aagagaagat tggaatcagg atgtcgaagt cgtgattcaa agtaccattg accttgattg     68340
     actcattcaa cgaagtgctc aacagatggg ctccaacaat caacttgaag ataccttcag     68400
     ctccagcaaa tcctacatag tcggagccaa tgaagctgaa gccatactca aacgaaggag     68460
     caatatctga aacaacgtga ggaactattc ctgagaatgt taagctgtcg gagtcgaaat     68520
     cgatccagtt tggcaaggag cttctgtccg ctgacctacc atagtaggca acgataggtc     68580
     ttttggatgt tgagtaagat tcgaaaaccg acttttcgaa gctgatgttg aactcctggc     68640
     cctctctgac aaccaagccg tcattaccgt tggtgtctcc gtatttggca atttcagtaa     68700
     acatgacatc attagaggat aagtgtaagc ctgtatcgtt ggaaactatc atagagtagg     68760
     tgttgttgat agtagaaccg tctgacgagt cagttccgaa caaatggatt tcaaactctt     68820
     gcacgtcgtc cttggaggga gttccggtga atgttctgga gtcagagtca aagctcaacc     68880
     acagaggaag ccctgtggcc tggtacgaga ttacgccgaa gttatcggat ttgtaggtga     68940
     tattggccat ggtaaaggag taggccgtgt caatacgggc gacattaggc aactgttcgt     69000
     tgaaggggaa ccccacttcg atctgtgccg aggctatcgc catcaagaaa accaagatga     69060
     atagcattgt ggatggctag tgaaataaat gaaactcgtc tggaaaaaaa gattaggtga     69120
     gacttaagct ggtgggatga gggagtagta atggatagca aggtgttgct tgtgaatagt     69180
     gtgaagtcac ttggaaaggg agtgaaattg tgaaaggaat ggctgaagaa gaaagaagag     69240
     tgaaaagacg attggaagat gttgataaaa tcgctggcct cacaaacgag aaatccccta     69300
     gttattatgg caaggctagc aaggggctgt atgataaaac aaggtacggt aataattgca     69360
     acgcatctgg gacaacaatg agaaacgaaa cagaacgcat cctggcacct gcagtcttta     69420
     catgataagg aggtgagctg cgtgtgattt tgactatatt cgtcacggtg gacacgccaa     69480
     aggtggaatt aaggaagaga ctgaaaaaag tagggagtat ttgtttacca aacgcgtgaa     69540
     acaaatgtaa agatacgcga ttcgcgtcgt ctaacctgtg tacagactct aaatagaaaa     69600
     gaagaatggg tgcgtacagg agctgcagta cgcatgcact actgagaagt ttattcctgg     69660
     aacccaccaa aagtctccta cacttatctg ctaccgtctt agaagtacac tccaaccaga     69720
     cgacgtttct gtgttgtttc gtctcgtcta ttttcacagt tttagttgca atttacagtt     69780
     taatttccaa aggcaacttc acccaatcac cttagtgatg gtagcggaca gatagacatt     69840
     ggctttcctt ttagttacac caattgcaac tgtatcatgc cttaatcgtc tggaccaaag     69900
     gcaccttgcc taaatgccaa ttatgagcaa gggacggaac acaactgaaa agaaacaaac     69960
     accctgtcct cgtatttgtc taacctcgag ttttagtcgg aactttagag ctggttttag     70020
     tcgtgagttt tagtcgtgat tgaggcatcg caaaaattgc aaggtgaaac tacaccactt     70080
     ccaaaattgc tttggcccat tgccgcaatc ctcattcctg tttgggaaga cgtcaaagac     70140
     cctgaactcg atctgtctat ggggatactc gatctgtcta gggcgatact tgattcagag     70200
     gacccttgct cgcatgccga ggcagctgta gaaggctcgt agaattgtag tccataattt     70260
     tattggatca tatgatatca aatgctcgtc tgattgcacg ataacatgac ttattgaaca     70320
     gcgtatcatt ctactgtatt agtgaacatt ttcaattgtg atatgattgt gctacatgac     70380
     aatatgaacg aaacaacagg catgtatgct gcagcataat tacgaaacca tgtatatgca     70440
     aaagatatga atggactact tagctctatg gatgtactaa gaaactccaa aactataatg     70500
     tgtgagtttc tgtgggatta tataatcatc caaatgctca tacgattata tggttatata     70560
     attatttgtc tattataatc tgtactgtat tacagctcac tgctgcttct gcttctctac     70620
     aatccgtggc acatagtaaa ttcccactac gccaatgtac ccaaacacca accctaccaa     70680
     cttctcacca agcgaatgga agtagatgtt ggtcatgagc aacatgaacc accataatgt     70740
     gatcaactta gcgacaacaa tcggtggatt tgcaaccaga tattttataa agctactgaa     70800
     tttttcacct aaactcacag gcttaacaac ctctttacga agcttagaca acgaagcctt     70860
     gaaatgagaa taagacaccc aatatggaga cacctccaaa aacaaataga gcgaagaatg     70920
     aatcaaaagg aatacatgtc ccgagggatc gtgtcctcct tcccaggatc ccttgatcct     70980
     tcggcaatga taggaagtaa tagaagttga actcaacttg ttgccaacct cttcgcctgc     71040
     tgcttcgaaa agatggagaa aacggctctg accaggatga gtctctttct ctatcacaca     71100
     actaccgcct gtatatacaa ataccttatc catgatgggc aagccaaaaa accactgggt     71160
     aaaaaagatc caccacactg tggccaacac gtatctgatt actgcaccct tggctatatt     71220
     aattctaatg gcactgctct tttctttata caacactatc ccgtagaata ggacaatgtt     71280
     ggctgtggtc cagaaccagc cgtttttcac aaacacctgg ttgagcacgt tcttcttatt     71340
     cgtgtagtag ttgtacactt cttcatctgg tgacaacgaa tgtactattt ttcctattac     71400
     aaagttcact aaaaatgaga tcacgaacaa aaactcagat ggactcattt tgaaacgctg     71460
     ctggatctgg cggaaaaaca tctcgatgaa tcggaaatga cggtcgtata cggaagacac     71520
     ctccgacggc ataatgactc cggattgagc gaatgacgaa tacaaagaca gtttggatat     71580
     agtattgaaa tctggagaag tgcactttta agtaggtggc caaacggggt cgtgctttgt     71640
     ccagttatct tctgtagaat gttctatctg aaaagtatag tatacaaact ctacggttgc     71700
     aaaatgtttc caatggccac tacgtaagtc ttataataaa ccttgaatcc ctatgatctt     71760
     agtgtattat tactgtgtta ttgttatgct attaatttat atcagacatc gtgattcgta     71820
     actcatagtg tgatgtctag tcgacgaata catgcccaat aagttgtacc accaagaata     71880
     tgacaatgtc tacgtcacat ttgctagtac aaagtgaata tacaatctgc tccaaataaa     71940
     ttttgtctct tattggtaat gcattttatt gaaaacttca aaatgcaagc tggaatcgct     72000
     agaatttgtt gtagagtcgt tattattcca tctttccttg gaggcttgat aatattctct     72060
     agtggtgata cagtcgtgac tgaactctga ttctacaact attcaaaagc aagaaagtgc     72120
     tatgaaggtg tttgcttgaa accagagcag tcagcgagtc ttttgaagta tctatgtcat     72180
     gattcatctc cttcaccagc ataggatgta tactaatgta tttcttcaaa tatggatcat     72240
     caagttgcca caacttcacc attactgtta ccattactgt taccgttact gttgctgtta     72300
     ttgttattgg tggtggcttc ttccgtagaa ctggcagctg cagtaacgtc gttattctgc     72360
     catctttgca ccatatcatt cataagacta ttcatgaagt caggattgac gatattgcta     72420
     cggaattgct catcttgaag aagcgttagt atgtgcaagc agtttggata taccaagtat     72480
     cgagcgtatt gcggttcctt ccaatagtta agatacttta tgtagttgat gaagttttca     72540
     tcgttcaaat aaccctgttg tgctaaatga tttaagtact ggatgttgct gagcgactga     72600
     acaaactcga gctctatttc ccatctcgtg ggcactgacg agatcaaggt attgacatcg     72660
     ccgttggaac tttcggttgg ggctgtagct tctgtagaca tttttattat gaactttttg     72720
     gagatttaga gtcttggtaa aacgaatttt gaaacatatg ctatagtcag cttttgttac     72780
     agagatttcc gagtctacga caattgaatt caccaaaacc ttttatattt tatatgaagt     72840
     atactgagaa tgttgcagaa ttttactaat tgaattggaa ttggaattgt cgatatacct     72900
     gtggatatgt cgtaaaatgt cgcattttag ctatcagttc taaatctcgc gacattgtaa     72960
     ataaatgaat atacaaacaa taataaagca tttatcgact cagctcaatt ttattcaaat     73020
     aaacaaatta taatggcaga cactatggaa tcgggcacaa ctccgacagg atcaacgcgt     73080
     caggtcgcgc tagaaagaga actagcacaa ctaataagga taaattctac tgtagctaat     73140
     ctcattgaaa ccatcaaata tactcattcc aatatagcga agatcaacga atctggaaat     73200
     agcacacata cattgcttga ccaatgggtg cggatacttt cacagacaaa tttcactcat     73260
     gatatcatca acgaccgtac ttggaacgga aaagaagatc aggaattgga agaagaggat     73320
     gacgatttgg cacagaaaga aatcttggag caacaacttt tgaaccaatt gtccaaactt     73380
     gaagctgaaa actctgaatt aagcacaaag atagaaacga aggaacaaga acacgaacaa     73440
     gcacgtcaga gacgtaatga cattctagta cagaggaaga gagagttggg gttgtatact     73500
     gtatctggca gagatgctac caaaagaaga agatagacat cttgattgta ttatagagaa     73560
     tttcacatga aagttattac atctaatata tctgttactg acagttactg gtattgaaaa     73620
     tcagggtgat gtcactggtg actacaacga tcttgaacta ccattaattc ataataaagc     73680
     tatatggaaa tataacaaaa ataagtaaca gataatatac taataataaa caaagatgta     73740
     gaactaaacg taataagtgg acgaagatac ttttctcttt tcataatgtc cttaacgatc     73800
     cacaaatcta gttgtgtttg agaatgctgg tgattaagtc gctggcatca acagattcac     73860
     cttctttgat caagatttct ccgacaacac cagaaacagg ggcagaaatc accatttcca     73920
     tcttcatggc ggacaacact gcgatagggt ctcccttttt gacatccgtt ccagactggg     73980
     ttctgatttc aatgacgaca ccagccattg gggcaccaac ttcgtttggc tgagtagcct     74040
     tacgtctggt gatggtctcg acagaaacag tcttgtcgtc tacagtgaca gaacgcattt     74100
     caccgttcaa ttcaaagaac acttctctgg tacccttctg ttgactgatc tcaccaacag     74160
     ccaacaattt cacgatcaaa gtcttacctt gttctatttc gacactcaac tcttcaccaa     74220
     cattgatacc cttgaggaag taacgtgttg gcaaaacaga taagtcaccg tacttttcaa     74280
     cgatcttacg gtatgactcg tagaccttag ggtacatagt gtaagaggcc aagtcgactt     74340
     ccttaatgga attgccgtac ttagaaacta actcctgctt gagcgcagag aagtcaactg     74400
     gagccaacga aagacccggt ctttcgttca atttctgtct cttgttgcct aacatattgg     74460
     ttctcaaagg ttctgggaat cctccgtatg gagtacccat caaaccttcc atgaagtcaa     74520
     gcactgagtc agggaaatcc aactcaccag ccaacttgtt gacgtcttct tcagtcaagt     74580
     tgtttgaaac catgaattga gctaagtccc caacgacctt ggaggtagga gtgaccttga     74640
     caacgtctcc caataccctg ttggcaatct tgtatgtctc ctttgtctgc aaccacttag     74700
     caccaagacc caattgttgg gcctggaaca acaagttggt caattgacca ccagggattt     74760
     cgtgctcgta cacttcgggg tcaggtccct tcaagtcggc ttcgaaacac gagtagagca     74820
     atctcatctg ggcccaatag tggtcaattt ctctgaccaa acgctcagac aatccggtct     74880
     caacctcacc ttcaaacgaa gccaagatgg cactgataga aggctgagaa gtcataccag     74940
     acatcgagtt ggaagcagca tcaaccacat cagcaccagc cttagcagca gcagtcatag     75000
     aggcgacacc agttccagca gagtcgtgag tatgaacatg aataggtaag tcagggtact     75060
     tggctctgat cgcactgact aaatcagtag cagccttagg cttcaaagta ccggccatat     75120
     ccttgatacc caagaagtgc gtacccatag caacaatctt gtcaacgaca tcgacatagt     75180
     aggccaaatt gtacttcttg cctttctgca acatgtcacc ggagtaacag acagtggctt     75240
     caactacacc gccagccttc ttcaccgcat caataccaac cttcaactgg tccaagtcgt     75300
     tcaaggcatc aaaaactctg aagatgtcga caccgttgtc ctttgcctgt ttgacgaatt     75360
     ggtcaatagc gttgtctggc aaagaagagt aagcaacacc gttggctcct cttaacaaca     75420
     tctggaaggg gatgttagga accaatttac gcaactttct caatcttgcc caagggtctt     75480
     cgtagaggaa tctcatgcac acgtcgaaag tagcaccacc ccagcattcc aacgagaatg     75540
     caccgttaag cgcatgggct gtagtaggtg caatgttcaa caaatcgatg gttctgagtc     75600
     tggtagccaa caatgactgg tgggcatctc tccaagtagt gtcggtgatc aaggtaccat     75660
     tgaaattacg aaccttctta gcaaaggcat ctggtccctc ttccaaaaga acctgtctcc     75720
     agcctcttgg tgcggggttg agttcgacgt caataggaat tccggttttt ggatcgtgga     75780
     tcgtagggat ctcagcttct tcgttcaact ttggaagacc aacttgacct ttgatggaag     75840
     aaccattgac aatcaagtca gccaaatagc tcaagatctt gttggctctg ttttgagagg     75900
     agatcatctg gaaaagggaa ggagtatcat caataaaagt cgtccaacag ctaccgctaa     75960
     taaacgtctc gttggtcaaa agagccaaca aaaatggaat gttggttttg acacctctga     76020
     ttctgaattc aatcaatgca cgcaacatct ttcttctggc gatctcgtag gtggaaccag     76080
     aagtagaaca cttcaccaac atcgagtcgt aatgaggact gataatggaa ccagcaaacc     76140
     cgttaccacc gtccaatctc acaccgttac caccagaaga tctgtacact tcgatcttac     76200
     cggtgtctgg ctggaagttc ttggatgggt cttcggtagt gattctacac tggatagcaa     76260
     aaccacgcgt ggtgatcttg tcttgcaaga gacccaactg ttgcaacgag gcacctgcag     76320
     caatctggat ttgggcagct acgatatcaa ctccagtgat ttcttcagtg attgtatgtt     76380
     caacctggat tctagggttg atttcaatga aatagtgtct gttttgttca tctacaagga     76440
     actcggccgt accagcgttt ctgtagttgg ccgacttggc caatttgacg gcgtcggtca     76500
     agatagcgtc tctaacagcc ttgggcaagt tcttggctgg ggcaatttcg accaccttct     76560
     ggtgtcttct ttgcacggaa cagtctcttt caaagagatg gatgacgttg ccgtatccgt     76620
     cagccaacaa ttgcacttcg atatgtttgg gtttgtctaa gaatctctca atgaaacacg     76680
     taccattacc aaaagcagtc ttggcttcgg aagtggctct cttgaaggca tcgccgatgt     76740
     catcgccttc tctgacgact ctcatacctc taccaccacc accaaaggca gctttgatga     76800
     taacaggata gccgtacttc tccacaaagg cttcagcttc ttctacagag tcaattggcc     76860
     ctggggtacc tgggacaact gggacatcgt tggccaaagc taagtttcta gcagaaacct     76920
     tgtcaccaac agcatcgatg gtttcgtgtg taggtccaat ccaggcaata ccagcttcct     76980
     cgacctttct ggcaaactca gagttttccg aaagaaaccc gtacccaggg tgaatcatgt     77040
     tgacgttgtg ggtctttgca atcttgataa tttcgtcgat ttgcaagtag gcaccaacgg     77100
     gagagaattc tcccttctta ccgataacat aagattcatc agctttaaga cggtgcatcg     77160
     acaaacgatc ttcatgtgag tagatggcta cggtctgcat tgacaattcg tgagcagttc     77220
     tgaagattct gatggggatt tctccacggt tagccaccaa gatcttgttc attgggccca     77280
     acacagtgga gtctcttctc atctggttga tcttgccatg gtggtcgtga ggagaaaggg     77340
     acgacatggt aattgagtaa gacaagagaa gacagggaaa gatgaagaag aaaagaaaga     77400
     aattagactg aaaaactgaa gttgttccag ggaaaaaatc agcgagtcaa ttcgagtata     77460
     tataggttca gcgcaatgag tgagaggcta ctttccaccg aagagataat aaaaattggt     77520
     atattcaata ataatattaa tcctaatcct gatgtggaaa agcgacacaa acaggaacga     77580
     aaaattactt accgagctcc atgtacctcc tcttcatctt gacttgccca ctccagccaa     77640
     ttccaacaat gagacaagcc tgtagcacaa tgatgctgat ccaccgcccg ctaataatga     77700
     aatgcctccc aatccagact tgtgcttgaa aataaacacc ctacgcttgg aaacatcatc     77760
     cacccgaaaa gtcaatgagt caggggcgtt cggagttggc ttccagcggt ggaattgaac     77820
     caccggagta tgtatatggt cgacgtactg cagaattagc tcaagtagca ataattttgt     77880
     ctcggtacgt tagctaatca caatcaatca attaattagc tgaagcagcg attcatcaat     77940
     tgcccattgg cactaattct ggtcttcgtg atttttcgcc ttagactcct gggttacagt     78000
     atctccaatt aatttgtatt ttgtccacca tactttcttg taatctcttg tagagattaa     78060
     ttctatattt taattttttc caggcttaac tctgctcctc tacatttcta tgagtccatc     78120
     ttaattaaat gttctaatct acgttcaaaa tattactacc tccattgttg gctttggagt     78180
     ggaaacgttt tgttatggtc ttgagtcacc cagaaagaca caaaacaaac tccgagtagg     78240
     ttcttacatc attgcatgta catatgactg gagaaatgaa aatttttcat gctggtacaa     78300
     tgtaactata gtagaatatg ccgttgattt acgattctgc tactgcctgc gttctaacta     78360
     gaatggccta atttttttta cttgcaagaa aactccatct ttgctacata ggttaggtgc     78420
     ttcccagaag gctttaattt accagttgct tgatcgattt tttttcttga ttttcgcaaa     78480
     aaccaattca cattctagta gtcttcaatt ctactctgat ttaattaggt accttaaggt     78540
     ccactattac tctgctgata acgatagtta tctatgaaat agtcgtagtc aaacctgcat     78600
     gggttcttat ccccctcctt aattaaatga aagagcatat gacttgatcc aagatgaaaa     78660
     attagttact gttgcacagg aattagttca gagaattata ttacatcggt ttctactgct     78720
     ctttaccacc acgtacaaag aagatgctaa atgacaaaat tccaccttgg ccaacaatgc     78780
     aattggaccg gtgtcatgtg ctccgtcgct tctaacctac tcttggatgc ccatctcacg     78840
     tgagctagta ccacaccacc tcttaatctc gtgaaagaca gagttacacg agcgggccgg     78900
     ttatatatat agagggtagt acgcctgcac gtattcttgc cagcttctta gtggaccaag     78960
     ataacttcat ctccctctat gtgaaggatt aatagatagc aagaggatgc ccatttccga     79020
     taccaccgga cttctatcgc cggtgcatct tcaacagtcc ccctcctctg agtctgaagt     79080
     gagtcagtat tgaccttcta gcgcacctaa tagcggaacc gttcctatat tagggttaaa     79140
     ccccttttat tccagagggg agttgcaaat tgagctcttg gatggaagga tcagtgagct     79200
     tttgccattg agccacgaca ttcccctcct tggatcataa ctccacgttc gatcgataga     79260
     ttagatgtag ccgataacgc tatcatcgta agatatcccg aaatttgtta ctccttaggt     79320
     ccctgtctta gtaatcgtaa gtttgtaatc tactgtggat atggtgaatt ttttttcact     79380
     cgctaaaact tttttcattg gggttgaatt tttcactcta taaatctgac actatccccc     79440
     tacttctgca acttgttgtc tgctttgtct gtaacagctt taccagcttc aatagttaat     79500
     atcataacaa tgtacttccg tagaaccttg acttccctca gtgccttgcg cttccaaaag     79560
     gaaagtgctg tgcagttcat taagtcttct tccaccaaga ctgtcactgt cccatcttct     79620
     atcaacccag tttccaagtg gcagcctacc cacggcaact cattcagatc ttttgctgaa     79680
     tacagagtca agattgtcaa cctttcccca ttggagatca agtctggaaa ctacatttct     79740
     accaggaccc agtaagtgat cacgtgagtc gttagtataa tagatagcaa gactacaact     79800
     actacataat gatggtacat aaaaggaaat taaacatagg cttatgaggg atcttttttt     79860
     attggcaatt agtatataca taatggtgac aacaacagtg gcaccttttc aattctcaat     79920
     cgttcggttt tgcgagtttc gcttttcggt ctttgcattc tgatattcgc aatacactga     79980
     aaatctggca taatcggctg gacgggtcca tatttctccg accgaccgac gatacttttg     80040
     taacattttt ttaatttagt tcaataaact taataactac taccctgtgg aatgtaggct     80100
     acttcggcgt aatgttaatg gtgtctgaag tcagaatttg caggtcttcc ctgtacaccg     80160
     attaatttag ttcaactgtg gtggtacgag cttcactgcc caagatcaga tcaagaacag     80220
     ggggtcatac ttacgaagca atttgaagaa atgagcctcg tgggccattg accaaataga     80280
     taactatttt tccgtgccag gtacgaaagg aaatgtcttg taattcaatt ctagatcgaa     80340
     gacttctgtg caaatgtgta gaatctggat taattgtggg ggacaggagt ttttttgaat     80400
     aggaaggtgt agagtgaact atattctact gattgaaaaa aaaaaatatt gcagcctact     80460
     atcatcaact aagccccata gatcttaaca gcaaatactt gaaagcttga ataaaataaa     80520
     aaaacttaaa ttgctaaaaa atagcttatt ataactaatc aatctagact agcttaaatt     80580
     accgaaatca gaatgaatat tcgtgtgaga atgaaaaaaa agtcaattac aagaacaaag     80640
     cggcaacagc caagaggaca ctaccagcac tagctaccaa cagagcacca gcaccctcag     80700
     caggagtgac ttctggttct tcagttggct cttcagttgg ctcttcggtt ggttcttcgg     80760
     ttggttcttc agttggctct tcagtaggtt cttcggttgg ttcttcagtt ggctcttcag     80820
     taggttcctc tgttggctct tcagttggct cttcagttgg ttcctcagtt ggttcctcag     80880
     ttggttcctc agttggttcc tcagttggct cttcagttgg ttcctcagtt ggctcttcag     80940
     taggttcctc ggttggctct tcagtaggtt cttcagttgg ttcctcagtt ggctcttcag     81000
     ttggttcctc agttggctct tcagttggct cttcagttgg ctcttcagtt ggctcttcag     81060
     ttgggtcttc agttgggtct tcagttgggt cttcagttgg gtcctcagtt gggtcctcag     81120
     tagggtcctc agtagggtcc tcggtaggat cttctgttgg gtcacctgtt tgttcaactg     81180
     ctgtcaaagt aatttgttga caatcacctg cttggaaaat ttggattaca aaaccagtat     81240
     cagctggaca agcgaaccag acggcattgt catcagatgg accatgagca aatacttgac     81300
     cttcgagaat ttggaaatta ctcgatgcat cagcttgagg agtaagatta actccagttt     81360
     ctgagagctg taagtaattg tctgtgcctt gcacgttaac caatccagat ggttcttgca     81420
     aaatcaaggt tggggcatca ccattaccaa tggtcaactt ggagtcagca gaagtgactt     81480
     caccaaggtc accagcactt aaggtgaaag tgtggtcagc caaaacaacg gcgactaaag     81540
     aaaggaaaac ggtaggctta aataacattg taaatatatt tgataatggt tgcaaatagc     81600
     tcgtgcatat tgaataatga gcgaaacaaa ctgctcttat atagcttaac tttttgcctg     81660
     aaagtttcaa gaactaatga cccctctggt taatttcatt ccagtcaatg agtatggaga     81720
     tctaaatcca ttcttggcaa atgtttgctt aatttgttca tcactaattg agcatgcatt     81780
     aaaatattct gcaacacttc acacagaatg tccccaccac catgtgggct gttttagctt     81840
     cctctaacat ttagtattga tgaaagactt ccgtttagta aagcaaacta aatatagaac     81900
     cgtggcaatt agtctacatt gtctggtgtt gaaatgtctt ggaagagatg acttgtgtca     81960
     ctcaatttat tttaaagcag atgcatttat cctcagccaa gcgccagctg cattatgtgc     82020
     agcagctcga tgaactttac atttattgtg gagaatacga atgctcaatc gggaaagtaa     82080
     ttcgggggcc aacgtaaatc ggtgtcaact tctggattct tttgctcatc aattattgaa     82140
     ctagggatag ccagcctgta cttgatgaag cgcatcaata atatcttcgg tccgttgttc     82200
     ggattgtcag tccggagcaa gattttatac cataagtgtt gatgtagcag taaaccagga     82260
     attttattat ctagcaactt atgtcttaaa aactggcatt gcatattttt atcagtagcc     82320
     gtattaacgc ttttcagaag cacagatttc tgtacggcgg gcgtcgtcaa tgcaaagaaa     82380
     tatactataa atagtaagat ttggaagcat acctaccaat acttaaagtt gaatagccgt     82440
     gaataggtcc atggtatttc tacattaata cgagaagtat cgtatgctcg tgctgaagat     82500
     tgcataccgc tcatgcgact gaaatattct ttaagagact tgaaacgtta gccaattgtg     82560
     gttaggaaga aaagacttgg caaagaacag caatcccgtt cacgaaatta tttccagcca     82620
     cggggtctta agcaagcatt ccattcccga atccctttta agattgaagc tggttcaatt     82680
     ggtttgtggc cagaccccct agcatgactc cttgtcaatg cagcaaattc attagacttt     82740
     cagaagtctt agccaatgtt gatgaatatc gatttttgca tgcgacttcc attattagaa     82800
     cagacagact ctatatgttg aaggaaaatc atgttcctga ccagcaccga actggtgact     82860
     ttccttgccg aatgcagaat tgtaaatgcg gatcgtgcat attgatcagt atcctgcagt     82920
     tggaactggt tttgtatcta ttccatcatc cttttagcat cttgttgcat caactttact     82980
     acaaaatgtg actctagagc aaagaaactc aagcgcttgc aatcatatcg catgagaatg     83040
     ttggtgatgt tttgattgtg cagtagactc cgggtgcaat aatgtgcttt tttgaatttt     83100
     ggtcgatctt ctcacttgtg tacttccatt cctggagaaa tcaattgttt atgaaattct     83160
     agaatgccct tttggtgtct ctatgtaggt tacagtaaat agtgatcggt gcccagtttt     83220
     tgatttgcga ggtggttaaa agcgttcaaa aatagctttg aaatgaaaca aagtgctgat     83280
     gtgtgggcaa agttaaagct attatttgca tctttcgaat tttcctaacc aaaacaagca     83340
     tctcgatatt ctttctctat aacaggcgtt aacacttaca aaaatgtgct tctgttagtg     83400
     ttcttttagt tgttacaaca ttataaattt tattaatatt ccaatttttg agccaaaatt     83460
     tgaaattggc cattgacaac atgtatgata catccgtttc ttcaataatt acatataaca     83520
     cacagatcgt atagaactaa cctccgaaat tgttcttgac tcaaggcact ggtgaatctg     83580
     aggtgaacac ccaattttaa tgcaacataa ttcgcagcca cattttttgc gactgcttcg     83640
     attgcaatat tgaagcatcc tgtgttagct cgcaattgct tttccactct ctaatatatt     83700
     caagcgatgg atgctttagc ttaatttagc aggtctaacc catttatcgg tcaaccagca     83760
     aacccaagca gggtgccctg tataatagct acgaagctta cttcttctga ttggtaccca     83820
     acccagacag tattggctac attactgtgc tgaaaagtag taattgaagt cagacacact     83880
     acattgactg attcaatcaa gaagtgctaa gttgacccat agctacacac tctgacaatg     83940
     atccaataga aagcgtcata tataccttgg taacggagta ccccatagat cgaactacat     84000
     tacggatcaa ggtaaattat cccgaaaacg gctcccgaca gtacccctct atatatttac     84060
     tggggagagt aggtccgaaa taggtgtttg tgcttattaa tacaaggcat tgtagatgca     84120
     aaacgtaaga tcaaatccaa ctcttatcgc aacgtcagca tctattccta tttcaaacta     84180
     ctagaacatg gacatgtcaa ttcatttcta tttttttaca ctggctagat gctgccagcg     84240
     cagagacaaa ccatcgtgac gagtttgaga gtcccagaaa tccaactaca gatcaacagg     84300
     cccatgaatc acggttgtcc gtagttaagg agtctactct tgattcagaa gcgtctgcaa     84360
     attctaatcg cacgtgaact cagcatatgt tgccagaagc caaatctgga aagtgtggaa     84420
     cgcaggttga aaaattgtcc atgcaaagac tactagtcac gtgtcattgt gttattgttt     84480
     ttcgctcatt cctatataat acagtgagtc cacgaagatt gtggatacca acgaggtagg     84540
     caaaacctgc acacaggctc tcttaactaa ggagactata attgtggatt caaattctac     84600
     aactgattag ttgatggtag aaatcgtgct tagctcatat atatagtata tatatgttac     84660
     attcatgtct aattcacata aagatccgag tgaaaggagc cttgaatttt tgaaaatttc     84720
     cacgctgtta taatttgaaa gaatctcttc acatcttagg aggctacaat agaaaaaaca     84780
     gactcccatc gcacagccaa ccccctaaga tgagcagcca taaccctgac aagtacaaca     84840
     ataccacgag ctcggcgctt cttgaacagt tggtgtacat cgacacattc atgaataatg     84900
     ggacgtcgtc gtccgccggt gatctaacac cgaatttgga catagacgga cagctttcca     84960
     tcgacttagc ggcctttgct gatgactcgt tcatttttcc agacgaagat aagcccaaga     85020
     accataatca cgacgacgac gacgatagaa taagtaacaa agactttggt gatcataacg     85080
     gaaaagagaa cgaagtcatt ttcaagacag aagaggatcc tctcatgacc cagcatcctc     85140
     tcaacttgga ttcatctacg gacaactcgc cagacatgca gcaacagcag aaacatctcc     85200
     ttgccaacca gaatggagct ggtgtgctaa acgacatcaa cttccaaaag cttcccaagt     85260
     tcccggtgcc tccaggagcc aagtcttcgt tagaatctgc tggtttgtct cagaaccaaa     85320
     tcgatctttt gagtgcgttg atagcacagc accaaacaag cttaggaaat tcgattcccc     85380
     aactgcagaa ctctccttct gtgcaacagg tactgcaaca acagcacgct caacaacatc     85440
     tgcaacagtc ccaacatcat aaacaaagaa accaatcttt cagtgctcag attcccgggc     85500
     agagtttttc cggatactcg ccagttaggc aacatagtca actctacggc ttagacgaac     85560
     ataacccatt tccacaacac agcagacaat ctacgtctct gtactcgata gcgagcccaa     85620
     cgtcgtccac agtacaaaca tcgccaaacg gcttttcaat ccgtacacca aactccagcg     85680
     aagacacatt aagcaatttg ggtaactcct catcattttc tagttttaat aacgacggtt     85740
     tgacgccctc ggctaacggc ggcagttctg ccgaactcga taaacgcaga cgcaacacgg     85800
     ctgcttcggc tagattcagg attaaaaaga agttgaagga gaaacagatg gaaaacaaga     85860
     tactatcatt gaacgagctt atcaaagaat tcgaagtcaa gatccagcaa ttggaaatgg     85920
     aaaacaaatt gttgcgtaac ttgattattg aaaagggttc tcaaaaatcc gacaacgaat     85980
     tgaagttgtt gagagaaaga gccaagatga attagatttg tatctggaat acaaattaat     86040
     cacgatttac gaacatcaaa attgcaaaaa ttgccggttt aaaaagctag ctagatactc     86100
     tttagatttc atagagaata ccatatcttg tgatccttcg tttacgtgat gtatatgacc     86160
     tcctaatgta gttcaacaga ttgagagttg tccgattgtg cagcaaagtc ctaattctga     86220
     aggtcgtatt gaaatgtaat tatttttgta cttcgtgggt ttttgcattc tttgtgctga     86280
     ttgcatgctt gatgcggtta tttttttatg ttaacaaccc aggagataag gcaagatgac     86340
     aagatgtgct tgttgcatat ggcgggttgc aatcgatgac aaatttgtcc aaatatagat     86400
     ttttaacgta gaagtattgt agcggctttt ggcaatcctt ttgtgagcag catttaggct     86460
     aagaaaaacc aacaaaatta ttatgtccta ggtctgtacc ttgcacacgg ctgttttagt     86520
     cgcacagacc gttatgacgt ttcaaatcca tgcacaatgt gatgccagcc gttgcttgtt     86580
     agccattttc ttggacaagt ttattattta aagaatatca agatagtagg cgctgatatt     86640
     gtttcaacaa tgtgacttca ggtggttcaa ttgcatttgg aaaagtggcg gaaggctcta     86700
     tctcctccag acgcctctat tgacaatctc ctccaacgga aaaaccttaa tccacagata     86760
     cgttgtgcat gactttaacg cataaaatga aatacatgag atgaaataat tcgaaaagat     86820
     atgacgataa tcaagcaatt ggagcaacgg tacagaagta tttacgggtg atcatagcaa     86880
     catatcgtca ccagcggcga tacccttagc cagttgtcct tattaagttt aagattaatc     86940
     ataaatctaa ttttatcacg aatgcatgag tcttaaatga atttgagact ggattttaaa     87000
     aatcgcaagc atctcatgca gctgtacaat atttggatga aattgattca ctttcaagtc     87060
     ggcaattatc ttctacaaca ggtgaaaacc tacgctgtca ccaataggtt ccccagattt     87120
     atcggagcat tcgggatgca taacgttctt ccacgcccgt agattacctt ccggatatga     87180
     tcgattgctt ttccatatcc aatcgttgtc gttatagtct cagctagagt ctgaagatta     87240
     gctgaaacaa gctgtttgga aggttgggtc gctgctattt tatagttgga cttgagcctt     87300
     gtccatgaag gaagtggggg tgattgaaat aacagaaaaa aatttttgaa aaaaaaaata     87360
     gattctatga aaccgttgaa tcttgtcatc aattttaaaa tatataattc attcatcaca     87420
     tcactaggat tcaatacatc cacctagtgg aaccatattt gttgatatgg tatccaccag     87480
     atccggaaga aaggatccag catctgtaga gcttggccag aacggcaagg aggtgaaaaa     87540
     aatacctaca agcaaatcta agagtcgagc aattcaacac aatgcagatg taataacagc     87600
     ttcggagtcg gtccatacga agaaggaaac gcgaggcaga aaaagaaaag tgacctccat     87660
     agttcctgag caaccagatg aacaggatgt ctcacttaga ggcaaaaaga aaagaacgac     87720
     agaggctcta gattccacag tttcaattga atcagcaaat acgcgcccaa acaacgacag     87780
     aagtacaccc tcttcggaat ggacatcttc caaggtaccc aaggacactt caactcctaa     87840
     aacaaatatg cctatcatgt ctattatatc ccataaggtg ggtaaaaaga acccaacaag     87900
     tacgcggcag gactcacctt cttcgatatc tgggctctca gatggtgata tgggtgatga     87960
     accagaatta tcaactgttt ccagcaactc agacaatatt aaaattaaca agagaattat     88020
     gagcagagat acagaagagg ttattcggat gttcaagaaa ttcgacgacg aggtccttac     88080
     aaacccagta gccagagcca gactcttatc actaaagttt gaaactcgaa agaggtacat     88140
     aaccacgttc aaacactata ttcggttctg ttgtaagaaa aagcttgaca atttttttgt     88200
     taccggtcct ctaatgaaag aattctacga ggagcaattt gcaatcagtg ccagtagtaa     88260
     cccaataatt cggttgaaga aaatggatcc ggctttcagc aagctccagg agatcaactt     88320
     cttggtctac catcttgaga acaaggatat tcccgatcga catattgctt atgactattt     88380
     gtttttcata gaaactggga aatacccgtg gtaccacaaa ccaattgtta atacgtcaag     88440
     tgagccagtt gatttcagta acacagcaaa caaaaaatcg aataaatcat tagcaacacg     88500
     agtatccaaa ggggctaccg aaaaatcatc aggaacacaa ccctcgacaa atactaatag     88560
     tgaaaaagaa gaaatagcat cctctcagca aaccaataaa gaaacttcac agttaatacc     88620
     aactccaacg acaagaagaa aaagaacaat tagaaaagtt gaattggaag catttattaa     88680
     atcccaatta aaacaaacaa ggctggaaat tcataatttg aatactgccc atattgaagc     88740
     attaaaatta attacttccg accaacaagt gttgaaccaa gtgagatccc taaatcgtaa     88800
     cattaatata gctttggata atttttcatc cctaattgaa aagggtccta atgaagttat     88860
     ttattctgga gcagaaaagg acaatactgt tttgcctaaa agtactcatc ctgtaattat     88920
     tgacatgaat cacaacatat ttactgtcta cgaaattcta gaagaatggt atcggattga     88980
     tccttctgtc gaaaaacgta tcaagaactg gggcatgaat tggataagag atgatattga     89040
     ccgagaaact tacaatgaaa gaaactccat agttgatttt gtcaagcgaa tatccaaaga     89100
     aatcaacgag ccggatttat ttcttattgc aaatgattgt gatagatata ttcatgacaa     89160
     gctgattttg gatgagttta ttagtgaaat cgaattagat ttcgacgatt tatttaagag     89220
     agtactccgt caccgtcaac gtcgtagctg aaattatcag cgaatgcggg aaaccctgtt     89280
     tcctaaaagg ttcttcgaag taggggtggg gtatagtcca ccttttaatg atgttgaatt     89340
     gtacaatatc tgaatttttt tgcagttgta gctgatagta acgtagttga gccaccaata     89400
     gaagcttagc ctcttcggtt attccagaga ttattacggg gtttagctcg gctttcattg     89460
     aatatgtgct cctgtgggtg gggagtagac tacgatagga caatctcgga atactttttt     89520
     ttttgtggct atgcttagtc tcccactagg aacaaggtga ctgcggacgc gaggtctatc     89580
     gagtgttgga tcccattcat ctgatcttgc ttggttctcc acaaattgaa taacataatg     89640
     cggagtcgaa accttagatt gctctgctcg cccaactggt gaatagtcca tgcatgaata     89700
     cggcaaatct agggttccat ttggaatttc gatcaaagaa taacgagtag gagagtgggg     89760
     gactgcggac tggctcggag cgatctttta gttcatagat gatattttgc aactgtctgc     89820
     gataggaata taattaagaa attttgacca caatcgaagt aatgcacgac ataaagagga     89880
     ccaaggacca agaagaatgg aagaaaccgg aagacagcaa aagaaatatg cctgcgaatg     89940
     caccattaat ctgcaaggat acaacagtca gaaagtgggg ttgaacctat tctctcgtta     90000
     aattccctaa ataactcgga ggagcgccgt tgcaaccata gcatattagt gttgcatgcg     90060
     gactgtacgc aataatgtaa caccaaacca tttgttccga gcgctcctca gtccaagaaa     90120
     aataatgcac aagaaatgcc caaaatagtt aagcaacatg gtgtagaaca cgcaaaaaat     90180
     aatttatgta aaagtttaac cccaccatat tttttagcaa tggggctaag tgtttacacg     90240
     aaaaaatggg cgtttgagga tactccctac attcggagcc cgggattacc cagaaagagg     90300
     gagcgagttt ttgaagctag taataacgcg gctgtttgac aggccaagtg tgcgaaaaga     90360
     aaggaaaaat gaaagtcaca ttccacaccc ccactcgctt ttacacaaaa gtagagtatt     90420
     gttagttaaa tctggtgcca taatgataat actttcacaa cgccaacgac accgtgtgca     90480
     acgtcggacg aggtaccaga tcctcataat gcctacgatc tacaaaatgt taagcgattg     90540
     aactctcttt ttcggttgaa gaagtatttt gaattgattt gaaattgact ttggctacac     90600
     cgcgcagtgt atatagattt ttgtggtgaa attgttgggg gattgattgt gaccttccga     90660
     aataaactcc attaacaaag caatttttaa caatcaaaat gatacaagcg ggtttatttg     90720
     atacgaactc caggggtatg gaaagagagt ggggaaggca agacccaatg ctggggaaat     90780
     attcaatctc cgatggtacc atttcattta tgatcgtatc acactaccac aaaaacagct     90840
     cagatgtgtg ctcttatccc ccaccctagc ccggacttga acaattagca tttggaagca     90900
     tttatttctc accccgcaaa atttcaaaaa atgcagcctg cctggagata ctccgagcta     90960
     tttttttttt tattacttgg ttctcacctg tcagaaacgg cagttccata ctcgcctacg     91020
     tgcaaatgct aaaagtgcag aatattattg gctcatcatt aaggttctct ttagataatt     91080
     cccagaatac actgaaaagc tttgcagact aatttggaaa tgtaacttct atggaaacgc     91140
     ttcaaaataa ttgggatagt gcatactccg aattttttaa tgtagaaaaa ataaaatgaa     91200
     ctcgccccgt tcaacattcg cagcctaaat gtgcgccagc ggtaccattg tcctcttcaa     91260
     gaaatgatct aactagcttc accatctaac caactgaaaa aatcgtatat ataatctggc     91320
     gtctgccgat aatctttctc aaggtttttc acttttctaa catcagcgaa caacccgatc     91380
     aaccgttctt agctacaatg gataccaagt cagttcatac tattcaatcg atccaacttc     91440
     aagagatccg tgatcacaac aagcacattg tgcaaccgcc aaaattcact gctcaggcta     91500
     tcaagaatta ctttggatcg agatttagat ctttgtttgt cccaaaggaa gaacttgagc     91560
     agtacacttg ggccgatatc tacaaccctt tctctgcctt gcgagaagtc agcttaaggg     91620
     aatggaactt cttcttcctt ggtttctggg cttggacctg ggatgctttt gattttttca     91680
     ccgtttcttt gaacattact aacattgcgg aagctttgga tctgtcagtc aaagatatct     91740
     cctggggtat tacattggtg ttgatgttga gaactgtcgg tgctattata tttggtttga     91800
     ttggtgatac tcgtggtaga aaatggccct acattatcaa cttggctctt ttgagtgtca     91860
     ttcaaatcgg aactggtttt gtacaaactt ataagcaatt cttggctgtt agagctcttt     91920
     tcggtattgc catgggtggt ttgttcggta tttgtgctgc tgaagcattg tcggacgccc     91980
     caagaaaggc cagaggtata atgtctggta tcttccaaga aggttacgct ttcggttact     92040
     tgttggccgt tgtttttcaa agagctattg cagacaccag cagctggaga aatgtcttct     92100
     acttttctgc tggtgtcggt gtcattttca tggtatggag atttttctct cctgaaaccg     92160
     attctttctt gaggcaaaag gctagaatgg aagaaactgc tgctgctggc ggccaaggtg     92220
     gttccaaggt tgcagctttc aaatcccaag ctcgtaaggc catgaagcaa tattggttaa     92280
     ttgtcatcta ctgtgtcttg atgatgtctg gtttcaactt ttcttctcat ggttctcaag     92340
     atttgtaccc taccatgctc aaaaaccaat accaattcag tgccgataag agtactgttg     92400
     ctaatgttgc tgccaacttg ggtgcttgcg ctggtggtat ttttgtcgct cacatgtcta     92460
     cttttattgg tcgtagatta gccatcattt tggcaacgat tctttgtgct gctgttattt     92520
     atccatgggc cttcattcct aacgcaggat ctgcattcgc attccaattc ggtatccaag     92580
     gtgcctgggg tgtcgttcca atccacttgt cagaattgtc tccaccacag ttcagatctt     92640
     tcgtcaccgg tgttgcctac cagttaggta acttgtgttc ttctgcatcc tccaccatcg     92700
     aagccaccat cggtgaacgt ttcccaattt ctggcaaggg tccagatgtc tacgattacg     92760
     gaaagaccat ggccatattc atggcatgtg tcttggttta ccaacttatt attatcttta     92820
     tcggaccaga aaacagaggt gccgacttgg gtatcgaaag agacgatatt ctcgatgaag     92880
     atgcttacga agacgacgac gaattagtgg aaggaaagaa atccggagaa gcttctgtca     92940
     taatgaagcc agaagtaatt cacaacgaag gtaaatcggt tgccaataag gtctagatga     93000
     ttttattgga gtatttcaat tctagttatg tttctatata cgaatattcc tatttatact     93060
     tattttgaac tttctgtcac tgtataagta gtataccaat tctgaaggct tttcttcccg     93120
     ttaatggcaa taagcagatg atactgctct gtagctgcta gttcttctac tcagatattt     93180
     gcacaaatag taggaagatt tggtagcgta cagatctaag cagttagtgg gtgtctaagc     93240
     taccgataag ctacacccgt gccacagtag ttacctctgc gcaccagaaa aattttcctc     93300
     tagcatcgtc tgccttgtaa tttttcagaa tattactatc gcttctttca gttcttgatg     93360
     gtattcctcc ttctctcttc tcttcctctc ctctctcgca aaagatttcg tgtgttacgc     93420
     tccaatccaa tactgctatc ttttcgagag aggaactgct cgtagactcg taaatctgga     93480
     catataaatt agaatagcga aaaaaatgga atcgtaccaa accagctttt tggaaagtgc     93540
     cttggagtcc aatgccttga agttcggaag cttcacgttg aagtccggcc gtcaatcgcc     93600
     atacttcttc aacttgggtt tcttcaacac cggtcttctc ttgtctgaat tggctacttc     93660
     gtatgcaaag gccatcatca agtccggctt ggaattcgaa gtcctctttg gcccagctta     93720
     caaaggtatt cctttggtgg ccatcaccgc tgccaagttg gccgaattgg acccagagca     93780
     ctatggtaac attctctact ccttcaacag aaaggaaaag aaggaccacg gtgaaggtgg     93840
     ctccattgta ggtgctgctt tgaaggacaa gaagatcttg atcatcgacg atgtcatctc     93900
     tgctggaact gccatcaacg aagctttcca gatcatcgct gctgaacaag gcaatgtagt     93960
     tggatgtatc attgccttgg acagacaaga gaccactgca aactccgaca cttcggctac     94020
     ccaagctgtc ctggaaagat acggaattcc agtgatttcc attgtgtctt tgtctgacat     94080
     cgttgagatt ctcagtcaca agcttacgga ggaacagctt gcttctatca aggagtatag     94140
     aaagcaatac tctccaaaga actagttgta gtaagatatg tagtaattat tgactcacta     94200
     cttctaggag tcaataggac atgataatat aacgaattac ataaaataag tttactgttt     94260
     tctatcttga ttccactccg ctcgtcagcc tacttttcta cattgcataa ccttcgtaga     94320
     atctgtaata cttttgatca atgtttttta agaaatcaaa gaaatcaatc atgtacttaa     94380
     agaagatgtg ttctagttat ctcatagctg gcgacgacag gtctgtggtc agagaagtaa     94440
     aaacctttga agtaattgtg caagatccca aattgcttga ttactatatc ataaaccaaa     94500
     tggtgttcaa ggttgtagta gttgttcatc tcattggcta cttcatcttc ataatcttta     94560
     accggcgagg tatcgtttcc gaaatttcct tgggaaaagt atggtgacca gatgtaatca     94620
     ataatagaag agtcctcctt ctccttatta aagccggtga acgtcgtact atggccatat     94680
     gagtaatcat agtcaaccaa ctttctacta tctttgaatc cagcatcaga taaaacatgg     94740
     taaggttgat ccttgggctg ggtattaaag tcaccgcaaa gaaacgatgg gttatcgtta     94800
     aagttttcca tcttgtcaac aatcaactcc gccgacttct tcctagccaa tacaccccga     94860
     tggtcaaagt gtgtattgaa cacattcacc ttgatcaaag gattaatcct agattccaat     94920
     gtgaccatag tgacaattct ctcaagggct gcatcccatc ccttacttgg cttccaagga     94980
     gtttcactaa gccagaacgt ctggttatcg agcaaaatcc aatcagagtt cttgtacaat     95040
     ataggagcat attcgccagc ttctaaacca tcgttgcgac ccactccata ataggtccag     95100
     atctgctcag cgttcttatt caacccctca aggatatcaa ccaattggtt gtgcaatact     95160
     tcctgtaagc ataccacgtt ggcatgcccc aaagctgtgt tgaagtcaat ggagttgatg     95220
     acttgcttct tacgcttgga ccatggctgc tcgcccttga ctgggtaacg attatcaagt     95280
     ctaatgttgt tggtgtagac gcgaagtttc aaaggctttc ccaaaaatgg caaggcttgg     95340
     ttaacactgc tgtggctagt aatgtaccaa ttggtagcgt agaccaagac aataatgatc     95400
     aacgtgggga taatcaatag tctgaaacga gaggatctac cagaactacg aggattagtt     95460
     cgagtttcct ccagacccga gccgctagtc aacaatggtg tactctcact aaggtgtgtg     95520
     ccttcttcag cggacgtgga cattgaaaat atgacaatcg atctttagac tggaaattgt     95580
     aactacccca gaagttaggc aattctttct taaatttttg gaaatcaacg agctatgacc     95640
     tgtatcactt ggcctgacca cttctggtat tttattcctt caattggcag ttatgtcgtg     95700
     attttactcc agtagaccag gaatgaagga gtatttcgga ttattgtcta tggcattgtt     95760
     ctctatgcag cctcagatgt gcaccaagga aattcttccc ccacaaaaga gcattcccga     95820
     taaacgtaaa tgaaatatcg gagtccgtgg ggcaattctg atttagcctt acggccaaga     95880
     aaccacttaa agctacaact acagtgcaat tgctgctgct attgttgctg cacttcacac     95940
     atattagtca aagtaggtat tttagtatat actatctagc tgagtaatac acttgcgtgg     96000
     tatcatttct ttatggcctc ggtagccgat ctatttacac cggtcagttt agccgtttca     96060
     attgtgttaa cgtcttcatc gtcagcaaga agttctattt ttggaccatt ggagcgaggt     96120
     tcatccaaga tctcatatgt atgactcccg cctccgccgt tgctgatcat gaataaaagt     96180
     acactaccta tcccacaaat gacggtgaag acaaacacga agactacaca gtacaacaca     96240
     aacttaatgg gacggtgggt gatctggtag acgggatccc gtaaaaagtc gtagaaaaag     96300
     tccttgatgt caagaaactg tctcaaggcg aaaagttgta gaaaaaggta gaattgcttg     96360
     aaggtgttac cgttcttatc taagagtaat tcgtcaaagt tcttaggtgg agctactggc     96420
     tcattctgaa tctttggctt gttggcccgc ttgtgctgat cttccaatag gtacttgacc     96480
     ttgaaggtta ggtttccaat tctttcagct tcggcaatgg agtgaccaag gtagatgttg     96540
     tcgaacaaga tctcgtcgct catgctccat aactcaaacc caagacctcc aaccaatttg     96600
     tttaagttcg aaggcttatc gtcttcgtaa tagtgtgggt ttgcgatcat tcttggcttc     96660
     cattcaccca catagttagg attgtcaatc attggctgaa tccatggtcc agtgtattct     96720
     ttgttaggaa tccgcggagg agaccatggt ccacaaccag cgagctcctt gcatttggga     96780
     ttaggaattt ctttagctaa ccattttcca tcctcttcct catcccagta ttcaggagct     96840
     gttgagtctg gatcctcgat aagaacaggt accagttcgt cccaattttc aggcttgaca     96900
     gcttctggat ctggaattgt aggcaatccg tgtttctcat cgtatccctc gggtttctgg     96960
     acattcggat ctggaatacg ggggctatcc tcccaatcaa gaggcttggt atcattttca     97020
     tcaattattt ccttcggagg attgagtctt ggctccaaca aatggggact acgtaacaag     97080
     tttccagctt tagccacttc tccgttgatt ctgatttcaa aatcttggtt ttgcttcaaa     97140
     atcaatgtgt acaatgttgt taagtcgcca gatctagaca taggtgaatt cttcaatttc     97200
     ttctcttgta catctgaaac gtttaaaggg ttctctcttc tcaaaatgaa atgaatcttg     97260
     ttttcagaac cacagcggtc gggtccaaac atcacctggt agggtgtatc tgtgctgaaa     97320
     ttgtcgtagt tgtcttgtag gtctagtaac ttaatgtaag tgccaccaca tgataatccg     97380
     ttttgtagct tgatctcata ctggagaaca agatcattat cagtattgtc aaatggctgg     97440
     ggcaatttgt aggagatcgc atggtgggca gccttcagtt ttagtaccaa ccctttatca     97500
     ttagaaaagg ctgggtactt ctttgcaggt tctatagccc attttccaac ataggaaacc     97560
     acttcatgtc tgccttcgtc gaattttttt gcggttgagg gtttccaggg cgagtgatct     97620
     agatcttggt aatcgaattg ctcgaatata gcagaagtag taagcttgga tttgtcgtaa     97680
     ggaatgtagt cttcagcttt cactacacaa gccaatgcga ttgacaaaag cgagacttgt     97740
     tttaagcata ccatattggg caaaaatctg tgaacgtgca agagttagct gaatattcaa     97800
     atatcagtag atttgtcaat tgatacctat atatatgtaa tttgtattgt tgtctgaaga     97860
     atcgatggag aaaggaagaa gttatgttgc ttgacgaaca aaaatcggct agttgatgcg     97920
     aaatttgtat gtcgtgctgt aattctgcat gaagataatc cgagcatgta ggcccgagct     97980
     catacttccg agtgccataa ttgcatttga atttgctcag aaagagatat gcttacaaag     98040
     taggtgtccg cttcatttgg agagatgtga cgaatttaag tttttacaga aaataaccaa     98100
     tgtctgtctc tattttctat gtctattcta atgtacacta ataataaatg aacaaccgat     98160
     cacctcaggc ttcggcttcg tccaacaatg caaacacgtt cccagttgac actggttttg     98220
     actcttcttc ttcttccttt tcagcgtctt cgccaaagaa ctctttcacg tattcgtctt     98280
     cttcttcctt ctcgatttcc atctcagact tctcgacggg gccagtagtt accttggtct     98340
     ccaacactat gtcgttttta atggtgatac tcttgttgat ttgatcccag ccagattttc     98400
     tggcactttg aacgtacttg gcacgagcga tactctgctc gatttttgta gacaacactc     98460
     cgctcaactt gtctgatctg tccaacttgt gtttcaatga actggttttc cttttgttct     98520
     gattcgactt tctgatcttc agattttcca ttttctttgc caaaagattt tcgttcttga     98580
     ttgtcgttct gatgatggac ttcttgactt cgtctgattc ggtcttgggt actttgctca     98640
     agtccttggc ctcgccttct tctgccaaaa gacctcgtct agcagctcta ctatgcttag     98700
     aaactgtaca gttgttagta caagctgttt aaataataag tgcaacctta ttgcaaaccc     98760
     caacagaatg tatccatatg ataatattat cgtattccta tctttacata cttttcttag     98820
     ccatcttgcc gtttattcaa ttctaactag acaacttcta tgctgctttc taacagaact     98880
     tatatactca tctcacctga aaaattcagc ttcctgcaga tacccaatct tttatttcgg     98940
     cacagaagcc ttcatccagg aacgaattta gataagaatc atgacgtcgt tgaacagcca     99000
     aaattctgtc atttctcttc ttcaacttac catctaagtc tgaaattcta taccgacgtc     99060
     gctttgtcat ttagcctttt gcagtttact tctcgttgaa atcaaactcc tcaaaatttc     99120
     aagaaatact ataatccacc atgaatctcc ataataccga caattcgtcc aatatgctcg     99180
     cttcccacta ccaagacgaa acgaaggccg ctgtcttctc tcgctcttat gactcgtctc     99240
     taggaataaa gtggtatgtt tgactccgca attccccctt ctgctgttga aaacggctca     99300
     aaatctttac gagatttggt gatttccatc aacgaatcca atttcatata tggcaaggtc     99360
     tctcgttgta gcacttactt gtttcttgac agaaatgttg tccgctttct cgacggtgtc     99420
     agtgaaagtc cacgagtaag aatcaatatt gcatccttga tgctggaagt ttgtgatata     99480
     gtttcggact gtcttcacca gagccagcta tatattatga tagacagatt agaaagcccg     99540
     tctgtttctc tacaagtggc tgcaactgcc tataaaatac tagagggcca attggttaca     99600
     tctgaacaga ctgaagatac ttttattaag caagtagatg gttacgaatg gcttatcgtc     99660
     agctgttctt tatgattttg tattcagaga attaattatt gacatttaag tgttaataaa     99720
     tctgaagaaa ggctcgatag ttatttagat gaaaactatt aatgaaatgt ttgtattagt     99780
     aaaatataag ccaatgaagt aattattgat ctatatgatt agatatgatc gataataatg     99840
     caattaatag tgtagcttaa atttactgtt gttttctcta ttgctgtagt ggtctttttc     99900
     cattatcgtt gatctctaca gattctgttt cttgaggctg ttgtttttga gctagcctca     99960
     cagccgcaac atactcatta caagccatgt ccaaactgac ttccataggt tcaagacaac    100020
     tctgtaagct tctaatgatc ttttcacgta atttctcgtt attcttgact aattccatct    100080
     catcaaactt cttagttgct cgttctttaa gtgctgtaag gtcattgcga caattcttga    100140
     gactggcaaa caatctcttc aattgcgtgg gattgttgcc gttcaaaaac aacttccaga    100200
     aatgtgacaa gaactcaacg acagtcatgt tatacctgat aatttcttga accaacgatt    100260
     catccaccaa gttcttgacg tcgtcataac tcacaccatg tgagtctttg gttgtgagtt    100320
     taaatgttct gaagttatgt tttatcaacg aagtaacttc attactcgac ttctctatat    100380
     cagcattctt agaatcataa gtatcgctga gattcacaag aggcttgaac ttgttcagag    100440
     aaaagaaact tgaaagctcg tcaggagtga aatgattcat ctgagcttca gatcccctcc    100500
     gtaacgatga cttggcgtca agattactgt tgatggataa gcgtatgaac tcagactcct    100560
     caacttcgtt caaatcgtgc aaattcaact cttcctggta ttcgtttatt tctgcctgag    100620
     ataaagaatc tggttcatct ggctgcgtca acagctgctg ggtcgtcaga atggcattgc    100680
     tcatctccac catcttcgac gacaatttgt tcatgttttt catcaacact atcatctcgt    100740
     tttcttggcc aaggtttact ttcttgatac catcgtcttc gaatcgcatc gtcaagtctg    100800
     gacggtttcc taacttctgt gaattgtctt cttcatttcc caataaatcg agaaacttat    100860
     tgacctttat ttgagggttc tgaagagaag gagcagttga tgtttgttca gattggggtt    100920
     cttttgatgt ctggtccaat gacgtcgtag ccagctcttt gtcctcgttg gccttttgtg    100980
     tttggtctat atataagtat ttgtccaaga tcacatcacc tctgttagtg ctgttgttga    101040
     ttttgtctcc tctcaatctt cggaatagtt tggagttgaa gaaacgcgac caaaactctc    101100
     cctccaggaa cttagacggc accaactcgg tgaaagcccg cctgatgatt gggtacgtgt    101160
     caaagatctc gttaattgtg tctcttgtta cattcacgtt gacctggttg tctgatgtgg    101220
     ctacaggctt tatagtagag agaacattat acggtcctct atgctgtgag atcgttaaag    101280
     catatgtccg caactgattc aatcttgtgg accagaacaa ctgcggcgtt agcttgttgt    101340
     ctattaccga cagtgtgaat atgctacgga gattacggtc ttccttcaaa tactgctgtt    101400
     gtaattgaaa gtttctgagc aagctcgcat cagaaagaga ttcgggtgtg ttgaaagata    101460
     gactaccggc tccattggtc agagcagacg atgaagcacc gactgaagat ggcgtgggtg    101520
     tcagagttgg agttatagca ccgggagtag tttcatttcc atcagaaact gtcgttgcag    101580
     gagttggagt gtctttgatc acagttctca gtctggctac aattgtctgg agagcatctt    101640
     tgatattgtt catagtcggc ctgttgctga agttgaggag aagcgacttt tcgtcctcgc    101700
     cgtcgttttt gtacaagaga cggagtctca ttttgggcga tccagccttg gactcttgga    101760
     gcttggtgat ggaatgaaga ggaatggtga tggtacgttg ctcttcgatg gctatccatt    101820
     ctagaaccag cggagttagt tcttcacgga tgtgcaccat cccggcgatc ttgtcgacag    101880
     aacatgcccc cgagaccgtc tccattgtgg atgtaatgta agaagatgtt ggtatagaag    101940
     ttgaagaagt gaaaatattg aagatagtac aggaatatag cggactttat agagagagat    102000
     agtgattctt gcgagagtta gcgagagtgc gcacaagtag tgggaagaga atagagagaa    102060
     tagtgagaca aaatgatatg tcgttttgat ctaccccagt agaacaatta cttacctgct    102120
     tcatagattc agtgtggaca ccctaatcat acaagtatag cgagatgacc agtggaaatt    102180
     tcatcattag cgagaattga aatactgaaa aaactgcgaa atatggggat tactgagaaa    102240
     tagcgagaac cgactatttt tcacccagac cttttcgcat cctaatccaa tgccagtgca    102300
     ggatttccat acaaatattc acttccactt ttcattcaga acgttagcca gttgccgaaa    102360
     gatcaaacat tttcctccaa gctctagctc cattactatc acaatgttgt ctacagtcgg    102420
     acttgttcac agaggcttcg tgcccttgtt caggacaaat gtcttgagaa gtggtgtgag    102480
     atgtcttcaa acatctagaa tcgtacaatc ggctgctact tctacgtcta cttctactgg    102540
     cttcaatgat cccacgaaaa agcacactgt accagtgact gtcgaccgag aattgccaga    102600
     cccctttgcc aaccagaaga agaacagaaa gtactttgtc tcatatgcta ttggaatcac    102660
     actcgcctgt gccatcatct tcaactacga aaagaccaga tcgcccatca ccaactctac    102720
     cttgtacttt ttgcgtagat cggctcttgc caaggagcat ttgggagagg ggatcgactt    102780
     cagaagctcg tggccgtgga tttctgggcc gttgaacacc gttaaaggtg atatcgatat    102840
     cagtttcgtc gtccagggtt ccaagagcaa gggtgtcttg aagttgaagg ctagcagaga    102900
     cacgaagttg cacccttttg aagttcacca tttcattttg gaagtgactg acagcaatgg    102960
     ccaggctgtg gagtacgact tgacgaagga ccctgcagtt gagtttgaca tttagtagat    103020
     agtgtggtta acttgtacat agaagcatcg atatggatat atgaaaacga agagtagaag    103080
     agaaggagtg tagagtcata atgataaaat gaataaagaa tagagtagta aaacatttgc    103140
     aggtgaagtg aggacagtga agaagcgcaa atgaagaaac gagtatagcg aagatttata    103200
     taagagacga ggagcagagg gagaatacga ctaaagagag ccattacagc agagagagag    103260
     tgtgtgtgaa ttgtagagac tttagaatag tgaagaaaaa ggtgaagaga ccgtaacagc    103320
     aagacaaggt acaatacaag cgtgctagga agtcaagtat agcagatata gtaaaatagt    103380
     acttgctcag aacaagaata tgcatatcct aattcggatg gatttatgaa aatcaaagaa    103440
     ggcttccaaa agcatcaagg gcacgataag ttggaactaa ttcctataga gtggaatagc    103500
     cggaactgtg cggaggcagg gctaatttca agtactaaag tgagatttaa attgctgaat    103560
     tgatttaacg aatttgccag gcgatccaga aaatatcttg ataccacatg gctggacggt    103620
     ttgtgatttt atttggtaca gaagctatag aagtatacga gagggaacga gctgagctga    103680
     gatgagatga gatgagatga gacgagacaa gaagacgata tgagacgata tcagacgata    103740
     tcagacaatc tgaagagagg tagagagtga agcgattcat gagattgtta ccgagatcag    103800
     ttggaagtga aatagagact ttcagcttcc aagtcctgct ttttgttact ctgcttctgt    103860
     gtcgattctg ttcacgtttg tttctccctg tgcatttgat aaaggagcac tattgtctcg    103920
     ttgtgagcac agaccaggct tgccgttgta catagcctgg taaaacgagc tgcgaatttc    103980
     acaccgagct gtatcgtgaa acttgccaga tcggccgagg tgtcggttag ctttggcatc    104040
     tgtcacagct ccagataagc ccatgctcct acgagataag gatactggaa atacgccctt    104100
     aacttctagt tcctcttaca cttcctcagt gtacgcaata ttgaatgtgg gaggcatttt    104160
     atgacagatc gaagtattgc ttattcgcca gacaggggtg gctttgctat cgagactttt    104220
     ccacattctt cgtccacatt tcgtcttagt ctacctgctg tagcgaggca ctgaagtgaa    104280
     cattttatca aggggtaggg ttgcccgcct ttccttgatt aagtccttaa ttctgcgggc    104340
     aggtagcgtc tattcacact gccgtactat aaatatttct ttctctattt tatggctcta    104400
     tatacttgga gactttgtaa acgtcaatga atatgacatt gaaaaggaca atagcaccat    104460
     cagatttggt gcggtgatca cctctccgaa tctcgcgata atcggccgtc tacttctctt    104520
     ttgtacttag caaatttgtc gtacgaatcc tctgccgcta ctggcctgcc aaatttcacc    104580
     ttggatcaca ttcctattta accctccacc attgtcccgg ttaacttcgc tattctcttc    104640
     tataattagg ccagaaaata ttggctaccg tacaggcttg cgctcgcaac cacacggata    104700
     ttccccatta gtttcttttt cgccagaaga ggtcgtgtgg ccagcacaaa ccttccacag    104760
     gcatctacat cgtggaagaa ggtgatattc agaaagagtg caagagcctt acagcctaca    104820
     ccagcattat accctctgat tcgacacttc cagcgccttc ttagctacgc ctttgtcttc    104880
     ctcgagtttg cctttttttt ccactctcgc tactgttcat atctgctatc tctcgctcag    104940
     cacgatattg aatccagaag aatatcgaaa tatcaaaaat caagaataga agagtattga    105000
     aagagtagaa tagacgtcac aagtacatag tcgacaccgt catagtctct gtcgacatca    105060
     ccatcgttat cttgatcata taagcaatat ctaacgctac gactgcgagc ttgctatata    105120
     ctcctattgt catcactcct attctcaatc cacagttctc ttatcactcg accattcttc    105180
     accgtactcg ttaactattc gaccacggtc tccaaatcca acatagtcat atctgaacct    105240
     ccagaaaccc cccaaaacct cgaatctcac atctgagatt atcacacaca cattttccac    105300
     agtcactcac tattaactca taattgacat tatacaatgg tagacagcca aagtttaacc    105360
     gtcggactag cagtgggcat cccctcgttc gttatcatct ccgtggtgct cctcttgtgg    105420
     ttacgtaatc agcgcaaaca aaagaaggaa gactctgtca acgacgacat cgacatggac    105480
     ctcagagacg accagtcctt caaccagttc caagaagaac tacatcggcc ttacgcaaaa    105540
     gggaaagccg aactaaacat aaacacatac agcgacccca ataagtcgtc atcaacaacg    105600
     cagggtgaat cctctacaga aaaaccctac atctcctcgc atggatctac atcatccagc    105660
     aacataattg accagcccca cgtctatgcg actccaccac gtcctaaata cagtaatgct    105720
     aacaacggca ctaataacgt aaacaataac aacatcaaca acttaaacaa caacttaaac    105780
     aacaacatca ataatactaa taatattcat ctgaaatctc cttcggcgta cgatttctac    105840
     gagaccttta ttcctatatt accaggagga ggtagtccct ccactaacaa cggcaacaca    105900
     gcgcaccatt ccaatgcgaa cagcgtccac gaggctcaca gtaacggtaa tttgcaaagc    105960
     caactccagc agcctcctca tattcacgat gttgcgtcta caaacaacag ctctaacgat    106020
     agtttgaacg gcaacgatag atcgtctcta gataatttgg ctaaacagtt aacaagcccc    106080
     gtcttctttg aaaagttgcc ctcgcgtgcc accacggtag cgttgaaacc tcgtttcccc    106140
     aacatgcaat cgaacaactc ttctagtgaa ggcttgaaca atagattgat cggcgacact    106200
     actgctctca atgacaactt catctacgaa gcacctacag tggatgtgaa aaagacagag    106260
     ttgcaggcca aagatttcca gcgcagtcat ctttcacgtg aacaaacagt gaagtctcat    106320
     gaagacgatg tttcgtctat actggccagt cacgctgaag acgtcgattc tttggtggag    106380
     cctgatgtgt cgaggtcttc gaatgacgac gaattcgttt cggatatcga cactaccgcc    106440
     agttgataaa ggattcatag agttgtgaaa atgagttcgt ccctgtgtat ctgaaagtat    106500
     tctcagatag ttgtcttaaa cgaagtagtt tcagtattcg ctttactcta ggccctgccg    106560
     tattttctgg cttttactga gaatctattc ttgatattta gacgaatgta caatattaca    106620
     cctttagaat aagatgcaaa cttgtagtat agtgaataat cattcatatg taatgtcatt    106680
     gtactctata taaagacagc tctaaagagt attgaattga tggaatcatg aatgaagtag    106740
     cttgcaagtg aacttgaaag tgggtgcaaa ttcggtcctc ttagtcccac tatagcacaa    106800
     ccaaaggtca atttgaaagg cttcttaatg tataaacaga taaaaatgca ccttgataag    106860
     tatttatata taatttcatg ataatatagt caacctgctt aatcatcgtt ccggaagaat    106920
     tcttaatttc ttgtttaaat tcgtatctta aattcgtatc ttaattttgt atactaaatt    106980
     cttttaattc tttactattc tgaaataatg caaataagta agcaaccaat tcagcttcaa    107040
     cgaactttat tcttattaat cgctttccct cgctcactct atttatcagt gcagcagaga    107100
     tgcactgatt aaagcttcga tctgcatgaa atttctccaa ctttcaaatc tttttatccg    107160
     tacgccgctg taccgaaaac cctacatttt cttccaaaag cagcaaaatc atgtttccaa    107220
     tatcgagagc ctttggacgg caattgggtc gaccatcaac gttttcttcc cgttttcaaa    107280
     gtgtttctcc agcttctttt gctcttcgta gtagagtttt tcagtcggcc ccagctagac    107340
     aatatgcgac ctacaaccgt ttcaatggtt cttcgtcgtc ttcttcatgg aatacgacta    107400
     ctttcataaa tctattaacc agcagaagaa ccatctactt tggtgtaggt ttcttgggct    107460
     tttatgtcta caatctcaat gaagcacctt ttactcacag gcgtagactc atctggattc    107520
     cctactggct cgaaactaaa atcggagatt tttcctatag acaaataatg taccaatacg    107580
     gtgataagtt ggtctccagc caagatccct tgtatgggcg aatctccaag atcatgaata    107640
     gattgctctc agtagccctt gagaataacg agaatcaggc acaaagacac catctcgaaa    107700
     gcttgaaatg gaccatccat atcatcaaag tagatcccag agagtatccg cctaatgctt    107760
     tcattttgcc caacggtaag atcttcattt tcagctcgat tttgcccatc tgcaaaaacg    107820
     acgatggctt ggcaaccgtg ttatcacatg agttatcgca tcagttagct catcattcgt    107880
     cagagcagtt gtccaaacag cccttctaca tcatgttgtc aacgcttttg tatacagtaa    107940
     caggaatcag ctggttcaac gacttgatga ttaagggttt acttgaaatg cctgcttcac    108000
     gtgaaatgga atcggaagca gatcacatag gctgtgaact tctagccaga tcttgtttca    108060
     acatcggtga agcagtccaa ttctggaaaa gaatggctca agcagaagaa ggctttcaag    108120
     ctagaactgg atctctgaga ctacaagaat tcttctcgac ccatccagcc acagacagaa    108180
     gaataaatga tatacaacat tggactccag gtttggaaat tataaaggaa tcgtccggat    108240
     gctacgaaca ccaattcggt ctctttcaag aagtttcccg caacttcttt agataattta    108300
     agcatagcta tactatgacg ttagatcatt acatttccca caattcttat atatatatat    108360
     caatagatag atcaaatatt tacagtaatt tcctcttcct cttccttttt tgtgtcatct    108420
     tccttatcct ctagcatcaa cttgctcttc aaaatacctt caccttcgac gtaccttatc    108480
     acaaggctgt ctggcttgag caagttgaac tggctgacag agattgagat gttataatct    108540
     atatacttgg gtttaatgag atttccgttc tcatcatata tgtcctcttg aaatatctgc    108600
     aataaactca cttctattgt tccagttctg tttctggatg tgatgtcttt gctggaatac    108660
     aagggcaatg ataacttaac gaagttgaga tcttcattga attgtgtttg gtcttcagca    108720
     ttgggaattt ttaccttggc cgtgatccag ctttctactt cattttcatt ggtattcaca    108780
     gagaactggt cattttcatc catgaataaa gcagagaatt tcttgacttt aggttcgcct    108840
     ctttggttta tgatgtagtc tatgattcta cgttcagtca catccactac ttgtctcttg    108900
     aaatggtccg cctcattttc tatgcctttg agaacatttc caagttccga ttcatcgtat    108960
     gtcttgaaac gaacaatgcc attctcattt tctgtcgatg taccaagtat cttgttaact    109020
     tctcgattgt actgcttctt tctaaagaac ttatacaaat agtacccacc tatagctaga    109080
     ggagggcaaa ctgtaattag cacgtcgtga tgaacatgta ctaaagtata ggcacaacta    109140
     ccaattgccc cgaaatattt ggttgttagc gatatcttct ggttccagat atactgaaga    109200
     gcattcgtat tggcgatgta ggatttccta ggagggccaa ttatgggacc agaaattttg    109260
     acgaattttc tcgtatggcg taattttggg aaattcctca aagtaacctc tccgaacaga    109320
     cttcgtatta taatcatggg cagtggtatt gatatttctc taatagtgag accaggtttc    109380
     tggtaggagt tctagagtag gcaacttttc aaagtgcgac attaagcatc acaaaatgtc    109440
     gcgcatcaat aaagtgatat caattgctcc aaaattataa ataatttcat acttgaatgg    109500
     taacattatt caaactaaca cattaaaacc tcatttaata taatcggaat ggctcgagcg    109560
     gaaataggta cagcgaagta ccaatccaag aagctcaaga tggcgggact ccagaaactt    109620
     aaattttatt gccagctttg tgaaaaacag tgtagagatg ctaatggatt caagaatcat    109680
     attgcctctc caagtcatca gaggaaaatt caatctctca atgatgaagg acaaggtaaa    109740
     acagttgtag aaaactactc agagcagttt gagaaagact tcatgaggtt gttgaggata    109800
     aatcatggta caaagaagat caatgctaac aaattctacc aagaatacat attgaatgat    109860
     agagatcacg tccatatgaa ctctacgaag tggtccagcc tcacctcttt catcaaatat    109920
     ttgggacaaa gaggtttggt acgtgtggaa cagggaggtt ccggaaacga agacgagttt    109980
     aaccttgaaa tacgtttggt agaccaatct atcgagattc aacagaacca aaaggagaag    110040
     cttaaggctg aaaacaaacg ttcagatgaa cagttaacca ataagttcct cgaagaacaa    110100
     ataagaagag ggaaagagtc tgccaaatta aacgaagaga gccaacctga agatgtgcaa    110160
     gtaccggtta cagttcaatc gggtcctatt aaggtatctt taaaatcaac aggcataaca    110220
     aagaaattac aaagaccttc taaatcaatt tttggtgacg ctgcatcaga tgacgaagtt    110280
     gaagctgaca agaagccaga gccgaaagaa actaaaggta agataaaatt cggttctatt    110340
     aagaaacact aaaatgctgt agcctcattg gagagtctac atcttgaatg ttactacagc    110400
     tccaaaaact taattttaac gatttacggt agtactagca ggataatagt ataatagata    110460
     ctttaataga tatttttatt cctatagtat aaatatgcaa ttttgtagtt cttaatcgtt    110520
     agactcgttc gtagcacaac acatagacat ccttggagtt gatagcaccc ataccaggct    110580
     gcgtaatact tccgtgaggc aagttcacct tcacattctc atcatcaaac aaacaccaat    110640
     aaggaacttt gagattgtcc aaattacttc ctagattttg attgaccgta gatttgttga    110700
     caatggatgt gtagtgcccg cttttaagat taccaaagtg atttatcaaa ccggataatt    110760
     tgtacacaat ttcatgaccg tcattattga acttcaattt caacggatat tgaatgtatg    110820
     tgtctaactt atcagtcaag ttgaagactg aaaaccggga gagttgaata atcaaaatct    110880
     gtggcaattt gatgaagttc aaactcttcg ttgaaatgtt ggagtgaatg gaacttgtcg    110940
     ttgttttcgt gctcgtctga gaagaaggcg atttgcttct tctgcctagt ttgaagattc    111000
     ctgacttctt gttgacgaaa acaggatgat tatcaagaac actgctagca gaaacttggt    111060
     ctccgttctt gctacacttg ggacagttcc aggcattttc tccactgaga acttcatcct    111120
     gggagtagta gcgtaaacaa tcggctaagt tgaccacatt cttactgcta tggctgcttg    111180
     gaatcggtag tgacaaaatg gtaaatggag aataactaat agactcatat ccacaagaat    111240
     tacatgtcaa tttgttttgc aagtggccct ggaaaagatc atggactgga gacgttcctt    111300
     ccagtttcac aagggacaag taccacttca agtattcgtt tctatccttc atattgacat    111360
     taatatccca cttacgaata tagtcctcta gctcgtagtt ggtttcaatg ctcttattgg    111420
     acaactccag atgaagtctc tccaaaacaa agagtagaaa ctcctgtgca tcctgctgtt    111480
     cgtatggaat attgaagtct ggcttcaaca aggacgtcac tctgatgaac tttgtaggag    111540
     ctatagaaac acttccatgc tgtgagaaag ttcgtaacaa tgctgaaatt gcttcagaga    111600
     gaagaataga atctttgtgg tgactgttca acttcagcga caggataagt ctcaagtact    111660
     tgggatcctt gacatatctc tggtacgcca ggttgatgaa caacgacttg aacaacagaa    111720
     caccgaatat caactgtatt gtcaggttga tataacagga agaaccaaag tttctcaatc    111780
     cacaaacaga atactcttgc atgtattgct gcttctgagt tttgatctga tactgttgca    111840
     tctgcacatg ttgaggaaca gaagagcgag gtgctccgaa atgttgcaca ctgctaggac    111900
     cattattgtc ataataacca ttcgctcctt gttgatttac ttgctggcct acctcttgct    111960
     gttgaggata gttaggaaat gggttgttgg attgttggcc attgtgaaag acattattgt    112020
     tattcatgta gtggttattg ttaccattct gttggtggat ttcgtgacta ttgtaatgga    112080
     cattgacgtt tgtaggcagc gtcaccggcc tagctatggg aatcgtttgt ggaggacggt    112140
     gggaaatatt gccgctattg ttctgtagat tgctatatga atttgtattt gggtttgcat    112200
     cagtaggtga tttttgtgga ttcaggaaat accactcgtc tgtatcgttg gccaattctg    112260
     gagcaaccgg agatctcaaa cccggagata ttggcgacgg aattggtgat ctgcttgtaa    112320
     tttcgtcagg aggatacgga gccgaagctg taggtgatcc tggaaacgta ctagctctat    112380
     ttggttgtaa tgtatttgca gcagaatgag gcggaggagg tggcggagaa tgtggaggaa    112440
     gcaaagatgg agaaaagtgc tttggaattg gatgtggaat atttggaggc gaaggtggag    112500
     gaagcttctt agaaccaaag agcgatgtat catttttccc atttaaggac ggaaatctgt    112560
     gcttgaattc tgagacagaa tcgcttggca gaagggcctc tttttcttga atgtattggt    112620
     catagttatc gttatagtct tgtctagtgt cgctaccata ggtattttga cttttatcgg    112680
     ccactgttag gaactcttca ctagagttca attccgggtt caaaagcggg ttcaaactgt    112740
     aagttttctt tgactttgtg atcagagaat ttccattaga cgtctgtctt gttgaagacg    112800
     acgttgcagt ttcgacaaaa agatcaccat ctgagcgcat ttcgtcacca ctggagatat    112860
     tgatttccac catggatcgg tctttttcct tgaggtattt tatatactca tggagccagg    112920
     cataaagctc ctccacgtta aaactaagca agtttgagtc gacaaggtac tttttgatgt    112980
     agccgcgaag cgtcgccagc gaaactgtgt gtgagctgtt tcgtataatg tcgtcagcgt    113040
     tataaaaggc aaatacattg agatagatga tgaagtcctg ctcgttggac tcgacaaagg    113100
     cgtcaaagcc cttaaagtgg agcataatga agctgttaat gaaatagttg aagatcaagt    113160
     atcccttgat gtaattcttc aatccgttgt ggtgatcacc ggaagagaac gccgtggcag    113220
     acttctcgta taaaagttca cagtagtcaa tgagatcaaa tagcgatttt gacgctaatt    113280
     caggatcgag ctggaggttc cggaattcgt ggttgatcac tttggtgtaa tactgttggt    113340
     tggacttgtc attgacttca ctattcatat tcatgccgtt accaatatgg ctgacgttgt    113400
     tgttgatgtt catgttcaca ttgctattca tgttgacatt actatgcgta tgatttgtat    113460
     ttgcgttgta gttgttcata ttcacattca tatttgtatt caaatttcca tagttagtgc    113520
     ccaccgaatt cacattcacg tatttagatc cgctgcccac atttgggggg gaattcggat    113580
     acgacaacgt gttgttatac atcagtgtag gtgtccatgg aagaagattc agagagaaag    113640
     aagagctggg gagccgtaga tgagagtata tatattttca gtgacgtaag gagtctggat    113700
     ttgatttgaa tttgatggca gtgtgccggg gccagatgaa ggaagccgag cgagaaaagc    113760
     agacgtacaa acaatgccaa caagttacaa atagcaccaa cagtatcaag tagtatcttt    113820
     atagtaacaa attacactct taccgcgaga tgagtacagt accaaagtag cagtatacca    113880
     ctacaatatt gctacgaaat tcagatctag taaatcatcc agatcatcag agaaatgatg    113940
     gctgcgcatt ttctatgctg agaaatttca ctgagccatc attctaccgt atgaagtcta    114000
     cggactcagc atttgtgtaa ggaaagaaac agctttgctt tactaccaga aagtcgttcg    114060
     ctgccggtga ctcaaggcta ttttgtattt atatgacgct tttcttgctg aaaggtgcta    114120
     atgatgctta gttatctgat cacgttcgct actgtcacaa catctgatga tttgtagttc    114180
     tgatttatgg tgctacaatt gaccgatcgc tattgaaatc ctggttctaa tactctacag    114240
     ccagatactg gtacttctac tctgccggtc tctatatttt atctattttt atctatttct    114300
     gacactgtct tctcttcttc cattctcata gttcatataa atttttcact ttgtatggct    114360
     gcgaatcgcg gggtttcacg aatagcctct tacgacagat agatacagca aagttaaacg    114420
     atctctcagt atctgcattt gtgaccattt cagacagatt ctacttctcc tctttaatct    114480
     tatttagcca tcagatcgta tcgtgcttct ttttattttg tggcacactt ccgtatcgtg    114540
     cttccgtccc gagtccactg agcctctttc catcactatt tcagtcatgt tctgtcattc    114600
     caccaaagaa caaaatccta cacgaacaaa gagctcatac caagaaaaat acaagaatac    114660
     taatattgaa gtgataaata ttgtatagac aaatactgac taatatgaca aattgaaatg    114720
     catgttgact ttgtacaatc aacatgattt ctctattctt tacctttttg agctcttcag    114780
     cactttccag acaacgaaaa gtcggctacg atcggacggt ggtcgctcat gtacgaccct    114840
     ccgaacttgg aatgcaacat gccgaatcct tgcaaccgca agaagagctt gttggctgct    114900
     gagttgacgt ctatagaatc acactggggc ttgtcgctca ttttggccgt gtacttggga    114960
     gcaaaaatgt agtcaatact ctgacctcct tgaagcaata cttcaccttc aaagcccgtc    115020
     actgacgatt tctcatgacc atacctgttg aatggtgtag acaatgttga aacatcactg    115080
     aaagattcct ccaattgctt gaaggcagca tcatcgggct cggtgttgaa atctccacaa    115140
     aggaacgagg gccagctgtt gatgcttttc atggtttgtc caatcaactt gaccgaacca    115200
     atttttgact tctcaccaac gtgatccaaa tgggtattga atacatttat atagttttct    115260
     gaacctttgt gtttcattgt gacatatgaa actatccgtg gatattgagc atcccagcca    115320
     gtcaatgaca gcctcgtatt cttctcgttc aaccagagag aatcagaaaa aactagttcc    115380
     cattctgact ccttatatat aattggaaca aactctccaa gctccatccc atcaattctc    115440
     cctactccgt agtacttcca gtcctcattt ggtgaataac ggtttaactc tttcatgata    115500
     tcgttcaact gaaatttgta tacttcttgt aaacacacaa tagagtctct ttgagcgttg    115560
     aaatgaatgg aagccgtgat ctttctgaac ctttttgtcc agggctcttc acctggaact    115620
     agagccttat ggcccccgtt cttgacgtta tgagaatata tccggaaggt ggcgtctctt    115680
     attgagatac gaccgaagtt ctgaggcaac tctggaggtg ttttatcttc catatcaaaa    115740
     atctcgtcac ctataaagtc gtgaggaggt acaccgatta gctctggctg tttgtgaatg    115800
     tcatcgtcat aaatatcacc aatggcgtcc aactcgtcct ctttcaactc gtgtagatca    115860
     cctaagaaat tcttgggatt ctttttgtac atgcccatct ttctcgtatt ctcttctaat    115920
     tcttggaaat gatccaagtc accaatatct ggaggaggat ggactcgttc gggtaaaaca    115980
     ccatcagcaa cttgagctac tggtggaggt ccatcgtcta tgggattctc ttttgtcgct    116040
     ttcacaggct tacttttact acctttcttg ggtactttat cgtcagtcga cggacgcttt    116100
     ggtgccttcc tattagccag aggatatctt tccgtttctt catcttcttc tacttcttcg    116160
     tcggcatttt ctttgcttgg ggccttacga gaaccgtatg atttctgacc tagaaccagc    116220
     ttcggcgaag tcgattgctt gttgcttttc ggtgaaatca gcacctcgta agtctgagaa    116280
     cttttccatg tgagaaaagt caacagaagc aatataaata cgacaagtgc caagagacga    116340
     ttcctcttgg tgctttgaag tcttgtcatg tttgaatgcg tgtcaagtat gtcactctat    116400
     gatttatagt gtttctcgat ttcgaaacaa cttcgatggt ctttccttat gcacacaaat    116460
     gacagtgata ctattgggat gtaattgtta atattgagga agtattttct agagattcag    116520
     cggaatagtt cataaaatta agaatttgaa tcggttcctg aattattcgc attaagtcac    116580
     atacacacaa aatcgtactt tcattttatc atttacttag agacaagact tttttttcat    116640
     agtctataag tcaccatgaa gagcatttcg gattcgaaca gcaatctaga agaataagaa    116700
     tttacatact agcctacttc tattttccat ttttttgtat tttctattaa ctaatctgtc    116760
     ttccaaggat tataaccaaa ttgtgccttc actgacactt cacagagttg acagcagctt    116820
     cctcgcgaac tgatgtcgat aaaaaatata aaaacaactc cgtgacaata taaatacgtc    116880
     tcaagagatc tccgatattt ctcctagaca acaacctaat ggtgtctgag aatgaaatca    116940
     taaatatatc tctgagtttt ctatttttct ttcttgtgaa ctcttatttt ctgatcttgt    117000
     ttttcttctt tcaacatatt ccataagcct aactctttgg aatgttttcc atcttgaccc    117060
     tgccggtctc gatccaataa ggatcaatga gcttttcctt ttcttcatac atcaccttgt    117120
     aagaagtctt gattgtaccg tcactgacac cggtcttgtc agagatcttg gatgggggta    117180
     agtcgatgcc aaataccaat gctgccatat aaataacagt agcagcaata gttgtaggcg    117240
     atctaccagc caaaacacct acttccttac atcttctagc tatgtactca gcaccgttcg    117300
     tgacttgagc attcaaaccc aaatgagaac agtttcttct gattaagtcc tcagctgtgg    117360
     tctgcgtggt ttgcatgttg tcctggttga acatcaatgc atttggatta gctgcgttct    117420
     tttcttggat cactttgtca ataatcttga atacttttcc tatttccttg cgggggacat    117480
     tggttaaggc ccagatctcc ttgaatgaac gagccacttt agccttacgg cagccaataa    117540
     agatagcagc agccatgatg gactcttgag atttgcctct caatggtctt tcatcataca    117600
     ccaacttata cacttctttg gcaccatcct ggacaatctt aggcaactgg taaccatcac    117660
     acatctgtga gatttttgca tatgctgccg ccaatgcatt gtccttcttg tctacaagcg    117720
     atttggactg agccctattc aattctcgtc caactctggt gttttctggc acgtatgaaa    117780
     tcatagtcga caaatcctct gtgtccaaca acggattccc agcatctcct acacgactgg    117840
     ggtcgtctcc gttctggtcg tcgttgctga acgttctcca ttcggatcta gtatccacta    117900
     cacgatcact gaggaccaac ccacaactgc cacaaacgat atctccttca ctaaacctct    117960
     ctatcaaatc aggggggaag atcttacatt cgggacatgt caacgtgacg ttgagattag    118020
     gaccgagaaa cggctcgggg ccatttgaca gcacggcagt agcagcacta cctggagcca    118080
     tgttttttag cgttctttta gggtgaagaa actgctggtt gagtcgaact gaagccgttt    118140
     cgaatctgct tattaatctg atggttgtga acttcggaaa atctgaaaaa aaaacttgca    118200
     gctttgattt cagtgataga tccagtagcg tcacaataat caactctaag gagataatag    118260
     attaagcaag aaagagacgg attagtaggc tgaagaaaag aagatggtaa ccctctgttc    118320
     catttcaaac tgatgataaa ggtagaattt atcatgattc tcgcggtcgt gcgcaggtca    118380
     cgtttttgca cgtgacacct gtggtacaaa atagcagatg tcaagaatgg taggaaaaag    118440
     atacagaaat atgtaatatt cccatagaag taaacacata agaagggaca gccaaatgac    118500
     aattcaatta aaaaaccact taaaattaga agctctaacg atactttctc ttttttacta    118560
     aatggcctgt agcatgtatt acgaaaagcc ctccaaattt cgccgtacgt taattggtag    118620
     cgccgattta catcgctcca caaagcaagc aatatttttg agcaactatt ggttgtatag    118680
     tgtagtggtt atcactttcg gttttgatcc ggacaacccc ggttcgaatc cgggtacgac    118740
     ctattttttg ccttttactc ttttgaactt tattgagacg ttctgttaca ttaagacacc    118800
     aagatatatg ttcaaatctg aagacatttc acctctgtgg attgcgaaaa agtgaaaaat    118860
     tttgtgagtg aacttttgag attttgctac agaatgctcg agttttcaat ccttagagaa    118920
     gcctcacaaa gctaagtata tacgataata tagtagctac aatgctatag ctacagtgtt    118980
     gggcggtagt agcctatcaa tgtaaccata ttgtcttctc tcctttatct tacttcttgt    119040
     tctttttaaa gttctttttt gtcgcattct tacgtcagca tcagacactc ggttcctcat    119100
     caaatttttc agttgatttt ttttaatagt gaataacttg ctttcacctc ttctccagtt    119160
     attaccccaa ataaaccatg tctgctgtaa ttggtatcac tttcggtaac acgtcgtcgt    119220
     ccattgctgt cgccactcaa gatggtaagg tagacgtcat cgcaaaccca gacggtgaca    119280
     gagccattcc ttcagcctta tcgtatgttg gctccgatga ataccacgga gtccaggctg    119340
     agcaccagtt ggtgagaaat gccaagaaca ccattatcaa cttcagagac tttattggta    119400
     agagttttga cgaagctgaa accgctgctc catatcatgt aggtgctcca gccgtcaaga    119460
     cagccgatgg aaagattgcc tacgacattg tcagagatgg caataacgag ctcatcactg    119520
     tagacgagat ttccaagaga cacttcaagc aacttaaaga tgctgctgaa gactacatag    119580
     gtaaggaaat cgaaggtgta gttttgactg ttcctactga cttcaatgag catcagagac    119640
     aacagttaac ttccattgct actgacgctg gcttaaaggt attgcaattg atcaatgagc    119700
     cttctgccgc tttgttggcc catttgtccg ccgatgagga ccgtttgtta caggacaaga    119760
     tctacgttgt agctgatttt ggtggtgtca gatccgatgc agccgtcatt tctgtgagag    119820
     gaggtgtctt gaccatcttg gctacagccc acgagtacgg cttgggaggt gacaagttag    119880
     acgaggcttt ggctgaatac ttcgccaagg agttcgaaaa gaagaccaag gtgaacccta    119940
     gaaccaacgc cagatccatc gccaagttga aggccgagtc tattgtagtg aagaagacct    120000
     tgtccaatgt tcagacttcg acctgttcta tcgagtcttt ggctgagggt ttggactttc    120060
     acacttctat caacagatta agatacgagt tggctgctag acaaccgctt tctgaaatga    120120
     ctagctttgt agagaaggct gtcgccaagg caggcttaga taatttggat atcgacgaag    120180
     tgttgttagt tggaggtgct tcgcacactc ccaaattggc cagcaacatc cagttcatat    120240
     tcccagaaac cactactgta gttgctccag ccttggaccc aaaggctttg aatcctacgg    120300
     aattagtagc tcgtggagct gctttgcaag cttctttgat tgaatcgttc gacgaagacg    120360
     aaatcaagga gtcgttacag ccaatcgtcg tcaacaccca gcacttgacc aagcctattg    120420
     gtatcaagga tgctgagggt aacttccagt ccatcttggt agccgaaact gcctacccaa    120480
     tcaagagatc tatccaagtg accaacggtg aatctgcttc tgtagttgta gagttgtatg    120540
     aaggtaagag aacaatcaag gaaaccgtcg ttgaagctga gcctgtttct gacgaagact    120600
     cggaagacga ctactccgac gacgagccag aagtcaagaa ggagcttgtg tacgaagctg    120660
     gttccaagtt ggctgagtta accttgaagg acttgaagcc aaactccaag ttggaagtaa    120720
     ctgtcaacat cacccaaaac ggtactttgc acttgtctgg aagagaattg aagcagggtt    120780
     ctgttgctgt caagggtgaa atcacctctg cttaatagag tcaatacatg aaagtaaaag    120840
     aaatgagtgt agagtagaag tgagaactat ggtatcattt tgtcaaaact acaataaatg    120900
     aactttagta gatctacaag tagcatggta aaagattaat tgcaacatga atagaaccat    120960
     aatataaaaa ttgtaaaaaa tgtcaattct acttcttaaa ataccgagac atatcatata    121020
     ttgtatccat atgatcttct aatatcttaa tatgctccgt agtgtacgag catctcctta    121080
     catatcatgg tggttgcgaa atgcttatta gggacagaat caattaagga gcaccataca    121140
     ggaaagtgtc aagatataaa agccaaagtg tcgcatagag atagacttga attttgtgaa    121200
     tctgttgggc ttctctttta cgctaattcc attattttca ccattttcac cctattggca    121260
     ccgccgtctt gacaacatgg gcaagaaaaa gcaggagatg tcgcaggtgt ataacaattc    121320
     caacaacgag ttcattttcg gcgaaaatgg tggaaaaggc aaacatctat catccttcct    121380
     caagaacctc tccttgacag gcacatcctc cacatcttct gtccatagtg cgaacacaga    121440
     caatatccac gagatcaaca gcaacatcta cggaacgttg ggctactcta gctccaaagt    121500
     cagctccaac cagagcaaca gtgggtctat aatctccaat gtccagaacc ctactagttt    121560
     cactagacct cctccaaagc gatctgtttc ggtaggagct tcgtattcac atctcgcatc    121620
     aacacctcca ccagatgctg gaggttctag aacttcaccg tacatggctg gaaatccctc    121680
     tacggcttcg aatcctcaga tcatgccttc acatcgtaga tctcattcta acaccaagta    121740
     caaagaccta gacgacgact gggacgccga catcgacgtt tccacagaca gtgtagttag    121800
     aaggtcgccc gacaacagaa atctcagtcg agtgaccaaa gtagagtcga atacgtcgtc    121860
     acggtcttct ttcaatctcc agccatctcc catgctcgac tcattgtatc ctgacttgac    121920
     ccttccagcc acaaactctt ccgtaaactt aaactctcaa aagccaacaa acgaagagtc    121980
     gcttgatgtg gaggactacc gcaccaccat ggagatcaac cggttgaacc agatcagctc    122040
     gagaaacaat aagttccgta acatccttat ttccgactcc atcgtcaacc tccaggatct    122100
     tcgtaaacta gcctggaacg gcataccctc agaattgaga gccttgacgt ggcaaatcct    122160
     cttaggatat ttgccgacta acagagctcg tcaggcctct accttgaaac gtaaaagaca    122220
     agaatatctc gaagggctca atgcatctac catagatttt gaagatacag ctccatctaa    122280
     cagctcttca gtatcgcttt ccaacagcag cagtaattcc cgtgaaaaac agttgtatca    122340
     tcaaatcaaa attgatgtcc gtagaacaaa tcagagcatc aagctctatg gctatcctga    122400
     gacccaacaa tcattacgga aattattgta tctctgggct gtaagacacc ctgccagtgg    122460
     atacgtccag ggaatcaacg acttatgtac gccgtttttt cagatcttct tgttgaacta    122520
     catctggcaa cttcaacgta gaagggctgg tggagctgac gaacacaacg aagattctaa    122580
     gctcttcata ccaggcttgt tggacgacaa tgacgaaaaa gaacataaac ttttgaatga    122640
     tccaaaactc atgtcataca ctttggacaa ctttgacccg tcgctattgt cagaaagagt    122700
     actctccatc ctagaagcgg acacatattg gtgcctctct cgtttactag aaaacattac    122760
     agataattac attcacgaac agccaggcat cattagacaa gtcggtgact tacgtaactt    122820
     gatttccaag attgatttgg aattgttgaa ccacttggat catgaaggag tcgaattctt    122880
     acagttctcc tttagatgga tgaactgttt gttgatgaga gaattatcta tctcacttat    122940
     cgtaagaatg tgggatacct acctcagtga gacaccgttg gggttcaaca actttcatgt    123000
     ctacgtctgt gctgcatttt taatcaagtt cagcaacgat ctcaaagaaa aggattttca    123060
     ggagatcttg ttgttcctcc agaatccacc cactggacac tggaaggaaa aggacattga    123120
     gctcatgttg agtgaagcat tcatctggca gagcttgtat aagaatgcaa gtgcccatct    123180
     tcgttagatc ggcgctacca ttattttgca cccagcaagt tgacgagcaa tagaaactag    123240
     aatcacaatt gcatgcgatt gaatgttact ggtaatgata acgggaatgt atcgatacat    123300
     gtgtatctat gtgggtatat atgatcattt aagtatctct aatatatctt ctcttgtatc    123360
     catatatcct gaatgcttta tccttagctg tatcacgtgc cctcatctcg ctttttttga    123420
     ctcggttgcc taatcgcgcg aagcttctcc atacttcact tatctagtag taatttatta    123480
     gttagactct gcgaacgtga attcatttcc tggcaatttc ttattatata taaggaacaa    123540
     gaattcaggt ttttcgtcca ggggatattt tcggcacagc tcaactcaac ttttcaaccc    123600
     tctatatcaa ttttcaacaa tatatagaac actcctcact aaaatggctt cgactgaaac    123660
     tgttactccc aagccagctg gaagaaccat tttggcttca actatagcca agccgtttgt    123720
     ggaagaggtt actggaggtt taaccaagct cgatttcaag cctaagttgg tgggtttctt    123780
     ggccaacgat gatcctgcgg ctaaaatgta tgccaactgg actggcaaga cttgtgagtc    123840
     tttgggcttc cactacgaat tgatcgacgt caacaagaat gaattagaga acgagttgat    123900
     caaggccaac aacgacgatg cagtcaatgg cattatggtg tatttccccg ttttcggtga    123960
     tagccaggac cagtacttac agcaattgat atcacctgaa aaggacgtcg aaggcttgaa    124020
     cttcttgtac taccacaatt tgtaccacaa tgtgagattc ttagatgctc ctaccaatga    124080
     gcagaagtcc attttgcctt gcacaccttt ggcaatggta aaaatcttgg agtatttggg    124140
     ggtatacaac aagatcttgc actatggaaa cagactctat ggcaaaaaga tcttggtggt    124200
     gaaccggtca gaaatcgttg gccgtccctt agcagccttg ttggctaacg atggtgctac    124260
     agtttattct gtggatatcc ataatgtgca gcaattcact agaggagacg acttgctggc    124320
     tcagagacac aaggtgatcg acttggacca gaacgaatac tccatcgaaa agattgcacc    124380
     tctttgtgat gtaattatca ctggtgttcc ttccgacaac tacaagttcc caacagaaca    124440
     cgttaagtat gggacagtag tgataaactt ctctagctcg aagaacttca acgatgacat    124500
     caagttgaaa gctggcttgt acgtaccttc tatcggtaag gtcaccattt caatgctctt    124560
     gagaaacttg ttgagactta ttgagaacaa gcaaatcaga ttggccaaag agaagaagta    124620
     atttgcccgg agaaaatccc attgcaacta ctgcaatgtt aatgtagata ctactactac    124680
     aatgacaaca tacataacga taacataaca aaacaaaaca tagcaaaaga attgcaataa    124740
     ccatacaata tcattagtat aaacaagaat gcaagaatat tacgaataga gccatatcat    124800
     ttttatcatt aacttcagat tccattccat tcccattcac tcctgctcgc ttatggctcg    124860
     ggatgagcaa cggttggtgg ctacagtact gcgtcaaggg ttttgttcat tatgcaggat    124920
     tttacatgga gtcaattttt tcttcgattg actctttcct agcagactta caagatatcg    124980
     agtccacagc tggaagaggt tagatctcca acaccatcac acaactctcc aagcagctat    125040
     ccataccgca aagacgactc cccagcatta gagtattata tatttagtct gtacgtaatc    125100
     acgagtttct ggttattgac aagattatac attgtacaag gtgcaacgtc tgtagaatat    125160
     cgattcgatt gatttgctga acatcttacg tcaacttttt atacttggaa ttcaaaattt    125220
     cacctgaaag cgataccctg ttccaatatt tggattaaga acgtgcttga ttataattca    125280
     gtatcattat ctgattgtta gtagtgaatt tatcacctga tatcaagacc aatatcattt    125340
     tcgtttcact tggttcgaaa gctatataat cgatgactga tctcaggtca gaagactcaa    125400
     tgtcttctac gtctgtctcg actccggttg gttctggtat acccagaccc agaaaaagag    125460
     tggaacctgt agatccatta gcgatatctg aatcgctagg agttcagact tttcgtagag    125520
     aaaccagacg gccgtttacc aaagaagagg atgaccgttt gaccgagctt gtcaaccgtt    125580
     attatggtga taaggtccat gacttaaact tagatctggt ggactgggag tttctatcca    125640
     aggagttgga acctaacggt tctaggaaac ccaagatgtg tcgtaagaga tgggccaatt    125700
     cgcttgatcc caacttaaag aaaggcaaat ggtcgcctga agaagatgaa ttgcttatac    125760
     gaacctacca gaagtatggc gcaacctggc tacgtgtagc ttcagaaatt cctggcagaa    125820
     cagacgacca gtgtgccaaa agatataccg aagtgttaga tccaagcacc aaggaccggt    125880
     tgaagtcttg gacacaagag gaagacttga agttgatcag tttggtcaag attcatggca    125940
     ccaaatggag aactatatgc acaaagatag ctggccgccc agcattaact tgcagaaaca    126000
     gatggagaaa gcttctaacc gacgtagtac gaggaaagtc tagcgacttt ataaaacgac    126060
     aggttcagtc cataacagat ggccttaagc tcgaagccac tgcctccatt tctaatgaag    126120
     aggatcaatt tacaaagcca gcagcttctg gttctatgga aaattcaact ctttcacaga    126180
     cttccaagtc tatacaagct ggttcgtctt ccatactgag cacgatcgct tcagtcttgt    126240
     ctgccaactc tgtaggcaca gtatcggctt ctccctctgt gtctgcctcc acgtctgttt    126300
     caggtattgc tgaacaagca ggtgaccaag ttgctctagc ttccagatcg aaaccagaac    126360
     agcgtacatc gtcggaatct acaagggagg ttgaatggag atataccata atgggaggcg    126420
     aagatgccga tttgcctcac aagcgattgt tcaacagcga gaacggtggt gccatcaaga    126480
     atcaagaaat ggtgcattat ctaatttcgt atgccaaaac tcatggattg aatataactg    126540
     tccaccaaca tatccaccac cactactcgc ctccacagca tgcggcagta gatgtgaatg    126600
     gttaccagca gacctaccag tctttattat cgcctgttaa tgctatcaat cagactgatg    126660
     gctcccatag agacaccata agtaatgcgt ctggatctcc agctgacggc cgttcttcat    126720
     ccgcatactt acttgagcct gaaactcaat taaatagaca tcaacacttc aactacttgc    126780
     cacccacgac tgaagttcca aagttgaact cttcacagaa ctcccctcat gacaatccct    126840
     cgactcatca tcaccaccac catcatcatc atcatcatca caattcatta tcgaagagga    126900
     atcgaatttt gaatgaaagc gaatctgttg caaaggagtc tgacttgctc aagatattga    126960
     atcagtcgca aatagacatg accgatactg ctaatgaaag agaaaaaact cctggtggac    127020
     atcccttgac tcctttgacg caagcagtgg aaatggctgc ggctgctgag gccaattcta    127080
     aaaagagaaa gaacacagac gaaacgagaa atagcaaaaa acttcactac gaagtaccag    127140
     acgaagaggg tttggatttt tgggaaacta tgagaaactt gaccgatcta cccaaccacc    127200
     aggtaatcca gcaatcgatg acaagaaagg ataagtctga atacatggtt tcagagccgc    127260
     aaagacaaca tcgactgcat aggcaccaaa atcagcatca aagccaacac cagagccaga    127320
     accatcagag tccacatcag cagcaacagc tacatattca tcagcagtcg atttatggag    127380
     atgatcacca gaagcaagtg tcgcaccatc agcaatactt ctccaacaac agtaatgttc    127440
     aaactggtga acaaactatc cccgagggaa aggatagtca tgatattcat aagaacggag    127500
     aggccgaagc gaaacatgaa gagatcgatg aagatgtgga tcctgaagtg ttgaacgctt    127560
     acgggttgtt ctacaatgta tacacaagag aaggttccgt gttgccggaa ggacagccac    127620
     agaaccagca gcctccagct ccaggggctg tgtatgatgc ctggggtgga ggttttggaa    127680
     tcattccttt caatccttca tagatatagt atattagata acgaattatg agttgtattt    127740
     ctagataagg atgtgtttac ataagtagag aggaccaaat gagagcatac tctgaagatc    127800
     gtctgcaagt gtattgtctc tttttgcctt tttctaagat tccaacgttt tctttcgagt    127860
     tatagttgcg aaataattgg ctgcgaaact ttgacgtctt aaaactcatc agtaactcat    127920
     aagtcacaaa ctagcagtgt gctctagaac ttcgaaaact aaggtttttc gctaggaatg    127980
     gcccaaatgc gcatgaggct cgatacgaat gtgaagcaat gagcttacac ggttttcttt    128040
     aatctcctcc tccattctac ctggtgtcaa ggccgttgcc tcgcccaaga aatagcaacg    128100
     tgtctctgag gttgacctct gtggggaatg tggctagcga cagtcttcca agcagcttga    128160
     agcaattata tacaccacac gctcataaca tagatcccag gaatgtcccc aggaatgtct    128220
     gaccactggt cggcagccga atattctaat ttggggacaa cctaccggct attgatagag    128280
     agacgatagg ccattgggcg atacggagac tgccaattac attcgaactc tctggatcca    128340
     gttggctcat gataaggccc tttgcggcta gcgtgtatac tagatagtga acaaagccat    128400
     agggagcatt gtctgagcaa ctaagatacg ggacaatgtg gaatgtgaag gaaaataaag    128460
     aaaagggcca tggaacaatc gagatagtga ggtaagaatg tcatgtagct aatgccagct    128520
     catcttagac aatggaataa aaatacaata acaaacagag tatatattat cctctggatg    128580
     gttgggttcg ctagcgagac caacaatgcc gttctagaca ccgactaggg tttagtgccc    128640
     tacgctaaag attagtagta gggagagtat tatctacaca ttattcactg atccttgcct    128700
     tacactctta agctcgtaag tagttaacaa acccgtagct ctggatcctt ccgacgtata    128760
     ctgaagccaa tgtagttctc gtacaaagaa tgcttctagt ctccttctcg tatttgtttg    128820
     ctgatctcat ggatagcttt agcgagactc cccacaactc gcggtctagt cactgtttgg    128880
     cgctaaatac ccgcgcggca gccaaagaaa aaatgctaca aaacacacca gcgacaaatt    128940
     tatttatttt gctagcgata aattttgtct ctgtgaacta gcaagaaaag ctaaacatat    129000
     tggaagccac cgatttcggg ttaaaagttg tcaaacccct ctgttcgaaa cagaacaagt    129060
     cctctgttgt cttagtcacc gtcacgatcg cttctccgcg gcaagtccag cacaaatcaa    129120
     tgccctttgc tatttttttc tgaccctcta tctgtcccta taataataaa ctacaatcgt    129180
     caacttccac aataatagca acaaccatac caacacataa ttacaatgtc agaaaacact    129240
     ctccaccaga aaccggcgcc agagctgtcc agtcctaaca agaacatcaa gaacttgtcc    129300
     atcgctgtca ataatagcgc taccagtaat actgaaaaag agtctgtgaa aacgccagta    129360
     gtgatgacag cttctacaaa cacaccatca gcgccgattc ccgacccacc agcccctgta    129420
     ctacatcctc tccatcccga cccatctaca acgagtttca aggtgcccaa aaagatactt    129480
     gtctctgaga ataaggatct tgtaaataac atcagaatgc cttcactcag ccagtccagt    129540
     ctggccatac taaactctaa tgaagcatca cataactaca ataataatag caacactggt    129600
     aacagcaata tcaataacaa tattaacaat agtagcaata acaatgctac gaataatacc    129660
     aatactacga atactacctc caacaatatg acaaatgtcg cagttagtgg ccctaattct    129720
     acagctggaa ctggcccagt tagcaatata ccgtctacgt cagctactcc caccattcct    129780
     aactcgatgt tgaacaagag cataatatca agtctcaaca agtcgttgaa ggccaaacag    129840
     aaaatcatca gtaacagaga acctcatcct aagaatccaa ccttaatctc agatatacta    129900
     aacacgtcgc cacagtcaac cattttcccc aacaatatat cctcgacgaa taatagtact    129960
     cttgagttag actcagatag tggtgtaacg tctagtaaag caggcgcatc tcatttgggt    130020
     tctaatgctg gtgctcccat ttcaacacat caggcaccta attctctgac tatggccaca    130080
     ccaaacccca acgctgcctt cctcttgcat cctaatagtt ctacaacaaa cgtagctcac    130140
     gcatctggca gtagtcagtc taattccaac agcaatgcag cccctgtagc cacattgact    130200
     gaggtatcta acgataactc taacgatgcg ggtgtagctg agagccagac aagcgcagcc    130260
     agtaaacctc cgccctccaa aggcaaacag aagaaaattt cgaaacagaa ctccacgaga    130320
     acagacttct ttgctgcgaa attagccagc gctgtagatg atgttgaaag cagtgatagt    130380
     gacgagacat ttgtctacga gaataataac gattttgaga ccatgagcac gacaatggcg    130440
     actccaaacg tcgctaacga tgccagtagt gttcatggta gtgttcttgc ttcagctttg    130500
     caaatgggtg gtgcgcctag tttccattca ccttcaatag cagaaggaca tactggaggg    130560
     gaatctatag ctgttcagcc ggtagaatcg atacactcga cacattcttc taagttgccg    130620
     aagattcagg ctcatgcgac gtctaacaga cctccctcta tagccaactc tttcaccagt    130680
     aactacttgg aaagtgtagc caacagtgcc aacagcaata taaataagga taaaagacca    130740
     gcttaccaaa ggtccttctc gtcttattca caagacgaac atcctggtgc gaagttacaa    130800
     gttccctgtg aaagatcgtc aaacaacata tctccatctg gagcattgga tgaaatcaat    130860
     agccagtctc atgcgccgca agggttggga attgaaggca ggtctgatca tccaagtcaa    130920
     tcaaattccc acgtagctcg tagtatcaac gatggttata acgacgacaa cttctcgtac    130980
     aatgaggtag aggacgttga gatcgacgac gagatgtcta ctgatggaga tttctatgcc    131040
     cagagaaatg ctagtgccaa tcctcaattt ggtggggttt ctggaactac aaatatcacc    131100
     aataaccaag cgtcacagac taataattct ttaacgagca gaagtacatc taagaagaac    131160
     tacaagtctt caacatcttc gtcaaagttg agatctacaa cgtcaaagct ttttgataaa    131220
     aagggttctc aaccaagaag atacagtatt attccagatg acattgacat cgaagacttt    131280
     gatgatgagc tcatatacta cgataacaac atcagattcc cttacaataa ctcaaatgtc    131340
     aatgaggcat cacctttaat gagtcaaggc cataggttgc cccactacag gtctttgaac    131400
     ttgaattttc caggcgccaa aaggccttcg ggtttgaaaa aaaagcggta tctttccacc    131460
     ggccagtcat tgattcccgg tgctgaaaat tctggtgcaa actcaccaag caatgtcagt    131520
     agtcacaatg ccgacatttt cccattcccc taccaagaac cgcaacaaaa ttattactat    131580
     gattttgatg aatatgacga agaatctcaa agaaatggtt ctaatgacaa agaccaaatt    131640
     aacagaagta tttccagagg taccaagaac ggactttata accacaacct tactgctagt    131700
     gagggccatt tcttcttgcc tcgaaaacaa tccagtgaat tcaactacca tagaatcaac    131760
     tgtatcaaat catttatcta tactttggtt agtatattgg tgattttggc tattggtttt    131820
     gtgatgggtt ttgttctagc aacgacaaaa gacttgacca aggtttcaat tacatctatc    131880
     gagaatgccg tagtcagtca agatgaactt gttttcaata ttgttgttga agcatttaat    131940
     cctggatggt tcacagttga aattgaagat gtcaatttgg atcttttcgc taaaagtgga    132000
     tacttacctg atgcttctgt acagagtctt gaagaaggtg gtttagatga tgaaatgtcg    132060
     tctttggcca atggagttga aacggtttta cttggaacgg tctacactct tgagtcgcct    132120
     atgagtttca agggtggatt cttcagtcgt gaactggtta ttcaatctgg cgagattaag    132180
     ttgttaacgc caggcaagaa ccttactaca ttgaataatt ttgcaaaggg caaaaaggga    132240
     cacaatggaa actccactga accagataat tccaagaaat gggaaattat atcgaagaac    132300
     ccatttgatt tggttgtcag agggatattg atgtacactc ttccgatggg taaggatacc    132360
     aggtctgtgg tggttgataa aattggatac attgacccca cccagatctt tagtagtaat    132420
     gtagagagta gctagtacta tttattagaa tatattgctg tattcacatt atcctttagg    132480
     aagattaaga tcttcgaagt ttgttgtaaa ggctgtcgct atatctaggc tctaacctaa    132540
     ctttaaatgg ctttggttca aaagaggtgg cacttggatt ttcgttgttc ctgaaaggat    132600
     ccaaatccat gattgctcca caagttggtg gcttaatctt gaaatagaga acaaggcgag    132660
     aggtgaacgt atacatctca ttgatggcca attgaattcc agcacacatt ctagaacctg    132720
     ctccaaacga taagtgaatt aaatcatgtt tatcaattag ctcaccagtc tctgcatcca    132780
     accatctctc aggaatgaat tcgtaaggag attggaatac acaagaatca tggttggctg    132840
     caaaagcgtt catgataagg atggtttcct tgggaataaa tgccccatta tagacaatat    132900
     ctttagtggt gattctgggc aaacctaaag gtaaaactgt gaaatacctt aacgattctt    132960
     gaaccaaagc aataacatat ggacatttga catcaacagc gtcgtcccat gcttgacaaa    133020
     tatctccatt gcttccagcc aaaagtgcat cataggcctt tttctgtagt gcagcaccat    133080
     aaaatggctg cgaaaaatgg cccatcaaat ggttgatatt taatgcagta ttatccaagc    133140
     cagcactaac caaagttaaa caaatgcttt ggatctcttc ttctgttagt ttgttcatct    133200
     gctggtcttg ttctatcttt attgttccaa cgatacttgc aacagcatcg gcattaccca    133260
     ctacaatccc ttcaatcatt gttttgtaga gcttgttcat gtatctgtcc cttctttctc    133320
     ggaactcggc cgctttcttg aatttgccag gaaaatatct caagataggc aagaagtctt    133380
     ccaagttggc aattggagat ctgaatttca ttatggcact ttcaacttca atgatttcgt    133440
     tgcaaagctt tgaatccttg ccaaaacaat ccaagtgaat tccaaaagca aagaaaactg    133500
     agcttctcaa tgcaaattgt tggaaataaa tcttcatatc aatgtccgcc aattcacatt    133560
     tgctatttct aaacatgtta actgatggag gacctgataa ttcatggttt ctagaaatca    133620
     tttggttgat catgtactcc acttccttat cgagagttga ttttgatctt tcaacagccc    133680
     tgtggttgag gtgctgagaa atagatttcc tcttcctctt gtagctttca cctgctggag    133740
     tggatccgac tgtgaaacct ctagtcagtg acactacctg atggaaagta tacagaacag    133800
     gacgagaatt gtttgaacat gagtacttga tccacaatct agtgacatct tcaaacgagt    133860
     tgactacaac cacacttcta gaaccaaacc taatctgaaa caaactgaca ttgaatactt    133920
     ctgaccactt cataaacact tgagctgggt tgttgatgac ttggaaaaga ttaccgacta    133980
     ttggataacc gggaatcttg aacaccccca gaatatagtt gtcgtgagaa tactcccaaa    134040
     gataatacag aatggagcca gcgatgaaga ggacaaggac ataaaatact gtggtagtcc    134100
     attcccctaa tattatatga ccaaaaaatt ctgaaaacag attaaacatc gttgcttgtg    134160
     ttggcgctag agggaaatag ggtaataatt agaaatttag attcaggagg ataatacctc    134220
     tagattgatt taggtacaat tagcagtagt tgctagcgag cttggcacaa tctttgaaag    134280
     caaagaaaga tcaagggaaa tctcccgaga tagaaataaa tagaatggat gtgaaaatga    134340
     gaattgaatt gccgcaaaat taaggttgag tgagcgtatg gtagaagaaa ccgataacgc    134400
     agcgaaaaaa tagtgagcta cgagatatcg ggaaattgta cttttttaac tatattgacg    134460
     actataaggt agtatgtaca ttatgtggat gttgaatgtt actatgattt cagcatatag    134520
     ctaattatgc agaaaatggg gaaagttcag aaacaatttg actagaaaga tggctacacc    134580
     atttcttctt tctcctttcc gatttcttgg ttcctgtaaa aatcctgttg ttgctcctta    134640
     acagcaattt cgttctcttc gtttatcaaa tcgtcgatgt cgtaatcgta gttgtttgga    134700
     tcggtatcaa gatccaactt ttcctttcct cttcttctca aaccggaggc ctctggtgta    134760
     ttcaatttga ttttcaacgg aatgtcgtct ggagtgacat tgatcttttc ctttaaggct    134820
     gaagcacggg ctctgacaga gctggacgtg gaagaagcct gttctacttc atctggagga    134880
     acatatccaa actggtcgta atcgtcatgt ttctttgcta ctgcaactgg atcggttttt    134940
     ctctttggtt tctcgacttt gtaagtagct aaaccagagg catagggcaa gtacaagacg    135000
     atggccacaa gcacaattgc aataaggagc acaagaaaaa acattatctc aagtctataa    135060
     ggattatcca ccggttgaga taaaaacagc gaagttattc ttgcactttt aaccagagaa    135120
     agcgatcgat gatgaggtct gtgacgttcc cgagtcaatt atgtcacttt tcagccgttg    135180
     gcagccgaca taaaatgtcg cattttcgct gcgcacaaat atcgctcaat ttcgctcaat    135240
     cacagcgact tttatgtcag ccgattattg caactatttc ttcaccactc gtttagactc    135300
     aatcgaacga cattagttta ctttgtttta cagcacccgt tgcatgcatc ttgtcttgtt    135360
     gatatcgaca aaatgttcag gcaagttttg cgttattccg gtcgattctc gtctctagga    135420
     gtgagaaaat acgcaccagc catagctcct agagccacag tgttgagctc tccaaccaga    135480
     catgtttctg caatggctac tagagcctac tctttgagca catcaggcga agacattgag    135540
     gacaagattg atcaaatcag cgtcaacgaa tacaacagca tcagcgaaga gtatttggag    135600
     tctttggccg attccttgga agacttaagt gaaaaatacc cgcagatcga ctgtgagtta    135660
     agtcacgggg tcatgacatt gacgattcca ccacacggta cttacgttat taacaaacag    135720
     ccacctaaca aacagatctg gttgagcagt ccagtgagcg gtcccaagag atacgacttg    135780
     attggcggtc agtggatcac gttaagagat ggctccgcct tgacagaatt gataaccgag    135840
     gaagtttctt ctgctctagg tacagaagtc agtctcgaca tagaaggata gatgataagt    135900
     ggagcaccac gtagtatatg accaagcaga catatcagtc gggtcgtttg tcgttagtac    135960
     tgtaaatagg atatgatcgg ccgatagcaa tatgaaaatg gaatatgacg aaattgtaga    136020
     aaatcacgtg tagcatacga ttgcgtgtgg gaagttgttt gaaagaagat gcgatcactc    136080
     taagaatggt aaagaaccgt tgggtctaac taagcagttg catattaatt ggggtcaacg    136140
     tctaaagacg gctgagtcag atgatacgag aacaaagatg cgccagagat tttcgtagag    136200
     gttctctgcg gaattaggtt aaacttcgaa gtattttcct gcaatagaac aaatctgtga    136260
     tctgctaaag gcacagcaga cgcagctaat gcgaaagtcc acagcgtcta tttcaagtgc    136320
     tccaaatata gcagaatctg tcaaaggata tgttctccat agtataattc cagcttagtc    136380
     ataattgcag gagtatagcc catattggcg tggagttaga atgaaaatca gtgatggatc    136440
     gtttcagtct cagtgtcatc tcagtagtgt gttccaaaat ttggtgttgt ggccgataag    136500
     cctcatacag gctcgagatg gataggctta gcacgttggg taaagtgatg atcagattgc    136560
     cgaataccat atgcttcaca aaatatcgag aaaagtagac acggcataga cagaatatca    136620
     tcaaacacaa ttgggtagga tctagccgca cgggcgaagc agccgtagat ggtgaccaag    136680
     ttaagttcgg gatatacgag tgagacaatt tcacattcca ctactatttt agcttttgtt    136740
     accccgttgt ggattgtatg taaagcaatt gctcaaatat aaaaccagaa atttctggtg    136800
     tggacgtttt gtcttttgta caagtgaaat ttcacgtttg tagaattcag tcctagacca    136860
     attcctaaac gaaattcaac tcttcaacta tagttatgtc tgaaggttac gatagacaag    136920
     ccccagccgt tcctgaaggt gaaggttcga ttcccgtgaa ccagtcgggt tctgaatcga    136980
     gcaaccagca gcttgaaagg ccccgtcttc cccaattgcc agaaggctgg atcgcacaat    137040
     gggacgatga gtacaaccac tatttctttg ttaatactgt taccggcgaa tcgcagtggg    137100
     aaattcctga gtctagtgtg ccaggtgcat cagaagctcg ttctagcgag tttgcacctt    137160
     ctgactcaaa catcgccgac aacgaatctg ccgaaagagg tattggtgga gacggtactg    137220
     gcgaaagggg ccttggtagt gtagtgggct ctcttttact gggaggtaac tctggccatc    137280
     aatccggagg cacttcaggt cttattagct tagtcagttc tttggcttca tccaagacta    137340
     gtggaggtta cggtggaggc tacggtggag gatatggtgg aggatacaac cgtccatcac    137400
     acgctccagg tagtggtgga ggtgctggtt cactcttagg ccttttggct ggaggctcta    137460
     gtggaggtta cggtggtggc tatggtggag gctacggtgg aggctacaac caagggggct    137520
     caggaggtct tcttggagat ttgcttggtg gtggtggtgg tggctacaat caaggctacg    137580
     gtaaccaggg ctatggaaac caaggtggcc atcatggtgg acaccacgga ggtaatggtg    137640
     gcttcggtgg aggattcggc ggtggattcg gtggagaagg acgtcacggt ggaggattcg    137700
     gcggagaagg tcgtcacggt ggtgagcatc acggaggtgg tcgtcacaat ggaggaggat    137760
     ggtagaatac caggtctacc gctgttgaat tgtatctgtt ttatatactg agtatatatc    137820
     ttcgaatcta agaaaattga atgagctagt cttgctgtgt atttatgcta gtatagtaaa    137880
     gcatgttttt ctactttgtt tcacatctaa atgaattcat attcttggta atcatctggt    137940
     tcatattcag tgttcgatcc gtcccttttt cgcaacctca gcaagtttta tagaaaacgc    138000
     aatttgtgta caataatatg ctaaaatgta ttcaaatata ttatattcac cacggatcat    138060
     ctacttgttg tcatataatc aattgccata gaatatactt atacttcatc ttattgtttc    138120
     ttcatatttg gcgagctcaa attcttcaat tgtcctccat tgctaaatcg cagcctcagt    138180
     aatgtatggg gttcttcagt gcgaatatcc tgataaatct tgtcttcact gatgacatct    138240
     acatcgaaga atttccaact caaatttttg ccttcagcaa gcccaagcat tataatttac    138300
     cgttgtatag ttcgccaact cactgctaca ctggtctact tcaaattttg tatttcatag    138360
     aagttcttct ttcccatctt tccgaagcgt ctatccctat gaagaatcac attaattaat    138420
     cttatttcac acctcaagat gacacgaaat agcacgtcag atgcggtaaa tgtattgccg    138480
     aatgctgtgc aagtcatctc acaagttgct ggagctggtt catcacaaag acgagaaatt    138540
     cacgtcaaga tacgactacc aaaacaagag ttgtccaagt tggaaattga agacgttgta    138600
     gaagacgacg acgacgacga agacagcatc cttagaagca gccacattat accgacactt    138660
     cctacaacgt ttgagtacga aagtgaagac cctttttcgt cagaaggaga tgaatttctt    138720
     cttgatgctg agttggataa ggcgataaag tcagtctttg gcgatactcc tgcctcagac    138780
     actagtagtc cttctacgaa agatcatcca aggataacca caaggaaacc tgattttcaa    138840
     aaggaatcca ctccgttgag atcatcccag agactaagag aaaagattca aaaacaagaa    138900
     aaatttgaac gacagatagt aaaagagtcc gtcgttgtac ataaagacca acatcaagtc    138960
     aaaatcgtgg acgggtacaa gccggtacca aaacatatac ttcctatgat tgaacaagag    139020
     attggagcca tgaacgatga gtttgcaata gtagacaagt tcattttctc gttgaaagac    139080
     cccttaggtg caagcaagat caagttgcca gtgaaatcaa tgtattgtat ccattttgaa    139140
     tgctttgatt tcaacaactt ctgtcttttc aataagatcc caccgggagt aaagttgttg    139200
     gtcaaaaagg atctagccaa gaagagcttt gagagcatca agctccgaaa gcgggttcat    139260
     aaagaagtca aaagcgaata cgtgaccatt attctggacc caaaggcgta tactgccaag    139320
     ttcattgcac caatgggacc tatctacaag tgtcccatat gtgaccgtag ttttccacta    139380
     agtgagctag ttatgggcga tgcctacaat tactttgtca agtctacacc tgtagatgct    139440
     gaacgtgtag agctactaga tatgaataga tataaggtat tagatgacaa acgaataccg    139500
     aaggctgttg aggaagaaat tatagtcctt tcagatgatg acgatgataa taataatggc    139560
     attgtcaatg ctaactatga tgacaaagtt aatgcaaatc aggcggatac agttggacta    139620
     gcactgcttc aaaatctact gtatgatagt ggagatgact tattcgatga tggtcttgat    139680
     gaagagattc tcaatcttag tgaatcagac taccaaaggt tcggtcaagg tagcagctat    139740
     gacgatcctg tgaccataga ctaggaattg tatatatgta tgtaacataa agataatggg    139800
     ttttgggata acgaatataa aagggtcgtt ggattcaatt tttgataatt actttgtagt    139860
     aaaactatct tgtttataat ttattgatag tgatgtcatt actgttgtat ttattaattc    139920
     aaatttgatt ttcgatttcg cacccatatt tatatagata atattcaatg ctcgcagagt    139980
     gaaaactgtc tcttgaatgc tcccaagtca ctaacttgag gatcgttgtc agctgctgtt    140040
     ctttcatcca tgagtgcttc tcttactttc tttgcactag tcaaatctat gggccagata    140100
     tttcctttct tcaaatccaa gatttgtttc atgatattat cagaaattag tgtggaattg    140160
     agaggtccag ctttggcatc ttcatcatgt tctttgaaaa gccccaaatc gtcccaccat    140220
     tccttctgtt ggggaggaac ttgatcagta gtaaccacca aatcattgta cggatcaacg    140280
     atgaaaaaac aaaggatctt acggtgaccc ttcttggact tgtcggccaa ttcgaaggta    140340
     tcaacttggt gttggaatat attggggaaa attacaactc tgtcttctcg agaaataaca    140400
     tgtccaagct cttttaccat taaatcttcg tcattgacac caaagatctc tcttccgtag    140460
     tcgtcatcgt tttgctcgta ttctggatct tcaaatccag ttctaaactt caacttagat    140520
     tccgtgatgt tttctgaatc atagtagtac aaaacggtag caacaatgtc ttcgttgatt    140580
     gttccttcca catgccatgc tcccccttcg taggtgggcc tctctggagt caattcaatg    140640
     ttcgccaact tgacaatgac cttcaatttc tggaagtccc taacaacatc gatttctttg    140700
     tcgataatag ggccctgatc gtaaatggga gtgaaagtct tcaaatagtt gactctatta    140760
     tcttgaagct cgtcccagat ctcatccgca accgcatctt ctccattcca aatatcctca    140820
     agtttttgct tatactcatc caggtatgca tcgttgtatt taggaatttc aattctaatg    140880
     tattccttgg aaacagcctt agataagata tagttcaagc caggcaaaac agagttgaaa    140940
     attgcttgga ttgaggagta taacttggca tgttttgctg ggtgcaaatt gttgatgtag    141000
     gaaataaact caaagctgct cagtgctttg ttgaatgata atagagcagg aagccattgg    141060
     aaattcttcg aaatgccaaa gggcatgact gcatttttga aaaattcaat tttctcctcg    141120
     tactctacca cttcgacctg gttcttgttg gaagaataaa ttggagtaat gccgtattgt    141180
     aacggaaaca aagaaggatg gactaagtca atgaccttgt tatctgtttt tggatggtag    141240
     tccaaatcgc caccaaagga ttctgctaat ttatcgatgt ctctcttgaa ggtggccgcg    141300
     agttgaggat caatggcttt atcagcaaag acaatcttat catcacatcc aatggaatat    141360
     tccttgcctt taaatccagg gaagtcgtgt tcagtcttct cataccattc caattcgaga    141420
     aaaacgtagt caattacttc atcaatgagt ttagtcctgt cgttgtagaa gtccttaacc    141480
     tcctgtttcc atttggccga gatcgtagga tctttgtact ttgctttcca gttgggcttt    141540
     tgacggatac tgttggaaat ctcaataatc aaccattcgt ctttgcattt tatggttgga    141600
     cctactcctg tgtaggctgc ccaccatggg tgtttaaacg gagatttgga tgctatcttt    141660
     ggtctacggt acattcttgg tcgtaattag actaaatgaa gatgtgtcta atcaaacgtg    141720
     caattcacta cagcttcaat tggagatata aaaatgacat tgttgaattc tctatcgaac    141780
     cttttttgtg atgtagaaca catggagaga caagaaatca tatggccaat ttgtggtatc    141840
     cctgattgac ttcgtaattg aaaaagcaaa atgcttggag acttcctaaa gtgagtttgt    141900
     gttgcaggaa acaaggaggc gggttgcaga tatggaacag aaatacgagt tgtcgaagag    141960
     gagaagtttg agcagtgtta attaaccttc acagatttaa ctgaaaattt tacctagcaa    142020
     attaagtaat ttttgcaatt gaccgaagtc ggtttatttt gcaaccagtc ttagaaaata    142080
     tattcgggta cgtctcgata tggagagatg gtactatggc ttactatttg aaaatatcct    142140
     cgagtctaca agtagtgcgc gattgtcatt tataaactca ggtgggcaca aacgatatac    142200
     tagtatgtct ctaatgtaca taggaagaaa atcttcaagt aaaataaatt tatcaaatag    142260
     atttgtacgc cattgaagga tgctaggtga attcagtctg agcaacactc tggggataat    142320
     ctgatacacc caaattgagt agcaaaacgg gaaatccaga tttgcttttg atgaaaattt    142380
     gtcaggtttg agaagtaccc tatgaaatta tttcgtctag ataggcactt ctcttctgat    142440
     ccttttcttc tgtatcttca aaacattata gcccaagaac aagtttttcc accattcctt    142500
     gtcttcagcc attctttccg cacaagaaat ctgtctacag ttaataaaaa aacggttgta    142560
     ggtttacaag atgtagaatg aatgccccca tttagtttaa aagggcagct tgatgatggc    142620
     tgttgatgaa acttctctcg tgattatggc ggcatcaaca cgtatctatg ttcaattttt    142680
     tatactcgaa tttgcaatag ctttaaattt cgcagccata tatttataaa aaaatgcaga    142740
     tattctgcac aaatcataaa agctagaaca tagcaatacc ccaaaacaaa aagttatccc    142800
     attcacagta gacactttcc agagttacca gtaagcaaaa aaaatgcgca aacccggaat    142860
     cgaaccgggg gcccaacgat ggcaacgttg gattttacca ctaaaccatt tgcgcaagaa    142920
     acctccgcga cggggaattg aaccccggtc taccacgcga caagcggtaa ttctagccac    142980
     taaactatca cggacttttt cctgacagca gaaggaagat gtatgacaat aatatccatt    143040
     cacgtgattt atctcacctg ataagcacgg gatttacccg tgttctcgat atgcatccaa    143100
     tccaattttt ttcattagct gtgaaaaaat atcttatcag gagataaact tcactgttct    143160
     tgttttttgt tgtcagtgtt gaaaaacgtg aaaacgcagt tttaaaggtc caggaaagta    143220
     tgttaagaca gaatagagcg ggattgttgc ttgtgcggaa gctccactgc tctgtggttg    143280
     tgatgaagcc atttgacatc tcgcaattgg ctagagacaa ctcatctgaa aagagaaatc    143340
     aaggattcaa tatcgagagt cttatcaaga accgaatgga cttggaaaca gataaagtag    143400
     tatctgaaaa tgccaccgcc gcaccaaata gatttgctac tatgtttgat aaggaaaaga    143460
     gacaagcaca aaagaaaaca ggacccagac ggaattctga atctactcat caccacaatg    143520
     ctggacctta tcccaagaaa ccatacggaa aaacaaactc tggaagcaaa actcgcccag    143580
     agataaaaac tagaccccac aagagagtag tacgttttga attcaagact ggttcagacc    143640
     aagcccaggc tgcgttaaaa tccatcatag ccaaagttca tgccttgagc acaaactaca    143700
     agattaaatt catagatcca gtttcgggag aagtgaaact cctgaatttg gtggatatcg    143760
     caaatagcac tgatctcaga gaggctggtt tacaactttt accttgtaaa gaaggtgact    143820
     taccttcgat caagaaagtt agcaccagag agatgttaaa gttgtactca gatgagcttg    143880
     ctgctgaaaa ggaaaaagca cttttgcaac tggggagtgt agctgctcaa agagcattga    143940
     accaaagatt gaagtctgaa cgtaaaaagt cagctgccaa gttgttgaat atattctgga    144000
     acattagttt gggagatttg aaaaaccaaa agaaaactga actagccaac aggttgtgta    144060
     agggtgaaac ttttacaatc tacttaaaga gaaagggcag agaagtcgca acgcccgaag    144120
     gagaaggcga cgaagaaagc gaaacgttga atatgtatga tatcagacgt tcccttgcgc    144180
     acgacgaaga tgccttgaac attgaaacac aaagacgcga gttgatttct caacaacttt    144240
     tttgtattct tgatgaaatg ccttgtacct atgaagtaga aggacaaaag gagaacaagc    144300
     tcaaggtcac tgtctctcct agacaagacg ctgtaaagca atcaatttct ccatcttctg    144360
     aagaatgtac tctatcagct aaggatttga agaagcaaag acaattgcaa aaacaaaagg    144420
     agagagaaga actattgaaa ttaaagaaac aagaaaagga ggataatttg gactcgttgt    144480
     acctgttcaa gattgaagat taagatccga cttccataat atgacctaat gagctcttat    144540
     ttaattcttg taaatagcac tatataatac attacgttgg ttttcaaaga attgaatata    144600
     attcttaatg tgtaaaactt caaaatacga tccatatcct tgctattttc gtaggggact    144660
     atgtagcaat agacacataa actatctgga cgttccattt gatgaaagct attatctaga    144720
     aacaacctat ctaccatccc agatggattc tcttaaacaa tactaccata ccggtagctt    144780
     tcatttgtat tcaccttatt taggatctga tcttctgaat ccctcagcag ttgtctgtag    144840
     ctacgttcct gtctcaatct tctgacctta taaccatacg catgtcctcc tatcatttcg    144900
     tctactattg ggtaattgag aagcctttta atttctggct gatccaactt atagttaggc    144960
     acttcggaac acgcattttg atagtaaagt tcatcttcgt ccaagagctc tttgctgtaa    145020
     ttaatagacg ataaaaagtt gtcacttctg agaatttctg aaataaattg caattgctcc    145080
     gaaccggaca ctacaggtga ctcaggtgga gatccatttt tgggcgagcc aggatagatt    145140
     gctctcattg atgttccagt agaatttaac gatgcagagt attcattgct gcttctgatg    145200
     ctattagttg tgttgagctg tggcgggcta ttgggaagag cagctatctc tgaagtgctt    145260
     cttatatgtg tattgttctg ctgaagcgtg ctgacttggt tggacaacca gtgcttttgt    145320
     tttccgtcgc tatggtagcg taatccttga ttaattctac tcatacgccc tctggagcta    145380
     ggatgggcta tcaaggcttc cacagagtca aactgcttgt aatccttgta atagtctcca    145440
     tagtaagtaa gcttgaaatc atgtatcaag tccttgatac caaccatatc cttaaaggca    145500
     tacttgaact tcaatctacc atacggtatc tgtgatattg tgaaggggtg ataactgaaa    145560
     gcaaaccaat ggcccaaagc aaagccaatg agctctacac agagaagtcc attctggatg    145620
     cagacaccta tactgccttt ttcttcagac tcgtcacttc caggcaacac ctggaacaca    145680
     ttcaaaatcg ccaaaatgac cccttgccag tacgaggcaa aaataatcaa cttgacacac    145740
     aagaatttgc ctacagggtt gaacggcttc aaatcgttcc acaagatctt ccagaagatg    145800
     gccaagcagt ataatgacat ggtgacactg ccgttgtaga taatggttaa ccagagatat    145860
     atcgacttgg gacccatcga gttgacatcg tacaagccca aaccttgcga taataatgta    145920
     gaaaaacaga ttataggctt agcccataca tactgaagaa tgcctctttt gattccgaga    145980
     aaggtatacg gatcagaaat atcgagtggg ggaagaatat acagtaatat gcccgggtgc    146040
     tttaccggtt cacgtccact agtcataatt atgatattac gctcacctcc aagcatatca    146100
     gtaagcaacg agaagaatgt gtagatgaca aaagcttcgt agacctctcg cacaggttcc    146160
     aagatgaatt tgttgaaggg cgactcctgg ttgatcaaca ttgagtagca cgataatgca    146220
     aacaaaggca cgatgatttg gattctgagc attaaacgtt gttgaaacgg ttttctgtaa    146280
     tttcgtaaat gaagaaagat acagcttatg attattaatg tagccaaaac acatgaatag    146340
     aaacagatgt tatttaccca cttcggaaga cgcgccgagc tatctgatat cgccgctata    146400
     gctattgatg tcatcatggt ggtgattttg aaaaatgtga actcttgtta cagaaaatgc    146460
     aagatgaaat gaaatatatg atgacttaag tatgagtatg agtgtatgaa tatgaactat    146520
     acgaattata tgaattgcgt gttgtgcaaa tcgagattga gtgattgaat tgcagtataa    146580
     gatgatataa gaagtaacga cagacacacg tcaagcaatc catcctctac actctgcaag    146640
     gtgagattgt actggttctg attataactg aaagaaatat gagcctttcc gtctgttagt    146700
     ttgcagatta accaaactaa ggccgcgcta ccaccctgcg atatcaaccg gtcttcacca    146760
     aaagctacgg ggaagcaatt atagcagtcg acagtacatt ctctgtgact tgataatggc    146820
     aacactggcg tataacgaga aattacaata tgttctacct tttgttatgt tccacgcaaa    146880
     tgcggattca ataatatata tgaaccacta tgtcactatg tacatagata atgtatgagt    146940
     aatgtaagac ttttagtatt cgttattatg aggaatgaga ggcattatta tcatcaattt    147000
     atgccattcc ggcgttcttc aacttcttaa ctcgttcctt ctcttggttc aacttctgca    147060
     agtcttcttc ggtaaccaag tgatgggtgt ggtttgagac tggcacaaag atttcgttgc    147120
     cattgtcgtc gtctacaaac atgtggcatt gttcgattga gttaatgaag tcatcctgga    147180
     gcacatcagc cattaatatt ctattggcag gatcaaggat caacattcta cgaaccaact    147240
     ctcgcgaagc ttctggcaac aatctcatca aacgttctgg accctgggag tgatgtccgt    147300
     ttcttgtact cttgacactg ctgctaacgg tcatttcaga aacgctgttc tgcattactg    147360
     ttactggatc ttccgaagcg ttacttggag cacctacaaa agaccggtaa gaaggatcgg    147420
     agatccttgg gatcttccag gggaatcttt tcaagatcat acaacaaaag atcacagcca    147480
     ctgaccagac atctgcagca cgaggatcgt acccttccag aggagaagca agcacctcag    147540
     gagacaaata tggatcagag ccgacgattc ccttagcctt gaccaaggtg tactgctcgt    147600
     cgacaagatc atcatgggag gcgttgggat cggtgatttc cttacgaaat tgtacggccg    147660
     agccgaaatc gattaacttc aagataccaa actcgctgac tacgcagttg tcaagtttca    147720
     agtcacgatg agccaatccg ttttcgtgca agaaagctac accactgaca atctgtctga    147780
     agtagcaaca cacttcctct gtgctcataa gtccactcat caccaagttg aagaagtcgt    147840
     acggacagta ttccatgaca atgtagtatt ctggttctat agttgacttt ggtgactttc    147900
     ttttggagaa acgaccacta ctgatgctgg tgctgctgct attggctgaa gatttcagtg    147960
     agtagtcctt gataagctca atggtgcaga tcaaattttc gtgtttgaga tagtcaccaa    148020
     tcttgaattc gttctttacc ttgactttgt agtcagtttc cagctcctgg ggcattctcg    148080
     accggaattt cttcactgca aagatctgcg tagggtcatc tttggcggta accaaattga    148140
     cagagccact agctcctgtg ccgaggagct tccctatagg accatacttc ttgaacaagt    148200
     ctgaagtagt caggtctgga agaggtggtg gcacagtatt ggctgttggg ctagaagttg    148260
     ctgagctctt tcctttggtc agagttgtag atgcacgcga gtctgtatgc ttgagtttct    148320
     tgagaaaccg tctaagcgaa agatggtgtt ttttgtcttt ggcttcagtt acgctgctat    148380
     gcgcgctcac atgatgggtt tggtggtggt tttggctatg gctactggaa atgttgtttg    148440
     agtgactact agagatattg tttgagctga gattttttga ccgttcagac actgttggct    148500
     ctatgggttt gttcttgtct gaggacgagt cgcggactac tgtaggctgt gttgctgtgg    148560
     acgcacgcga actcaaatgc gggctccgct gggaatggtt cgatgaggct aaatccatgg    148620
     acgtggaagc cgagtgcaat tcaaactcgg cattggcgtt gtggaactcg tggtcgcctg    148680
     tagtgtctgt tgaagctgta tcgttggact ggtagctcgt gtttgggttg ttactggtat    148740
     tgctgataat gtccaggtgg tggtttccgt gattttcagc attgtcgaat ttttcacttt    148800
     gtccacttct ggatgaacgg ttggatatgg agccagacga gttgcggctg cgtagaaaca    148860
     gccgatgcga cggtgccgag gcagaaggag cgccattggc agcgccgtct tttcgtgaga    148920
     gcgacgtcga cgacgacgaa aacatattct tcaatgccat cccggctatg gatatataga    148980
     tgctgaaacg tgaagaaaag tggtggataa attaccttgc aaaatcctgg tctgtagatt    149040
     tagtgacagg ctattttttt agtgcaccag actggagaag cgcagtcgga aataacaata    149100
     tttgtaagcc caagccgaga tagtgtgtat agccgattct acggaggggg tgtcgaaaca    149160
     gctggagatg agcaattgtt atgaagtcta gagtagggtt ggtgctagct gtgttggaga    149220
     aaaggagagc ttggagtcgg tgtcgaaaag cgagttattc gtgtcaattg agagtctctg    149280
     gtattgctga aagcggcaat cttcacgtgt ggaatttttc acagtcaaag actataaagt    149340
     cagtagacgt gcgtattgtg tggaagatga ctagtgatgg catacaaaga aattgccagg    149400
     aagagaagac aaacgaagag acaagcgaag aagagaggag gagtaagaag aaagagtaag    149460
     aagaaggagt tacaacaaaa gagtaacagc gcaaggcacg aagaaacgaa gaatagcgga    149520
     agagtggagg agtgtaaccg acctaaatag tctcagtaaa agtttcagta atcgtagcac    149580
     ccgcagagtc tcactaagtt tcagttagtt tccgcaagtt tcagacgaag tcttgggact    149640
     acactttttg cacttcgccg ctaaacgaaa accgtgaaaa gccaggctca ggaggcccac    149700
     aagaatgtgg atatttctca ctactctact ggtacgccgt ggaagacaat tgatccacag    149760
     aatacttgag caggtacatt gcggacggtt actctaccca actacagacg gggttaacac    149820
     tgaacacaat agcggcccca atcccgcaat aatccactca aattggctgg ggtaatcgaa    149880
     atggtcctaa ctccttcgac gcatttagac acattctcgc taaaccattg acatgactca    149940
     actgggtaaa aagttagcta atccacctgg tggagagatg gagggataca attaacggtt    150000
     aaatctacta cgagattctg cacagtggga aaggaatcaa tttcatatga ttttaataga    150060
     gtatcttcct tttctccctt aacaatgctg tggatttgtg ccttacaatt tgtagatgga    150120
     caaactctcc gtaacaatgc ggcgttgtcg gtttttctcc gtgtctcaga ttgtgaattg    150180
     atgtcgtcat catcccctga atctgtagag aatgtgaaat atttcactag cctctctttt    150240
     atgcaatgct actccttgat tgtgtggatc tcggtcggct tctgctcctg ccgactccga    150300
     catcccggct aaatctacac tttccacatc tctttggcta gatccattaa cggctacttc    150360
     gatctagacg atcttatctc taccatagcc cctttcacac cgggaaaggt ttcggccttg    150420
     aatgctacct tgggcactaa actaaagtaa tcttatttaa gtactcttat tcgaacctct    150480
     tttactacct acagatttac tactccagaa tctgctttac tctacaattc ttcttatcac    150540
     aatttatttt gtttgtagaa actaaaatct cttataggaa ttctattgtt ttattacatt    150600
     ctcaagatga acctcctcca ttggaagacg tgttgcctcg aattttgtcc cacatactca    150660
     aacgtctgtg gtgactactt tccgaaacag acgaatttct cgagccttta tcatgaccat    150720
     tcttcaacaa accttgcgct tcttcatctt cgccatctac agctataaca ctgctgttga    150780
     tcgtgtcatc cttaccattg taaggattca tggtgaacag atcgctacga ggcttcttct    150840
     tctttttgct cttcttcttt ttcgacgatg acgacgcact tatctggtcg atctcgccgt    150900
     tttcgatgtc gttgatatcg agaacttcgt cttcatcgct gacattttca atgatggtct    150960
     tgtgcacacc ttggacattg atcacagatt caatgatccc tcctgttctg tatattcgcg    151020
     attcttgcga ttcagtgaca ggaatggcca tcggtactac ttcgtgttca tgtgcacgga    151080
     tatcgtcggc tctctcagca gtaatatctt ctctagcttc ttcatcaaca gaagctcttc    151140
     taacagcttc ttcaatagcc cctacttcag tagaaaaaac agcgccataa gcaccgggtg    151200
     caccgactct gttgggcaaa ggaatggcag caatggtctc agcgtttggt cttttgatcg    151260
     ttacgaaaga cttgttagtt tccaatgggt ttgcagcagg attcttgggt ttccagttct    151320
     ttgtgtctac caaattattt ccattcgttg tactgagcct ggtagccaaa tctggcacct    151380
     ggacttgcag tggctgtggt gtcagcgctt gacctggcag ctgagcagaa acatcaaggg    151440
     agttcctctt ggaagtagaa gcagatcttt ggtataagtt atgtaagtaa gaagtcaagt    151500
     ttctcttaga caaaggaccc gggttcttac gcttgatatt cttgttgatg tcaatgtata    151560
     catccgattc gtcaacaatc tcttcaccaa tcaactcttc aatcacatct tccaaagtca    151620
     acacaccaat ggctcctaca ggttcaccag gatgttcact gaccacgatc atatgagatt    151680
     taccttcttg gaagtagttc aagatgttca aacaagaggt gtctagggcc gtttcaggca    151740
     aagtggccaa tgggaacgaa gctacaggca aggcatcttc tgggtcgtaa ctgatcaaga    151800
     cacgcaccaa aagcatacca atgaaattca atggctcgtt aggcaaatga atgggtattc    151860
     tggagaaacc ggcattgaag atttcttcta cggttttctc gtccaacaaa gtatcagcac    151920
     tcatggtgta gactctatcc ataggagtca tgattgcact taccgatttc tccttcaagt    151980
     caagaacagc actgatgatg gtgacttcgt cttggttcaa tctttctaca cccatcgtct    152040
     tgtgcaaagt caccaaggtc ttcaacccgg acttcttgta aactgttccg tggtcttcac    152100
     caaggatgtg gtccaacaac aaggcaattg gataggcaat agggtacatt atatacatca    152160
     agacgaggac aaatggagcg aaaagagcac cgacttgcaa accatatctg acacagatgg    152220
     actgggggat aatttccccg aaaatgacaa tggaagcggt ggaagtgacg acagcaggcc    152280
     atcctcctcc caagcaacgg tctaatacaa taggcaatgt ttcgttggtg atgacatttg    152340
     acaacaacaa tgtgactaaa acccagtgct tacctctacc aataagagaa agcactttac    152400
     gagcatgtct acgttcatga ggttcaccac tggtggcgat gaccttcaag tatacttcgt    152460
     cctggcccat caaacctaag gttaagccgg caaagacacc tccagcgaga acaagaaaga    152520
     cagaagtgaa caaattggca taaaactcct cggctgtcat ggaggacgtt gtagcgtcaa    152580
     cgtcgggatg agaaacagca gcatggaccc gtttgttgaa cactggaagg gcatgggtca    152640
     ccttgaccaa ctgggacaag atgaaaacta atttggcaat ggcgtttccg ctagttaatg    152700
     gaacggcatg gttacttcgg gacgatagct tacttttaga catatagctg tggtgttagt    152760
     acggaaaaag aatacaaaga aactgaagaa tgaaaaacaa agaaattgca atggcaaatg    152820
     gcagaaagta cggaaaatta gctggtattc cagaatgtat ggtacgctga agtatggaga    152880
     ctgtgcgaat ggaattgaaa attgaatgcc tagaattgaa atttgaatgg attctgagat    152940
     gggcaagcta gggattcaaa agaaaaagcg agggctgcga tggaaatagc tactagtgac    153000
     cgtgttgagg atgtgaagat gagagagacg ggtttctgac actgtcttct tgtgtttgta    153060
     tttttgtcgt tgtttcttca atttttcgag tttcttcagc tttcagaacg tggagctcca    153120
     ggctgacggt gcgatgagat acttactaat gggcaaaaag ttaaagaatc ttgagggcgg    153180
     cgaaaatagc acgagtttta agtaaagata gtgttgtgta aagagacttt ggcaacaagg    153240
     aggaaaagga agttggataa cagaatatta tggcttgggg cttcttcgct tcttctcttc    153300
     gttctcctac cgtttatgac ctgccaggga ttttgtatgc cctctggcag tcgtgcctgc    153360
     ctaaatgcgg tatttgacag agaggcgcta gggagcccac gaaaaaacgg tactgccaga    153420
     gacactgtta gcctgaagtt ggaattggtg cggatgaaga gacagactcc ttgagtccgg    153480
     gcatttgtcc tcaattgtct actatatagt accggtacca gtccatactc ttgtggacaa    153540
     ttctgccggt agatttctaa attctactag agccgctaaa atctctctaa actactgtac    153600
     tatgcttact cggtagtgag acgacaattt ctcctacatt gtatatgtcg tcattttgcg    153660
     ttgctaatcc tcgctaagaa actggacaca taggggctgg aacggtgcgg ctcagctccc    153720
     tgatggagcc cagcccgata agacggaagc atatgatagc agttaatgaa cccactaagg    153780
     gcttcagcag aaattcagca attgcacatt cctggttttg caagtgattt tttgctcatc    153840
     atgtcgtgaa ggagtggaag gagctgtttc tcgtgaaccg gccataagtc gtgagcgaaa    153900
     gaccagacag taactgaact ccactttggc tgcggggatt tcgtaaacag tcggcatctt    153960
     gaaatctgcc tcagagtgct cacccgagtg ttatccttct gtggccaata atactagatc    154020
     ctcttcgcca tatacgatgc tttgatgtgg agtcgctgct gaaattgtct gccagaccat    154080
     tctcaaacat ttcgcgtctt tgcgtaactc actaaatcgc tcgtgtttct gctgacgtcg    154140
     acccagtcgg ctcaaaacac caatctccgt cgtctgattt ttgattcggc cggccgagac    154200
     tttcgaaacg cctcagtatc tgaactccat gttacatatt tccagtgttt gttcgtctag    154260
     cttcttgagt tgaacatcca gttccctgta ttttttacta ttttattttt ttatcgtggt    154320
     cgcgtttagc tttttcgcag ccattacctt aaccataaaa atggcaatat tcagaaatgt    154380
     atctgtcctt gaattcttaa ccctagcaat ctttctccat tgcctcatga caaccattcc    154440
     tgaaaccaat aattagttga tcgaccatca gaagaaacct gcacttgacc attgtagatt    154500
     gcaaccatcg gagtctgaaa gctcagaaca ctgctgtgga gtgaagggcg tgggactaga    154560
     tgttgatgaa agcttctgtg aagaatgata ccaatatcaa gccttccctt gtaattacta    154620
     atagcaaaat agcaagcgat ctggaccttc tattcccgct agcttgtgta taggaattta    154680
     ctcgatattc agagaacttg tgttctttca gcagctttca attcaatatt tgtattatat    154740
     aatgaaagat tatctttggg tatattcata taatatgtca ctctacaagc agaaaagaac    154800
     aattatatga ggtgttgaat gaagtcttcc cattatacaa ttatagaaaa gataaataga    154860
     attgtgcaaa gcagttgaat tcaaaattgt caatagcggt ccttccaaat tgctcagttt    154920
     attcgccagg gatgcccaaa atacaagttg aagtctccaa atgcatttct ctgctgttaa    154980
     ccattacgtt ggtcaattgt ctactcacga atagagaata atcgaaaaca ataatcttat    155040
     tttcatccga gaaatactcc aacttcgtgt ataacttgcc aaggtaaggt gagagccatt    155100
     tgaagaaagt gttgagtaga cctaattggc attgctgaaa aataaacaga atgccaggaa    155160
     gtagtgaaag ctcgcgtatc ttcagggttc atattcattt agtactggct ctctttcaga    155220
     gaaaatattc ctagtgatga cgtatctcaa cataaatata ttccatcgct tgcaaagtag    155280
     aaaactccgc atactagaag caagacttaa aaagaagaag ccacagaact ccgcagtggt    155340
     ccttatgtat tggtttgtca tatttccttt ttaagggatt actatatcag ctcgaggctg    155400
     cacactgtgg gaagcatatt caactacaac tcaacaaaaa ccccaaatgt tttacatagc    155460
     aactttagcc gtgacagtag tggttagtgt cgtatagtag gaacatctct gttttcaata    155520
     ttccttatcg agacggtgtc atgaatggaa gatctgaaca cttcgttaat gaagtctcca    155580
     aatcgattcc atcacagatc ccttcggtcc ttgtaataca attagatcac ggtccaacca    155640
     atttcaagta ttgtagattc tttgaaaaca aatttcacaa ctatacacat gatttattta    155700
     tttttactaa gactatgatt gttgagactc tagaccttac tggatcggtg gcagcttctc    155760
     tcaattgatc tagctactat agggttatac ttgttgcact gggctgtgca cccagatgaa    155820
     gccgagaatc gaatctttat ggttagaaac attctcccta aaattggatc agaccctttt    155880
     aagtaacttg ctgttttact tggccgttga aaaatataaa ttgcacaggg atacatagta    155940
     tatcgctaag ccagctctac tctccagctt gaagaccgaa tcgaggggct tattaccatg    156000
     tcgaactaat atggcaaagt tgctcccttt ctagattaca taccatgaga cgcgagaaag    156060
     atctgcgtca taccgtaata caagacaagg atcggcaaca caatcgaagc ttaaccagag    156120
     atgatgttaa tgaagtggtg ggtataactc ttatacaatt ttcaggttgc agaacttcgc    156180
     atagaaatag aacatttttc agaatctcaa tcaattctta caaaaacttc aattaaatat    156240
     ccaagaaacc tgaaatcatg aacagtgaca actgctggaa caagccatct gttaacagga    156300
     ctggagtaga tagccactca tccagatcta gaagctagag gaactggaat aattaaattt    156360
     agttaactgt catctgcttc gatgcaggta ttttctacgg ttatgaaaga acaataatat    156420
     tgctgcaggg cacacgtccc agatttttcc tgtagaaaag cattctgata gtcctattct    156480
     agaaataaag ggtaacatag ttttcgtttc tcttcaagaa tacgtagcaa tttgtttcag    156540
     atgtattcaa tatttgggag ccctcatgtc ttgaagatca atgtttaagt ttctgctaga    156600
     acgagggaga ttattatttt tgttgacaag cgtattgtcg cgatatattt cttggaaggt    156660
     ttatttgata ttcaagtaaa tgccactctt tcatggatag gattacattg cactacaaca    156720
     atagcgtcat tccaggtagc tgcaacttca gaacctaaag tatgaacttc gtaaacgagt    156780
     tgtgcaatgt cttaccggat attattgctt tttggttgca tttcgtaact tagaagtcaa    156840
     caaggagact tacttggcca cgaaaatggc ggcaatggtt gtgaatataa atggtttgta    156900
     gccagctata gtctctgctt gctattgtat atatatagat aatggctccc tggacatgat    156960
     gctgttattg aaattttgca aggaattact atcaaggtct ataaagtagc aaactctcca    157020
     atatgttgtt cctagatctt tattttgttg cagtactctt cctgatagca actgtatggg    157080
     ccaaaaccat tactgaagat accatcgata gaggagccgt tgctatagat gcagacgaaa    157140
     cgatcatcgt ggatggtgtt tactggtctc ttgttgataa tgactatact aattttgcag    157200
     gtaatgtaga cgtaggtgaa ggttctggct tctacatctc caacacatcg ccttcaagca    157260
     tgtacgttgc catactttct ggcctgttcg tcaacgatgg gattacgtct tggaatgcta    157320
     ttgaagcgat aaatgctcca acctttaaca tagatggctt taatttcatc aacaatggtg    157380
     aagtgtacat gtcagccgac ggttctactg gcaacccttc tatgggaatt acaactacaa    157440
     attttgataa caatggtttg ttggtcttct accaaaatta tagaactggc aattcagttg    157500
     aattaggtga tgatcttctt acaattaaca acaatggcca gatttgtttg cacaacaaac    157560
     tttacgcaca aagaacttct attgctggta ctggttgtat ctccgccgtg gacgattcca    157620
     gtatattcat ccaatattcg gcattggata ttgatactaa ccaagttttc catttgcaag    157680
     actctaattc taacctacgc gctgcagccg ctataacacc aaaaacttac actgtcgcag    157740
     gctttggtaa tggaaacaag attggattgg actttgctct tcagactctt aatccttgga    157800
     catatgatcc tgttagtggc atattaactc ttcgatcaac attattatct caaagattta    157860
     atattgggac aggatacgac ccagcattgt tctcaattac aaccgagtct ggtttaggtt    157920
     tgtcaactgt cacacgaggt gcactcacct attcaggacc ccctccaaac gcaattccag    157980
     aagtctgcca gccatgtcca gtacctcctg aagctccagg aatggatcca atagagtaca    158040
     ctacaacaat cgtgacgacg aaccctgatg gatcaatttg tactgaagtt gccgatgttc    158100
     tagttagcac cgatgctgac catatatggt acactaccac aaatagtgtt cagacagact    158160
     gtttagcggc tactatttac actacaacgt tcaccactac gaaccctgat ggatctgtat    158220
     ctactggcac tggagaagtc cttgtaacta ctgatgaaga aggtaactgg gttactacta    158280
     cgtctgagat taccggaccc gagttcacac tctacacgac caccttcacc actaccaacc    158340
     cagatggatc agtatctact ggaactggtg aggtgttagt tactacagat gaagaaggta    158400
     actgggttac tactacgtct gagattacgg gacccgagtt cacactctac actactacct    158460
     tcaccactac caaccctgat ggatcagtat ccaccggtac tggtgaagtc cttgtaacta    158520
     ctgatgaaga aggcaactgg gttactacta cgtctgagat tacgggaccc gagttcacac    158580
     tctacactac aacgttcacc actacgaacc ctgatggatc tgtatctact ggcactggag    158640
     aagtccttgt aactactgat gaagaaggta actgggttac tactacgtct gagattaccg    158700
     gacccgagtt cacactctac actactacct tcaccactac caaccctgat ggatcagtat    158760
     ccaccggtac tggtgaagtc cttgtaacta ctgatgaaga aggcaactgg gttactacta    158820
     cgtctgagat taccggaccc gagttcactc tttataccac gacgttcacc actaccaacc    158880
     ctgatggatc agtatccact ggaactggtg aggtgttagt tacaacagat gaagaaggta    158940
     actgggttac tactacctct gagattaccg gacctgaatt cactctttat accacgacgt    159000
     tcaccactac caacccagat ggatctgtat ctactggaac tggtgaggtg ttagttacaa    159060
     ctgacgagga aggtaattgg gttaccacta catctgagat tacaggacct gagttcacac    159120
     tctacacgac taccttcacc actaccaacc ctgatggatc agtatccacc ggtactggag    159180
     aagtccttgt aactactgat gaagaaggca actgggttac cactacatct gagattacag    159240
     gacctgagtt cacactctac acaactacct tcaccactac caaccctgat ggatcagtat    159300
     ctactggaac tggtgaggtg ttagttacta cagatgaaga aggtaactgg gttactacta    159360
     cgtctgagat tacgggaccc gagttcacac tctacactac taccttcacc actaccaacc    159420
     ctgatggatc agtatccact ggaacgggtg aggtattagt tacaactgac gaggaaggta    159480
     actgggttac tactacgtct gagattacgg gacctgagtt cacactctac acgaccacct    159540
     tcacaacgac caaccctgat ggatctgtat ccactggaac tggtgaagta ttagttacaa    159600
     cagatgaaga aggcaactgg gttactacta cgtctgagat taccggaccc gagttcactc    159660
     tttataccac gacgttcacc actaccaacc cagatggatc tgtatctact ggaactggtg    159720
     aggtgttagt tacaacagat gaagaaggca actgggttac tactacgtct gagattaccg    159780
     gacctgaatt cactctttat accacgacgt tcaccactac caacccagat ggatcagtat    159840
     ccactggaac tggtgaagta ttagttacaa cagatgaaga aggtaactgg gttactacta    159900
     cctctgagat tacaggaccc gagttcacac tctacacaac taccttcacc actaccaacc    159960
     ctgatggatc agtatccact ggaactggag aagtccttgt aactactgat gaagaaggta    160020
     actgggttac tactacctct gagattaccg gacctgaatt cactctttat accacgacgt    160080
     tcaccactac caaccctgat ggatcagtat ccactggaac tggtgaagta ttagttacaa    160140
     cagatgaaga aggcaactgg gttactacta cgtctgagat taccggacct gaattcactc    160200
     tttataccac gacgttcacc actaccaacc cagatggatc agtatctact ggaactggtg    160260
     aggtgttagt tacaactgac gaggaaggta attgggttac cactacatct gagattacag    160320
     gacctgaatt cactctttat actacgacgt tcaccactac caatccagat ggatctgtat    160380
     ccactggaac tggagaagtc cttgtaacta ctgatgaaga aggcaactgg gttactacta    160440
     cgtctgagat taccggaccc gagttcactc tttataccac gacgttcacc actaccaacc    160500
     ctgatggatc agtatccact ggaactggag aagtccttgt aactactgat gaagaaggta    160560
     actgggttac tactacttct gagattacag gacctgagtt cacactctac acgaccacct    160620
     tcaccactac caacccagat ggatcagtat ccactggaac tggtgaagta ttagttacaa    160680
     ctgacgagga aggtaattgg gttaccacta catctgagat ttcaggaccc gagttcacac    160740
     tctacacgac taccttcacc actaccaacc ctgatggatc tgtatccact ggaactggtg    160800
     aagtattagt tacaacagat gaagaaggca actgggttac tactacctct gagattaccg    160860
     gacctgaatt cactctttat accacgacgt tcaccactac caacccagat ggatcagtat    160920
     ccactggaac gggtgaggta ttagttacaa ctgacgagga aggtaactgg gttactacta    160980
     cgtctgagat tacgggacct gagttcacac tctacacgac caccttcaca acgaccaacc    161040
     ctgatggatc tgtatccact ggaactggtg aagtattagt tacaacagat gaagaaggca    161100
     actgggttac tactacgtct gagattaccg gacccgagtt cactctttat accacgacgt    161160
     tcaccactac caacccagat ggatctgtat ctactggaac tggtgaggtg ttagttacaa    161220
     cagatgaaga aggcaactgg gttactacta cgtctgagat taccggacct gaattcactc    161280
     tttataccac gacgttcacc actaccaacc cagatggatc agtatccact ggaactggag    161340
     aagtccttgt aactactgat gaagaaggta actgggttac tactacgtct gagattaccg    161400
     gacctgaatt cactctttat actacgacgt tcaccactac caaccctgat ggatcagtat    161460
     ccactggaac tggtgaagta ttagttacaa ctgacgagga aggtaattgg gttaccacta    161520
     catctgagat ttcaggaccc gagttcacac tctacacgac taccttcacc actaccaacc    161580
     cagatggatc agtatctact ggaactggtg aagtattagt tacaacagat gaagaaggca    161640
     actgggttac tactacgtct gagattaccg gacctgaatt cactctttat accacgacgt    161700
     tcaccactac caacccagat ggatcagtat ctactggaac tggtgaggtg ttagttacaa    161760
     ctgacgagga aggtaattgg gttaccacta catctgagat tacaggacct gaattcactc    161820
     tttatactac gacgttcacc actaccaatc cagatggatc tgtatccact ggaactggag    161880
     aagtccttgt aactactgat gaagaaggca actgggttac tactacgtct gagattaccg    161940
     gacccgagtt cactctttat accacgacgt tcaccactac caaccctgat ggatcagtat    162000
     ccactggaac tggagaagtc cttgtaacta ctgatgaaga aggtaactgg gttactacta    162060
     cttctgagat tacaggacct gagttcacac tctacacgac caccttcacc actaccaacc    162120
     ctgatggatc agtatctact ggaactggtg aggtgttagt tacaacagat gaagaaggta    162180
     attgggttac cactacatct gagatttcag gacccgagtt cacactctac acgactacct    162240
     tcaccactac caacccagat ggatcagtat ctactggaac tggtgaagta ttagttacaa    162300
     cagatgaaga aggcaactgg gttactacta cctctgagat tacaggaccc gagttcacac    162360
     tctacacgac taccttcacc accaccaacc cagatggatc tgtatccatt ggaactggtg    162420
     aagtattagt tacaacagat gaagaaggca actgggttac tactacgtct gagattaccg    162480
     gacccgagtt cacactctac acaactacct tcaccactac caaccctgat ggatccgtct    162540
     caactggaac tggagaagtt atagtaacta ctgacgaaga tggcagttgg tacacgacga    162600
     catctcagat tgtaggacct gaattcacta tttataccac gacgttcaca actacgaacc    162660
     ctgatggatc cgtctcaact ggaactggag aagttatagt aactactgac gaagaaggta    162720
     attggtacac cacaacatct cagattgtag gacctgaatt cactgtttat accacgacgt    162780
     tcacaactac gaaccctgat ggatccgtct caactggaac tggagaagtt atagtaacta    162840
     ctgatgaaga tggcagttgg tatacaagca cttctcttat aactggaacg cagctgactg    162900
     tggacagtat gatctacact actacttata ccactacctt tattactaca aagtcgggtg    162960
     gattggtgtc cacttgttct ggagaagtaa tagtaagtac cgctgcaaat ggaagtttgt    163020
     gctcaactac ttcgttgata attgaaccgc tgcttactga ttacactact atttgtacta    163080
     gtacggacaa agatggttct gaatccattt gtagttgtga agtgattgtt gggactgacg    163140
     gagaaggaga ctggtacact tccaccatcc caatttccag taagatcaag ccaaatattg    163200
     aagttactgt acaaacaacg actattagta ctgtttgtga taagacttct atttgtgtga    163260
     ttgagtctgt ggtcgcggcg actgttactc caattattga ttctggtaag atagaaggac    163320
     cagttggaac agaaactagt agttctaggg acgctggaac tgctatatat aaatcaggac    163380
     ctactggaat agtatcttcg agtacagttg cggctcatgt tcaacctcaa gctgaacctc    163440
     aagctgaacc tcaagttgaa cctcaagctg aacctcaatc tgaacctcaa tctgaacctc    163500
     aagttgaacc tcaagttgaa cctcaggctg aacctcaagc tgaaactcaa gcaggaacac    163560
     atgctggaac tcaagcatta cctgctgaga cgagctattc aagtgtagtc gtatctcaag    163620
     tttcacctac tgaaacagag cagtcaacta cagttgcacc acaggttgca cctgctgaag    163680
     gtggtgcaga aatgatcaat attaatagtt tcaaggtggt tgtaatcacg gctctaatag    163740
     caattatgct tgcttgagag gatctcgttt tcgtcatctt gactggattc cagatttaat    163800
     tagaggtagt acaactttgt tgctatttat tatgatatca tactattgat gtttccaata    163860
     gaaaatttca ttcttacatc ggcaagctgc tgattgaagg gcgccttgaa ttacccgtta    163920
     gtcatcggga tcctctaaat gatgtcataa ttagtatttc gttatagact tcataaaatc    163980
     gatagtattt ttaatgactt tgatatttgg attacaatta tacactatga agacttatat    164040
     aagaaagatc ccgtgatgac tacttaaaat gatttttaac aaagaaatct gcggatggca    164100
     ttgaccttgt tgttaatgca tttcattctt tttgtctttt taaatatttg tatctcctgc    164160
     cctgactcta attttcgcta ccaaataacg atcaatattc tcttgtatca aaattctaaa    164220
     aattgttaga gacattatat actgaattgt aggaataaag aaatcagagg tttagatgac    164280
     aatagagagt aaaataatct tcagaaatct aaatttaata cttgtgatac atttcactag    164340
     atacatttat cgtttaggaa aacttttaat tgtggattat cattctcctg gaattcaact    164400
     tcgaaagaac tctattttga caaacttaaa taaatgagaa tctcgtctta gcattaaatc    164460
     aatggcaatt ccaccggatg gtgaaaatct ataaatgatt tacagagaag cctgaaatga    164520
     gcctctgtaa ttcgacattt cttcttgaaa actgatctaa ggatcggtga tcgtatagat    164580
     ctgttgaata cattatcttt taaatatttg tgaagcagac agtggaagat tgcttacctt    164640
     gtcctgaagc aaatacgacg aactgacggt aagttttaat tcatgcaaag aagctattat    164700
     acagcaagtc aaacagaaag accgctacat tcgaattcta attcgaatgt gctcggaaac    164760
     agtgagtcga tttgagccaa caagtcaatt gttgccagct gagtccccct acaaacaagc    164820
     taaactgctt ttctactacc tctgtacttt cgataccctt gtataatcct tcatactatt    164880
     ctataaatat cctaccacct ggcacccaat aaaatagaag ccgagtctgt gggcttctcg    164940
     acttcattaa accacgtctt caagagccta ttttccgaga ctccaaactc ctcgcggaat    165000
     aaacaactcc attgcataat ctcggccacc gtatccacat tttccattgc tgccaagtcc    165060
     aacaatggaa tcaggttgta cttttcaaga cttgcagaaa gccaatcctt ttcagaaaca    165120
     tcttcaggag gattgatctg gcctccgcca tttatacaac catttggaca tgccatgatc    165180
     tctacatagt cgcacttgga agcatctgcg ctttcgtctg aaccagcagg tgagctagcc    165240
     tttgttattc ctccagcaac cctagctctg cggcgagcca ctaaagcatt tcctttgcct    165300
     gtagtcgaac ccggcttgac tgtaggtttc aacttgcgaa ctaaattttg aatgtttctg    165360
     aacccattta cgatggcaga actagcaagc ttttcgcttc catacatcaa cctcatttct    165420
     gtgagatcgg tattacggcc ctttacatag tcgatagaaa atccttcttg ctggtacttt    165480
     gtcggatgct tcattatcaa atgattctgg tacatcttta aatagttgta accgtagcct    165540
     cctgaagcag aaccgctatc attggaccaa gagtattgca cgaggggcca tgttcgaggt    165600
     gcacatttac tgtacaaatc tactacaggg atggcagagt tggtgatagt atgtgcttgc    165660
     ggtggtatta actgaaactt atcagaatgc tgttcaagca aggtgaccaa ttcttttgct    165720
     gtgagaacac agtctacatc gttggaagta ttttgttctc cgtacttttc tggccttgcg    165780
     ctttccaact ttttgtcgaa acatggcatt atggatagat ggtatatatc gtttctggtg    165840
     actccaagct cgtgcgctgc taacgtcttt aacaaacatc cagtgatctg ctgaggggac    165900
     ttcacagtgg acattctggg caaaacgtaa ggatgagttt tttccgcata taacacccaa    165960
     ccaggacaaa tggatgaaag aacagggccg tcaaactcgg attccttctt ttcaatcaaa    166020
     ttctgcgctt cgttgatcaa agaaagcttt ctccctatag aagtccctac aatatactta    166080
     aaccccatct ggttgatgaa taggttgatg aggagtttgt cgatctcttc gatagacaag    166140
     ttatacgctg tagctaatga agcacgagac tggtgtgata tgctcgctac aaatactttg    166200
     gtactattat tgtcaacttt ctcattcaac gctttgatca actcttcgtg cgaatgctga    166260
     gctaccaaca cttcttcagc agatgtgata cagccagagc atgccaaaca gtctgccaac    166320
     gatatttggg caggcagcaa gtttgtctgc ttcccgtcga tttttgaaat ctccaaaggg    166380
     ttgccctcgc tatctatctg tatttctact tctccattct cgtttagcag gttgaacttt    166440
     tgatcgctat tctgtgctgg aggctttata cacgccactc cgggtgaaat gaagtcgttg    166500
     agatcgtcgg cagatagtat tgcactcatt ctgtcgactt tcaacaataa atagacacta    166560
     tttgctaaat gtatcaatga ctaatggaaa aaacaaagaa aagtttacca agatgactat    166620
     ctatgacaaa ttatcgataa aggcaggaag agtcacgtga atcatgcgaa gactgtgcaa    166680
     cctttgacca attaggcaag gttctgaggt cagcaatgta gtcttgaaaa cttggtgtag    166740
     caacggggaa catatttgtc gctgatattt ctgtgaattg tttgccatct gcatgtgttc    166800
     aagaaagaag cttgacggct actctcctag ttgttcattt ttgcgctcct tttgtttggc    166860
     tcctactttc tcagcaggct gcaaaaaaaa gaaagttgcg aacaaaaaat aattagataa    166920
     atacaatttt gattattatt taaatactct caaactcagc cttctagcaa actatgaaca    166980
     ggctgcacat ctcccatttt tctattctat ctattttcaa gcgctctagc ccagaccgcc    167040
     gctgccaaca ggagtgtcgt cttctgataa gtctcccaac tcaaaatctt cggcttgtct    167100
     agcatgaacc agttcatatt caccacttcc actcaactcg ccattctcat cgtaaccgac    167160
     caaccgtaag tagagagcca aaagcaactg gttccacaag aatatgagaa acgctgctga    167220
     ggagacaaca agaatatatg ccgagtggtc tgagcccaag tcgtgaacca actgtaactg    167280
     ttcctcagtg gctgacataa agaggattcc tgcaagggta agacagaatg gtggcatgta    167340
     ctggaacgac aaaatacgac cggtttccga acaggctttg tcgtgcaaca aaaacaggat    167400
     ctcgattact ctggtgacac ctgcacccat aagtgccaag ccaaacaagc tatggacttt    167460
     cgtcgagatt tccaagtgct gagaatgctg cgacatcgaa taccctgtga aaacgagcaa    167520
     ggcactagga ataaaagttc ttctgttttt catcgacaag tacattccta acaagcctcc    167580
     agaccaccag atgataccca tggcagtgtg ctgatagtcc cccattgacc agtcctcggt    167640
     gccccaccta tgttctgtga aagtgttcac aataccccaa acacacataa cggtagaatc    167700
     gtagaattct tgcgacttta ggttggagct gttgtgcaac tggtgggttc tgatccacgg    167760
     aactacaagt acgaacgaca acacaaacga gtacaaaata aaggccgaac ccatgattcc    167820
     atgagcaata cattgaccag tgtgtttccc ataacaaaat ccaaatagcg ccacaggagc    167880
     catgcacact ctaacccagc cagttagcac tgctaggaag gacaatgtct tgtagatctt    167940
     gtaagtgaag ccatattcgc ctctgctctg ccaatgggga tagaacttgt tgatgaccaa    168000
     gtttgagcca ttgataagcg tgcccacaaa aatagttgct cccaatagag ccgagagaaa    168060
     ccagctggta cccttagaag ttctgttttc gtgattatct acattatctg gaaaatccaa    168120
     gaacaacgac tcaaagacag aatagcccgt ggacacgcat tgcaacaata atgaccaatg    168180
     taatctgtca gcaaaagcta gcaccgacga aagcgacggt agcaccaata ggagtgccaa    168240
     ggtgagaatc cagtggaagg tcttggattc tgggtttatc ggatgaaact gcttccgttc    168300
     tccttcgtcc atatccatgt cagcggcaac caccgctgcg aaaacgacaa ttgcagccgt    168360
     cgatagtctg gatatcttta gcatgtttca gtttgaaaca gtagttgcag ttttaacgtg    168420
     ttcaggctca taatcggatc atactgaagt aagcataaaa ccgaatcgca ctagtgctta    168480
     tgagacacgt gactgaaaac tatctcgctc aaatatcaat aattttatgg aggaatttac    168540
     tgtagattta gcttcccaat ttagtggaga tgtattgtat attctgaaat tagcataaat    168600
     atgagagcac catttctctg attggtgttc aaatggggca acgtggcgat ttttgctgtt    168660
     gtctcattcg tagacaaaac tgtttttgta ccatgcccag aacggcgttg gaatgtgtga    168720
     accttgaagt agcccttttg gcggtgtaaa agttgcagcc cactaatttt tgtcgctact    168780
     cccctttcta ctctcagtaa tctcctttta tcgagccgca ccgcgggagc aactctcgca    168840
     atcgcggtaa ttttgtgttg acttttcccc gtcgcaagat gaaggacgtg gcactgaatc    168900
     tgttgaaaaa tgcctgagcc taaaaatatg tcttcatctc agatcacaga ctgttcggct    168960
     ccattttcag atataccaac acggtacact attgtctgca tcgtgacttc gggagttttc    169020
     caaatacaac cagaagggaa ctacttttgg tgatagcctg ttttatttat tgcctgtttg    169080
     actttcactc acttgattag atttttctac gtttcaccta tcaactatac tgaattcata    169140
     aactatccgg atatacttga attctgttat tagattcaac taatagtacc gtttcagtct    169200
     ttgcagtctc gttttatact tccccaaatt ttatgattat atctaactaa caagatgttg    169260
     tttccgttac ggactttact cctcattctc tcggtgttgc ttcaggtgca atcgacagcg    169320
     attcccaaga gagactacga gctgaagaac tactacattt tcgagatcga cacctcgatt    169380
     tcacaacagc cattagctga cttcaccagc aagtaccgtc tgcactacaa gttcgaacac    169440
     cagcttcaag gtcttgataa ccactatgtt ttcagtatca acaaatcgca ccctcacaac    169500
     gacttcttag gaaaccacaa gtccaacgac ttcaacttga tgaagagatc tccggggttt    169560
     gaagacgaat acgactactt ggtttcgaac ccgcacttga gatcaattca ccagttgaag    169620
     cccagaactt tgtctaaaag aatgcctgtc ttgatcacag acgacaagga atacgaaaga    169680
     ataatagata gcaaacgtgc ggatgctatt actaattttc ccgttgttaa tactgtagat    169740
     gctaatacag atgctgctgg gaatactgta gatgcctcga agcagctttt gaaggacgtg    169800
     tcggacagtc ttagtatccg cgatcctggc ttcattgaac agtggcattt gatcaacact    169860
     gcatatcctg gtcacgacgt caacgtcaca ggcttgtggt atgaaggtat aactggtacc    169920
     ggtatagtca gcgcaattgt agacgatggt ttggacgctg aaagtgaaga cttgcgtgcc    169980
     aacttcaacg ctaagggttc atgggacttc aatgacaaca ccaacatccc gttgccgcgc    170040
     ttgtatgacg atcaccacgg cactagatgt gctggtgaga tcgctgctgt caagaacgat    170100
     gtctgtggag taggtgtggc gtatgattcc acagtagccg gtatccggat cttgtctgga    170160
     cccattacag ctgccgaaga ggctgccgcc ttgatctacg gcttggatgt caacgacatc    170220
     tactcttgtt cctggggtcc aaccgatgac ggaagaacgc ttgcggaacc ggaaactgtc    170280
     gtgaaaaaag ctatgatcaa gggtgtccaa gagggtcgta aagataaggg atctatctat    170340
     gtgtttgcct ctggaaacgg tggcagatca tatgactcat gcaactacga tggatatacc    170400
     aattccatct tttccataac agtaggtgct atcgactaca agggaattca tcctgattat    170460
     gccgaggcct gttcagccgt catggtggtg acctattcat ctggctcggg agaacatatc    170520
     cacactactg atatcaagaa gagatgtaca gctagccacg gaggtacatc tgcagctgca    170580
     cccttagcag ctggaatcta tgccttggta ttgcaagcta atccgaactt gacatggagg    170640
     gatgtccagt atgtatctgt gctaagttcg gttcccatca accaacagga tggtaactat    170700
     caaaccacag cattgaatag agagtactct cacaagtatg gttacggtaa gatagacgct    170760
     tatcagatgg tacactttgc caaggactgg aagaatgtaa agcctcaggc gttcttctac    170820
     tccgacatcc agctggttag agagactttg gaaacgaacg ctcctccccc taaagaaaac    170880
     aatgcgaacg atggagttga gaaacctccc gctgattctc acaagagaga tggcaatatc    170940
     atccggaaga agatcactgt tactgaagag gatttgaaga ttatgaatgt agaaagagta    171000
     gaacatgtta ctgtgaaact caacattatg gctacattta ggggccgtgt aggagtcaga    171060
     ttgatttctc ccactggtgt gaccagtgac ttggctactt tccgccctcg tgataactct    171120
     ggtgtagggt tcaaggattg gacgttcatg tctgttgctc attggggaga gtcaggtttg    171180
     ggggactgga ccatagaggt gtttggagac gaaaattctt ccaaacagaa gaataccatt    171240
     gtctttgaaa actggcaatt gcgtttcttt ggtgagtcta ttgatgccga caaagctgaa    171300
     acatacgagt tagaaaagga ctatgctgct gttagaagag acagactttc gcagaacaat    171360
     gacaagcaac ctgagacaac ttcagagact ttgtcatcgt ctgagagtgt gtcatcttca    171420
     gaagttggaa cctcaactgt gtctactgag agctctacaa gtgtaactag tacttcagac    171480
     tctacaacac ctgtagaaga ggatcacaat gctgaaaaag taacagaaag tgtttccgct    171540
     agctcgagtt ctacccaaga cgccgaggct acggagtcga gtggagcaga agaagatgaa    171600
     gacggcaagt tgaaatattc cgcagaccat acgggccagt attttatggc acttgctgtt    171660
     gtcggcttta tagtcatcat tcttttcatg aagttcttca agacgccagg aagcggcaga    171720
     agaagaagaa gagaggattt tgagtttgac ataattcctg gcgaggacta ttctgacagc    171780
     gaagacgacg aagattctat ggaatttgga cgtagaagcg gaagaagagc accaccagca    171840
     ccttcattta ttcctaatga agtcgacgat gaggacgacg atcgtgccag agatagagtc    171900
     tatgatgagt tcaatagcga cacattgccc gagtacgaag aagagatgtt tagaatagac    171960
     gacgaggatg aggacgacga ccataagaag cccaagaaga ccgttcgaat cgacacgggc    172020
     gattccaaag tcaaagaaga agaacaaaga cttattgacg atatagacga caagaatcca    172080
     gacgatgctg ttgaagacga aaggttgatc aacacggggt cgtcgtccag ctgaggcctt    172140
     tgagctcgaa gttttcagca attgtgcata tacagatata atatacaatt taaaatggaa    172200
     gtatagcagt tggaaaatga taaagagcat tgatagaaaa gtaaatggaa attgcgattg    172260
     caattgcaat aataagtagg aattcccgtc tccacaaatg aggatgtagg aagtcgtgat    172320
     tcagccgcta gaccgcaggg cgtatctcta taattgctcc atttgtccag gcatttccac    172380
     atgaaaagga taatagaaga aaagcctgca gaggagccag cgattagctg caaacgagtc    172440
     agtgtcgctg ggaaaataat ccgaggatcg gctggtgctc atgggtgaaa ggttcctgat    172500
     gtccggaaag aaccttatca caatcctttg agccagcaag aggttgtacg attttgccac    172560
     ggaattcagt gaaaagttac cgagaagtta ctgagaagtt actgagaagt tgctgagaaa    172620
     ttggcaagac tttagcgagg gagttccagt ggagcggctg cgggttatta caaaagacaa    172680
     aacccgaaag tcgcacagtc gagatcagac tgatttcacg tgacatgtag aaacttttgt    172740
     ccgacatgct tacgaccgat ccgaacgtca gaagagatgg ctcgacggag aaatggagat    172800
     cagagatgga gatatggggt aaattgtggg tctatcatgg ttgcattgtt ataagagtgt    172860
     cagtggtgaa gatcaacttt tgagcttatg aaaatttata gaatggaggc cattttggcc    172920
     atgtttctgg cgatatgtaa tcagaaatca cggaactagc ttcactggat tctcgctgtt    172980
     accgctttgg gcagcaacgg tcgtgatttt tccgtgctgc gagcggtggt ggcccgagca    173040
     gttctctcgg taaacctgga gttttcgcaa acttccgcct gcggcatggt gcgctccagg    173100
     tggggaggaa caggtccagc accgtgcggc ttgaacgcta cgctagacct ggtctagcga    173160
     gagagccagt atatatatag agcaatggtg gaagaatccg cctgcgccag agctggagat    173220
     atatatttga gagcattgag ttcaacgaga aattgtagtg gtagttgtag gtgtagatgt    173280
     actggcttag tgatcaggaa gctacgggaa gattgtaggt gcatcaccgt agtgcgaaat    173340
     tctgccgtgc cagagaactc tccgacgctg gtgccaccga agagtgatac cgaagagtta    173400
     taccgaagag ccagatctga agtcttagtc aatggaatca ttgtcgagtc attttggacc    173460
     ccccatggca tcatgtgcgg actcgtacgt ctgtatttgg agtcaaccaa acccccgaca    173520
     gaatggtgtt actatttggg tgcccccacg gcagatgtag ctccatccct gttagtaata    173580
     catgagttcg ggtctacatt ctactaattt ttcgcttcgg gcctgacaaa tttcacagcg    173640
     gactgtgact gacctgcctg ggcctagaac agtaccacga ccacgaagag agctaaatcc    173700
     gatgatcatg tccccagaat ttggtggcta ttcaaccggt ggccaacacg agcataccag    173760
     acggcccagt gatgttgagc cagttgaagc ctatgtattc ggctgggttt gtccgatagt    173820
     tgtaccccta ttagagctct tgccttcgca gactgtccat gctaaattag cggtgtcgct    173880
     atttttctgc cattttttcc gtaccgcaac tcagcatttc tcactaattg cgacagcaca    173940
     ctctccccaa tgctcggaaa tcgcattcgc actcgcaccc actcgcacgg tgatttccca    174000
     ctatataagc gccggatttt tctccatgca tgcgggcccg atttttcagc ttctcctgac    174060
     ttttctctgg ttgtaatcct ttctactttt gcccccccca aacagccaat tgggatctac    174120
     cttttcattt agaaccacct acatacccct acactatgtc gtttgatcct tttggctcta    174180
     cagccaccat tgtcgtcttt ggagcctcgg gagacttggc taagaagaag accttccctg    174240
     ctctctttgg cttgttccgt gagggccact tatcgtccga tgtcaagatc attggttatg    174300
     ccagatcaca tttggaagaa gacgacttca agaaacgtat ttcggccaac ttcaagggcg    174360
     gtaaccccga aacggtggag cagtttctca aacttacctc atatatctcc ggaccatacg    174420
     acaccgatga aggataccaa actttgttga agtcaattga agactatgaa gccgccaata    174480
     acgtcctgac cccagagaga ctcttctact tagccttgcc gccatcagtg ttcaccacag    174540
     ttgcttcgca gttgaagaag aacgtctatt ccgagactgg caagacaaga atcattgttg    174600
     aaaagccatt tggccacgac ttggaatctt ccagacaatt gcaaaaggac ttgtcgcctt    174660
     tgttcaccga ggaagaatta tacagaattg accattactt gggaaaggaa atggtgaaaa    174720
     acttgttggt gttgagattt ggtaacgagt tgttcaacgg tgtttggaac aaaaaccata    174780
     tcaagtcgat ccagatctcg tttaaggaag cctttggcac cgacggaaga ggaggctatt    174840
     tcgattccat tggaatcgtt agagacgtca tgcagaacca tctcttgcaa gttcttaccc    174900
     tcttgaccat ggacagacct gtttcctttg acccagaagc cgttagagac gaaaaggtca    174960
     agatattgaa ggctttcgat gctttggacc cagaagacat cttgttggga caatacggca    175020
     agtccgaaga cggctccaag cctgggtact tggacgactc tactgttcct aaggactcta    175080
     agtgtgtaac ttacgctgct ttaggtataa agatccacaa cgaaagatgg gaaggtgttc    175140
     caattgttat gagagccggt aaggctttgg acgagtccaa ggttgaaatc agaatccagt    175200
     tcaagcctgt agcaagaggt atgttcaagg aaatccagag aaacgaattg gttatcagag    175260
     tgcaaccgaa cgaatccata tacttgaaga taaactccaa gattccagga atttctactg    175320
     agacttcctt gacagacttg gacttgacat actctaccag atactcaaag gacttctgga    175380
     ttccagaggc ttacgaagcc ttaatcagag actgttactt gggtaaccac tccaactttg    175440
     tcagagacga tgagttggat gtttcatgga agttgttcac accattgttg cagtacattg    175500
     aatctgacaa gtctccacag ccagaagtat atgcttacgg atctaagggt cctaagggct    175560
     tgagagagtt cttgaacaaa cacgactaca tcttcgccga tgaaggtaca taccaatggc    175620
     cattgactac accaaaggtc aagggtaaga tctaggtaaa gacgaaaagt atgatagacg    175680
     tttttggcga tgaaatgttt aatgtgatct gataatagtt ttgttttttc tatagtttaa    175740
     ttttgaaagt ttgggcattc aatatattga tacgctttgt aactagaggt agttctagat    175800
     ggaagtactc cacacttgta gtagtaaatg cttctgctag ctctatatac tttatcggct    175860
     tctactggta atactatacg cttctattca catataattg ttttgaaatc tattccttcg    175920
     attgtgtttc catcgggctc cttcaacaca gatcgtgttc caagagaatc acaccgacaa    175980
     cgttaaaact aaaaatcaga catccatgga aggtcgataa gcggtcaccg gcatactaag    176040
     atgggttcta ttgtatgcta ccgaggaaac tgcgaatgtt tatggtaact ttcatcactt    176100
     tagttcaaca tgtcgttgct gtattctctg gaacccacga ttcactagtg ctttgacgaa    176160
     ggtgtccttt gtaaactcaa caaaagaaat ggtgaaccac aaataatgaa tcagaactgt    176220
     tataatactg gcaagtataa gtcccaaatc aaacacctcc tgcaacagag gatcaatatt    176280
     gataggacgg ttttcaaccc tgtcgtcata gtcgtatcgg actgggaaag aagtagactt    176340
     agtttcatca tcttcgtatt tgtggttcag agaaataata aaatagtaaa gtagtataag    176400
     acaagacgga acaacagagt attacaagtg aatgaattcc ctgacccatc ttgagtctta    176460
     tacctagaag aatgtcaata cgaaactaat ggactggaag tccatgttgt ttgtacagag    176520
     cttaagagtt ctataagtaa acgagaagga aggaatatcc cagactattt atatagtgct    176580
     tgcacaagca aaaatttttt cagactgatg agaagggtta cccggcgcct gcagccagaa    176640
     ccaagaggaa atttttggct gcaaccctat tgactgctag atatgaacag aaagtcgaaa    176700
     tatggaaata taaaattgcc gaagtcaccg agtaaaagaa attctaaatt atagatatga    176760
     tagaatgata tggaagaact ctgtgttggc agaggaaaaa aattgtaaat tatcaagatt    176820
     tgcagaactt gatcgccatt tggagaacaa gaacttacaa atttataata gagatggtta    176880
     tcgtagattc cgttctatct tagcctattt aatcttaatt ttaccatctc tatcaaacat    176940
     tcacaacact tgaattatat aattaaatac cattgttttt ccattctctt atagctgatt    177000
     actttagatg ctaattaatg aaattgctga aacttcttgc agttagcggt gttctcgtga    177060
     acattaagag agtcctagcc agtttcatta attgtaggtt gattagagcc aaagctcaag    177120
     cttcgacgta tactgaagtt gttgacatcg agctttcctg atacagggcc atagttggta    177180
     ctgacagttc tgttgcgcaa ggtactggct cttctggcag cagcagaagt tggaggagca    177240
     gttggaacca cactgtactt tctttctctg aaaaccacac caacctcttt gatgttcttt    177300
     tgatgttcgg gctgaacttg tacgaaccag tcgagattct cgtcgtattc gtacattcta    177360
     taatctgttc cataaggctt cagctcaaga cagtacaatg tgtgcaaagg cacatccaac    177420
     tcaccaatcg cagacttttc caaatttaag aagtaggcta gcaagattct caacaccacg    177480
     cgatgagcaa tgatgagtaa atgatcagta gtacgttcaa tttcggtaat aagcggacgc    177540
     aatctcgtca aaacgtccaa gtacgactct cctccaacac caggatatct ataggataac    177600
     ttatcgtgga ttctggcatc aaactcctta gggtacctac gctggatctc gtcgtaagtc    177660
     ataccttcaa acttaccacc acccaactcg ttcaacattc tcatctgctt gacagagaac    177720
     acttgctcgt tgaaataagc tcctgtttct acggcacgga aaagcatcga cgtccataca    177780
     cagaagttcg gctcagtagg aatgttgtct agagaagcca catcatcttc gctgaaaaga    177840
     gtattatact tcaactccaa cctggtggag aatctttcca actggagctc cctgaacttc    177900
     tttctctgtt ccaccataaa cttggctaaa gccttggaga acttctggcc acgcttagtc    177960
     aacttggaat caccaccaat tctgcctctc aagttatcaa tactctcacc atgtctggtg    178020
     atccagattt gacgttcaca gaggttgaag ttcaagagaa agtagattgt ctgcgaagcc    178080
     aagaagccct tgatgttgta actgactacc tttttgccca cgtcaatcat cttgacatat    178140
     tgaaactgtg gaatcttttc ttcttcttca tcaatagtct catatgcctt ttcgtagttg    178200
     tgtaatctac caacaaagtc cttaagggct acctcagggt ccatgtctct gtagtctggg    178260
     cccagcaact tcaatctgat attgctttct atgattgcag ggtcactaca aatactttct    178320
     agatacaaca cctttaactc accattggtc cgttcattga ttctcttaag aacatgcaaa    178380
     cgacgacttt tggtggagtt tgtggcatca aatataccaa ctgaaccggg cccatcgaca    178440
     atgtagtcca ataagttgtc taaagtgtcc atagcccact tctctctgag agcgttggaa    178500
     gacttgttgt ctggactaaa gaagtctgca ttgtgctgcg aaggggaaga tggctggttt    178560
     gttggagtaa ctgcatcagg caatggcttc ttctctggac cggcattgtt cttatccttt    178620
     cttcgcgtgt ttcctacatt gaaaactcgg caatcatgtt gcaaccagtt caagtatctg    178680
     gtaagtttgt tagtgatgta actcttacca cgagctggaa gccccaccat gacaatcacg    178740
     agcttagagc ctatatctac ggaggcaatc tttccatctg gtgaagtctt tgaagaagtc    178800
     tggccaggaa tgttcaaagt gtatgtcttt ctggcacttg gaggaggttt ggtgagtaac    178860
     aacgacttga gcttctctat tgacggagtc ttttcgaatt gctcctggag ctctaaaggt    178920
     agatcctgta gtaaattgga tctaagttcc tcgttcaaca ggatcttttt cgacaacgga    178980
     gccatgcctg ccatgggtga gggtgtacca ctctgttcag atttggatac agaagcaggt    179040
     actggtggtt ctggaagagc ctcgatgcct acagttgaag tcatgggact gatagactcg    179100
     gaacgaataa gtatgttact cttggctaaa ctcacggccg gcttgagagt attagattct    179160
     agattcttca gtttgttcga atcttcttct gggtctttta atttttctaa atctacatta    179220
     gggttcatat ctgccaagtt gagatcggag atatttctcg ttctggatat cgatggaggt    179280
     ttcatttcat cagtgtcttt attctttgat gacttctgga tgtttttgag ctcttcctta    179340
     acctttttca tgggatcctc gtgagattca tcttcatctt catcatcact ggattgttca    179400
     cgtgtttctg gcgacgccat actggaaacg ataggcgtgt ctgttaacgg acgtttgttg    179460
     aactcgggta agttgacatt ggacgaatct ctgctttcga gaagttgaga gtccaaggat    179520
     ttggaaactc ccattctctc gccagcgtag ggatatgaag aaagctttct caaggcgtag    179580
     tttttcttga agttagagct ggaagttacg ggagtgaggc tgctattgct gacagagggc    179640
     gatatggtgt ttggagaggg cgtgacagac attaggaaat gggctggatg cggaccagga    179700
     ttcgcactag ggttgggatg agatgagttg gtgatatttg cgggattgtg agtatcttca    179760
     tcatcgtcgt catcgtcttc cagatcgctc gagtttcgtg aggaggcccc ggaagaggaa    179820
     gccgaggatg tgaatacttg gctcgagttg gtgtgggcga acttggaaaa cgacaccttc    179880
     ttgttgatgg agcgagcatg ttgaagaact ccgttcgaga tggagtttga ctttttgcgg    179940
     aagtgatgtc tcggatgtaa ttttgcggtc atgattccct ttggtgacgt ttggacgttg    180000
     ctgtcggtat tggtgttgtt gtcggcatta gtgttggcct tgctggtggt ttgtgtgagc    180060
     tgaggacttg tggctggcga ttcttctgca gacgacaagt ccgccgagga ggggaacgac    180120
     tcgtgggaag aggacatgta agggtgtgat ttttggttga tagtggtaga aacaacgaga    180180
     tatgtggaat tagcggtaaa aagatgtaaa ttagtgtgtt ggtcgtggag gttggctttt    180240
     ctttttatct tcgtatttgg gttgatctgg gaaacgagtg cgaacggtca attggttcac    180300
     cagaagaatc aaacagaggt gtggatatga aagacaaaca agagagtcga cacaatcgta    180360
     cggtaggaaa aagctgaaga acagcaggag taatgagacc aataacaagc acggaataaa    180420
     aaagacagcc agagaaaata aggatcataa tgcaacctct gcttaaaggc tattcgcaga    180480
     cgttatatta tgagaatatt attgttccta acgataaggg aaattgggcg ggttgtgtac    180540
     agtatagaat agagagaaga acagccaaga atggtacgag gagagatggg agatgaatgg    180600
     cagagaagga gaaggagaag gagaaggaga attgaagagg tagaatcgca gaagcgtgct    180660
     acccaccacg gccattccac tctagcagaa ttgtacaatt ctcggagttg tatgattacc    180720
     agtgctggag ctcccgtcca ttgctctttt gagctttggc aaggaagccg catcgcctga    180780
     gaagcgcata gttttcctct attctagcga gagaatgtct gaagaatgga ggagtgtact    180840
     tggctctcgt gctaccatta tagtctaatg gctacaggga atcagagcat tctacgagcc    180900
     tctcaagtca cgctacccgg cattgtctcc gctgtctact gatctacgat tggcttattg    180960
     tgtcttcgtt cttgctatcg ctctcaccgc tctcgctcgc aattgtctct ccgccgcagc    181020
     gtgatggagt gatagacttc aagacctgta tggctgagga ggggacagac aagttatggt    181080
     gtaatatttc tgttcacagt ctgttactaa gtataggctg gagtcgagca gcgagatgag    181140
     ctgtcgattt atgtgaaaat accagatctg aatgtctggg tgccgaacac atggccatac    181200
     agtttgtata tagagaatgg acgggacgat ccacagtgag agtagctgag cacgttgaac    181260
     actagaaatg aattatagag tgtagagtaa agccaagcac ttgatagagt tggcttatct    181320
     tagaagaggc tggaaaggaa gacaaagtca aaaagacgaa gtaagaaaga caaaagcgaa    181380
     ggagacaaag aggaaaagac acaatcgcaa gccgtggaga attttctgag tcttgaatga    181440
     gctcattttg gcactccata atatggttac taacggatta atcatgaggt gaagtttaga    181500
     cacagacaat ttctggcatt ccaatgatgt aattggagaa tagacgaagt cttcaactca    181560
     gatgcaccca tcgtgacatc atagacattt ctgtgtgaga tttctagctc tttttgtagt    181620
     ctcagttgtc acgaatctct ggtccccctc tcgtcaaaac tggttcacag tgagatggcc    181680
     agaggatgct ggcttctggt agtcttctat tttctctttg tctctcaact ggagattccg    181740
     actcgggact ggatccggtt ctggcaataa tctcggatcc aaggagggga acgctgatac    181800
     aggcacaatt ggttgatggt tccccaccgg ccaagggttc gttcgagagc cgaacaggaa    181860
     ctatttctaa catcacaatg ggccatcagt gaggagaaag ttcagttctc cacagaccat    181920
     aatgtattca ttgtttggga gagtaatctc agtctgttag tagaaaaaga gaatcatttt    181980
     atgctggcta agagctagtg gtggtgtatt gtagatttcc attgtggtgg tcgtttg