(data stored in ACNUC7421 zone)

EMBL: CP000503

ID   CP000503; SV 1; circular; genomic DNA; STD; PRO; 4708380 BP.
XX
AC   CP000503; AALN01000000-AALN01000226;
XX
PR   Project:PRJNA13902;
XX
DT   04-JAN-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Shewanella sp. W3-18-1, complete genome.
XX
KW   .
XX
OS   Shewanella sp. W3-18-1
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Shewanellaceae; Shewanella.
XX
RN   [1]
RP   1-4708380
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Lykidis A., Tiedje J., Richardson P.;
RT   "Complete sequence of Shewanella sp. W3-18-1";
RL   Unpublished.
XX
RN   [2]
RP   1-4708380
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Lykidis A., Tiedje J., Richardson P.;
RT   ;
RL   Submitted (13-DEC-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 1ffdf802621bd8b1878646731ce1ab5f.
DR   BioSample; SAMN02598315.
DR   EnsemblGenomes-Gn; EBG00001127764.
DR   EnsemblGenomes-Gn; EBG00001127765.
DR   EnsemblGenomes-Gn; EBG00001127766.
DR   EnsemblGenomes-Gn; EBG00001127767.
DR   EnsemblGenomes-Gn; EBG00001127768.
DR   EnsemblGenomes-Gn; EBG00001127769.
DR   EnsemblGenomes-Gn; EBG00001127770.
DR   EnsemblGenomes-Gn; EBG00001127771.
DR   EnsemblGenomes-Gn; EBG00001127772.
DR   EnsemblGenomes-Gn; EBG00001127773.
DR   EnsemblGenomes-Gn; EBG00001127774.
DR   EnsemblGenomes-Gn; EBG00001127775.
DR   EnsemblGenomes-Gn; EBG00001127776.
DR   EnsemblGenomes-Gn; EBG00001127777.
DR   EnsemblGenomes-Gn; EBG00001127778.
DR   EnsemblGenomes-Gn; EBG00001127779.
DR   EnsemblGenomes-Gn; EBG00001127780.
DR   EnsemblGenomes-Gn; EBG00001127781.
DR   EnsemblGenomes-Gn; EBG00001127782.
DR   EnsemblGenomes-Gn; EBG00001127783.
DR   EnsemblGenomes-Gn; EBG00001127784.
DR   EnsemblGenomes-Gn; EBG00001127785.
DR   EnsemblGenomes-Gn; EBG00001127786.
DR   EnsemblGenomes-Gn; EBG00001127787.
DR   EnsemblGenomes-Gn; EBG00001127788.
DR   EnsemblGenomes-Gn; EBG00001127789.
DR   EnsemblGenomes-Gn; EBG00001127790.
DR   EnsemblGenomes-Gn; EBG00001127791.
DR   EnsemblGenomes-Gn; EBG00001127792.
DR   EnsemblGenomes-Gn; EBG00001127793.
DR   EnsemblGenomes-Gn; EBG00001127794.
DR   EnsemblGenomes-Gn; EBG00001127795.
DR   EnsemblGenomes-Gn; EBG00001127796.
DR   EnsemblGenomes-Gn; EBG00001127797.
DR   EnsemblGenomes-Gn; EBG00001127798.
DR   EnsemblGenomes-Gn; EBG00001127799.
DR   EnsemblGenomes-Gn; EBG00001127800.
DR   EnsemblGenomes-Gn; EBG00001127801.
DR   EnsemblGenomes-Gn; EBG00001127802.
DR   EnsemblGenomes-Gn; EBG00001127803.
DR   EnsemblGenomes-Gn; EBG00001127804.
DR   EnsemblGenomes-Gn; EBG00001127805.
DR   EnsemblGenomes-Gn; EBG00001127806.
DR   EnsemblGenomes-Gn; EBG00001127807.
DR   EnsemblGenomes-Gn; EBG00001127808.
DR   EnsemblGenomes-Gn; EBG00001127809.
DR   EnsemblGenomes-Gn; EBG00001127810.
DR   EnsemblGenomes-Gn; EBG00001127811.
DR   EnsemblGenomes-Gn; EBG00001127812.
DR   EnsemblGenomes-Gn; EBG00001127813.
DR   EnsemblGenomes-Gn; EBG00001127814.
DR   EnsemblGenomes-Gn; EBG00001127815.
DR   EnsemblGenomes-Gn; EBG00001127816.
DR   EnsemblGenomes-Gn; EBG00001127817.
DR   EnsemblGenomes-Gn; EBG00001127818.
DR   EnsemblGenomes-Gn; EBG00001127819.
DR   EnsemblGenomes-Gn; EBG00001127820.
DR   EnsemblGenomes-Gn; EBG00001127821.
DR   EnsemblGenomes-Gn; EBG00001127822.
DR   EnsemblGenomes-Gn; EBG00001127823.
DR   EnsemblGenomes-Gn; EBG00001127824.
DR   EnsemblGenomes-Gn; EBG00001127825.
DR   EnsemblGenomes-Gn; EBG00001127826.
DR   EnsemblGenomes-Gn; EBG00001127827.
DR   EnsemblGenomes-Gn; EBG00001127828.
DR   EnsemblGenomes-Gn; EBG00001127829.
DR   EnsemblGenomes-Gn; EBG00001127830.
DR   EnsemblGenomes-Gn; EBG00001127831.
DR   EnsemblGenomes-Gn; EBG00001127832.
DR   EnsemblGenomes-Gn; EBG00001127833.
DR   EnsemblGenomes-Gn; EBG00001127834.
DR   EnsemblGenomes-Gn; EBG00001127835.
DR   EnsemblGenomes-Gn; EBG00001127836.
DR   EnsemblGenomes-Gn; EBG00001127837.
DR   EnsemblGenomes-Gn; EBG00001127838.
DR   EnsemblGenomes-Gn; EBG00001127839.
DR   EnsemblGenomes-Gn; EBG00001127840.
DR   EnsemblGenomes-Gn; EBG00001127841.
DR   EnsemblGenomes-Gn; EBG00001127842.
DR   EnsemblGenomes-Gn; EBG00001127843.
DR   EnsemblGenomes-Gn; EBG00001127844.
DR   EnsemblGenomes-Gn; EBG00001127845.
DR   EnsemblGenomes-Gn; EBG00001127846.
DR   EnsemblGenomes-Gn; EBG00001127847.
DR   EnsemblGenomes-Gn; EBG00001127848.
DR   EnsemblGenomes-Gn; EBG00001127849.
DR   EnsemblGenomes-Gn; EBG00001127850.
DR   EnsemblGenomes-Gn; EBG00001127851.
DR   EnsemblGenomes-Gn; EBG00001127852.
DR   EnsemblGenomes-Gn; EBG00001127853.
DR   EnsemblGenomes-Gn; EBG00001127854.
DR   EnsemblGenomes-Gn; EBG00001127855.
DR   EnsemblGenomes-Gn; EBG00001127856.
DR   EnsemblGenomes-Gn; EBG00001127857.
DR   EnsemblGenomes-Gn; EBG00001127858.
DR   EnsemblGenomes-Gn; EBG00001127859.
DR   EnsemblGenomes-Gn; EBG00001127860.
DR   EnsemblGenomes-Gn; EBG00001127861.
DR   EnsemblGenomes-Gn; EBG00001127862.
DR   EnsemblGenomes-Gn; EBG00001127863.
DR   EnsemblGenomes-Gn; EBG00001127864.
DR   EnsemblGenomes-Gn; EBG00001127865.
DR   EnsemblGenomes-Gn; EBG00001127866.
DR   EnsemblGenomes-Gn; EBG00001127867.
DR   EnsemblGenomes-Gn; EBG00001127868.
DR   EnsemblGenomes-Gn; EBG00001127869.
DR   EnsemblGenomes-Gn; EBG00001127870.
DR   EnsemblGenomes-Gn; EBG00001127871.
DR   EnsemblGenomes-Gn; EBG00001127872.
DR   EnsemblGenomes-Gn; EBG00001127873.
DR   EnsemblGenomes-Gn; EBG00001127874.
DR   EnsemblGenomes-Gn; EBG00001127875.
DR   EnsemblGenomes-Gn; EBG00001127876.
DR   EnsemblGenomes-Gn; EBG00001127877.
DR   EnsemblGenomes-Gn; EBG00001127878.
DR   EnsemblGenomes-Gn; EBG00001127879.
DR   EnsemblGenomes-Gn; EBG00001127880.
DR   EnsemblGenomes-Gn; EBG00001127881.
DR   EnsemblGenomes-Gn; EBG00001127882.
DR   EnsemblGenomes-Gn; EBG00001127883.
DR   EnsemblGenomes-Gn; EBG00001127884.
DR   EnsemblGenomes-Gn; EBG00001127885.
DR   EnsemblGenomes-Gn; EBG00001127886.
DR   EnsemblGenomes-Gn; EBG00001127887.
DR   EnsemblGenomes-Gn; EBG00001127888.
DR   EnsemblGenomes-Gn; EBG00001127889.
DR   EnsemblGenomes-Gn; EBG00001127890.
DR   EnsemblGenomes-Gn; EBG00001127891.
DR   EnsemblGenomes-Gn; EBG00001127892.
DR   EnsemblGenomes-Gn; EBG00001127893.
DR   EnsemblGenomes-Gn; EBG00001127894.
DR   EnsemblGenomes-Gn; EBG00001127895.
DR   EnsemblGenomes-Gn; EBG00001127896.
DR   EnsemblGenomes-Gn; EBG00001127897.
DR   EnsemblGenomes-Gn; EBG00001127898.
DR   EnsemblGenomes-Gn; EBG00001127899.
DR   EnsemblGenomes-Gn; EBG00001127900.
DR   EnsemblGenomes-Gn; EBG00001127901.
DR   EnsemblGenomes-Gn; EBG00001127902.
DR   EnsemblGenomes-Gn; EBG00001127903.
DR   EnsemblGenomes-Gn; EBG00001127904.
DR   EnsemblGenomes-Gn; EBG00001127905.
DR   EnsemblGenomes-Gn; EBG00001127906.
DR   EnsemblGenomes-Gn; EBG00001127907.
DR   EnsemblGenomes-Gn; EBG00001127908.
DR   EnsemblGenomes-Gn; EBG00001127909.
DR   EnsemblGenomes-Gn; EBG00001127910.
DR   EnsemblGenomes-Gn; EBG00001127911.
DR   EnsemblGenomes-Gn; EBG00001127912.
DR   EnsemblGenomes-Gn; EBG00001127913.
DR   EnsemblGenomes-Gn; EBG00001127914.
DR   EnsemblGenomes-Gn; EBG00001127915.
DR   EnsemblGenomes-Gn; EBG00001127916.
DR   EnsemblGenomes-Gn; EBG00001127917.
DR   EnsemblGenomes-Gn; EBG00001127918.
DR   EnsemblGenomes-Gn; EBG00001127919.
DR   EnsemblGenomes-Gn; EBG00001127920.
DR   EnsemblGenomes-Gn; EBG00001127921.
DR   EnsemblGenomes-Gn; EBG00001127922.
DR   EnsemblGenomes-Gn; EBG00001127923.
DR   EnsemblGenomes-Gn; EBG00001127924.
DR   EnsemblGenomes-Gn; EBG00001127925.
DR   EnsemblGenomes-Gn; EBG00001127926.
DR   EnsemblGenomes-Gn; EBG00001127927.
DR   EnsemblGenomes-Gn; EBG00001127928.
DR   EnsemblGenomes-Gn; EBG00001127929.
DR   EnsemblGenomes-Gn; EBG00001127930.
DR   EnsemblGenomes-Gn; EBG00001127931.
DR   EnsemblGenomes-Gn; EBG00001127932.
DR   EnsemblGenomes-Gn; EBG00001127933.
DR   EnsemblGenomes-Gn; EBG00001127934.
DR   EnsemblGenomes-Gn; EBG00001127935.
DR   EnsemblGenomes-Gn; EBG00001127936.
DR   EnsemblGenomes-Gn; EBG00001127937.
DR   EnsemblGenomes-Gn; EBG00001127938.
DR   EnsemblGenomes-Gn; EBG00001127939.
DR   EnsemblGenomes-Gn; EBG00001127940.
DR   EnsemblGenomes-Gn; EBG00001127941.
DR   EnsemblGenomes-Gn; EBG00001127942.
DR   EnsemblGenomes-Gn; EBG00001127943.
DR   EnsemblGenomes-Gn; EBG00001127944.
DR   EnsemblGenomes-Gn; EBG00001127945.
DR   EnsemblGenomes-Gn; EBG00001127946.
DR   EnsemblGenomes-Gn; EBG00001127947.
DR   EnsemblGenomes-Gn; EBG00001127948.
DR   EnsemblGenomes-Gn; EBG00001127949.
DR   EnsemblGenomes-Gn; EBG00001127950.
DR   EnsemblGenomes-Gn; EBG00001127951.
DR   EnsemblGenomes-Gn; EBG00001127952.
DR   EnsemblGenomes-Gn; EBG00001127953.
DR   EnsemblGenomes-Gn; EBG00001127954.
DR   EnsemblGenomes-Gn; EBG00001127955.
DR   EnsemblGenomes-Gn; EBG00001127956.
DR   EnsemblGenomes-Gn; EBG00001127957.
DR   EnsemblGenomes-Gn; EBG00001127958.
DR   EnsemblGenomes-Gn; EBG00001127959.
DR   EnsemblGenomes-Gn; Sputw3181_R0001.
DR   EnsemblGenomes-Gn; Sputw3181_R0002.
DR   EnsemblGenomes-Gn; Sputw3181_R0003.
DR   EnsemblGenomes-Gn; Sputw3181_R0004.
DR   EnsemblGenomes-Gn; Sputw3181_R0005.
DR   EnsemblGenomes-Gn; Sputw3181_R0006.
DR   EnsemblGenomes-Gn; Sputw3181_R0007.
DR   EnsemblGenomes-Gn; Sputw3181_R0008.
DR   EnsemblGenomes-Gn; Sputw3181_R0009.
DR   EnsemblGenomes-Gn; Sputw3181_R0010.
DR   EnsemblGenomes-Gn; Sputw3181_R0011.
DR   EnsemblGenomes-Gn; Sputw3181_R0012.
DR   EnsemblGenomes-Gn; Sputw3181_R0013.
DR   EnsemblGenomes-Gn; Sputw3181_R0014.
DR   EnsemblGenomes-Gn; Sputw3181_R0015.
DR   EnsemblGenomes-Gn; Sputw3181_R0016.
DR   EnsemblGenomes-Gn; Sputw3181_R0017.
DR   EnsemblGenomes-Gn; Sputw3181_R0018.
DR   EnsemblGenomes-Gn; Sputw3181_R0019.
DR   EnsemblGenomes-Gn; Sputw3181_R0020.
DR   EnsemblGenomes-Gn; Sputw3181_R0021.
DR   EnsemblGenomes-Gn; Sputw3181_R0022.
DR   EnsemblGenomes-Gn; Sputw3181_R0023.
DR   EnsemblGenomes-Gn; Sputw3181_R0024.
DR   EnsemblGenomes-Gn; Sputw3181_R0025.
DR   EnsemblGenomes-Gn; Sputw3181_R0026.
DR   EnsemblGenomes-Gn; Sputw3181_R0027.
DR   EnsemblGenomes-Gn; Sputw3181_R0028.
DR   EnsemblGenomes-Gn; Sputw3181_R0029.
DR   EnsemblGenomes-Gn; Sputw3181_R0030.
DR   EnsemblGenomes-Gn; Sputw3181_R0032.
DR   EnsemblGenomes-Gn; Sputw3181_R0033.
DR   EnsemblGenomes-Gn; Sputw3181_R0034.
DR   EnsemblGenomes-Gn; Sputw3181_R0035.
DR   EnsemblGenomes-Gn; Sputw3181_R0036.
DR   EnsemblGenomes-Gn; Sputw3181_R0037.
DR   EnsemblGenomes-Gn; Sputw3181_R0038.
DR   EnsemblGenomes-Gn; Sputw3181_R0039.
DR   EnsemblGenomes-Gn; Sputw3181_R0040.
DR   EnsemblGenomes-Gn; Sputw3181_R0041.
DR   EnsemblGenomes-Gn; Sputw3181_R0042.
DR   EnsemblGenomes-Gn; Sputw3181_R0043.
DR   EnsemblGenomes-Gn; Sputw3181_R0044.
DR   EnsemblGenomes-Gn; Sputw3181_R0045.
DR   EnsemblGenomes-Gn; Sputw3181_R0046.
DR   EnsemblGenomes-Gn; Sputw3181_R0047.
DR   EnsemblGenomes-Gn; Sputw3181_R0048.
DR   EnsemblGenomes-Gn; Sputw3181_R0049.
DR   EnsemblGenomes-Gn; Sputw3181_R0050.
DR   EnsemblGenomes-Gn; Sputw3181_R0051.
DR   EnsemblGenomes-Gn; Sputw3181_R0052.
DR   EnsemblGenomes-Gn; Sputw3181_R0053.
DR   EnsemblGenomes-Gn; Sputw3181_R0054.
DR   EnsemblGenomes-Gn; Sputw3181_R0055.
DR   EnsemblGenomes-Gn; Sputw3181_R0056.
DR   EnsemblGenomes-Gn; Sputw3181_R0057.
DR   EnsemblGenomes-Gn; Sputw3181_R0058.
DR   EnsemblGenomes-Gn; Sputw3181_R0059.
DR   EnsemblGenomes-Gn; Sputw3181_R0060.
DR   EnsemblGenomes-Gn; Sputw3181_R0061.
DR   EnsemblGenomes-Gn; Sputw3181_R0062.
DR   EnsemblGenomes-Gn; Sputw3181_R0063.
DR   EnsemblGenomes-Gn; Sputw3181_R0064.
DR   EnsemblGenomes-Gn; Sputw3181_R0065.
DR   EnsemblGenomes-Gn; Sputw3181_R0066.
DR   EnsemblGenomes-Gn; Sputw3181_R0067.
DR   EnsemblGenomes-Gn; Sputw3181_R0068.
DR   EnsemblGenomes-Gn; Sputw3181_R0069.
DR   EnsemblGenomes-Gn; Sputw3181_R0070.
DR   EnsemblGenomes-Gn; Sputw3181_R0071.
DR   EnsemblGenomes-Gn; Sputw3181_R0072.
DR   EnsemblGenomes-Gn; Sputw3181_R0073.
DR   EnsemblGenomes-Gn; Sputw3181_R0074.
DR   EnsemblGenomes-Gn; Sputw3181_R0075.
DR   EnsemblGenomes-Gn; Sputw3181_R0076.
DR   EnsemblGenomes-Gn; Sputw3181_R0077.
DR   EnsemblGenomes-Gn; Sputw3181_R0078.
DR   EnsemblGenomes-Gn; Sputw3181_R0079.
DR   EnsemblGenomes-Gn; Sputw3181_R0080.
DR   EnsemblGenomes-Gn; Sputw3181_R0081.
DR   EnsemblGenomes-Gn; Sputw3181_R0082.
DR   EnsemblGenomes-Gn; Sputw3181_R0083.
DR   EnsemblGenomes-Gn; Sputw3181_R0084.
DR   EnsemblGenomes-Gn; Sputw3181_R0085.
DR   EnsemblGenomes-Gn; Sputw3181_R0086.
DR   EnsemblGenomes-Gn; Sputw3181_R0087.
DR   EnsemblGenomes-Gn; Sputw3181_R0088.
DR   EnsemblGenomes-Gn; Sputw3181_R0089.
DR   EnsemblGenomes-Gn; Sputw3181_R0090.
DR   EnsemblGenomes-Gn; Sputw3181_R0091.
DR   EnsemblGenomes-Gn; Sputw3181_R0092.
DR   EnsemblGenomes-Gn; Sputw3181_R0093.
DR   EnsemblGenomes-Gn; Sputw3181_R0094.
DR   EnsemblGenomes-Gn; Sputw3181_R0095.
DR   EnsemblGenomes-Gn; Sputw3181_R0096.
DR   EnsemblGenomes-Gn; Sputw3181_R0097.
DR   EnsemblGenomes-Gn; Sputw3181_R0099.
DR   EnsemblGenomes-Gn; Sputw3181_R0100.
DR   EnsemblGenomes-Gn; Sputw3181_R0101.
DR   EnsemblGenomes-Gn; Sputw3181_R0102.
DR   EnsemblGenomes-Gn; Sputw3181_R0103.
DR   EnsemblGenomes-Gn; Sputw3181_R0104.
DR   EnsemblGenomes-Gn; Sputw3181_R0105.
DR   EnsemblGenomes-Gn; Sputw3181_R0106.
DR   EnsemblGenomes-Gn; Sputw3181_R0107.
DR   EnsemblGenomes-Gn; Sputw3181_R0108.
DR   EnsemblGenomes-Gn; Sputw3181_R0109.
DR   EnsemblGenomes-Gn; Sputw3181_R0111.
DR   EnsemblGenomes-Gn; Sputw3181_R0112.
DR   EnsemblGenomes-Gn; Sputw3181_R0113.
DR   EnsemblGenomes-Gn; Sputw3181_R0114.
DR   EnsemblGenomes-Gn; Sputw3181_R0115.
DR   EnsemblGenomes-Gn; Sputw3181_R0116.
DR   EnsemblGenomes-Gn; Sputw3181_R0117.
DR   EnsemblGenomes-Gn; Sputw3181_R0118.
DR   EnsemblGenomes-Gn; Sputw3181_R0119.
DR   EnsemblGenomes-Gn; Sputw3181_R0120.
DR   EnsemblGenomes-Gn; Sputw3181_R0121.
DR   EnsemblGenomes-Gn; Sputw3181_R0122.
DR   EnsemblGenomes-Gn; Sputw3181_R0124.
DR   EnsemblGenomes-Gn; Sputw3181_R0125.
DR   EnsemblGenomes-Gn; Sputw3181_R0126.
DR   EnsemblGenomes-Gn; Sputw3181_R0127.
DR   EnsemblGenomes-Gn; Sputw3181_R0128.
DR   EnsemblGenomes-Gn; Sputw3181_R0129.
DR   EnsemblGenomes-Gn; Sputw3181_R0130.
DR   EnsemblGenomes-Tr; EBT00001718956.
DR   EnsemblGenomes-Tr; EBT00001718958.
DR   EnsemblGenomes-Tr; EBT00001718960.
DR   EnsemblGenomes-Tr; EBT00001718961.
DR   EnsemblGenomes-Tr; EBT00001718962.
DR   EnsemblGenomes-Tr; EBT00001718964.
DR   EnsemblGenomes-Tr; EBT00001718965.
DR   EnsemblGenomes-Tr; EBT00001718966.
DR   EnsemblGenomes-Tr; EBT00001718969.
DR   EnsemblGenomes-Tr; EBT00001718971.
DR   EnsemblGenomes-Tr; EBT00001718972.
DR   EnsemblGenomes-Tr; EBT00001718973.
DR   EnsemblGenomes-Tr; EBT00001718974.
DR   EnsemblGenomes-Tr; EBT00001718976.
DR   EnsemblGenomes-Tr; EBT00001718977.
DR   EnsemblGenomes-Tr; EBT00001718978.
DR   EnsemblGenomes-Tr; EBT00001718979.
DR   EnsemblGenomes-Tr; EBT00001718980.
DR   EnsemblGenomes-Tr; EBT00001718981.
DR   EnsemblGenomes-Tr; EBT00001718983.
DR   EnsemblGenomes-Tr; EBT00001718985.
DR   EnsemblGenomes-Tr; EBT00001718987.
DR   EnsemblGenomes-Tr; EBT00001718988.
DR   EnsemblGenomes-Tr; EBT00001718989.
DR   EnsemblGenomes-Tr; EBT00001718990.
DR   EnsemblGenomes-Tr; EBT00001718992.
DR   EnsemblGenomes-Tr; EBT00001718993.
DR   EnsemblGenomes-Tr; EBT00001718996.
DR   EnsemblGenomes-Tr; EBT00001718998.
DR   EnsemblGenomes-Tr; EBT00001718999.
DR   EnsemblGenomes-Tr; EBT00001719000.
DR   EnsemblGenomes-Tr; EBT00001719003.
DR   EnsemblGenomes-Tr; EBT00001719004.
DR   EnsemblGenomes-Tr; EBT00001719005.
DR   EnsemblGenomes-Tr; EBT00001719008.
DR   EnsemblGenomes-Tr; EBT00001719011.
DR   EnsemblGenomes-Tr; EBT00001719012.
DR   EnsemblGenomes-Tr; EBT00001719013.
DR   EnsemblGenomes-Tr; EBT00001719014.
DR   EnsemblGenomes-Tr; EBT00001719015.
DR   EnsemblGenomes-Tr; EBT00001719016.
DR   EnsemblGenomes-Tr; EBT00001719017.
DR   EnsemblGenomes-Tr; EBT00001719018.
DR   EnsemblGenomes-Tr; EBT00001719019.
DR   EnsemblGenomes-Tr; EBT00001719020.
DR   EnsemblGenomes-Tr; EBT00001719021.
DR   EnsemblGenomes-Tr; EBT00001719022.
DR   EnsemblGenomes-Tr; EBT00001719023.
DR   EnsemblGenomes-Tr; EBT00001719024.
DR   EnsemblGenomes-Tr; EBT00001719025.
DR   EnsemblGenomes-Tr; EBT00001719026.
DR   EnsemblGenomes-Tr; EBT00001719027.
DR   EnsemblGenomes-Tr; EBT00001719028.
DR   EnsemblGenomes-Tr; EBT00001719029.
DR   EnsemblGenomes-Tr; EBT00001719030.
DR   EnsemblGenomes-Tr; EBT00001719031.
DR   EnsemblGenomes-Tr; EBT00001719032.
DR   EnsemblGenomes-Tr; EBT00001719033.
DR   EnsemblGenomes-Tr; EBT00001719034.
DR   EnsemblGenomes-Tr; EBT00001719035.
DR   EnsemblGenomes-Tr; EBT00001719036.
DR   EnsemblGenomes-Tr; EBT00001719037.
DR   EnsemblGenomes-Tr; EBT00001719038.
DR   EnsemblGenomes-Tr; EBT00001719039.
DR   EnsemblGenomes-Tr; EBT00001719040.
DR   EnsemblGenomes-Tr; EBT00001719041.
DR   EnsemblGenomes-Tr; EBT00001719042.
DR   EnsemblGenomes-Tr; EBT00001719043.
DR   EnsemblGenomes-Tr; EBT00001719044.
DR   EnsemblGenomes-Tr; EBT00001719045.
DR   EnsemblGenomes-Tr; EBT00001719046.
DR   EnsemblGenomes-Tr; EBT00001719047.
DR   EnsemblGenomes-Tr; EBT00001719048.
DR   EnsemblGenomes-Tr; EBT00001719049.
DR   EnsemblGenomes-Tr; EBT00001719050.
DR   EnsemblGenomes-Tr; EBT00001719051.
DR   EnsemblGenomes-Tr; EBT00001719052.
DR   EnsemblGenomes-Tr; EBT00001719053.
DR   EnsemblGenomes-Tr; EBT00001719054.
DR   EnsemblGenomes-Tr; EBT00001719055.
DR   EnsemblGenomes-Tr; EBT00001719056.
DR   EnsemblGenomes-Tr; EBT00001719057.
DR   EnsemblGenomes-Tr; EBT00001719058.
DR   EnsemblGenomes-Tr; EBT00001719059.
DR   EnsemblGenomes-Tr; EBT00001719060.
DR   EnsemblGenomes-Tr; EBT00001719061.
DR   EnsemblGenomes-Tr; EBT00001719062.
DR   EnsemblGenomes-Tr; EBT00001719063.
DR   EnsemblGenomes-Tr; EBT00001719064.
DR   EnsemblGenomes-Tr; EBT00001719065.
DR   EnsemblGenomes-Tr; EBT00001719066.
DR   EnsemblGenomes-Tr; EBT00001719067.
DR   EnsemblGenomes-Tr; EBT00001719068.
DR   EnsemblGenomes-Tr; EBT00001719069.
DR   EnsemblGenomes-Tr; EBT00001719070.
DR   EnsemblGenomes-Tr; EBT00001719071.
DR   EnsemblGenomes-Tr; EBT00001719072.
DR   EnsemblGenomes-Tr; EBT00001719073.
DR   EnsemblGenomes-Tr; EBT00001719074.
DR   EnsemblGenomes-Tr; EBT00001719075.
DR   EnsemblGenomes-Tr; EBT00001719076.
DR   EnsemblGenomes-Tr; EBT00001719077.
DR   EnsemblGenomes-Tr; EBT00001719078.
DR   EnsemblGenomes-Tr; EBT00001719079.
DR   EnsemblGenomes-Tr; EBT00001719080.
DR   EnsemblGenomes-Tr; EBT00001719081.
DR   EnsemblGenomes-Tr; EBT00001719082.
DR   EnsemblGenomes-Tr; EBT00001719083.
DR   EnsemblGenomes-Tr; EBT00001719084.
DR   EnsemblGenomes-Tr; EBT00001719085.
DR   EnsemblGenomes-Tr; EBT00001719086.
DR   EnsemblGenomes-Tr; EBT00001719087.
DR   EnsemblGenomes-Tr; EBT00001719088.
DR   EnsemblGenomes-Tr; EBT00001719089.
DR   EnsemblGenomes-Tr; EBT00001719090.
DR   EnsemblGenomes-Tr; EBT00001719091.
DR   EnsemblGenomes-Tr; EBT00001719092.
DR   EnsemblGenomes-Tr; EBT00001719093.
DR   EnsemblGenomes-Tr; EBT00001719094.
DR   EnsemblGenomes-Tr; EBT00001719095.
DR   EnsemblGenomes-Tr; EBT00001719096.
DR   EnsemblGenomes-Tr; EBT00001719097.
DR   EnsemblGenomes-Tr; EBT00001719098.
DR   EnsemblGenomes-Tr; EBT00001719099.
DR   EnsemblGenomes-Tr; EBT00001719100.
DR   EnsemblGenomes-Tr; EBT00001719101.
DR   EnsemblGenomes-Tr; EBT00001719102.
DR   EnsemblGenomes-Tr; EBT00001719103.
DR   EnsemblGenomes-Tr; EBT00001719104.
DR   EnsemblGenomes-Tr; EBT00001719105.
DR   EnsemblGenomes-Tr; EBT00001719106.
DR   EnsemblGenomes-Tr; EBT00001719107.
DR   EnsemblGenomes-Tr; EBT00001719108.
DR   EnsemblGenomes-Tr; EBT00001719109.
DR   EnsemblGenomes-Tr; EBT00001719110.
DR   EnsemblGenomes-Tr; EBT00001719111.
DR   EnsemblGenomes-Tr; EBT00001719112.
DR   EnsemblGenomes-Tr; EBT00001719113.
DR   EnsemblGenomes-Tr; EBT00001719114.
DR   EnsemblGenomes-Tr; EBT00001719115.
DR   EnsemblGenomes-Tr; EBT00001719116.
DR   EnsemblGenomes-Tr; EBT00001719117.
DR   EnsemblGenomes-Tr; EBT00001719118.
DR   EnsemblGenomes-Tr; EBT00001719119.
DR   EnsemblGenomes-Tr; EBT00001719120.
DR   EnsemblGenomes-Tr; EBT00001719121.
DR   EnsemblGenomes-Tr; EBT00001719122.
DR   EnsemblGenomes-Tr; EBT00001719123.
DR   EnsemblGenomes-Tr; EBT00001719124.
DR   EnsemblGenomes-Tr; EBT00001719125.
DR   EnsemblGenomes-Tr; EBT00001719126.
DR   EnsemblGenomes-Tr; EBT00001719127.
DR   EnsemblGenomes-Tr; EBT00001719128.
DR   EnsemblGenomes-Tr; EBT00001719129.
DR   EnsemblGenomes-Tr; EBT00001719130.
DR   EnsemblGenomes-Tr; EBT00001719131.
DR   EnsemblGenomes-Tr; EBT00001719132.
DR   EnsemblGenomes-Tr; EBT00001719133.
DR   EnsemblGenomes-Tr; EBT00001719134.
DR   EnsemblGenomes-Tr; EBT00001719135.
DR   EnsemblGenomes-Tr; EBT00001719136.
DR   EnsemblGenomes-Tr; EBT00001719137.
DR   EnsemblGenomes-Tr; EBT00001719138.
DR   EnsemblGenomes-Tr; EBT00001719139.
DR   EnsemblGenomes-Tr; EBT00001719140.
DR   EnsemblGenomes-Tr; EBT00001719141.
DR   EnsemblGenomes-Tr; EBT00001719142.
DR   EnsemblGenomes-Tr; EBT00001719143.
DR   EnsemblGenomes-Tr; EBT00001719144.
DR   EnsemblGenomes-Tr; EBT00001719145.
DR   EnsemblGenomes-Tr; EBT00001719146.
DR   EnsemblGenomes-Tr; EBT00001719147.
DR   EnsemblGenomes-Tr; EBT00001719148.
DR   EnsemblGenomes-Tr; EBT00001719149.
DR   EnsemblGenomes-Tr; EBT00001719150.
DR   EnsemblGenomes-Tr; EBT00001719151.
DR   EnsemblGenomes-Tr; EBT00001719152.
DR   EnsemblGenomes-Tr; EBT00001719153.
DR   EnsemblGenomes-Tr; EBT00001719154.
DR   EnsemblGenomes-Tr; EBT00001719155.
DR   EnsemblGenomes-Tr; EBT00001719156.
DR   EnsemblGenomes-Tr; EBT00001719157.
DR   EnsemblGenomes-Tr; EBT00001719158.
DR   EnsemblGenomes-Tr; EBT00001719159.
DR   EnsemblGenomes-Tr; EBT00001719160.
DR   EnsemblGenomes-Tr; EBT00001719161.
DR   EnsemblGenomes-Tr; EBT00001719162.
DR   EnsemblGenomes-Tr; EBT00001719163.
DR   EnsemblGenomes-Tr; EBT00001719164.
DR   EnsemblGenomes-Tr; EBT00001719165.
DR   EnsemblGenomes-Tr; EBT00001719166.
DR   EnsemblGenomes-Tr; EBT00001719167.
DR   EnsemblGenomes-Tr; EBT00001719168.
DR   EnsemblGenomes-Tr; EBT00001719169.
DR   EnsemblGenomes-Tr; EBT00001719170.
DR   EnsemblGenomes-Tr; EBT00001719171.
DR   EnsemblGenomes-Tr; Sputw3181_R0001-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0002-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0003-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0004-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0005-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0006-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0007-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0008-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0009-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0010-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0011-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0012-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0013-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0014-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0015-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0016-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0017-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0018-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0019-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0020-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0021-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0022-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0023-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0024-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0025-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0026-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0027-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0028-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0029-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0030-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0032-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0033-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0034-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0035-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0036-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0037-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0038-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0039-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0040-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0041-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0042-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0043-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0044-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0045-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0046-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0047-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0048-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0049-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0050-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0051-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0052-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0053-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0054-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0055-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0056-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0057-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0058-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0059-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0060-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0061-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0062-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0063-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0064-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0065-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0066-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0067-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0068-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0069-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0070-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0071-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0072-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0073-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0074-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0075-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0076-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0077-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0078-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0079-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0080-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0081-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0082-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0083-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0084-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0085-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0086-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0087-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0088-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0089-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0090-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0091-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0092-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0093-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0094-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0095-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0096-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0097-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0099-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0100-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0101-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0102-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0103-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0104-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0105-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0106-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0107-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0108-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0109-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0111-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0112-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0113-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0114-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0115-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0116-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0117-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0118-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0119-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0120-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0121-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0122-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0124-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0125-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0126-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0127-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0128-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0129-1.
DR   EnsemblGenomes-Tr; Sputw3181_R0130-1.
DR   EuropePMC; PMC2493277; 18539733.
DR   EuropePMC; PMC2897672; 20348258.
DR   EuropePMC; PMC3147445; 21642407.
DR   EuropePMC; PMC3850215; 24074349.
DR   EuropePMC; PMC5058578; 27727307.
DR   EuropePMC; PMC5122569; 27933056.
DR   EuropePMC; PMC5958206; 29867831.
DR   EuropePMC; PMC6007103; 29654185.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00208; snoR72.
DR   RFAM; RF00240; RNA-OUT.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02276; Hammerhead_II.
DR   SILVA-LSU; CP000503.
DR   SILVA-SSU; CP000503.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000559
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@pilot.msu.edu)
CC   Contacts: James Tiedje (tiedjej@pilot.msu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4708380
FT                   /organism="Shewanella sp. W3-18-1"
FT                   /strain="W3-18-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:351745"
FT   gene            150..1535
FT                   /locus_tag="Sputw3181_0001"
FT   CDS_pept        150..1535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: shm:Shewmr7_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator, DnaA C-terminal domain; Chromosomal replication
FT                   initiator, DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22854"
FT                   /db_xref="GOA:A1RDX7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RDX7"
FT                   /protein_id="ABM22854.1"
FT                   /translation="MAVSLWQQCIGRLQDELPAQQFSMWIRPLQAEMDGDTLVLYAPNR
FT                   FVLDWVREKYINIINQFFTEQMGSDAPKLRFDIGSRPSAKKFEPAPVATVRAPNTQTKA
FT                   TVGTYFNTQAEPIANANHRSNINPTYQFDNFVEGKSNQLGKAAALQVAENPGGAYNPLF
FT                   LYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRS
FT                   VDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDRYPKEIDGVEDRLKSRFG
FT                   WGLTVAIEPPELETRVAILMRKAQESGINLPDEVAFFIAKRLRSNVRELEGALNRVIAN
FT                   ANFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMADMLSKRRSRSVAR
FT                   PRQVAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYANLIRT
FT                   LSS"
FT   gene            1556..2656
FT                   /locus_tag="Sputw3181_0002"
FT   CDS_pept        1556..2656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: shm:Shewmr7_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22855"
FT                   /protein_id="ABM22855.1"
FT                   /translation="MKFSIDRDALLKPLQLVCGAVERRHNLPILSNLLVEVSGHSLKLT
FT                   GTDLEVELVGQAVVHGDIEEGRTTVPAKKLLDIVKSLPEQSELKVEQQDNKWLLRSGRS
FT                   RFSLATLPAEEYPNVEAFQAEIEFSLKQGVLKSIIDSTQFSMANQDVRYYLNGLLFETE
FT                   GNMLRAIATDGHRLALSHRVIDAQLPEKQVIVPRKGVMEMARLLESDDLDIAIAIGDNA
FT                   IRATTANTVFTSKLVDGRFPDYRRVLPKGGDKIVIASRNHLKQALTRASILSNEKFRGV
FT                   RIQLENGLLKITANNPEQEEAEEIIDVDYNNQSLEIGFNVSYLLDVLNNLKSDDVRITL
FT                   IDGNSSALIENHLEEDSMYVVMPMRL"
FT   gene            2853..3935
FT                   /locus_tag="Sputw3181_0003"
FT   CDS_pept        2853..3935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: shm:Shewmr7_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22856"
FT                   /db_xref="GOA:A1RDX9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RDX9"
FT                   /protein_id="ABM22856.1"
FT                   /translation="MSLTRLNIEAFRNIQFAQLIPAPGINVIYGQNGSGKTSILEAIYF
FT                   LGMGRSFRSHLSQRVINNDNDKLTLFATLNLARGDSKIGLRRFRSGETEVKIDGEKVKR
FT                   LSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHADPQFYGAWTNVRRVLKQRNQ
FT                   LLRNGAVYTHIQFWDQEFVRYAEQVTEIRNHYVDSLNGLLKGIIGEFLPSVDVKVSFTR
FT                   GWDSKTDFAELLENQYSRDLATGHTVSGPHKADLRLRVGNLPAQDALSRGQLKLLVCAL
FT                   RIAQGKLLKQQIDKHSIYLVDDLPSELDAQHRQLLLKQLTDTGAQVFVTAIDPAAIVDS
FT                   LHTPPNRMFHVEQGRVTVVE"
FT   gene            3952..6369
FT                   /locus_tag="Sputw3181_0004"
FT   CDS_pept        3952..6369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: son:SO0011 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22857"
FT                   /protein_id="ABM22857.1"
FT                   /translation="MSENSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
FT                   DNSIDEALAGHCSDITITIHVDGSVSVKDDGRGIPVAIHEEEGVSAAEVIMTVLHAGGK
FT                   FDDNSYKVSGGLHGVGVSVVNALSRKLQMTIRRAGKVYEQFYTHGVPDAPIKEIGDATK
FT                   TGTEIRFWPSEDTFSDVEFHFEILAKRVRELSFLNSGVGIRLIDERDNKNEFFKYEGGI
FT                   SAFVDYLNRNKTPVNKEVFHFMQERDDGITVEVAMQWNDGYQENIFCFTNNIPQRDGGT
FT                   HLVGFRSALTRNLNNYMENEGYNKKGKTNATGDDAREGLTAVISVKVPDPKFSSQTKDK
FT                   LVSSEVKTAVEQTMGEKLNDYLLENPADAKLIVGKIVDAARAREAARKAREMTRRKGAL
FT                   DLGGLPGKLADCQEKDPGLSEIYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKAR
FT                   FDKMLSSQEVATLITALGCGIGRDEYNPDKTRYHNIIIMTDADVDGSHIRTLLLTFFFR
FT                   QMPELIERGYVYIAQPPLFKVKKGKQEQYLKDEPALTQYLTTQALDGTVVYPTQGAPGM
FT                   SGEPLERLVTQYREVEAIVARLEQRYPTHITNRMLYHPMITNEMLADEGKMKEWIDAFI
FT                   HELVEMESSGVLYSAEPILDPERKVYLPKITIRKHGIDTNYLFTYDFFQSSDYQRIGKL
FT                   GAALDGMIEEGGYVQRGERVKEVGSFLEALDWTISEAKRGLYIQRYKGLGEMNPEQLWE
FT                   TTMDPESRRMLQVTIDDAVGADQLFTCLMGDQVEPRREFIEANALNVANLDV"
FT   gene            6571..7617
FT                   /locus_tag="Sputw3181_0005"
FT   CDS_pept        6571..7617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0005"
FT                   /product="putative signal transduction protein"
FT                   /note="PFAM: HDOD; KEGG: shm:Shewmr7_0007 putative signal
FT                   transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22858"
FT                   /protein_id="ABM22858.1"
FT                   /translation="MIKSIFNKLFNLRENNPIERPKSFSATDLGKPLAISPKNITQQES
FT                   ISANVVYVDLSALFYSLLFPARVNDAGGIANNLERRVMTEIEHALASPQVIAEKVLKLP
FT                   SKVLELDRKLADPQFDIKALLALIERDPLLSVEVLKLCNSPAFKRSDRDITSLQQALVQ
FT                   LGREQLRKFVTTCLVREMLDIKPIYFRRFGAEIWRHSMQVAFLASELSDEDQDTAFLLG
FT                   LLHDVGKLAIFKMLLDAFVQAEPGEQPNSGLFRQVMTTKSLTLSSLLAKHWQLPNTFET
FT                   ELDRLATVNSRPQAGLAAVVWRANVISEISMLHQAGQLSPEILANLLQQVNLEQTQFDG
FT                   LHQKLLQF"
FT   gene            complement(7705..9774)
FT                   /locus_tag="Sputw3181_0006"
FT   CDS_pept        complement(7705..9774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0006"
FT                   /product="Glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: she:Shewmr4_0008 glycyl-tRNA synthetase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22859"
FT                   /db_xref="GOA:A1RDW4"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RDW4"
FT                   /protein_id="ABM22859.1"
FT                   /translation="MNFENLLIELGTEELPPKSLRKLAESFLANFTEELTKADLAFSSA
FT                   VWYAAPRRLAINVTELALAQADKIVEKRGPAVSSAFDAEGKPTKAAEGWARGNGITVEQ
FT                   AERLVTDKGEWLVHNAKVEGVETKSLIAAMAQRALDKLPIPKPMRWGNNKTQFIRPVHT
FT                   ATILLGSELIEGELLGIKSARTVRGHRFMGLKQFELAHADHYLADLKEKGKVIADYESR
FT                   KALIKADAEKAAAKIGGTADIEDSLLEEVASLVEWPVVLTASFEEKFLSVPSEALVYTM
FT                   KGDQKYFPVFDDAGKLLPNFIFVANIESKDPAQIISGNEKVVRPRLADAEFFFNTDKKH
FT                   TLESRLPSLETVLFQQQLGTLKDKVNRISALAAFIAEQTGANAVDAARAGLLSKTDLMT
FT                   NMVMEFTDTQGTMGMHYARLDGETEAVAVAMEEQYKPKFSGDTVPSAGVSCAVALADKL
FT                   DTLVGIFGIGQAPKGAADPFALRRAAIGVLRIIVENKLPLDLVTLIAKAQELHGTHLSN
FT                   VNASDEVLEFLMARFRAWYQDKGIGVDVILAVLARRPTRPADFDSRINAVSHFRSLEAS
FT                   GALAAANKRVSNILAKVEGALPTTIDASLLTEAAEQALAAKLNELQPQLAPLFANADYQ
FT                   QALTLLAGLRESVDQFFEDVMVMADDEALKNNRLALLNNLREQFLHVADISLLQ"
FT   gene            complement(9785..10690)
FT                   /locus_tag="Sputw3181_0007"
FT   CDS_pept        complement(9785..10690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0007"
FT                   /product="Glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /note="PFAM: glycyl-tRNA synthetase, alpha subunit; KEGG:
FT                   shm:Shewmr7_0009 glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22860"
FT                   /db_xref="GOA:A1RDW5"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RDW5"
FT                   /protein_id="ABM22860.1"
FT                   /translation="MTTKHDVKTFQGFILTLQEYWAQQGCAIVQPLDMEVGAGTFHPQT
FT                   FLRSLGPEPMSSAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLQ
FT                   ALGIDTQIHDIRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECSPVTGE
FT                   ITYGLERLAMYIQGVDSVYDLVWTDGPMGRITYGDVFHQNEVEQSTYNFEHADVDFMFA
FT                   LFDQCEKMCQHLLSLEKPLPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTMA
FT                   KAVAESYYQAREALGFPMCK"
FT   gene            10808..11410
FT                   /locus_tag="Sputw3181_0008"
FT   CDS_pept        10808..11410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0008"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: shm:Shewmr7_0010 DNA-3-methyladenine
FT                   glycosylase I; TIGRFAM: DNA-3-methyladenine glycosylase I;
FT                   PFAM: methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22861"
FT                   /protein_id="ABM22861.1"
FT                   /translation="MEEIRCGWVSDDPLYREYHDKVWGRPVYDSKELFAKLCLDGQQAG
FT                   LSWITILKKQQNYEQAFANFEPEIIATFDETKVEELMLNPGIVRNRLKVNSIIKNAKGY
FT                   LAYTADGKDFSAFLWSFVGGKPIVNQIRAMSQVPAQTPESEAMSKALKKLGFNFVGPTI
FT                   CYAFMQAVGMVNDHLVECIAYQACVDSCAGLHNHEQH"
FT   gene            complement(11528..14716)
FT                   /locus_tag="Sputw3181_0009"
FT   CDS_pept        complement(11528..14716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0009"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: peptidase S9B, dipeptidylpeptidase IV domain
FT                   protein; amidohydrolase; WD40 domain protein beta
FT                   Propeller; KEGG: she:Shewmr4_0011 amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22862"
FT                   /protein_id="ABM22862.1"
FT                   /translation="MLNAKLTPLYIALILGMNTFTVNATETKESTWHVNAPANAPLEQV
FT                   KVDVNEGTWMNLSVSPDGKHIVFDLLGDIYQIPVTGGEAKPLAQGIAWQMQPVYSPDGK
FT                   HIAFTSDGDGGDNIWIMDADGKKPRTVTKETFRLLNSPAWSPDSQYLVARKHFTASRSL
FT                   GAGEVWLYHVAGGEGVKLTERPNDEKDLGEPAYSPDGRYIYFSQDDTPGKTFHYSKDSV
FT                   NGIYKIKRYDTQTGEIEILIEGTGGAIRPTPSPDGTKLAYIKRDDFQSSLYLLDLKSGE
FT                   TTKLFGELDRDMQETWAIHGVYPTMAWTQDSKDIFFWAKGKINRLNVANKTLTDIPFSV
FT                   KTELAVQPSVRFKQDIDKDVFDVKMLRMAQVSPDGSKVTFEALGKIWLKSLPDGKMSRL
FT                   TELDKNIAELYPQWSRDGKNIVFTTWNDQDQGTVQVISAKGGKPKQLTSEPGKYVEPTF
FT                   SPNGELVVYRKTQGGNLTPRTWSQEPGLYKVDIKGKQNSKLSADGYQAQFGANADRIFF
FT                   MNSSEDETPQLSSINLDGFDKRVHYSSKHATEFRVSPDGEQLAFAERFKVWVTPFAKHG
FT                   ETVEIGPNASNLPVSQLSARAGESISWNSKSDQLYWTLGPELYQAKVDTQYRNKDEKAQ
FT                   PSIIDLGFTEKADVPRGTIAFIGGKVITMENDQVIDNGVVIVKDNHIVAVGDANVAIPK
FT                   DAQIIDIKGKSIMPGLFDAHAHGPQADDEIVPQQNWALYSGLSLGVTTIHDPSNDTTEI
FT                   FAASEQQKVGNIVGPRIFSTGTILYGANAPGYTSHIDSLDDAKFHLERLKKVGAFSVKS
FT                   YNQPRRNQRQQVIAAARELEMMVVPEGGSLLQHNLSMIADGHTTVEHSLPVGSIYNDIK
FT                   QFWSQTQVGYTPTLVVAYGGISGENYWYDKTDVWAHPRLSMYVPADILQARSMRRPHAP
FT                   ESHYNHFNVANVANELNKLGVHPNIGAHGQREGLAAHWEMWMFAQGGMSNMEVLKTATI
FT                   NPATTFGLEHQLGSIKEGKLADLIVIDGDPLADIRVTDRVTYTMVNGKLFNAETMNKLN
FT                   GDKAQRKPFFFEKI"
FT   sig_peptide     complement(14642..14716)
FT                   /locus_tag="Sputw3181_0009"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.957 at
FT                   residue 25"
FT   gene            complement(14938..15390)
FT                   /locus_tag="Sputw3181_0010"
FT   CDS_pept        complement(14938..15390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22863"
FT                   /protein_id="ABM22863.1"
FT                   /translation="MPKLLGIAYKTVKNGLMNEVLYANVTQLSGVEKDIFGRPGKRQVT
FT                   VLSKQQWLTACQSINVDLPWTTRRANLFVDGLVFSSADVGKHLQIGELLLEITGETDPC
FT                   KKMEVAHIGLEAALSPDWRGGVTCRVIVGAMIHQGDTVTLVTESLS"
FT   gene            complement(15435..15680)
FT                   /locus_tag="Sputw3181_0011"
FT   CDS_pept        complement(15435..15680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0011"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: shm:Shewmr7_0013
FT                   SirA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22864"
FT                   /db_xref="GOA:A1RDW2"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RDW2"
FT                   /protein_id="ABM22864.1"
FT                   /translation="MNDAFSNAQHKLDALGLRCPEPVMMVRKTVRQMAAGETLLIIADD
FT                   PATTRDIPSFCEFMDHTLIASETAQTPYQYLIKKGL"
FT   gene            complement(15911..17074)
FT                   /locus_tag="Sputw3181_0012"
FT   CDS_pept        complement(15911..17074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0012"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: son:SO0020 fatty oxidation complex, beta
FT                   subunit; TIGRFAM: acetyl-CoA acetyltransferases; acetyl-CoA
FT                   C-acyltransferase FadA; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22865"
FT                   /db_xref="GOA:A1RDW3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RDW3"
FT                   /protein_id="ABM22865.1"
FT                   /translation="MKQAVIVDCIRTPMGRSKAGVFRNVRAETLSAELMKGLLLRNPQL
FT                   DPNLIEDVIWGCVQQTLEQGFNIARNASLLAGIPKTAGAVTVNRLCGSSMDAIHQAARA
FT                   IMTGMGDTFIIGGVEHMGHVPMSHGVDFHPGLANNVAKASGMMGLTAEMLGKLHGITRE
FT                   QQDAFAVRSHQRAYAATIEGRFAKEIYGIEGHDANGALIKVLQDEVIRPETTMESLAAL
FT                   RPVFDPVNGTVTAGTSSALSDGASAMLIMEESKARALSLPIRARIRSMAVAGCDAAIMG
FT                   YGPVPATQKALARAGITVADLDVIELNEAFAAQSLPCVKDLGLADVVDDKINLNGGAIA
FT                   LGHPLGCSGARISTTLINLMEDKDATLGLATMCIGLGQGIATVFERV"
FT   gene            complement(17097..19247)
FT                   /locus_tag="Sputw3181_0013"
FT   CDS_pept        complement(17097..19247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0013"
FT                   /product="short chain enoyl-CoA hydratase /
FT                   3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="4.2.1.17"
FT                   /EC_number="1.1.1.35"
FT                   /note="TIGRFAM: fatty oxidation complex, alpha subunit
FT                   FadB; PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD-binding; KEGG:
FT                   she:Shewmr4_0018 fatty oxidation complex, alpha subunit
FT                   FadB"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22866"
FT                   /db_xref="GOA:A1RDW6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RDW6"
FT                   /protein_id="ABM22866.1"
FT                   /translation="MIYQSPTIQVELLEDNIAKLCFNAPGSVNKFDRETLASLDAALDS
FT                   IKQNSNIKALVLTSSKDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLPFP
FT                   TASAIKGFALGGGCETILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNA
FT                   LEWISTGNDQRAEDALKVGAVDAVVAPEALEAAAIQMLKDAVAEKLDWQARRNRKLSAL
FT                   TLPKLEAMMSFTTAKGMVFAVAGKHYPAPMAAVSVIEQASTKGRAEALQIEHQAFIKLA
FT                   KTDVAKALIGIFLNDQLVKGKAKKAGKLAKEVKNAAVLGAGIMGGGIAYQSASKGTPIV
FT                   MKDIAQPALDLGLNEAAKLLSAQVARGRSTPEKMAKVLNNITPSLDYAALKHSDVVVEA
FT                   VVEHPKIKAQVLAEVEGYVSEDAIIASNTSTISINLLAKSMKKPERFCGMHFFNPVHKM
FT                   PLVEVIRGEHSSEETIASVVAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEG
FT                   GDFAAIDKVMEKQFGWPMGPAYLLDVVGLDTGHHAQAVMAEGFPDRMGKSGTDAIDVMF
FT                   ENKRLGQKNGKGFYVYSVDSRGKPKKDVDPTSYGLLKDAFGELKTFEADDIIARTMIPM
FT                   IIETVRCLEEGIVASPAEADMGLVYGLGFPPFRGGVFRYLDTMGVANFVALADKYAHLG
FT                   GLYQVTDAMRTKATNNGSYYQA"
FT   gene            19738..21060
FT                   /locus_tag="Sputw3181_0014"
FT   CDS_pept        19738..21060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0014"
FT                   /product="Xaa-Pro dipeptidase. Metallo peptidase. MEROPS
FT                   family M24B"
FT                   /EC_number="3.4.13.9"
FT                   /note="PFAM: peptidase M24; KEGG: shm:Shewmr7_0017 Xaa-Pro
FT                   dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22867"
FT                   /db_xref="GOA:A1RDW7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RDW7"
FT                   /protein_id="ABM22867.1"
FT                   /translation="MDQLAHHYRAHIAELNRRVAEILSREALSGLVIHSGQPHRMFLDD
FT                   INYPFKANPHFKAWLPVLDNPNCWLVVNGRDKPQLIFYRPVDFWHKVSDVPDMFWTEHF
FT                   DIKLLTKADKVAELLPKDTVNWAYLGEHLDVAEVLGFTSRNPDAVMSYLHYHRTTKTEY
FT                   ELECMRRANQIAVQGHLAAKNAFYNGASEFEIQQHYLSAVGQSENEVPYGNIIALNQNA
FT                   AILHYTALEHQSPAKRLSFLIDAGASYFGYASDITRTYAFEKNRFDELIAAMNKAQLEL
FT                   IDMMRPGVRYPDLHLATHAKVAQMLLDFDLATGDAQGLVDQGITSAFFPHGLGHMLGLQ
FT                   VHDVGGFSHDERGTHIAAPEAHPFLRCTRILAPNQVLTMEPGLYIIDTLLNELKQDSRG
FT                   LQINWQTVDELRPFGGIRIEDNVIVHQDRNENMTRELGLAD"
FT   gene            21088..21702
FT                   /locus_tag="Sputw3181_0015"
FT   CDS_pept        21088..21702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0015"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; KEGG:
FT                   shm:Shewmr7_0018 protein of unknown function UPF0029"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22868"
FT                   /protein_id="ABM22868.1"
FT                   /translation="MLDSYLIPSENIQIEEEIKHSRFISFIFHCDSIDKLKLVLTDIKR
FT                   DYPGASHYCYAFIAGAPIDTVLIGSSDDGEPAGSAGRPMLAVLQGANIGEVAAVVVRYY
FT                   GGTKLGVGGLVRAYTSGLRLGLTKLSMQTKQLRYPARLQCDYSQLRDVEYSLQQVDAVM
FT                   INKQFAEVVYIEFEIGKLQQERFSELLMTLSQGSLSAEFEL"
FT   gene            21780..23237
FT                   /locus_tag="Sputw3181_0016"
FT   CDS_pept        21780..23237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0016"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: she:Shewmr4_0021 potassium
FT                   uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22869"
FT                   /protein_id="ABM22869.1"
FT                   /translation="MQYKTIIRIIGLLIGLFSITMLPPALIAIWYNDGGGTAFIQAFFV
FT                   SLFIGFWLWYPNRRCKEELRTREGFLIVVLFWTVLGSIGSLPFIFSNQPDLSWTDSFFE
FT                   SFSALTTTGATVIVGLDSLPKAILFYRHMLQWLGGMGIIVLAVAILPVLGVGGMQLYRA
FT                   EIPGPVKDSKMTPRIAETAKALWYIYLLLTISCAGAYWLAGMSIFDAICHSFSTIAIGG
FT                   FSTHDASMGYFDSPVINLICVFFLIVSAVNFSVHFAAFSRRGINVKVYFKDTEFKMLVA
FT                   IQLILTAICFLTLYHSGIYESPEETLDQALFQAVSVATTAGFGTDSFHMWPLFLPMLLI
FT                   FSSFIGGCGGSTAGGIKVIRVILLLLQGSRELKRLVHPKAMFSIRIGSKALPDRVVDAV
FT                   WGFFSAYALVFVICMLALMAMGLDDITAFSATAACLNNLGPGLGEVASNYASIGDGAKW
FT                   VLVVAMLFGRLEVFTLLILFTPTFWKN"
FT   sig_peptide     21780..21866
FT                   /locus_tag="Sputw3181_0016"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.771) with cleavage site probability 0.769 at
FT                   residue 29"
FT   gene            23240..23764
FT                   /locus_tag="Sputw3181_0017"
FT   CDS_pept        23240..23764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0017"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: shm:Shewmr7_0020 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22870"
FT                   /protein_id="ABM22870.1"
FT                   /translation="MQTLIIYSTIDGQTLAICQKIKLFAEQAGENVSLVTLEQAEALSL
FT                   ADFDKVLIGASIRYGKYRPELYQFVNRHHAVLDTKINGFFSVNVVARKPLKNTPETNPY
FT                   MQKFLKLSLWQPQHLAVFAGKIDYPKYSFFDRTMIRFIMWMTKGPTDINGTFEFTDWAK
FT                   VDAFGTDFSHQ"
FT   gene            complement(23815..24123)
FT                   /locus_tag="Sputw3181_0018"
FT   CDS_pept        complement(23815..24123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0018"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG:
FT                   shm:Shewmr7_0021 transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22871"
FT                   /protein_id="ABM22871.1"
FT                   /translation="MQNDIDVDAMVTNAESAAKWLKAIANPYRLMILCLLLDKELSVTE
FT                   LNATVPLSQSALSQHLAVLRAEDLVDTRKSSQIVYYKLKNEQVTQVISILHNRYCAG"
FT   gene            24326..24880
FT                   /locus_tag="Sputw3181_0019"
FT   CDS_pept        24326..24880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0019"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: she:Shewmr4_0024 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22872"
FT                   /protein_id="ABM22872.1"
FT                   /translation="MIRVLVLYFTRGGHTAKIASAIADQLKNRGAQVDLVDINSAAATR
FT                   INWPDYQVVALGACVLYGTYDKTVFQFIEQHNQALSALPNSFFCVNVVARNPEKRIPEN
FT                   NKYLQKFIALSPWTPADLKIIAGKVDYPSWPWYDRLAIQLIMKMTKGPTDPKSVIDYTD
FT                   WEDVKIYADHLLDLTEVTATT"
FT   gene            complement(24920..26362)
FT                   /locus_tag="Sputw3181_0020"
FT   CDS_pept        complement(24920..26362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0020"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: she:Shewmr4_0025 potassium
FT                   uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22873"
FT                   /protein_id="ABM22873.1"
FT                   /translation="MLNFRPLLFILGLFLSMLTAFMFIPLLLAAFSGEETVGSFMVSAL
FT                   ATGICASLCLHNGQSKTIHLNIRDMFLLTSLTWLIVSLFAAMPFTLYHGIGYTDAFFET
FT                   MSGITTTGSTVLSGLDTMDHSILIWRSLLQWLGGIGFIVMAVAILPFLNVGGMRLFRTE
FT                   SSDWSDKAVPRTQNMAKHLFFIYILLTIVCCVAYHLAGMTWFQAINHAMTTISTGGYST
FT                   SDSSMAAFSNSAHWVGIVFMAAGGLPLLLFVHTIQQRNLHIWNDAQVRGFLFFLTFVSC
FT                   SIGFWLWQTRDIALLDALRLSSFNVVSVVTTTGYGLTDYGSWGAFANIAFLFLMFVGGC
FT                   SGSTSGGIKIFRFQIAGAIMREQLKQQCHPNGLFRERYNNRIISEDIVRSLITFVLLFM
FT                   LVIVGLSVILVLTGLDPMTSFTGAITAVTNVGPGLGPIIGPAGNFSTLPDVAKWALALG
FT                   MLLGRLEILTVAVLFHPSFWKY"
FT   sig_peptide     complement(26264..26362)
FT                   /locus_tag="Sputw3181_0020"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.506 at
FT                   residue 33"
FT   gene            complement(26383..27792)
FT                   /locus_tag="Sputw3181_0021"
FT   CDS_pept        complement(26383..27792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0021"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: shm:Shewmr7_0024 TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22874"
FT                   /protein_id="ABM22874.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITIVDSDRSKLRALQDKYDL
FT                   RVVAGHGAHPDVLKEAGAEDADMLIAVTNSDECNMAACQIAYSLFGTPTKIARIRSEPY
FT                   LAMRDKLFIDSETKNSDGRPRGGFVIDELIAPEQLVTAYIQRLVEYPGALQVLEFAEGK
FT                   LSLVAVRAYYGGPLVGNALAALREHMPNIDTRVAAIFRQGRPIMPRGTTIIEADDEVFF
FT                   VADSRHIRAVMSEMQKLDNTYRNIMIAGGGNIGLGLAKRLERTHSVKLIEHKFERAESL
FT                   SEQLENTTVFCGDASDQELLLEEHIDQTDVFIAVTNDDEANIMSALLAKRMGAKKVMVL
FT                   IQREAYVDIVQEANIDIAISPQQATISALLTHIRQGDICNVYSLRRGAAEAIEAIAHGD
FT                   SNTSKVVGKAIGDIKLPPGTTIGAIVRNDEVLMAHDKTVIEQGDHVILFLVNKKFVGEV
FT                   EKLFQPSAFFF"
FT   gene            complement(27808..29097)
FT                   /locus_tag="Sputw3181_0022"
FT   CDS_pept        complement(27808..29097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0022"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: she:Shewmr4_0027 sun
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22875"
FT                   /protein_id="ABM22875.1"
FT                   /translation="MNLRALAAKAIFEVLEKGVSLSVALPDQQKHLASGKDKALLAEIC
FT                   YGVMRTLPQIEKRISECLEKPLKGKQRIIHQLLIVGCYQLYFTRIPSHAAISETAEACR
FT                   QLKFEGMVKVVNGVLRNIQRQLSPLSTESDTLSYNTPAWLIKRLKEAYPEQWQDIIQQS
FT                   HERPPMWLRNNRLSQSRTEYLAALAELDIEASEGSSADAILLAHPKDVATLPRFHEGAA
FT                   SVQDGAAQWAATLLAPQVNELILDACAAPGGKSCHLLELEPSIKLVAVDFDAKRLERVQ
FT                   QNLDRLSLKAELIHGDAANIGSWWQGGLFDRILLDAPCSATGVIRRHPDIKWLRKNHDI
FT                   EELAELQQQILDHCWKWLKPGGTLLYATCSILPQENRDQISAFLDRTVDAKLDILAQQN
FT                   SPQDIGWQITPGQDNMDGFYYARLLKATHK"
FT   gene            complement(29100..30056)
FT                   /locus_tag="Sputw3181_0023"
FT   CDS_pept        complement(29100..30056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0023"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: shm:Shewmr7_0026
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22876"
FT                   /db_xref="GOA:A1RDX6"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RDX6"
FT                   /protein_id="ABM22876.1"
FT                   /translation="MKSLNIIFAGTPDFAARHLQALLNSQHNVIGVYTQPDRPAGRGKK
FT                   LTASPVKELAVANNIPVYQPGSLRKEPAQQALAALNADIMVVVAYGLILPKVVLDTPRL
FT                   GCINVHGSILPRWRGAAPIQRALWAGDKETGVTVMQMDVGLDTGDMLLKTYLPIEDSDT
FT                   SASLYEKLAEQGPVALLQALKGLANGTLAAEKQDEALANYAEKLSKEEARLDWNKSAKQ
FT                   LWQEVRAFNPWPVSYFEHQGNTIKVWQAHVSETISTAAPGTIISASKRGIEVATADGVL
FT                   TLLSMQLPGKKPLNVADILNARGEWFSPNTRLANEAE"
FT   gene            complement(30066..30578)
FT                   /locus_tag="Sputw3181_0024"
FT   CDS_pept        complement(30066..30578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0024"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: shm:Shewmr7_0027 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22877"
FT                   /protein_id="ABM22877.1"
FT                   /translation="MALLNVLRFPDERLRIQAKPITEFDAELQTQIDNMFETMYQEKGI
FT                   GLAATQVDYHKQLIVMDLQDEIERPKVFINPEIISSSGDFCNEEGCLSVPGIYAKVDRA
FT                   EFVTVKALDRNGCEFIVEADELFAICIQHEMDHLKGKLFVDYLSPLKRQRIKQKLEKAA
FT                   RLDAKEA"
FT   gene            30704..31828
FT                   /locus_tag="Sputw3181_0025"
FT   CDS_pept        30704..31828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0025"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG:
FT                   shm:Shewmr7_0028 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22878"
FT                   /protein_id="ABM22878.1"
FT                   /translation="MDHTMKRLILLVLMTFSCTFVSADTLTLKAGYPESYVVKKGDTLW
FT                   DIATTFLNDPWKWPRLWDVNPQIANPHLIYPGDQLTLIFIDGQPRLVRDSSSAGKPFVK
FT                   KSPEGRIIAKSNAVPAIDLALIKNYLVQNRVVDSNWFSEQPMILAGESPSRHHIIGDVV
FT                   YINNILPLHQKYGVYESGRAFFNKESGEALGQEAILVSTGQVIESGNVSKIKLLSSFRE
FT                   TKAGFKVLPMEDDSLMSAYFTPKPAQLVNHASVLATESAMREAGKLNVVYLDKGTQDGV
FT                   EPGNVFSIYRDGEEIVINHDGSPVPALERTAYDNIIASVSSERSIKMPDVYHGKLMVFK
FT                   VFDKVSLGLIVSTERPVRVDDKLISPDYLAFRGQ"
FT   sig_peptide     30704..30775
FT                   /locus_tag="Sputw3181_0025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            31907..32929
FT                   /locus_tag="Sputw3181_0026"
FT   CDS_pept        31907..32929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0026"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: she:Shewmr4_0031 DNA protecting
FT                   protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22879"
FT                   /protein_id="ABM22879.1"
FT                   /translation="MHMEVDDLRQRLEHERQALPLSDHLLHSLVIDYQKVDAALEWQQH
FT                   SSEHYLICFSDPLYPPLLKQLPDPPSILFVKGCLEALVPPYLAIVGSRNASPGGLQVAY
FT                   QLATEMSSLGFGICSGMAMGIDGAAHKACVDHNKRTIAVLGTGIDIVYPRRHRQLYENI
FT                   QQQGCILSEFWPDIGPFAGNFPKRNRIISGLSLGTLVVEACRKSGSLITARLAMEQGRE
FT                   VFAVPGSILGGYHQGCHDLLRDGAKLVETAADIVEELASLTAFHLEELNLCHHIQKSDI
FT                   CHLPFSSLLASVGYETTTIDAVVEHSGKTIDLVLEQMLELELQGWVIAVPGGYVRVKRS
FT                   "
FT   gene            32932..33405
FT                   /locus_tag="Sputw3181_0027"
FT   CDS_pept        32932..33405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0027"
FT                   /product="protein of unknown function DUF494"
FT                   /note="PFAM: protein of unknown function DUF494; KEGG:
FT                   son:SO0035 Smg protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22880"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RDY5"
FT                   /protein_id="ABM22880.1"
FT                   /translation="MFDILMYLFENYVHSEVELLVDEDELTKELTRAGFHQSEILKALT
FT                   WLERLAELQEGDKPYLCNHDQHSFRIYTKDEMDKLDVESRGFLLFLEQVKVLNVETREM
FT                   VIDRVMELDEPTLILEDLKWVILMVLFNAPGHESAYEQMEDLIFEQPEGRLHS"
FT   gene            33519..34088
FT                   /locus_tag="Sputw3181_0028"
FT   CDS_pept        33519..34088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0028"
FT                   /product="DNA topoisomerase, type IA, zn finger domain
FT                   protein"
FT                   /note="PFAM: DNA topoisomerase, type IA, zn finger domain
FT                   protein; KEGG: shm:Shewmr7_0031 DNA topoisomerase, type IA,
FT                   zn finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22881"
FT                   /protein_id="ABM22881.1"
FT                   /translation="MIMSKIDEQLFSAHEHALEKEYELCPECGSELSVKHSKHGGFIGC
FT                   NNYPSCNYTRPLVQHESIETQVIDGSVCPECGHELAVKSGRFGIFIGCTQYPSCTHIEK
FT                   QDQGANKPDIPCPECKAGKLEHRTSRFGKSFYACSAYPKCKFIVNYPPVAEVCPSCGFG
FT                   ILVERKGAAGMRLECPQKSCKYKRPL"
FT   gene            34236..34802
FT                   /locus_tag="Sputw3181_0029"
FT   CDS_pept        34236..34802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0029"
FT                   /product="translation factor SUA5"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC, N-terminal domain; KEGG: son:SO0037
FT                   Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22882"
FT                   /db_xref="GOA:A1RDY7"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RDY7"
FT                   /protein_id="ABM22882.1"
FT                   /translation="MLQLHPSDIKDIVLNGGVIAYPTEAVYGLGCDPDNDTAIQKLLAV
FT                   KQRPWQKGLILVASDFQQLLAYVDESQLTAEQLEFAFSKWPGPFTFVMPIKAQVSKYLC
FT                   GEFDSIAVRVSAHAGVQALCRALNKPLVSTSANLAGEDPALTAAEILADFTGKIDALVL
FT                   GELGEQRQPSTIIDARSGKILRNGQ"
FT   gene            34828..35736
FT                   /locus_tag="Sputw3181_0030"
FT   CDS_pept        34828..35736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0030"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="PFAM: coproporphyrinogen III oxidase; KEGG:
FT                   shm:Shewmr7_0033 coproporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22883"
FT                   /db_xref="GOA:A1RDY8"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RDY8"
FT                   /protein_id="ABM22883.1"
FT                   /translation="MSVPDVAVVKAFLIDLQNRICAGLQALDGQATFAADSWTRAEGGG
FT                   GTSRVLTQGAVFEQAGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYI
FT                   PTTHANVRFFIAQKEGADPVWWFGGGFDLTPYYPFEEDVREWHQTSKDICAPFGDEVYP
FT                   KYKKWCDEYFFLPHRNETRGVGGLFFDDLNQDGFEQSFSFMQAVGNGFLTAYAPIVERR
FT                   KETEFGERERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRWQYAYT
FT                   PEAGSPEADLYDNYLKPRDWV"
FT   gene            complement(35771..36208)
FT                   /locus_tag="Sputw3181_0031"
FT   CDS_pept        complement(35771..36208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0031"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: son:SO0039 hypothetical globin"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22884"
FT                   /protein_id="ABM22884.1"
FT                   /translation="MNWLKKIFSKHTPPQDDRDPIQSNAYDLIGGEKVIRAITKCFYQK
FT                   MASSAETTTLLAIHRAPIAESEQKLFEFLSGWLGGPQLYQQKYGHPALRARHMHFAVDE
FT                   AMRDQWLFCMKFAIEENINKPEHRAAIFEAISTLADHMRNQ"
FT   gene            36350..37198
FT                   /locus_tag="Sputw3181_0032"
FT   CDS_pept        36350..37198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0032"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="KEGG: son:SO0040 shikimate 5-dehydrogenase; TIGRFAM:
FT                   shikimate 5-dehydrogenase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Shikimate dehydrogenase substrate binding,
FT                   N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22885"
FT                   /db_xref="GOA:A1RDZ0"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RDZ0"
FT                   /protein_id="ABM22885.1"
FT                   /translation="MTDKYAVFGNPISHSKSPFIHGQFAAPTQELLTYEAILAPVDGFE
FT                   ASLTAFFNAGGKGANVTVPFKEQAFALCDSLSPEAKLAGAVNTLSLLADGTIRGDNTDG
FT                   LGLVADLIANLGSLQGKRVLLIGAGGAARGCILPLLNAGIAQLTISNRTHTKAQLLVDI
FT                   FTSVDNGAFANRVTAVEMNELVGEFDIIINSTSASLAGELPPVPAHIITPQTVCYDMMY
FT                   GASVTAFNQWALSQGAAKVIDGLGMLVGQAAKSFTLWRGVEPDTQVVLTLLRDKLKAEP
FT                   K"
FT   gene            37204..37479
FT                   /locus_tag="Sputw3181_0033"
FT   CDS_pept        37204..37479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0033"
FT                   /product="protein of unknown function DUF1488"
FT                   /note="PFAM: protein of unknown function DUF1488; KEGG:
FT                   shm:Shewmr7_0036 protein of unknown function DUF1488"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22886"
FT                   /protein_id="ABM22886.1"
FT                   /translation="MNQSILFPELQYWDDAHKRVCFIAQSQGMNIKCYISANKLTELND
FT                   FSKQPSTDEAAAILALFDAVRFDAEEMAEELIEAEEFDEFGAVHLG"
FT   gene            complement(37613..38161)
FT                   /locus_tag="Sputw3181_0034"
FT   CDS_pept        complement(37613..38161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0034"
FT                   /product="carbonic anhydrase, family 3"
FT                   /note="KEGG: shm:Shewmr7_0037 carbonic anhydrase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22887"
FT                   /protein_id="ABM22887.1"
FT                   /translation="MSGPLRTYQGIHPQLGNNVYVDEASVLVGDIALDTDASIWPMVAA
FT                   RGDVNHIRIGKRSNVQDGSILHVTRKSAARPEGHPLIIGDDVTIGHKAMLHGCKVGNRV
FT                   LVGMGAIILDGAILEDDVILGAGSLVPPGKVLQSGYLYVGSPVKQARPLTPAEIAFLPE
FT                   SADNYVRLKNEYLVELQNI"
FT   gene            38735..40269
FT                   /locus_tag="Sputw3181_R0001"
FT   rRNA            38735..40269
FT                   /locus_tag="Sputw3181_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            40645..43537
FT                   /locus_tag="Sputw3181_R0002"
FT   rRNA            40645..43537
FT                   /locus_tag="Sputw3181_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            43712..43827
FT                   /locus_tag="Sputw3181_R0003"
FT   rRNA            43712..43827
FT                   /locus_tag="Sputw3181_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            44067..46517
FT                   /locus_tag="Sputw3181_0035"
FT   CDS_pept        44067..46517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0035"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: shm:Shewmr7_4007 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   PAS sensor protein; PFAM: GGDEF domain containing protein;
FT                   EAL domain protein; PAS fold-3 domain protein; SMART: PAS
FT                   domain containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22888"
FT                   /protein_id="ABM22888.1"
FT                   /translation="MLRKLSLAVLIPLCMLILYLVLVIGEYLYESDQIRSELAGRQVTQ
FT                   IKQQLLRMQAVVQSAQVLQDIERIEQEVSLAALDMNTMVYILVDMDSRIRFANHTVWRD
FT                   SNAIQVIDGYDVVRHHTVAQSSLPQVSVNMERLTIQAYYPVISQYPGAVELIYLESDLA
FT                   PLVSEASAKLQQRFIRVWGLGGLLLIGFTLILYFLLIKPFRILSESAKHIGTPEFSTQI
FT                   PWSSSEVLSLQSSLQEVHARLGRAVKQLNDSEQRWLFAVEGSRNGIWDWDISTGEVFLS
FT                   DRWKEMIGYAPDELECVFKTWESRLHPEDRETVLDCLQEYISGKSKEFESVHRLRHRDG
FT                   HYIWVLDRGMLVDWDHLGRPMRMIGIHVDVSESEKNHAAIAELVEHSVAGHRMLPAVFM
FT                   ERLSQFLTQEDNSGHWGGLFFIEVESLGVMNSLTSHEAERLFTQIGARLSSYFTDNIIV
FT                   GHLGLGRFTLLAKELSIDAEVAARRTLALATELRQIIARPFHYRDHHFELNANVGIYLL
FT                   DPVETLEPLLVIRRAELAQKHAKLLGQCGCAFYHSELDVRQSRDELLQHELKLAIEHEK
FT                   LSLMFQPIVNVAGEILSAEVLSRWYLANGDVVPPSEFIALAERCGLIAGLDLSVAKRIC
FT                   ILLQQADEQGLSLPRITINISALSFCQIDFIEHLIALIRTYSIRTNQLGIELNESALLL
FT                   QDAFVNERITQLVEIGVPVILDNFGSGHAALSCLNQYPISEVKLDLSCVASITSTQIWQ
FT                   KALIQSVLPFDLCLVAKGIESAQQQQIFTALGCHAYQGYYYSRALNFADFKQLFHSNSL
FT                   LRSV"
FT   sig_peptide     44067..44144
FT                   /locus_tag="Sputw3181_0035"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.741) with cleavage site probability 0.298 at
FT                   residue 26"
FT   gene            complement(46474..47457)
FT                   /locus_tag="Sputw3181_0036"
FT   CDS_pept        complement(46474..47457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0036"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   she:Shewmr4_3914 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22889"
FT                   /protein_id="ABM22889.1"
FT                   /translation="MSQAKATFSTEHDLNTSEQQAFWQTVVQDTLATADGVMLAYMMVK
FT                   HPQAHTAIVLSSGRVESYLKYQELIFDLYQQGYSVYAIDHRGQGLSDRMTINPHMGHVR
FT                   RFNDYIDDFALFMQKIVLPQNDKQLMLLGHSMGGAIGTLYLKQHPDIFTAAAFSAPMYG
FT                   IKLPMPKGFVRWLASKLDTTLNGGEPNYVLAGQNYKPVPFKGNELTHSQTRYQAYRELY
FT                   DAAPKLQLGSPTNRWLTESLDAADTCVLATAQIRTPILILQASEDKIVDNAAQNLAVST
FT                   HCQLKVIAGAAHEIFMEKDACRNQALNYALDFFKRYATKNSNGKVV"
FT   gene            complement(47553..49364)
FT                   /locus_tag="Sputw3181_0037"
FT   CDS_pept        complement(47553..49364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0037"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   shm:Shewmr7_4005 protein of unknown function DUF885"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22890"
FT                   /protein_id="ABM22890.1"
FT                   /translation="MHKLLTPSLLIFALAACSATQTTKNIQTPSSQTISAAQSQVEPIA
FT                   PALQAIIDQSWQLQLSASPEMAYSMGDTSAAGKLADLSPAALAKLNQGQIAVLAQLKAL
FT                   DRSSLSKEDKINAQILEDQIQNDVDLYRFKDYYLPITAESGFHAYITSIAQGRFNTLED
FT                   YRNYIAKLNALPTYFAQQTHWLKQGLAEGITPPKVTLYGFEDSISAYIVPVEKSGYFKP
FT                   FTQYPSYFTEAQKTQLTQEGRTLVEQKVLPLYQNFYDFMTKEYIPNARENIAASSLPNG
FT                   AEFYENRVRYYTTLNMTSMQVHELGLKEVQRIRQEMEQIIASVGFKGNFADFLHFLRTD
FT                   PKFYTTSADQLLKEAAFIAKKADAMLPKYFGKLPRKPYGIAPVPAEIAPKYTTGRYSGS
FT                   NSDDEPGYYWVNTYALDKRPLYELEALTLHEAVPGHHLQISLNSELTSLPDFRRYSYIS
FT                   AFGEGWGLYSEYLGLEAGFYQDPYSNFGRLTYEMWRAARLVVDTGMHAQGWSRQQAIDF
FT                   MASNTALSLHNVTTEIDRYISWPGQALSYKIGELTIKRLRAKAEQELGDKFDIRAFHDA
FT                   VLENGSVPMSILEQQINDFIEAKKVTR"
FT   sig_peptide     complement(49308..49364)
FT                   /locus_tag="Sputw3181_0037"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.612 at
FT                   residue 19"
FT   gene            49575..50570
FT                   /locus_tag="Sputw3181_0038"
FT   CDS_pept        49575..50570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0038"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="KEGG: she:Shewmr4_3912 adenosine deaminase; TIGRFAM:
FT                   adenosine deaminase; PFAM: adenosine/AMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22891"
FT                   /db_xref="GOA:A1RDZ6"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR028893"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RDZ6"
FT                   /protein_id="ABM22891.1"
FT                   /translation="MIDTSIPLVDLHRHLDGNVRVNTIWELGHQHGIALPADSLETLAP
FT                   FVQIQGKETSLVAFLKKLDWMVAVLADLDAVKRVAYENVADAALSGLDYAELRFSPYYM
FT                   AMNHKLPIEGVVEAVVDGVKAGLKDYNVKINLIGIMSRSFGQAACTQELEGLLAHKQHL
FT                   VAMDLAGDELGFPGELFNDHFKRVRDAGLAITAHAGEAAGSQSMWQAIQELGATRIGHG
FT                   VNAIHDPRLMEYLAKHRIGIESCPTSNLHTSTVVSYAEHPFRTFMDAGVLISLNTDDPG
FT                   VSAIDIKHEYRIAKSELKLTDAELAQVQRNGVEMAFLSDSERKALYAAKV"
FT   gene            complement(50667..52007)
FT                   /locus_tag="Sputw3181_0039"
FT   CDS_pept        complement(50667..52007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0039"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /note="KEGG: son:SO4730 oxygen-independent
FT                   coproporphyrinogen III oxidase; TIGRFAM: oxygen-independent
FT                   coproporphyrinogen III oxidase; PFAM: Radical SAM domain
FT                   protein; HemN domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22892"
FT                   /protein_id="ABM22892.1"
FT                   /translation="MIEKYNYSGPRYTSYPTALEFDDTFTEQNLLTAIENSKSDKLSLY
FT                   IHIPFCAKLCYYCGCNKVITRHQHKADQYIEYLSQEIIKRAPLFKHYSVTQMHWGGGTP
FT                   TFLNPEQILKLTSLIKANFNFADEGEFSIEVDPREIELSMLDTLKEAGFNRISIGVQDF
FT                   NKEVQIAVNREQDEQFIFDLMAKAKAMGFVSTNIDLIYGLPHQTPETFAATMQRVLDLS
FT                   PDRLSVFNYAHLPARFAAQRKIKDEHLPSPKQKLEMLHQTIETLTGAGYQYIGMDHFAK
FT                   PDDELAKLQREGRLHRNFQGYTTQEECDLLGLGVSSISQIGDCYAQNQKDIRPYYEAID
FT                   KDGHALWKGCSLNRDDEIRRVVIKQLICHFDLDMAKMDEKLGIQFEEYFAEDLKLLQTF
FT                   IDDKLVEVVDRKITISPTGRLLIRNICMCFDLYYRQKARQQQFSRVI"
FT   gene            complement(52292..52759)
FT                   /locus_tag="Sputw3181_0040"
FT   CDS_pept        complement(52292..52759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_4002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22893"
FT                   /protein_id="ABM22893.1"
FT                   /translation="MSTALIVLGFIIIVALSSYATFLLLKLKQQKQRQQVAHAEREVAA
FT                   NAKRAQILGDIRYIATAMIEDRCEISEGVVRIGRLFEILSLSERVAPEFPSLFQHFELI
FT                   KGHPIMEARQALPKQERMKLDLIRMKSEAELAEGINDDAKKLSDYQLKATH"
FT   sig_peptide     complement(52697..52759)
FT                   /locus_tag="Sputw3181_0040"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.903) with cleavage site probability 0.878 at
FT                   residue 21"
FT   gene            complement(52829..53380)
FT                   /locus_tag="Sputw3181_0041"
FT   CDS_pept        complement(52829..53380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0041"
FT                   /product="protein of unknown function DUF414"
FT                   /note="PFAM: protein of unknown function DUF414; KEGG:
FT                   son:SO4728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22894"
FT                   /protein_id="ABM22894.1"
FT                   /translation="MSRSKKTRKGGENSPKLQPRVKKQDRAVATGKRKESGNKSGSRHN
FT                   EGLILAQAPQQTATQKKDPRHGSKKPVALAIPAATETTQTAKAKQPKLTDEQKLLKLEE
FT                   DPRLNQLLDMLEEGRNLNDADQKWLDQQLNKIEALMIKLGISDELDEDVPASAKALSDD
FT                   ELFDKFESGADLLKDYQDKF"
FT   gene            complement(53471..54109)
FT                   /locus_tag="Sputw3181_0042"
FT   CDS_pept        complement(53471..54109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0042"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22895"
FT                   /protein_id="ABM22895.1"
FT                   /translation="MPRCPLCHNSQTQLLHQDKKRSFYVCKTCELTFADANSHLPPAAE
FT                   KQRYGRSRIASKQKQLSQFILPLLAQLEQQQAGSLLGLNFGRILDDESLTTIENAGHKL
FT                   NQYDPFFAPDHETLKQEYDFICCYRVFEHFKNPIKEWSLLSRLLRLRGWLAISTPLLID
FT                   LDGFAKWHHKNNLTHVSFYQRQTFEFLANNSDFELLFAAKDLVLMQKTS"
FT   gene            complement(54928..55551)
FT                   /locus_tag="Sputw3181_0043"
FT   CDS_pept        complement(54928..55551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0043"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: son:SO4666
FT                   cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22896"
FT                   /protein_id="ABM22896.1"
FT                   /translation="MKKLALALSVVVAAISSPAIAEGNAEAGKTKIIVCSACHGMDGNS
FT                   MIDMYPKLAGQHGTYLQKQLHDFRSAAQTGGKNGRMDPIMGGMSIALSDQDILDISAYF
FT                   ASQTVQVGEVKDIPELGAQLYKGGDVSRGITACMACHGPDAKGAELAGFPTLAGQHANY
FT                   IKIQLTKFRDAGRNNDLNGMMQDVAKKLNDNDIDALSKYLSNLK"
FT   sig_peptide     complement(55486..55551)
FT                   /locus_tag="Sputw3181_0043"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            55721..56380
FT                   /locus_tag="Sputw3181_0044"
FT   CDS_pept        55721..56380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0044"
FT                   /product="cell division checkpoint GTPase YihA"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; KEGG:
FT                   shm:Shewmr7_3998 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22897"
FT                   /db_xref="GOA:A1RE02"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RE02"
FT                   /protein_id="ABM22897.1"
FT                   /translation="MTESHIDFRRAKFLISAPDIAHLDQYLPGDVGVEIAFAGRSNAGK
FT                   SSALNALTEQKSLARTSKTPGRTQLINVFELDSQRRLVDLPGYGFAQVPLAMKNKWQQA
FT                   LGEYLQKRACLSGVVVLMDIRHPLKDLDMQMIQWAVASEIPVLALLTKSDKLAQSAKMK
FT                   TVNEVRKALADFGDWVLVEPFSALKGTGKPKVLSILNEWCHPQWLRDELDTAEQSN"
FT   gene            complement(57192..59960)
FT                   /locus_tag="Sputw3181_0045"
FT   CDS_pept        complement(57192..59960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0045"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: shm:Shewmr7_3997 DNA polymerase I; TIGRFAM:
FT                   DNA polymerase I; PFAM: DNA-directed DNA polymerase; 5'-3'
FT                   exonuclease; 3'-5' exonuclease; SMART: Helix-hairpin-helix
FT                   domain protein, class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22898"
FT                   /protein_id="ABM22898.1"
FT                   /translation="MPTIANNPLVLVDGSSYLYRAYYAPPHLTNSKGEATGAVYGVVNM
FT                   LRSLLSRYQPSHIAVVFDAKGKTFRNDMYSEYKAQRPPMPDDLRSQIEPLHRIIHALGL
FT                   PLISIPGVEADDVIGTIARQASRENRAVLISTGDKDMAQLVDENITLINTMTDTIMGPD
FT                   EVAAKYGVGPDRIIDFLALMGDKADNIPGLPGVGEKTALAMLTGAGSVANLLAAPEKVS
FT                   DLGFRGAKTMAAKITENADMLRLSYELATIKTDVELEQDWHELTAKPADRDELIKCYSE
FT                   MEFKRWLAEVLDNKAPTTVVADAAKVETQESSMPNPALETQYDTILTETQLDEWIAKLK
FT                   QASLIAVDTETTSLDYMVAELVGMSFAVEAGKAAYLPLAHDYVGAPQQLDKQFALEKLR
FT                   PILEDDKVKKVGQNLKYDISVLANAGIKLQGVVFDTMLESYVFNSVASRHDMDGLALKY
FT                   LGHKNIGFEDIAGKGAKQLTFNQIPLEVAAPYAAEDADITLRLHQHLWPRLEKEPQLAS
FT                   VFTEIELPLIQVLSDIERQGVLIDSMLLGQQSDELARKIDTLEEKAYEIAGEKFNLGSP
FT                   KQLQVLFFEKLGYPITKKTPKGAPSTAEEVLVELALDFPLPKVILEHRSLSKLKSTYTD
FT                   KLPLMVNAKTGRVHTSYHQANAATGRLSSSEPNLQNIPIRTEEGRRIRQAFIAPAGRKI
FT                   LAADYSQIELRIMAHLSQDAGLLKAFAEGKDIHRATAAEVFGTDFDAVTTEQRRRAKAV
FT                   NFGLIYGMSAFGLARQLDIPRNEAQTYIDTYFARYPGVLRYMEETRAGAAELGYVSTLF
FT                   GRRLYLPEIRDRNAMRRQGAERAAINAPMQGTAADIIKKAMINIAQWIKTETQGEIAMI
FT                   MQVHDELVFEVDADKAETLKQKVCELMAKAAILDVALLAEAGIGDNWDEAH"
FT   gene            60347..61009
FT                   /locus_tag="Sputw3181_0046"
FT   CDS_pept        60347..61009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0046"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: son:SO4670
FT                   enhancing lycopene biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22899"
FT                   /protein_id="ABM22899.1"
FT                   /translation="MKKIAVLLSGCGVFDGTEIHESVLTLLSLSKAGAHYQCFAPDINQ
FT                   MHVVNHLSGEVDVTETRNVLVESARIARGEIKSTTELEIAAFDALVIPGGFGAAKNLCN
FT                   FATNGSECEVEPLVADFINEFILAKKPVGFICIAPMMIPRLYPHGVKGTIGNDSETVAA
FT                   FNLMGGEHHIATVHEIVVDEANRIVSTPAYMLAGSIAEAHSGIEKLVAKVLEMTDER"
FT   gene            complement(61096..61941)
FT                   /locus_tag="Sputw3181_0047"
FT   CDS_pept        complement(61096..61941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0047"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG:
FT                   shm:Shewmr7_3995 rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22900"
FT                   /protein_id="ABM22900.1"
FT                   /translation="MIEIGRLPNSRAAQAFVDYLKGENIDCQIEPLVQGVAILVIHDKD
FT                   VEQARQEFAHFIAHPYDNKYLQASWEHGDTQTKLDYGAPSLQLFTQFITGAGPVTLIVF
FT                   AVCVLIFAAMNLGFANPIYETLSYFGAVSQSDLSQFWRVFTPSLLHFSAMHVIFNLLWW
FT                   WYLGGRIETRIGTTPLLILLFMAGTLPNIIQYYVSGPNFGGLSGVVYAVVGYTWIMGIR
FT                   KPAAGIGLPPAYMGFMMIWLALGFTDILGVSVANGAHIGGLFIGLTQGLFDSRKSPNSI
FT                   "
FT   gene            complement(61938..62243)
FT                   /locus_tag="Sputw3181_0048"
FT   CDS_pept        complement(61938..62243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0048"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG:
FT                   shm:Shewmr7_3994 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22901"
FT                   /protein_id="ABM22901.1"
FT                   /translation="MSSFKHLSVNQLLQMTEAQPVQIVDIRDGNSFTNGHIAGATNLNN
FT                   ENLAQFISQADMDSPLVVVCYHGMSSQNAAQYLCEQGFDDVYSLDGGYSAWHEANA"
FT   gene            complement(62354..63379)
FT                   /locus_tag="Sputw3181_0049"
FT   CDS_pept        complement(62354..63379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0049"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /EC_number="1.1.1.103"
FT                   /note="TIGRFAM: L-threonine 3-dehydrogenase; PFAM: Alcohol
FT                   dehydrogenase, zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; KEGG: she:Shewmr4_3901
FT                   L-threonine 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22902"
FT                   /db_xref="GOA:A1RE07"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RE07"
FT                   /protein_id="ABM22902.1"
FT                   /translation="MKALSKLKAEKGIWLVDAPKPVMGHNDLLIKIKKTAICGTDMHIY
FT                   NWDEWSQKTIPVPMVVGHEYVGEVVDIGQEVRGFNIGDRVSGEGHITCGHCRNCRAGRT
FT                   HLCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDLV
FT                   GEDVLITGAGPIGIMAAAVCRHVGARHVVITDVNEYRLELARKMGATRAVNVSKESLKD
FT                   VMKELGMTEGFDVGLEMSGVPSAFHAMLDTMNHGGKIAMLGIPGGEMAIDWSKVIFKGL
FT                   VIKGIYGREMFETWYKMASLIQSGLDISPIITHHFKIDDFQQGFDAMGSGQSGKVILSW
FT                   D"
FT   gene            complement(63391..64584)
FT                   /locus_tag="Sputw3181_0050"
FT   CDS_pept        complement(63391..64584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0050"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /EC_number="2.3.1.29"
FT                   /note="KEGG: she:Shewmr4_3900 2-amino-3-ketobutyrate
FT                   coenzyme A ligase; TIGRFAM: 2-amino-3-ketobutyrate coenzyme
FT                   A ligase; PFAM: glycine hydroxymethyltransferase;
FT                   aminotransferase, class I and II; aminotransferase
FT                   class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22903"
FT                   /protein_id="ABM22903.1"
FT                   /translation="MASTSFYAQINQQLADIKAEGLYKSERVIASPQQTAIQVNHQEVV
FT                   NFCANNYLGLANHPELIKAAQQGLDSHGFGMASVRFICGTQDIHKQLEASLSEFLGMED
FT                   TILYSSCFDANAGLFETLLDAEDAIISDALNHASIIDGVRLCKAKRFRYANNDMADLET
FT                   QLIAAKAAGARNILIATDGVFSMDGVIANLQGVCDLADKYGALVMVDDSHAVGFIGANG
FT                   RGTHEYCNVMDRVDIITGTLGKALGGASGGFTSGKKEVIDWLRQRSRPYLFSNSLAPSI
FT                   VSASIHVLEMLKSGQALREAVWENSRYFREQMSAAGFTLGGADHAIIPVMIGDAKLAGD
FT                   FANRLLAEHIYVIGFSFPVVPKGQARIRTQMSAAHTREQLDKAISAFIRIAKEMGII"
FT   gene            complement(64872..65519)
FT                   /locus_tag="Sputw3181_0051"
FT   CDS_pept        complement(64872..65519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0051"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: son:SO4675
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22904"
FT                   /protein_id="ABM22904.1"
FT                   /translation="MKTRDKIIYASLELFNEHGERNITTNHIAAHLNMSPGNLYYHFRN
FT                   KEDIIRSIFSLYENHLESGFQPYEDRRVDVELLIGYFDAMFYTLWQFRFMYANLADILA
FT                   RDEELKKRYLHAQQQVLTRSSHVLHKLKQDGFLSVDTNKITQLADTIKMIVSFWIGYQL
FT                   TQSSTSTITKATLYEGVLRVLMIFKAYATPTSVATFTRLEQHYHALADQESL"
FT   gene            65662..66927
FT                   /locus_tag="Sputw3181_0052"
FT   CDS_pept        65662..66927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0052"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="PFAM: Three-deoxy-D-manno-octulosonic-acid
FT                   transferase domain protein; KEGG: she:Shewmr4_3898
FT                   three-deoxy-D-manno-octulosonic-acid transferase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22905"
FT                   /protein_id="ABM22905.1"
FT                   /translation="MNRFLYSTILYLLSPLLIVYLAFRAIKSPDYRGRWGERFGLTTLK
FT                   STDLLIHSVSMGETLAAIPLIRLIQQSHPELSITVTTTSPTGSAEVRKAFGDSVQHCYL
FT                   PFDLPWCVQRFLSQVSPKWCVIMETELWPNLVAIVAKRGVRLMLANARLSAKSAAQYTK
FT                   RPKLSRPMLQRLDVIAAQTQVEAQRFIELGVSPERVTVCGSLKFDLSITPERLANAKLL
FT                   RQTWGRETSPIWVAGSVHPGEFDAILAAHRQLLARWPDALLIIAPRHPEKFTAVVEVVA
FT                   SQGFEFVRRSDDQPVTVTTQVLVGDTMGELLTFYGAGDQAFVGGSLIHHGGHNPLEPIA
FT                   MGVPVMVGPNYRDFAQITQMLADAGGLRIVVSADELGVNLIEYFAEPELRQQAANAGLA
FT                   VVEANRGALERQFTLVQSLLSH"
FT   gene            complement(66978..67730)
FT                   /locus_tag="Sputw3181_0053"
FT   CDS_pept        complement(66978..67730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0053"
FT                   /product="lipopolysaccharide kinase"
FT                   /note="PFAM: lipopolysaccharide kinase; KEGG: son:SO4677
FT                   3-deoxy-D-manno-octulosonic acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22906"
FT                   /protein_id="ABM22906.1"
FT                   /translation="MNDQIKIIKTANGHMALCQGISEAITPAWFSVDFWRTKNAVVGSS
FT                   KGRYTTWFVACEHSHWVLRHYWRGGLMEKFSKDAYVYTGLANTRAMGELRLLDILYRED
FT                   FAVPKPIAANIVRDGLFYRADIIIERVEGAEDLVAKLGKGTMSTTQWQALGATIAQFHQ
FT                   RGVYHADLNAKNILFQPMQAEGTQERFYLIDFDRGELKTPSSQWQKSNLDRLLRSFNKE
FT                   QGKLPNLAFNADNWTSLMQGYQAAMQSA"
FT   gene            67829..68872
FT                   /locus_tag="Sputw3181_0054"
FT   CDS_pept        67829..68872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0054"
FT                   /product="glycosyl transferase, family 9"
FT                   /note="PFAM: glycosyl transferase, family 9; KEGG:
FT                   son:SO4678 heptosyl transferase, glycosyltransferase family
FT                   9 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22907"
FT                   /protein_id="ABM22907.1"
FT                   /translation="MSLNPNSMNSLCLLRLSAIGDVCHAVAMVQAIQRQYPELNITWVI
FT                   GKLEYQLLKHLPGIEFVIFDKSQGWRSYFNLRKALKGRHFDVLLHMQVALRATLASVAI
FT                   SAKVRIGFDRARAKEGQWLVTNHRVEPLAKPHVLEGFMGFAKAIGVKDLTPQWNIPVPI
FT                   ADTEFAQMHIKDNERVFMICAAASKAERNWLPERYAAVASHAISKGFRVILCGGPTQLE
FT                   KDLAEQILLACPSKIDNLVGKTSLTQLLALLKRSSLVLAPDTGPAHMAVTQGTPVIGLY
FT                   AHSNPGRTGPYLSQQYVVSVYEEAIASQHRDEVKWGTRAKGQNLMVLISVEAVIEKFEL
FT                   VVEQALR"
FT   gene            68961..70046
FT                   /locus_tag="Sputw3181_0055"
FT   CDS_pept        68961..70046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0055"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   son:SO4679 glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22908"
FT                   /protein_id="ABM22908.1"
FT                   /translation="MRIAIAIDSLAGGGAEKVMITLAKQFIRLGHEPHFLVMEDNRYYE
FT                   TPEDLPIHQCFAPKDKDFDHFGRLNASVHKLSAKIAEIESQVGKFDLFLSNLDKTNLMM
FT                   TKTDVSPLYVIVHSSVEEELSRQFKLGPFAYFKKLRAKKALNGQHLITVSNGIAKEIKD
FT                   KGRLHPASMQTIYNPFEFNEITSQSQQDNPQIPKGDYLIHVGRFAKQKRHDVLFEALKL
FT                   TRNQLPVVLLCHNHKKAIKAAKKFGIEKRLIIPGFQSNPFPWIKQAKALVLSSDFEGLP
FT                   TVLIESLACGTPVVSTDCPHGPNEILTGNLVSYLVPRRDPKALSKMIDEVVSQPPSLEQ
FT                   VEILAKVDATLIAEQYLALAK"
FT   gene            70077..71156
FT                   /locus_tag="Sputw3181_0056"
FT   CDS_pept        70077..71156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0056"
FT                   /product="CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /note="PFAM: CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase; KEGG: son:SO4680 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22909"
FT                   /protein_id="ABM22909.1"
FT                   /translation="MEEVKQAKRRYLLYIAQNYSYAMLRPLQQVIWDRGDEVSWFLEGD
FT                   EVDPKFLRDYEQRLPNVDAVKAWKPDAVFVPGNVVPSFIPGVKVGVFHGFNAGKMNHKG
FT                   REDHFEIRGCFDLYCTQGPATTLPFLKLVKTFGTFTVAETGWPALDPLFLENKENPYIK
FT                   HDDPRPIVLFCSTFSRSLTCAPVVFEQIKALSQKSQWRWLVQFHPKMNSSIVEQYKALE
FT                   NENLQFVETDNVIPLLQAGDVMLCDTSSILLMFLMQHKPVVTFKNQSPKDYLIDISRVE
FT                   DIESALVRALSRPDDLMVHIHDYCSQIHPTGDGQSSQRVLAATDALIDKGTDWLKPKPL
FT                   NLLRHFKMRRKLGYWKFCS"
FT   gene            71321..72280
FT                   /locus_tag="Sputw3181_0057"
FT   CDS_pept        71321..72280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0057"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   bfs:BF0187 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22910"
FT                   /protein_id="ABM22910.1"
FT                   /translation="MTKMQPIISIIIPIYKVERFLERCLNSVLAQTYNDFEVICINDGS
FT                   PDNCDLILAEYEKNDNRIKVINQVNQGPSVARNAGLSSARGDYVYFIDPDDAIQPQTLE
FT                   IAFLLAKKHQADLVVWQRVYSNGLGKPDKIFDLKKIDAVIITDPLYHKSKRHNKIGSVV
FT                   WNKLYKRELLKDIFFIPGIHYEDISFSFSVIAKRPKIVIIPTPLYLYTKFEESITQQKP
FT                   TLKIINDYHIAIDSIYETYKKSMGSKELKHIKNNLMRPLLSYQFKKCKQADQEQRSAML
FT                   QAFAEELRDLDAKGLLTWRGHRIYLYIAYKKLMRTARL"
FT   gene            complement(72561..73634)
FT                   /locus_tag="Sputw3181_0058"
FT   CDS_pept        complement(72561..73634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0058"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   she:Shewmr4_3889 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22911"
FT                   /protein_id="ABM22911.1"
FT                   /translation="MKKIAIFCHNFFSNGTVKVALSQAEVLQQAGQDVYLFVFHKEGDF
FT                   MPPQNVTIHYLFEAGQKPSLHEQRQQLKAKVTEVEKTGKFSLFLSNSTDCDIVVSGCDF
FT                   EPCYYFCHCALKQELLMELKRGPVHFWRRWKKAKALIGKKIITVSNGIADELRTTSWLK
FT                   PKSVQTIYNPFRLEEIQKKAKEVIADIPTEPYMIHVGRVTRQKRHDILFKALRDMPTAP
FT                   KLVLLCNRPNKARKLAKKYGVEHRIITPGFQHNPYAWIARAELMLLSSDFEGLPTVIIE
FT                   ALVCGTPVVSTDCPHGPNEILTGHLAKYLVPVRQPALLAQRAFECLTSPPSLEDLEILK
FT                   AVDSQFIAQQYIELSRD"
FT   gene            complement(74334..76175)
FT                   /locus_tag="Sputw3181_0059"
FT   CDS_pept        complement(74334..76175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0059"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: vvy:VV0298 predicted
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22912"
FT                   /protein_id="ABM22912.1"
FT                   /translation="MIDHSLKLKLHSHGALILVNALIAMVIASRYFAFLPELPSDSLGI
FT                   FFLLVSTFSQMALLAGILGLVTLPLVYLPTTLRQCLQSGLAALAISVLVIDTFVFAQYR
FT                   FHINSVVLDLILAGQIVSFPWSTWVMVCVGVGVLWMGEWLLIRWLESTPLRKKSLNRYF
FT                   LSLTIIALLSTHSVHIWAAANAYQPVTQLKRYLPLFYPATANSLMRKYGYINESAIAQQ
FT                   KALTLKSQSDLRYPIEPLSFTEVSKPTNILLLVIDSWRADTFNAENTPNLWALAQSGVI
FT                   FNQHIASGNSTRAGIFGLFYGIPGTYWHAMLANQQSPLIVDRLQQLNYQMGIFTAAQLH
FT                   KPEFDQTVFVNIDNLRIGSSGTSPSALDANLVNDWTAWYAQRDKQRPVFSFLFFDSPHG
FT                   YDFPSDYPHRYEPMLSEINYLQLNNNSDPVPFFNRYKTSVHYVDSLAKQVLETLKSSGE
FT                   LDNTLVIITGDHAQEINDNKLNFWGHNSNYTDAQVKVPFAIVGPKVNVEMISKSNNKLT
FT                   SHQDVVPTLMENYLGVKSPINHYSVGKNLLNQIMERPWIISTDYNGFAIITDESILEVG
FT                   ASGQYELLDKTNRPLKNQQPNFDYLQQALEQLSRFNK"
FT   gene            76556..77047
FT                   /locus_tag="Sputw3181_0060"
FT   CDS_pept        76556..77047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0060"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="KEGG: son:SO4684 phosphopantetheine
FT                   adenylyltransferase; TIGRFAM: pantetheine-phosphate
FT                   adenylyltransferase; cytidyltransferase-related domain;
FT                   PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22913"
FT                   /db_xref="GOA:A1RE18"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RE18"
FT                   /protein_id="ABM22913.1"
FT                   /translation="MHTRAIYPGTFDPITNGHVDLIERAAKLFKHVTIGIAANPSKQPR
FT                   FTLEERVELVNRVTAHLDNVEVVGFSGLLVDFAKEQKASVLVRGLRAVSDFEYEFQLAN
FT                   MNRRLSPDLESVFLTPAEENSFISSTLVKEVALHGGDVSQFVHPEVTAALAAKLKLVKP
FT                   "
FT   gene            77138..78613
FT                   /locus_tag="Sputw3181_0061"
FT   CDS_pept        77138..78613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3982 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22914"
FT                   /protein_id="ABM22914.1"
FT                   /translation="MKAFFSPTILATSIASGIFFSSMLAAAPWVDASDIYLRADIQALA
FT                   DAGVITVPVNTYPLMWSGIGGDLAKIEPELLSPSLVQAFARVNFYYQNAVDNRGNARIK
FT                   VSAASDPARFQHYGSDYREKGEVLGSYEYLGSRVAYKATVAETYDPQDNKNFRLDESYF
FT                   AIIFGNWIATLGAVEQWWGPGFDSALHRSNNARPMSSLTLSRNNAAAFETPWLSWIGPW
FT                   TFKTGFSLTEVDRAVPKTAEWDMRLSARPIKQLEVGLSWSTLFCGEGQDCNFNSWWDSV
FT                   ASNSVCLDGTSNCTPDERRDAGHRTQSIDMRYTSSLQDIPVGLYLEHSCENGSDCGSLW
FT                   GIDTHFGTSGKQFKLFMEYSDTYVKCDGDSANCFYEDPVYLSGSRYYGRALGSTYDSDA
FT                   QTFVVGLVGQFSNSRGFTSLLRYAKLNKDGTNVASTWAPQPPKEDLLMLELSYRMPVWK
FT                   GMWSLGGTVSRSEFDVQENDTNATLFSSFEYRF"
FT   sig_peptide     77138..77218
FT                   /locus_tag="Sputw3181_0061"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.985 at
FT                   residue 27"
FT   gene            complement(78679..79686)
FT                   /locus_tag="Sputw3181_0062"
FT   CDS_pept        complement(78679..79686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0062"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain; KEGG: shm:Shewmr7_3979 UDP-glucuronate
FT                   5'-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22915"
FT                   /protein_id="ABM22915.1"
FT                   /translation="MKYLVTGAAGFIGAKVSERLCLLGHEVIGIDNLNDYYDVNLKLAR
FT                   LDLLQTLDNFHFIKLDLADREGIAALFARHAFQRVIHLAAQAGVRYSLDNPLAYADSNL
FT                   IGHLTILEGCRHHKIEHLVYASSSSVYGLNQKMPFSTEDSIDHPISLYAATKKANELMS
FT                   HTYSHLYQLPTTGLRFFTVYGPWGRPDMALFKFTKAILAGEVIDVYNHGDLSRDFTYID
FT                   DIVEGIIRVQAKPPRPNTDWTVEAGTPATSSAPYRVFNIGNGSPVQLLDFITALEDALG
FT                   IKANKNLLPMQPGDVHSTWADTSDLFDAVGYKPLMDINTGVAQFVDWYRQFYNK"
FT   gene            complement(79710..80873)
FT                   /locus_tag="Sputw3181_0063"
FT   CDS_pept        complement(79710..80873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0063"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase; KEGG:
FT                   son:SO4687 UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22916"
FT                   /protein_id="ABM22916.1"
FT                   /translation="MNIVVVGMGYVGLSNAVLLAQQNQVTAIDLVPERVKQVNERKSTV
FT                   VDELIEDYLQNKPLNLTATMENVAFQSADFVIIATPTDYDPQTNYFNTHSVESVIRDVL
FT                   AVNPDTTIIIKSTVPVGYTAALRHKFKSDNILFSPEFLREGKALYDNLHPSRIVVGERS
FT                   ARAQVFADLLAKAAIKQDIPILLTDSTEAEAIKLFANTFLAMRVAYFNELDTYAESRGL
FT                   NTRQIIEGVSLDPRIGDYYNNPSFGYGGYCLPKDTKQLLANYNDVPNNLISAIVDSNTT
FT                   RKDFIADAIIRKQPKCVGIYRLIMKADSDNFRASAVQGVMKRIKAKGIEVVVFEPVLKE
FT                   DYFFKSRVMRDLTEFKSLCDVIVSNRMVDELNDVADKVYTRDLFHHD"
FT   gene            81108..81839
FT                   /locus_tag="Sputw3181_0064"
FT   CDS_pept        81108..81839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0064"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   she:Shewmr4_3884 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22917"
FT                   /protein_id="ABM22917.1"
FT                   /translation="MISIVIPAKDEVGNIGPLMEEICQALQGLTEFEILVVDDGSQDDT
FT                   FGEVMRTAAEQQCDAKAIRHERSTGQSTAISTGVLHARGKYIVTLDADGQNDPADIPAM
FT                   FAQLPQIQAEHFCIAGYRKNRKDTAWKRFQSRFANKVRDALLHDGVPDTGCGLKLIPRE
FT                   TFLRLPYFDHMHRYIPALVRRMDGEIFISVVNHRDRQVGISKYTAWNRVWVGIVDIMGV
FT                   IWLGRRAKVAKIARSESSWRD"
FT   gene            81841..82506
FT                   /locus_tag="Sputw3181_0065"
FT   CDS_pept        81841..82506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22918"
FT                   /protein_id="ABM22918.1"
FT                   /translation="MKRLYKAIFIVCILLVLMLAAQQGLFEHVTDSNWVAHFIADKGRF
FT                   AFLVLLAIGALFTAVGGPRQVIAFVFGFALGGIYGGLFSTLAALLGCVSAFYVARLTIR
FT                   SSLQRRFGRRLQKFEALISDKTWLKVLMIRLLPVGSNLLTNLFAGATHVPARGFMLGSV
FT                   LGYLPQMLIFSFAGAGIGLSDHHQLGISIGLFILSSVIGAYLYRSSLRKQVDELETEA"
FT   sig_peptide     81841..81906
FT                   /locus_tag="Sputw3181_0065"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.693 at
FT                   residue 22"
FT   gene            82516..84240
FT                   /locus_tag="Sputw3181_0066"
FT   CDS_pept        82516..84240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0066"
FT                   /product="glycosyl transferase, family 39"
FT                   /note="PFAM: glycosyl transferase, family 39; KEGG:
FT                   shm:Shewmr7_3975 glycosyl transferase, family 39"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22919"
FT                   /protein_id="ABM22919.1"
FT                   /translation="MEALSRRFNRQDYYQVLWPLLLISLLVLLVGVGFRSPWPADEPRF
FT                   VEVAREMVSSGQWLFPTRGGEYYPDKPPVFMWAIALFYQLTGSLKLAFLLPNALCGLLT
FT                   VFLVYDLGARLWNVRVGRNAALLLLIVPQFLMQAKNAQIDAMVMCWITVGCYGLIRHFM
FT                   LGPHWRWYFVGWAFMGLGVITKGVGFLPLLMLIPIGIYAVKDKSRFQGRLTWLCLAGPL
FT                   AMLAVIACWLVPMVLTVQTHGTPELVAYQNNILFKQTGERYVNAWHHIKPWYFFVLSVI
FT                   PWMWFPISLLVVAYWKQWVQKVKADPTIAMLLIWVALVVLFFSISPGKRNVYILPALPM
FT                   LALAASAVLTGVAPKVWFEKLVSGLLWFLGGVVLLAGVLALIHHPALVKALADYTDDLT
FT                   GIGYLFILLGLLWFLLLWLARKQFALVKMGIVSALGWVLISTWGYSMLDEMRTPRSLML
FT                   HTAEVIGEDAELGLVNFKEQFILFSPMSVTHFSYLASVEEQERNAWQWMQENKQRYLLV
FT                   PSGAELSCFDIKGGKSMGMAHRDEWILLSATELKPQCEKPKREYRYFTDHPGRWLKE"
FT   gene            complement(84303..85118)
FT                   /locus_tag="Sputw3181_0067"
FT   CDS_pept        complement(84303..85118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0067"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase /
FT                   Formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: she:Shewmr4_3881 formamidopyrimidine-DNA
FT                   glycosylase; TIGRFAM: formamidopyrimidine-DNA glycosylase;
FT                   PFAM: Formamidopyrimidine-DNA glycolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22920"
FT                   /db_xref="GOA:A1RE25"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RE25"
FT                   /protein_id="ABM22920.1"
FT                   /translation="MPELPEVEVTRQGIAPYLVEQTVIDLVIRNGSLRWPVPDIAKQII
FT                   GQVIRQVRRRAKYLLIDTDAGTSIVHLGMSGSLRILPHDTPVEKHDHIDLVLANGRILR
FT                   FNDPRRFGAWLWCELPEEAHPLLAKLGPEPLTNAFNVKQLAAALTGKKKAIKLCLMDNH
FT                   IVVGVGNIYANEALFAAGIHPEAEAGKIDIERLTVLVAEVKQILAHAIKQGGTTLKDFT
FT                   NADGKPGYFAQKLHVYGRGGETCTSCGNLLSEIRLGQRTTVFCGICQTR"
FT   gene            complement(85154..85609)
FT                   /locus_tag="Sputw3181_0068"
FT   CDS_pept        complement(85154..85609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4725 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22921"
FT                   /protein_id="ABM22921.1"
FT                   /translation="MALTRKQWNNIIIVACAFMVAVLTFMDNNTNNVPSDAQRLFDDNA
FT                   PLSQLQLDGLWLHKQASQWECDTKVLNCDEWAKAWQTIRVSPLTAAPETTDNPQELVIQ
FT                   IADIRDAQLWIYFPNEGALKSPAGNWYLVPPSLRAKLQPILDAKPAT"
FT   gene            complement(85700..86683)
FT                   /locus_tag="Sputw3181_0069"
FT   CDS_pept        complement(85700..86683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0069"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: son:SO4724 molybdenum cofactor biosynthesis
FT                   protein A, putative; TIGRFAM: molybdenum cofactor
FT                   biosynthesis protein A; PFAM: Radical SAM domain protein;
FT                   molybdenum cofactor synthesis domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22922"
FT                   /protein_id="ABM22922.1"
FT                   /translation="MSLIVDSFGRKVEYLRLSVTDRCDFRCVYCMTEDPCFLPKDHVLH
FT                   LEELAWIAQAFTELGVTKIRLTGGEPLVRTDCDQLVGLLGKLPGLTDLSMTTNGSRLTK
FT                   FAKPMFDAGLKRLNISLDTLNPTLFTQLTRNGKLDRVIDGIDAAIAAGFERIKINAVIL
FT                   KQQNDNEVIDLVDFCRGRNLDIAFIEEMPLGEMDERKRARHCSSDEVKAIINSHYPLQL
FT                   SNKRTGGPARYYTMADSPIHIGFISPHSHNFCHECNRVRVTVEGQLLLCLGNEHAVDLK
FT                   SIVREFPADIERLKVAILAGINLKPKQHDFGNNEVQILRFMNATGG"
FT   gene            complement(86700..88511)
FT                   /locus_tag="Sputw3181_0070"
FT   CDS_pept        complement(86700..88511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0070"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain;
FT                   molybdopterin-guanine dinucleotide biosynthesis protein B;
FT                   PFAM: molybdopterin binding domain; molybdopterin-guanine
FT                   dinucleotide biosynthesis MobB region; MoeA domain protein,
FT                   domain I and II; MoeA domain protein, domain IV; KEGG:
FT                   she:Shewmr4_3878 molybdopterin-guanine dinucleotide
FT                   biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22923"
FT                   /protein_id="ABM22923.1"
FT                   /translation="MSNPFVNPLAIPVLGFCAYSGTGKTTLLKQLIPELNQRGLRLAVI
FT                   KHAHHNFDVDIPGKDSYEMRKAGARQMLVASHVRWALMTEDARDGDPELVHLLKQIEAD
FT                   KVDIVLVEGFKKLALPKIELHRAAHGKPFIYTQDENILAIACCDDTQLPNDALPSELRR
FT                   LDLNNISQIADFVMEYAQNWEAPLQYPISAVDACAIGDNKNLSVSQGLAQILSHVSPVA
FT                   EIEDIELDALDNRVLASDSISPVDVPQQTNSAMDGYAFVYQDPMPTTLKLVGEVLAGHQ
FT                   YSATLKVGETVRIMTGATVPAGADTVQPRELAKEVDGIVSFEGRILSGQHVRLAGEDIA
FT                   QGQVALAKATRLSAAEQGLLASLGLNHVSVYRRPTVAVFSTGDEVSQPGEVLKANCIYD
FT                   SNRFTIKAMAKRLGCDVIDLGIIEDSEAALEATLAKAADLADVVISSGGVSVGDADYIK
FT                   TVLARLGKIDFWRISMRPGRPLAFGKIGDSLFFGLPGNPVAVMVSFLQFVQPALRKLAG
FT                   EVNWQAQLFPAISDETLRSRQGRTEFIRGIYQLGKDGRLHVSSTGNQGSGMLSSMVKGN
FT                   CLIIIGDDAEAVNAGETVFIQPFADLL"
FT   gene            complement(88548..89138)
FT                   /locus_tag="Sputw3181_0071"
FT   CDS_pept        complement(88548..89138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0071"
FT                   /product="molybdenum cofactor guanylyltransferase"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A; KEGG: son:SO4722
FT                   molybdopterin-guanine dinucleotide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22924"
FT                   /db_xref="GOA:A1RE29"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RE29"
FT                   /protein_id="ABM22924.1"
FT                   /translation="MSSQIDAVILAGGMARRMGGDDKGLVELNGEAMIKHTIDRIKPQV
FT                   KEILINANRNQTRYAEFGFKVISDEHSGFLGPLAGMITAMGQTDADYLLVVPCDCPLLP
FT                   LDLVPRMLAAIEAEKAEIAVASDGEYEQPVVLLLKPSLRDSMKAFLEAGERKVDFWYIK
FT                   HHFVVASFADQPNAFVNVNTPEQKQRLAIKITQ"
FT   gene            complement(89122..89832)
FT                   /locus_tag="Sputw3181_0072"
FT   CDS_pept        complement(89122..89832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0072"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: shm:Shewmr7_3969 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22925"
FT                   /protein_id="ABM22925.1"
FT                   /translation="MTKVKLIARDVEMSFGARLLFKADVLSFCQGDVIYLQGDNGTGKS
FT                   TLMKILAGLMPPTKGHIEAVGFAQNAWWRRNPLLGKAVYLHQHPYLFDGTVEYNLTYGL
FT                   NFSSETKAKAKQRITQAIEMAQLGSLLQARASNLSGGERQRLAIARAWILQPKLLMLDE
FT                   PTSNMDKDSQELVLKMIQQLKHEGTGMLLSSHQNCALTAICEQQWHIEGERVMTSYQQP
FT                   ESLPAQEPLYVIAN"
FT   gene            complement(89836..90543)
FT                   /locus_tag="Sputw3181_0073"
FT   CDS_pept        complement(89836..90543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0073"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: shm:Shewmr7_3968
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22926"
FT                   /protein_id="ABM22926.1"
FT                   /translation="MNDGWLALLQQALNLLFSLDPEVWSIIYVSFSVSFAALLITLIPS
FT                   MVLGFVLAFAPFRGKWLITNLVQTLQSIPTVVIGLLVYLLLTRNGPLGDLKWLFTQEGM
FT                   ILGQMLICAPVLIAMSQAAFTSVDRRAWETSQTLGASWVRAVWTVCRELRMPLLLAIVA
FT                   AFSRILTEVGCSMMVGGNILNLTRNIPTAIALETSKGDFAQAIALGLVLLILSLILNFA
FT                   LGSLRGKAMPRSH"
FT   gene            complement(90540..91364)
FT                   /locus_tag="Sputw3181_0074"
FT   CDS_pept        complement(90540..91364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0074"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: she:Shewmr4_3874 extracellular solute-binding
FT                   protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22927"
FT                   /protein_id="ABM22927.1"
FT                   /translation="MLNMKSHMKSLLGLVVTASLLTVLPAQSTEIIKLATTTSTENSGL
FT                   LQDLLPKFESESGYKVQVIATGTGKALKLGEQGDVDLVMTHAPSAEAKFVADGFGVEPR
FT                   GIMENDFVVLGPKNDPAKLRESKTAEEAFAKIAKSGLPFISRGDNSGTHIKELEVWKAA
FT                   GVTPDFKGYTSVGQGMGKTLLMANELQGYTLSDRGTFVAYKTKLDLSVDFDGGKTLANP
FT                   YQVILINPAKYPDLNHKGAKAFSDWLSSKEGQTMINNFKVEGEQLFKATYSE"
FT   sig_peptide     complement(91278..91364)
FT                   /locus_tag="Sputw3181_0074"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            91602..93032
FT                   /locus_tag="Sputw3181_0075"
FT   CDS_pept        91602..93032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0075"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor,
FT                   interaction domain-containing protein; helix-turn-helix,
FT                   Fis-type; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase; KEGG:
FT                   shm:Shewmr7_3966 two component, sigma54 specific,
FT                   transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22928"
FT                   /protein_id="ABM22928.1"
FT                   /translation="MLELVANESKCPEADNMSQIDNNLKPLPSAVSVLIVDDEPGMRSF
FT                   LNKALSKKFALVETAGSIEDAEQLRSRCHFDLLIVDIRLPGRSGIEWHEALDEQGRRSD
FT                   IIFMTGYADMEVAITALRAGASDFIMKPFHLDQMMAAVDRCIERRLLKRENLMLRREVS
FT                   IGYSSTIIGSSEAMESVKHVIERVAPTNAVVLIQGESGTGKELVARQLHLLSGRQGPFV
FT                   PVNCGSIAPELLESELFGHVAGAFTGAKGNREGLFSFASGGTIFLDEIGEMPLKMQTAL
FT                   LRVLEQKAIRPVGSEKEVNIDVRVIAATNRTLLEEVDAGNFRRDLYYRLNVLDILIPPL
FT                   RDRPEDIVELTHHFTRQLAAELGVREVVWSHEDMVKLQQHEWPGNIRELRNMIERCILL
FT                   GKPPAEYWKQQVKSESSASQGYPLDWPLKDVEKHHVTSVVDLHSGNKSAAARDLGVSRK
FT                   TLDRKYKEWFGLSDEQES"
FT   gene            93034..95157
FT                   /locus_tag="Sputw3181_0076"
FT   CDS_pept        93034..95157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0076"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: shm:Shewmr7_3965 periplasmic sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22929"
FT                   /protein_id="ABM22929.1"
FT                   /translation="MSFFTHFFGVSWQQMQAKVRYRILILTLLPILLTLVSLVFITIYW
FT                   NISYTGKQLFMKVKADLAVAENTLQQVQVRQEKQLEKVMTSWTFQNDFRPILNGEMNHR
FT                   ANIDAFLNEQKQLLNLDYLRLVSVSEAATDPDLRLILPKMGGLLPYSGLMVLSPERLAR
FT                   IDPELAVTASIPIVATLRAQNPDKGVEGRGLLSRSLLPVPDLAGKVAWYLDGGILFNRD
FT                   TRIVDHIRDLVYDKGTLPERSIGTVTIFLDNIRISTNVPLHFFPQGNETQGRALGSLVS
FT                   EEVREKVLNRGELWVDRAFVFNDWFISAYAPLEDIRGQRVGMIYTGFSESPFIHNYLLN
FT                   IIELGTILMLVLLVSGLLVYRGAYSLLLPIERIHHVVQAVQSGRNIRIGALGLDRENEL
FT                   SNLAEQFDRMLDLLQRRNAQIQSAAEQLEMKVEERTRSLQDKTLELERNVALLNETRQQ
FT                   LVTNEKLTALGELTAGIAHEINNPTAVILGNMELMRYELGDNADLVKEEIDLVIQQVMR
FT                   ISTIIRSLLQYSRPGEFNAPLEMQSITPIIEETMVLVRHSIKKQEVILITELSATCLVQ
FT                   VNRPQLLQVLINLVVNAAHAMDGKGRIWVRTYDWLQQDVPIGVKIEVEDEGSGIAPELL
FT                   GRIFDPFYTTRKDGTGLGLSLSYGIIKRIGGTIEVSSTLGKGTVFTIGLYHEAKEEQEN
FT                   NPYDGLHFSGSEI"
FT   gene            complement(95384..95842)
FT                   /locus_tag="Sputw3181_0077"
FT   CDS_pept        complement(95384..95842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0077"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="KEGG: she:Shewmr4_3871 acetyltransferase, GNAT
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22930"
FT                   /protein_id="ABM22930.1"
FT                   /translation="MYSIEIKAETKLTSELAIQLIELSQQIPELNRPLAHEVLAERLDD
FT                   KTSLILLAFVEGELAGFKLGYEQEETIFYSWLGGVALDFRRLGLAQSLLEYQETWARRQ
FT                   GYNHIQVKTMNRFPGMLNLLINNRYMITELKADPKSLVDHKLHLSKTI"
FT   gene            complement(95942..96601)
FT                   /locus_tag="Sputw3181_0078"
FT   CDS_pept        complement(95942..96601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0078"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical integral membrane
FT                   protein; PFAM: protein of unknown function DUF165; KEGG:
FT                   son:SO4715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22931"
FT                   /protein_id="ABM22931.1"
FT                   /translation="MLMLTTAQLRRALLLLVGFHILIICVSNYLVQLPFQLFGYHTTWG
FT                   AFSFPFVYLATDLTVRIFGQQAARNIILKAMVPALMISYVMGVLFHQGSFQGADSLAQW
FT                   NTFVFRIAFASFAAYLIGQLMDITVFARIRKSRSWWVAPAASTLVGNFVDTLVFFSVAF
FT                   YASSDSFMASHWPEIATVDYSFKLLVSLGLFLPAYGVLLKVLQDRILQTSPQKSLS"
FT   gene            96843..97577
FT                   /locus_tag="Sputw3181_0079"
FT   CDS_pept        96843..97577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22932"
FT                   /protein_id="ABM22932.1"
FT                   /translation="MKRFLAIFYLCLAALSSAAAANPVVVNVVTSTWEGYANPDGTGYY
FT                   FDILQRVFPASQWQLNVQFMPFARTLYLIEHQRADMALSVYPGDIKHSLLSDNPVEIDS
FT                   IDAAVTPEIAASWVGIESLSHKKVQAMLAYRYNMLTSVPMYYEESSNMLTMLNSLNAGR
FT                   IDAVLDYQKDILALVPRLKSPKNFNIIQGVIKAEAYFAFADTDKGMMLKQHFDREHKRL
FT                   IDSGEQERLHLETIEKLKANNN"
FT   sig_peptide     96843..96908
FT                   /locus_tag="Sputw3181_0079"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.633 at
FT                   residue 22"
FT   gene            complement(97611..98969)
FT                   /locus_tag="Sputw3181_0080"
FT   CDS_pept        complement(97611..98969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0080"
FT                   /product="isochorismate synthase"
FT                   /note="TIGRFAM: isochorismate synthases; PFAM: Anthranilate
FT                   synthase component I and chorismate binding protein; KEGG:
FT                   she:Shewmr4_3868 isochorismate synthases"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22933"
FT                   /protein_id="ABM22933.1"
FT                   /translation="MPVHALSKDLKSLIDKLIQLKQVSPTEPIVQLSITTVSMPLISWL
FT                   ASQTQYPRIYWHGRDRIEEVAAIGACKDFRFETGVDDQQLAMVYQQQRALSTNQDIRYY
FT                   GGVAFDRTIESWPEFGNSRFVLPRIEFRRSGTHFSLRVNLNFADNAPHTEIDNAIAAIE
FT                   AVMPAKPLAPPTKLALLGRSDRPDFQRWKTLVEQVVDPKFNADTPKVVLSRLTQLEVNE
FT                   PVDPWMVLACWQGRNPNSFQFGFQFSPERTFISCSPERLFRRRQQELFTEALAGTTVRG
FT                   LNQEEDIALANALLEDNKNSVENQLVRSHIVNMLTPLSHYVGADELATIFKLNHIQHLH
FT                   RAIRAELKAGVNDFQLLQALHPTPAVGGLPRHSAMNFIRQREGYMRGWYAGACGYFNKY
FT                   ESEFSVAIRCTLIEPGRINLFAGAGIIAGSDPEAEWQELENKLATIMSILIEL"
FT   gene            99594..100940
FT                   /locus_tag="Sputw3181_0081"
FT   CDS_pept        99594..100940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0081"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: she:Shewmr4_3866 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22934"
FT                   /protein_id="ABM22934.1"
FT                   /translation="MKLLETQDVSFNYGCQLTTIFQEVNLSIRTGQCHCVSGPTGSGKS
FT                   SLLNLLAGVLTRPHEGDIWRHPELVTGLVMQDPQLQLLRQTVGAEVAFALENFGIPAES
FT                   MLPKVQLALRRVGLFLSLDTQVSTLSLGQKYRLMIASQLVCEPHLLLLDEPWAQLDNHG
FT                   VSELLGVMRNLLQEGMALVLVEHNAHAFADIIQHYWQLERGKLSEGIYPATDSAQVEVF
FT                   KWQNYCKREHLGKVLVKADAFDFGYDNNPVLFSCPQGFQLQSGEIVTLVGDNASGKTSL
FT                   LKILAGVLNIRQRLPIKVLGRRPKLGVYGAELGLLMQRPSRQLFETSVLAEMQFRLKRF
FT                   KLPKERAIQILDELALSSLAELSPHKLSYGQQHLIALASIVCLRPRVLLLDDPLAGMDK
FT                   DYYGKVWHLLTGLSSQGSAILLSSHRNIKHDAVSRQWSLRNRQLVLESM"
FT   gene            101205..102395
FT                   /locus_tag="Sputw3181_0082"
FT   CDS_pept        101205..102395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0082"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase, HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase, HD region;
FT                   KEGG: son:SO4711 HD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22935"
FT                   /protein_id="ABM22935.1"
FT                   /translation="MSESVESVDLIKLPVSRLTLGMFVSAIDKHDQGQLAIANAGQIKH
FT                   RDAIARLTQSGIKYVWVDTERSADHCGFKKKASQDNQLESKKSSLTREKQQAQAKVILT
FT                   EAKDLIRKVLSETFEGKAIEVAPFGALADSMIESALLDADALKCMSALRSKDAYLLEHS
FT                   VNVAFLLVTFGKYLQLDRSMLREMAIGGILHDIGKIKVDNKVLHKPGKLTPEEFEHMKL
FT                   HQVFALDIMNEAKGLSQMSKDICLMHHEKLDGRGYPRGLKGDEIPLHGRMSCIVDIFDA
FT                   LTATRCYKEAMSPAAAFKILLSLTPFHLDQELVYEFIRCIGVYPVGSLVELSDGRVGIV
FT                   WTSKDRDALHPIVKCFYSLKSKRYTDIVMVDLLKSELNIERGVSPSSLDIDPTPFY"
FT   gene            102500..103123
FT                   /locus_tag="Sputw3181_0083"
FT   CDS_pept        102500..103123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0083"
FT                   /product="Paraquat-inducible protein A"
FT                   /note="PFAM: Paraquat-inducible protein A; KEGG:
FT                   shm:Shewmr7_3953 paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22936"
FT                   /protein_id="ABM22936.1"
FT                   /translation="MKPLLSIFIILLSLALLVPGVTQPILSISGSIDKAKLAEQGIEQV
FT                   TQRFDEDAGRDHARGMLNMVSSLLGLNSLKGEVEVLQKTRSIWGTVTELYTTGNGLVAA
FT                   LVMLFSVVIPALKLSLMLAQQCVSSIGLKLRVNALVNALAKWSMADVFVVALIITFMAG
FT                   NASGGMGEMLKTQAQFENGFYFFTAYCILSILSGYLVRRPTPIL"
FT   sig_peptide     102500..102568
FT                   /locus_tag="Sputw3181_0083"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.903) with cleavage site probability 0.592 at
FT                   residue 23"
FT   gene            103372..103518
FT                   /locus_tag="Sputw3181_0084"
FT   CDS_pept        103372..103518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3947 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22937"
FT                   /protein_id="ABM22937.1"
FT                   /translation="MKNWLIIVFCLIALVASTQTTGLVRSLIEFSAFVGVLYWAWRIKP
FT                   TAE"
FT   sig_peptide     103372..103428
FT                   /locus_tag="Sputw3181_0084"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.609 at
FT                   residue 19"
FT   gene            complement(103539..104489)
FT                   /locus_tag="Sputw3181_0085"
FT   CDS_pept        complement(103539..104489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0085"
FT                   /product="conserved hypothetical protein 698"
FT                   /note="PFAM: conserved hypothetical protein 698; KEGG:
FT                   shm:Shewmr7_3946 conserved hypothetical protein 698"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22938"
FT                   /protein_id="ABM22938.1"
FT                   /translation="MNLFSTSHQFNKRHSIIFVCVGLFCLTPFISSPMALVLGFTLASL
FT                   GWVPVQWNIAALTKKLLSYSIIGLGFGINLNAAIEASTHNFGLIVGSIFFTLSLGFLLT
FT                   RALKFDQITGHLIASGTAICGGSAIAAVAPAINARNDQTATALACVFVLNSIALFLFPA
FT                   LGHLLNMSQYDFGVWSAIAIHDTSSVVGAASAYGDEALKTATTIKLARALWIIPIALAS
FT                   AMLFGGDKRKLSLPYFIGFYCLAIAVAHWLPQFHAIYDTLFMVSKRTLVLCLFLIGAGI
FT                   TVQKMRASGPKPLLLGVMLWAAIGITSLVYILYFQ"
FT   sig_peptide     complement(104382..104489)
FT                   /locus_tag="Sputw3181_0085"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.496 at
FT                   residue 36"
FT   gene            complement(104777..105340)
FT                   /locus_tag="Sputw3181_0086"
FT   CDS_pept        complement(104777..105340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0086"
FT                   /product="malate synthase"
FT                   /note="KEGG: son:SO4706 malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22939"
FT                   /protein_id="ABM22939.1"
FT                   /translation="MNMSIIKSNQIQSNLNSLIAEEVFAVAQVNVAEHEKIANAKQFLD
FT                   RVFPLNSGSHQDVSSYVVYYQHLLAFFADGSHSGLRQPKQFVAFGGTKDSPSAVVLQDQ
FT                   GCHVELSFDRNGMIGTRDVANLEDIQIETPLNMVAGTPESRSAASRHWLSLLHAGMSSA
FT                   NDTLEKQFTAKDGSDYSLKSIVNL"
FT   gene            105594..107123
FT                   /locus_tag="Sputw3181_0087"
FT   CDS_pept        105594..107123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0087"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   shm:Shewmr7_3944 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22940"
FT                   /protein_id="ABM22940.1"
FT                   /translation="MRNDQSLMRKSHFLGTKIRNLRKRNNLTMEDLSARCIRVDAGSAP
FT                   SVSYLSMIERGKRVPSAAMLAVIAAVFQKEVDWFLDDAPEESAITPDKGRRGGISGMAL
FT                   EPSFLFSNDILQIAIPEMLSQTGISGRQFAHLLIRAHQEHHQNHFPDLERAAEEVGLKR
FT                   MPLSLEDMLDIAKGMGLKIKWIDSAPQEVIDEVGGSSRQLVTSYIEPPSTIYVNKVLKN
FT                   RPSRLKYDLAAHIGHCVLHNKDGLKSVMISGRKLEVDEEVGMQSNTLNAQDILHAWRDF
FT                   ESSFFAGALLCPKVPYRQLLDRHGYEIEVHKQLQVSASVAMRRMTVVSPYPHWHYFDAY
FT                   APGKLKAVYRGNGIPLPWGNMRLVEDPCQHWAVFRMISEPTVGTSAQISILNVGNEPRI
FT                   YCCESIKVEDSAGNPHVLCAGIDLNPAIEAQGKDALSIAHDLKDACVASGGSVKIPKHI
FT                   KSDLVSVAKILNINWIERGIINDARLICSRGAVCPRQPSCYQTGKSQCGED"
FT   gene            107492..108394
FT                   /locus_tag="Sputw3181_0088"
FT   CDS_pept        107492..108394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0088"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   ppu:PP_0658 homocysteine S-methyltransferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22941"
FT                   /protein_id="ABM22941.1"
FT                   /translation="MKKQALWVLDGGMGRELARRGAPFRQPEWSALALMEAPQTVREVH
FT                   QAYVASGARIITTNSYALVPFHIGAERFAAEGEALAALAGQLAREVANEQPGSVQVAGS
FT                   LPPLFGSYRADLFEADRVGELATPLIRALTPHVDIWLAETMSLIAEPLALKALLPQDGK
FT                   PFWVSFTLEDEAPGCEPALRSGERVADAVTALASAGVDAILFNCCQPEVIEAALTVAGD
FT                   SLQVLGRGDIRLGAYANAFPPQPKEATANDGLDEIRADLGPLDYLGWAERWRAVGASLI
FT                   GGCCGIGPEHIQALASRLR"
FT   gene            108404..109801
FT                   /locus_tag="Sputw3181_0089"
FT   CDS_pept        108404..109801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0089"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   pmu:PM0162 arginine/ornithine antiporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22942"
FT                   /protein_id="ABM22942.1"
FT                   /translation="MKESKIGLWSLTALVFSSMVGAGIFSLPQNMAEVAGARAVLIGWG
FT                   VTGVGILALAASFLYLSRLRPDLDGGIYSYARAGFGDLVGFFSAWGYWLCATIGVVGYL
FT                   VIAFAALGSFVDTPEQIWFGDGNTLAAFIGESCILWAVHLLVARGVQQAALFNLVATLA
FT                   KSLPLLLFILFACYWFDPVTFAADQGGSTLAVPVSEQVRNTMLITLWVFTGIEGAAVLS
FT                   ARARNKRDVGTATVLGVVLALLLYVLISVLALGILSRPELAALPNPSMAGLMAQMTGSW
FT                   GKVLISVGLIVSVLASYVSWTLFSAEVPYSAARHGAFPAIFRRQNRNGTPIASLWLTSL
FT                   TVQGCLLLVWLLGKGYTNLLLISTSMILVPYLLIGLFLLKLSLSGEGNGLMRTVALVSS
FT                   GYGLWLLYAAGVEYLLLSLLLYGPGLLLFLYSRRQLGDHQRLSGRERLLAGITLVSLIP
FT                   ALWSFGF"
FT   sig_peptide     108404..108472
FT                   /locus_tag="Sputw3181_0089"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.940 at
FT                   residue 23"
FT   gene            110012..112213
FT                   /locus_tag="Sputw3181_0090"
FT   CDS_pept        110012..112213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0090"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor, plug;
FT                   KEGG: she:Shewmr4_0950 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22943"
FT                   /protein_id="ABM22943.1"
FT                   /translation="MLPYAYPKDTTEMTMRFNLLPLAAAITLALNPLSVLAGEQSSTET
FT                   KDQNIEKITVMGKYTVSRTIDTATGLGLSLQETPQSVSIMTAERIQDQALNTVVDVVNN
FT                   TVGLSSSKTDNVRNGFMARGFAVQNYQIDGVPLSWSLGGDAGETVSDISLYERVEVVRG
FT                   ATGLLTGAGDPSASINLVRKHADSAELKGYVDVATGSWDKKQITADVSNGLNDSGSVRG
FT                   RMVAKYVNSDSYQDLYQDRKTILYGVVDSDITENTMLRVGGSYNNNNPKGAMWGALPAM
FT                   FSDGSATDWDVSATTAADWSRWETTNINYFANLNHYFSNGWQLVANYNRMEYETTTKMI
FT                   YMSGLLDKETGAGLSGQRYHSHGESNSDNFDFQLKGDYQLFNREHQFVAGALYSKQKSY
FT                   ADTYEPIREDMTGWDSKVVENFYDWRSNTFDEPQWSTDANRQLNMDTEQKGFYAATRLT
FT                   ITDDFKIIAGGRISSWNREGVSYGTSTNFGDDGVFVPYVGALYDINEEHRVYASYTEIF
FT                   NPQNVTNAYGEYIDPLKGKAYEVGLKSAYLDDRLHTTVALFKIDQDNLATPDGTVTIDG
FT                   KPVTNYKAAQGTESTGFELEVVGEFIDGWNISAGYSQFTAEDAEGSKVETTSPRKQFKL
FT                   FTTYQFVDHLPELTVGGGVNWQSDSYSQSGGVVIEQEAYSLVNLMARYNLAENMDLQLN
FT                   LENLLDEKYYAYMSASGLSYSIYHYGTPRNVTVSFNYRF"
FT   sig_peptide     110012..110125
FT                   /locus_tag="Sputw3181_0090"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.993 at
FT                   residue 38"
FT   gene            complement(112352..113299)
FT                   /locus_tag="Sputw3181_0091"
FT   CDS_pept        complement(112352..113299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0091"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: shm:Shewmr7_3918 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22944"
FT                   /db_xref="GOA:A1RE49"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RE49"
FT                   /protein_id="ABM22944.1"
FT                   /translation="MYTQDRFMSPQYKARFKGYVQVTKPGIIFGNLISVAGGFLLAAKG
FT                   DVNLALMLASLVGLSLVVASGCAVNNCIDRDIDAKMQRTCKRVTVTGEIAVGNVLAFGL
FT                   ALGVLGFSILALFTNALALLFAVIGYIVYVGVYSLYMKRNSVYGTLVGSFSGAVPPVVG
FT                   YCSVTGQMDMGAAILLLMFSLWQMPHSYAIAIFRFNDYAAANIPVLPVAEGMTKAKLHI
FT                   VLYIAVFALVSALLPLAGYTGIAFMAVTCATSLWWLAMALKGYRHGVDIQRWARQVFGF
FT                   SIITIMALSITMALDSQVIKEQVIGQTNLFTLVK"
FT   gene            complement(113313..113654)
FT                   /locus_tag="Sputw3181_0092"
FT   CDS_pept        complement(113313..113654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0092"
FT                   /product="cytochrome C oxidase subunit IV"
FT                   /note="PFAM: cytochrome C oxidase subunit IV; KEGG:
FT                   shm:Shewmr7_3917 cytochrome c oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22945"
FT                   /protein_id="ABM22945.1"
FT                   /translation="MSAHSHTDKPSHGTDDLAASIKSYLMGFVLSVVLTAIPFWAVMTH
FT                   HFEKATTLSLVLVMAIVQIVVHLKYFLHLDFSKEGKVNTFSFLFTALIIVMVVGLSVWI
FT                   ILEANALMM"
FT   gene            complement(113654..114274)
FT                   /locus_tag="Sputw3181_0093"
FT   CDS_pept        complement(113654..114274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0093"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /note="PFAM: cytochrome c oxidase, subunit III; KEGG:
FT                   she:Shewmr4_3825 cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22946"
FT                   /protein_id="ABM22946.1"
FT                   /translation="MSIAIPADLEVAHAEDHHEHHDTSGNTLFGFWIYLMTDCILFASV
FT                   FATYAVLYMNTDGGVSGKDIFELDFVLIETAALLVSSITYGMALIFAKRHNKAATLAWL
FT                   LVTFALGCVFIGMEVYEFHHLIEHGNGPQRSAFLSSFFTLVGMHGLHVTAGLIWMAIMM
FT                   IEVAKTGLGHRSITRLSCLSLFWHFLDIVWICVFTVVYLLGAL"
FT   gene            complement(114276..116255)
FT                   /locus_tag="Sputw3181_0094"
FT   CDS_pept        complement(114276..116255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0094"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="PFAM: cytochrome c oxidase, subunit I; KEGG:
FT                   shm:Shewmr7_3915 cytochrome-c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22947"
FT                   /protein_id="ABM22947.1"
FT                   /translation="MSFLGKLSLDAIPYHEPIIMVTLAVVAVVGLYIAALITKHKKWSV
FT                   LWHDWLTSVDHKRLGIMYIVLALVMLIRGFSDAIMMRTQQALATNGAAGYLPPEHYDQI
FT                   FTAHGVIMIIFMAMPFMIGLMNLVVPLQIGARDVAFPFLNNLSFWLTASGAVLINISLG
FT                   LGEFAKTGWVAYPPLSELAYSPGVGVDYYIWALQISGIGTTLTGVNFIATVLKMRAPGM
FT                   KLMQMPIFTWTCTWANILIVASFPILTAVLAMLTLDRYMDFHFFTNDGGGNSMMYINLF
FT                   WAWGHPEVYILILPAFGIFSEVISTFTAKRLFGYTSMVWASGAISILGFIVWLHHFFTM
FT                   GSSANVNAFFGVMTMVIAVPTGVKLFNWLFTIYRGRLRLTVPVLWTLGFMVTFTIGGMT
FT                   GVLLALPGADYVLHNSLFLIAHFHNTIIGGAVFGYLAGFAYWFPKATGFHLNERLGKAS
FT                   FWCWQIGFYVAFMPLYVLGFMGMTRRISHTDNPAWNLWIYLAAVGACIIMVGIILQFIQ
FT                   LYVSIRDRDQNRDTTGDPWNGHTLEWSTASPPQFYNFAKLPQVADIDAFTDAKEKGLAY
FT                   EGLKHYQPIHMPKNTSSGILMALGITAAGFAAIWHILWLAIVGLVGAFIVFLFRAYNND
FT                   VDYYVQPDEVARIENAHLNNVVRG"
FT   gene            complement(116258..117334)
FT                   /locus_tag="Sputw3181_0095"
FT   CDS_pept        complement(116258..117334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0095"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /note="TIGRFAM: ubiquinol oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase, subunit II; COX aromatic rich domain
FT                   protein; KEGG: she:Shewmr4_3823 ubiquinol oxidase, subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22948"
FT                   /protein_id="ABM22948.1"
FT                   /translation="MLIRKLSKAAIAAVALMLAGCDGGVLDPKGQIGIDEKHLIIVATL
FT                   LMLIVVIPVIAMTLYFAWKYRDGRDQEIYAPKWAHSTAIETVVWIVPIVIVIVLGVLTW
FT                   GSTHDLDPYKPLEHEAKPVTVEVVSLDWKWLFIYPEQGVASVNELAFPANVPVNFKITS
FT                   DTAMNSFFIPQLGSQIYSMAGMTTKLHLIANEPGTFDGISANYSGAGFAGMKFKAIATQ
FT                   TPADFEAWVAKLKQQGKTLDSAAYATLAKPSEYHPVEYFGSVSKGMFDQIVMQYMHMDS
FT                   HEGMKGHEGMDMHAGMEHMGTEHTSDMAHMAGEHAMENTQNMADMDSSTPSAPSSTQDS
FT                   STEPLSLEHSSTHKVEAE"
FT   sig_peptide     complement(117263..117334)
FT                   /locus_tag="Sputw3181_0095"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.961) with cleavage site probability 0.519 at
FT                   residue 24"
FT   gene            complement(117524..117913)
FT                   /locus_tag="Sputw3181_0096"
FT   CDS_pept        complement(117524..117913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3822 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22949"
FT                   /protein_id="ABM22949.1"
FT                   /translation="MKLALSQFIAERLNLMIRFTNFSMTNLILFFGVLFVLPIVDLLSI
FT                   LIGGYVDIGELLVFSDSFLVEFIGASLLSLLLLNPLVILQLWHLIDCCFKFFNNLDLTN
FT                   ASLFLAPPRLKSLEYTAHGCRAPPF"
FT   gene            118314..121964
FT                   /locus_tag="Sputw3181_0097"
FT   CDS_pept        118314..121964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0097"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and Chase sensor(s)"
FT                   /note="KEGG: shm:Shewmr7_3912 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC and CHASE sensor(s);
FT                   TIGRFAM: PAS sensor protein; diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; EAL domain protein; CHASE
FT                   domain protein; MASE1 domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22950"
FT                   /protein_id="ABM22950.1"
FT                   /translation="MHISIKGLNIKSFTHSLRVNFLITLAYVVVGKIGLMIALPPGYSA
FT                   AIWPAAGIAIAACILWKEYTPWIGVFIGSFLINANMGGFVHWSWLPVVIAMGSSIQAIL
FT                   AAKMMSRIDHLVTLDSPHTVIKSCLGLALTCIVATVCGNLALVISGTIPQSDFLESLVN
FT                   WWMGDLLGAIIFIPLTMLVFDKRDIWRSRRIQTGIPMFVGFLCCVGIYSYSDMNQRQQL
FT                   QDKFEIQSNAIISRIEGFQDANLQRIIALASLFDNSEQVSVDEFIQFGKRTLLPTDGVH
FT                   AWVWAPLVAATEQESFEIAASAAISGAYNVKRPQNWQVNTDGWLVPVMYIQPLTNHEAV
FT                   LGMDLNSEPIRAAAIAKVRTTQAPVMTAKVQLAPDFTGPSGTLLFAPVFDRLGEIAGFC
FT                   TAVIDLQQIINEVEQVQGLQWKLIDMSAGGSLLYSNTDKDFPIFSDYIFSDKNGHFFQA
FT                   NLMFADRHWHIVLYQSYTMLMGDTFSLSLLMLLLAFTTCAVIGGLTLVYSGEHHRIAEK
FT                   VQEKTMALSKEIARSQAFQATLVESEQRYRNLFDKAPVGHVLKQVDNGRFVAINQAFTD
FT                   ITGYSLDELNQLDPWELTPKRYQLSEAEQLERLKQTRRYGPYQKHYLHKNGQSVAVRLN
FT                   GALVTGANGEQLVLFIVEDITEQERTVARVNLLAQVFQQSGEGITIIDANDIIVDVNTA
FT                   FSQITGYSREDIIGKNCRFLEAKRTDKSIDPQVRAALEQTGFWQGEVWDRHKDGYDFPK
FT                   WLMMSVVRDESGAVSHYIGSFTDISERKMSEERIHFLAHHDSLTLLPNRLSLQSSLEIV
FT                   FGEALASQSQIAVMFIDMDHFKNINDTLGHHVGDQLLLEVARRLKNIVDNNDIVARLGG
FT                   DEFVVVLSDTNHDEVASLAEALRSGLSQTYIIDNNSLHSSPSIGISLFPTDGNTVEALM
FT                   KNADMAMYRAKAAGRNNYQFFTAAMNTLITERQHIETGLRQVLANEELQLHYQPQIDIR
FT                   TGQVVSVEALVRWQHPEFGLISPDRFISIAEEIDMIIPIGQWVLETAMAQLAAWRAAGA
FT                   TRLRMAVNLSAHQLRKDTIVADITNVLLKHQLGKGALELEITESVAMQYPEQNARLLAE
FT                   LRQHGIELAIDDFGTGYSSLSYLKLLPLDRLKLDRSFVKDIETDPNDAAISAATISMSH
FT                   ELGLTVVAEGVENEAQLVLLSSMGCDLVQGYYFSKPLPAEECFRFIQRNL"
FT   gene            122043..122519
FT                   /locus_tag="Sputw3181_0098"
FT   CDS_pept        122043..122519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22951"
FT                   /protein_id="ABM22951.1"
FT                   /translation="MQVIFTKGTQRYGQLRCVRMDGSATETKMPEQGIAPHDMIHYVVE
FT                   KRLQIQGAFFSQVKAGANISFTLEHNQASRAVTNKAEIWQVESIVETLQSLLWPGDTPT
FT                   YDEFIYLLEQASSSRKLALPQISEVDFDHILNEIMDLTVEWQGLGEGQSLTLKF"
FT   gene            complement(122585..124057)
FT                   /locus_tag="Sputw3181_0099"
FT   CDS_pept        complement(122585..124057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3910 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22952"
FT                   /protein_id="ABM22952.1"
FT                   /translation="MNRLHRWNWLVLSAVLFALPFTPTTQAAGVSVSQGSSASVSQAEL
FT                   EQMLAPIALYPDSLLTHILIASTYPLEVVQAQRWLAQRPKLSLDQIMSQAEDKDWDPSV
FT                   KALLAFPVVLQKMSDDLDWTQRLGEAFLEDEGQVMNGIQSLRQQADKANSLANMDNMAI
FT                   TRANNHIIIEPVRREIVYVPYYDPRVVYGTWRWGVAYPPVYWEFSGYAGYPYRPSHSHF
FT                   YWAPGIHISFNYFFSSFHWHRHRVVVIDHRHSHHYRPRERYSVSHGAQPWKHKPEHRRG
FT                   VVYHNPVVKQRYYADSKYRGRDSHSSGSAQHATSQYSKSNQDLRHNRQDNKDWNNKETH
FT                   NYNSRERDNRAPTYQNTKAELKERRSANAEQMPATKGRSDPVHTQRERSDAQAKQMQAN
FT                   KDIQQKQYQTREPQRQENSRAITPRVESPRQEIKRSEPQRMEQPRQSVPRQREEVKVRQ
FT                   SEPRQNQNMQATRAVDQNKGRSTQSQERRNRE"
FT   sig_peptide     complement(123974..124057)
FT                   /locus_tag="Sputw3181_0099"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.979 at
FT                   residue 28"
FT   gene            complement(124197..125561)
FT                   /locus_tag="Sputw3181_0100"
FT   CDS_pept        complement(124197..125561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0100"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; KEGG: son:SO4648 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22953"
FT                   /protein_id="ABM22953.1"
FT                   /translation="MSNSSLAWQVINSLKARLVASSLLFILVLLPLIGVGLNDAFTEQV
FT                   KSAAKNELSAYVYSILAVTEVENTQISIPELVLENRFNLIQSGLYAIATTQDLNGKQSI
FT                   VWHSQSFMGITPPAYFTIPDMGKSTFEQIKLADLPHWIYSFSVSFASQNQNVPVTIHII
FT                   KDEQEFQQQIDQFNQQLWTWLLILMLVMLVFQLSWLLWTLRPLARFTQELHEVEQGKSM
FT                   QLSSQYPTELQAVARQLNILLNTEQTQRKRYRNALADLAHSLKTPLAVIKSQADLSEAS
FT                   SEQVSVISRIIGHQLKRAQTAAAASWHLGIRVDEVAAKLLRTLAKIYQEPQIHLHSEIA
FT                   EQAVFKGDDADLTEMLGNLLDNACKAAKSTVKLTVTGDAYQLQICIEDDGPGISELLKN
FT                   QIFERGIRADSYRQGNGIGLAIVRDLVDSYNGRISVSHSETLGGAKFSVSFVHSI"
FT   gene            complement(125554..126249)
FT                   /locus_tag="Sputw3181_0101"
FT   CDS_pept        complement(125554..126249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0101"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: son:SO4647 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22954"
FT                   /protein_id="ABM22954.1"
FT                   /translation="MRLLLVEDDLELQTNLKQHLLDAHYSIDVASDGEEGLFQALECNY
FT                   DAAIIDVGLPKLDGISLIRSVRQKERDFPILILTARDSWQDKVEGLDAGADDYLTKPFH
FT                   PQELVARLKALIRRSAGKASPLVYNGPFSLNTSSLEIRKGDELINLSGSEYKLFEFLML
FT                   HPGEVKSKTVLTEHIYDQDFDLDSNVIEVFIRRLRKKLDPDNQYNLIETLRGQGYRLKI
FT                   LAPESSVNE"
FT   gene            complement(126252..126554)
FT                   /locus_tag="Sputw3181_0102"
FT   CDS_pept        complement(126252..126554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0102"
FT                   /product="Propeptide, PepSY amd peptidase M4"
FT                   /note="PFAM: Propeptide, PepSY amd peptidase M4; KEGG:
FT                   shm:Shewmr7_3907 propeptide, PepSY amd peptidase M4"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22955"
FT                   /protein_id="ABM22955.1"
FT                   /translation="MKLGMTLALIVCLCASFGSMAANDKRTDRNQSRNQGVQNEQRRLA
FT                   VNSPDQAVAMAQRQYQGKILSVQSSGSGYRVKILDPNGQVFSVSVDAATGRVSRN"
FT   sig_peptide     complement(126489..126554)
FT                   /locus_tag="Sputw3181_0102"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            126959..127903
FT                   /locus_tag="Sputw3181_0103"
FT   CDS_pept        126959..127903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22956"
FT                   /protein_id="ABM22956.1"
FT                   /translation="MNILNRQIVATGSRTSLFKLTAMTLLFLGSVNVHAQSRDGESLMP
FT                   IAPFSAASIGIAKKADDAEQAAFQEQQALALLQQAAPANNVGDAAAAVVKSLAPSLSSK
FT                   AGTTKKVQLVGAKPMTRDQVIAQYESQSIPRSSAETENPYRSPVYHSFSIFDASSRLFE
FT                   DFDYDGFYQTFSVTFDVDVYGSYLNERADLFAELYLSRNGGPWVRYYTTDVFTIYGDST
FT                   LDDYEVLTTLYTGYATDHYDVLIDVYEVGYSDIVATISADEIDSLYALPLESSDRDRGP
FT                   DIIVVEESGGAVSGYILLFIGLCGALRMSRGRT"
FT   sig_peptide     126959..127066
FT                   /locus_tag="Sputw3181_0103"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 36"
FT   gene            127985..128458
FT                   /locus_tag="Sputw3181_0104"
FT   CDS_pept        127985..128458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0104"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   shm:Shewmr7_3905 redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22957"
FT                   /protein_id="ABM22957.1"
FT                   /translation="MIAQGQALPAGTLSQQTKDGTVNHKVTELFAGKKVVLFAVPGAFT
FT                   PTCSEAHLPGYVVLADQFKAKDVDLIACVAVNDAFVMKAWGEAQNASELMMLADGDASF
FT                   TKALGLEMDTAGFGGIRSQRYAMIIDNGVVTLLNVEAPKSFEVSKAEVVLAAL"
FT   gene            complement(128539..130521)
FT                   /locus_tag="Sputw3181_0105"
FT   CDS_pept        complement(128539..130521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0105"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: shm:Shewmr7_3904
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22958"
FT                   /protein_id="ABM22958.1"
FT                   /translation="MKISTLSLSASALLLLLAGLLAAVVLWSSTQRQQIEQQTHSLQNI
FT                   QQDFLVGVRRDLDGYLVTGNAGQLEQAKTKLITIKDQLAQLNLATVGATDNELQIGLSS
FT                   FIQDLETKYLAAGKLAGDPRKLLAHAESEMMGYNRRLSQYADKGATINALVAEQYLQLS
FT                   RDLPSIVYELSQLTEGYLIGKNQKLKGILDSTIKELDTWRETLNALPLIGIYEIQEADE
FT                   FALGGSEPEQIEIGENDRSELLSLSNRYSKEVANTHQQLQTNQEMQEQLIQAISKVEQQ
FT                   LIALGDAQAAKNQQLKSELQLILYTMVSIMALFAIGYLILQQNRVVKPLKRLNQAFMKL
FT                   SEANSRERLDINRRCETGQIAGHFNQLLQRFELEDETQRQQITKVSQSLRQLVARINQL
FT                   SVHTENTQTIVTETQTQTEHIRSLANEVSHTSALVENSAAETMRQMQSSQTEAEAVLSA
FT                   TEQTQTAVGLCHASLESLNTSVTDVSKIIDVISNIAEQTNLLALNAAIEAARAGEQGRG
FT                   FAVVADEVRNLSQRTQTSLNEIVKILQQLTQSNHALSESVNGIAQATSSQKLRAQSLWQ
FT                   VAQTVQNQASEMANTAKQGSLNAKEQVDYLDEFVRTMDNLRQQAQTSSQQSDVIAQEVQ
FT                   QSVEDIETSLGIANKTKAPPHLRAA"
FT   sig_peptide     complement(130450..130521)
FT                   /locus_tag="Sputw3181_0105"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.472 at
FT                   residue 24"
FT   gene            complement(130650..131966)
FT                   /locus_tag="Sputw3181_0106"
FT   CDS_pept        complement(130650..131966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0106"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: she:Shewmr4_3812 periplasmic sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22959"
FT                   /protein_id="ABM22959.1"
FT                   /translation="MKRKLWQRFLPRSAFSQTVMLIGCLLLINQLVSYVTVAVYVLKPS
FT                   YQQINQLIARQVKLLFVDGIDIGREHLTIVDALNAKVHDDGMKIYNQQQAREAGIEQAT
FT                   YYGFWSSQMSEYLGGEAEVRVTHGSVLQIWIRPPQAPSVWIKVPLIGQNVSDLSPLTLY
FT                   LIVIGALSVAGGWWFARQQNRPLRRLQKAAISVSRGEFPDPLPLKGSSEIVEVTNAFNQ
FT                   MAHSMKQLEQDRALLMAGISHDLRTPLTRIRLASEMMVEEDQYLKDGIVNDIEDMDAII
FT                   SQFIAYIRQDQEANRELAQINKLIQDIVQAEANRAGEIEMVLTDCPETLFQAIAIKRVL
FT                   SNLVENAFRYGSGWIRISSQYDGKRIGFSVEDNGPGIDESQIQKLFQPFTQGDIARGSV
FT                   GSGLGLAIIKRIIDRHQGQITLSNRKEGGLKAQVWLPLE"
FT   sig_peptide     complement(131865..131966)
FT                   /locus_tag="Sputw3181_0106"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.800) with cleavage site probability 0.618 at
FT                   residue 34"
FT   gene            complement(132009..132734)
FT                   /locus_tag="Sputw3181_0107"
FT   CDS_pept        complement(132009..132734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0107"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: son:SO4633 transcriptional
FT                   regulatory protein OmpR"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22960"
FT                   /protein_id="ABM22960.1"
FT                   /translation="MGQETSKILVVDDDMRLRALLERYLMEQGYQVRSAANAEQMDRLL
FT                   ERENFHLLVLDLMLPGEDGLSICRRLRQQGSLIPIVMLTAKGDEVDRIIGLELGADDYL
FT                   PKPFNPRELLARIKAVMRRQTLEVPGAPAQQEAEISFGEFSLDLATREMYHGDEAIALT
FT                   SGEFAVLKVLVTHPREPLSRDKLMNLARGRDYSALERSIDVQVSRLRRLIEKDPANPRY
FT                   IQTVWGLGYVFVPDGAARR"
FT   gene            133111..133614
FT                   /locus_tag="Sputw3181_0108"
FT   CDS_pept        133111..133614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0108"
FT                   /product="transcription elongation factor GreB"
FT                   /note="TIGRFAM: transcription elongation factor GreB; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: she:Shewmr4_3810 transcription elongation factor
FT                   GreB"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22961"
FT                   /protein_id="ABM22961.1"
FT                   /translation="MKAHLITRQGWLALDKELKYLWKEYRPQITLKVQEAAAQGDRSEN
FT                   ADYTYNKRLLRQIDSRVRYLVKRLEELKIVDYSPQQEGKIYFGAWFELENDAGERVRYR
FT                   IVGKDELDTKLGYITIDSPMARALIGKQVDDEVVVQTPSGPKEWYINEIRYTPFENPSA
FT                   SVTD"
FT   gene            133702..136143
FT                   /locus_tag="Sputw3181_0109"
FT   CDS_pept        133702..136143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0109"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase, RNase H domain protein fold; KEGG: son:SO4629
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22962"
FT                   /protein_id="ABM22962.1"
FT                   /translation="MKLIMRLWYRGRNYDSSVKHDILFMQTTSQTIAHNIAQIIAQELN
FT                   VREQQVTATIALLDDGATVPFVARYRKEATGGLDDTQLRTLHSRLAYLRELNDRRQVIL
FT                   SSIQAQGKLTAELQFAIDSADSKTRLEDLYLPFKPKRRTKGQIAIEAGLEPLADALLAD
FT                   RNADTEALAADYINENAGFADTKAVLEGARYILMERYAEDAELLRKVREHLSQNSVLES
FT                   RVIAGKEKEGAKFRDYFEHNELLSKVPSHRALAMLRGRNEGFLSLSMNADPNAQAGQGS
FT                   YCEVIIADHLGLKLGDSSVDQWLKTVVTATWRIKIALQMETEFISQMRERAEAEAIKVF
FT                   ARNLGDLLMAAPAGAKATMGLDPGLRTGVKVAVVDNTGKLLSHATIFPHAPQNLWEKSI
FT                   RTLANLVNMHKVELIAIGNGTASRETDKLAAELIASLTDTHPHLTKVMVSEAGASVYSA
FT                   SELAALEFPELDVSIRGAVSIARRLQDPLAELVKIEPKSIGVGQYQHDVSQSQLSSSLE
FT                   AVVEDCVNGVGVDLNMASVPLLSQVAGLNKTLAKNVVDYRDANGQFKNRKELLKVPRLG
FT                   PKAYEQAAGFLRIREGDNPLDMSAVHPEAYSLVETIAKAKQVELASLIGNSELLRTINA
FT                   QEFITPEFGLPTVTDILAELDKPGRDPRGEFKTAKFKEGIEELKHLKPEMILEGVVTNV
FT                   TNFGAFVDIGVHQDGLVHISSLTDKFISDPHTVVKAGDVVKVKVMEVDVERRRIGLSMR
FT                   LDEAIDQNNAQVKHSSQTKANHKLTSSGKTARPAQKPAPKAPANAAMGNAFADAFAKLK
FT                   K"
FT   gene            136360..138324
FT                   /locus_tag="Sputw3181_0110"
FT   CDS_pept        136360..138324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0110"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: shm:Shewmr7_3884 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22963"
FT                   /protein_id="ABM22963.1"
FT                   /translation="MLSVLSARGRGHAYGPFHAILIFCLLVLFVTTVSRICLGLWQAER
FT                   VVAVEGWSHLLLQGLRVDIATLCWLWGIAALGTALFSGDHFVGRLWQPILRIWLTFGLW
FT                   VIVFLEISTPTFIEEYGIRPNRLYVEYLIYPKEVLSMLWAGRKVELIFSVIVSMATLWG
FT                   GWVLSGKLTSYLRFPGWYWRPVLAVVVVVLAFLGARSTLGHRPLNPAMVAFADDPLVNS
FT                   LVTNSSYSLVFAIKQMGNEEDAAEVYGDLNDAEIIATIRQESGRPASAFTSTDVPSLSF
FT                   NQASYTGKPKNLVILLQESLGARFVGSLGGLPLTPNIDALSQEGWYFDHLYATGTRSVR
FT                   GIEAVTTGFTPTPARAVVKLGKSQTGFFSIAELLKNHGYTTQFIYGGESHFDNMRSFFL
FT                   GNGFSDIIEQKDYKSPAFVGSWGVSDEDLMRKANSEFERLHNEGKPFFSLVFSSTNHDP
FT                   FEFPDDRIELYEQPKQTRNNAAKYADYAIGEFFKLAKNAAYWKDTIFIVVADHDSRVVG
FT                   ADLVPVSRFRIPGLIIGDGVTPKRDHRIVSQIDLPPTLLSLMGISDSYPMLGRDLTKVS
FT                   DDWAGRALMQYDKNFALMEGKDVVILQPEKAAQGFQYNQKTEQLTPYIPAAKMLEKKAL
FT                   SWALWGSLAYQQELYRLPK"
FT   gene            complement(138388..138945)
FT                   /locus_tag="Sputw3181_0111"
FT   CDS_pept        complement(138388..138945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22964"
FT                   /protein_id="ABM22964.1"
FT                   /translation="MLVVSNYPQVPLATSNVATDLARVDNQLKPVVIPPQQATKAHEER
FT                   AFNPQNERTADQAQQQARLLEHNQQQVQDKQQQQQSSQQQNQQQQEKKAPVVMAERVQS
FT                   KLVKIATRGQAALQRKDIRLKVAQGDTTHINTRPKNNNTSTTQPSIQGESMQFYQQVGQ
FT                   RISQFYEQQTRPEPESAMSTWI"
FT   gene            complement(139007..139729)
FT                   /locus_tag="Sputw3181_0112"
FT   CDS_pept        complement(139007..139729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0112"
FT                   /product="bioH protein"
FT                   /note="TIGRFAM: bioH protein; PFAM: alpha/beta hydrolase
FT                   fold; KEGG: shm:Shewmr7_3882 BioH protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22965"
FT                   /protein_id="ABM22965.1"
FT                   /translation="MLHGWGVNSTVFTPLYESLSQYRVHYVDLPGFGLSQSVEGDIGAW
FT                   VDILVQSLPANAIWAGWSLGGLVATQAALSYPSYIKGLITIASSPCFMAREDKAWPGIP
FT                   PHVLSQFSEQLGQNLPRTIERFLAIQAMGSETAKEDIKQLRDLVLSRPLPDTKALSQGL
FT                   SMLTKVDLRPQLSALQQPWLRVWGRLDGLVPKRVQPQMPTGDQIEDAMLAKASHAPFFS
FT                   HRDDFLQVFLPWLAIHTR"
FT   gene            139833..140621
FT                   /locus_tag="Sputw3181_0113"
FT   CDS_pept        139833..140621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0113"
FT                   /product="competence protein ComF"
FT                   /note="KEGG: son:SO4625 competence protein ComF"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22966"
FT                   /protein_id="ABM22966.1"
FT                   /translation="MPHIVKGIWPQSALRIMRLGYQLCITWLAGSLPNRCLLCHQSMQA
FT                   PETGICMVCLQTGLYHSPICLGCGRSMLLEMDYCGACQKYSPHKIIAPCSYHQGLGTWV
FT                   GAIKYQGQLAALPVLCRALVARINHLEQLGLLTLPQAIVPVPLHPKRLQQRGFNQAWLI
FT                   AHELSQRLQLPLVDQGLTRRQDTRPQAGLNGAQRRRNLQDAFMLDDDFVYQRIALVDDV
FT                   VTTGTTVAEIARLFEARYVHVQIWCLARAEAPGLLDTTDL"
FT   gene            140789..141535
FT                   /locus_tag="Sputw3181_0114"
FT   CDS_pept        140789..141535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0114"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR; KEGG: son:SO4624
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22967"
FT                   /protein_id="ABM22967.1"
FT                   /translation="MDAKQALSNANTASTLKEVIQAITAALKLHGFSGFWFQGVPHCAY
FT                   ENYHFPKETNLFSQASLRKPNASVASSPVVAELQRFYLSQVAANDFNFGFSLDTSKSYM
FT                   YRLSCDKSDKASLLFSKHHIQTVLSWPVTCHSNRHWAGRFILLSHLSDSDILLTGLSAT
FT                   LKEAQNKLFECNKPLFNPFLQSSLLKDNARDILLMVANGLQNDEISTQLPISIRGVEYH
FT                   MESMRRKFGATNRANLIHLAHQYELI"
FT   gene            141538..142215
FT                   /locus_tag="Sputw3181_0115"
FT   CDS_pept        141538..142215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0115"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: son:SO4623 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22968"
FT                   /protein_id="ABM22968.1"
FT                   /translation="MLVLLVEDNRLLSNNIIQYLELSGIECDYAFNLAQADMLISQQQF
FT                   DAIILDLNLPDGDGIEACERWKAQCFTSPIIMLTARSSLNERLAGFAVGADDYLIKPFA
FT                   MEELVARLKVVAQRRPAPQRLIIGDLEIDFANHMVYRQGQLLVLSKTGWQILALLARRS
FT                   PETVSREEIERMLWPDSAPDSDSLRSHIHLLRRVIDRPFERQILHTIRGVGLSLRDEIN
FT                   ASA"
FT   gene            142202..143443
FT                   /locus_tag="Sputw3181_0116"
FT   CDS_pept        142202..143443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0116"
FT                   /product="ATP-binding region, ATPase domain protein domain
FT                   protein"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: son:SO4622 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22969"
FT                   /protein_id="ABM22969.1"
FT                   /translation="MQAPKLSLKRSYQVWGVIFLLITLGVNSFIPLCMMCAGMISMHEV
FT                   TMHNAGQAAEALLKMAEPTQQSLLHQPLLKTDNLTVYPHWRDIPLQIRELSNNEVLTDA
FT                   SKILYEHAEGPIVNALSVYYTQAGQPLYVWLQFSVTHDLQFAPKNMTAILLLVLITFCA
FT                   SASLAFYMQSKVITPVHQISQAIKQHDWEAGGKLSLPQQEYAELKAIVDALDNSILQLQ
FT                   EAQQRELNFLRFASHELRTPVAICQSSFEILALQQGELTGATLYASQATNQMKSLIETL
FT                   LWLTNKECSSLEKENVALSPLLASIIEEQQRVHGHEQKIQLFSDDTYFSVQLHPLKIIL
FT                   SNLLRNSIEHGGADISITQIARCIEITNSYNSNGRHGFGLGLLLVKRLANQLGWIFTCS
FT                   SENNLFTARLVISK"
FT   gene            143623..144387
FT                   /locus_tag="Sputw3181_0117"
FT   CDS_pept        143623..144387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4621 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22970"
FT                   /protein_id="ABM22970.1"
FT                   /translation="MCNKNVVSILVSAILFSGSVYADINKTSVDLGYKFYTSDTKDDNP
FT                   GVFNQPFVKLNHLGIADWGTYFANLKLENPAEIAENQKHVDGKTTIKSLLILENKLGES
FT                   QFNFWTQNFISASETLVEDNLYLGLTHNAKVQNLSLNYGVGFNYTIGNFSPTSEKFNDL
FT                   SGYAVVLNAKYPLELLGLKHSLSLNYEAQIDRDKAHQALFSYNSYGHQIITTLQTNITD
FT                   SIFSKLYLTHYDSWGSQYNDGFEYGISIGYQF"
FT   sig_peptide     143623..143691
FT                   /locus_tag="Sputw3181_0117"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            144480..146228
FT                   /locus_tag="Sputw3181_0118"
FT   CDS_pept        144480..146228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0118"
FT                   /product="flavocytochrome c"
FT                   /note="TIGRFAM: flavocytochrome c; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD dependent oxidoreductase; FMN-binding domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: son:SO4620 fumarate reductase,
FT                   flavoprotein subunit precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22971"
FT                   /protein_id="ABM22971.1"
FT                   /translation="MHYKKSIIGIAVTATAIIAGCQATHQIVKSQGTAQGKHGEVQVET
FT                   TFKDGHIVAIDIIKQKENKVLAGAVFKDVKQAIIDNNSVEVDGITGATVTSKALKEAVG
FT                   KSIEAAGVTLVATASAKKSEALTPAEYTYDVVIIGSGGAGFSAGLEAIAAGRSAVIIEK
FT                   MPIIGGNSLISGAEMNVAGSWVQKTMGITDSKELFISDTLKGGDFKGDPEMVKTMVDNA
FT                   VDAAEWLRDYVKVEFYPDQLFQFGGHSVKRALIPKGHTGAEVISKFSIKADEVGLPIHT
FT                   NTKAEKLIQDQTGRIVGVEATHNGKTITYHAKRGVVVATGGFSSNMEMRKKYNPELDER
FT                   YGSTGHPGGTGDGIVMAEKIHAAAKNMGYIQSYPICSPTSGAIALIADSRFFGAVLINQ
FT                   KGERFVEELERRDVISHAILDQPGRYTYVLWNQDIENVAHTVEMHQGELKEFTKDGLMY
FT                   KVDTLEEAAKVFNIPEDTLLSTIKDVNRYAATGKDEAFNHRSGLVDLSKGPYWILKATP
FT                   SVHHTMGGLVVDTRTRVLDEQGKVIPGLFAAGEVTGLTHGTNRLGGNAYTDIIVFGRIA
FT                   GQEAAK"
FT   sig_peptide     144480..144551
FT                   /locus_tag="Sputw3181_0118"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.911) with cleavage site probability 0.725 at
FT                   residue 24"
FT   gene            146468..147046
FT                   /locus_tag="Sputw3181_0119"
FT   CDS_pept        146468..147046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0119"
FT                   /product="HesB/YadR/YfhF-family protein"
FT                   /note="PFAM: HesB/YadR/YfhF-family protein; nitrogen-fixing
FT                   NifU domain protein; KEGG: son:SO4619 YhgI protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22972"
FT                   /db_xref="GOA:A1RE77"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RE77"
FT                   /protein_id="ABM22972.1"
FT                   /translation="MITISDAAQAHFVKLLADQPEGTHIRVFVISPGTAQAECGVSYCP
FT                   PDAVESDDIELEFNGFNAMVDEKSAPFLEEATIDFVTDQLGSQLTLKAPNAKMRKVSGD
FT                   APLVERIEYVIQSEINPQLASHGGNIMLVEITSEGVAVLQFGGGCNGCSQVDITLKDGI
FT                   EKQLLDMFPGELTGVRDVTDHQHGEHSYA"
FT   gene            complement(147258..147464)
FT                   /locus_tag="Sputw3181_0120"
FT   CDS_pept        complement(147258..147464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22973"
FT                   /protein_id="ABM22973.1"
FT                   /translation="MNYLTRFCPKTSRISTVKQTGYTDVKLVSHGDWRDDRPMDGAVEH
FT                   PRMDSLRVGERMPWLIISQHLKN"
FT   gene            complement(147821..148765)
FT                   /locus_tag="Sputw3181_0121"
FT   CDS_pept        complement(147821..148765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpe:RPE_0798 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22974"
FT                   /protein_id="ABM22974.1"
FT                   /translation="MRVRKQNRHDFKRMNDGYPLYARLLAKDIYKIPELPDFSADDGLF
FT                   IMSDFGGEHKGSDFSTYAFLILSADKRFVFERYIKELRGKHSLNEPFKELNYKDLRYGP
FT                   IKRALSEYLDLVDKYIHGALVTVSIDRSIETVFGLDAKASHKQLVEQLSNHGFSGWKGK
FT                   DAEKLLRVLHPLCMFLSLLGHQGQKTLWLCDNDAINEDGNERSFEDTQKIYGNILKMYC
FT                   DYEFEILGFAKPFKDDPLTSDLLSVTDFAAGTIQDILQSHVKKKDYKGNDSKIKLVKWM
FT                   AKESRFLTKINLVITKQDDGNWGCGIVQLGEKI"
FT   gene            complement(148917..149477)
FT                   /locus_tag="Sputw3181_0122"
FT   CDS_pept        complement(148917..149477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22975"
FT                   /protein_id="ABM22975.1"
FT                   /translation="MELKEAFLTILAAAGSSAAIGFLAMLFANSLASAAIKRYELVNAQ
FT                   ALEDQRLSHQKELEDVKSQLAKIQKEHEVVFSNLYVKRETVVINLYKLMSELALLADHK
FT                   LRDSSIEIDDKCKALIDYFELNRLYFPCDVALDINNVINTVFFLSNDPGKTEYEQLVFK
FT                   LKIQVYDEMESTFREFLKIEDYR"
FT   sig_peptide     complement(149373..149477)
FT                   /locus_tag="Sputw3181_0122"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.660 at
FT                   residue 35"
FT   gene            complement(150192..151481)
FT                   /locus_tag="Sputw3181_0123"
FT   CDS_pept        complement(150192..151481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0123"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: son:SO4617
FT                   DNA-damage-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22976"
FT                   /protein_id="ABM22976.1"
FT                   /translation="MILSNITIPLLGLVDTAVIGHLSDAYYLGGVALGSTIITLIIWLL
FT                   GFLRMATTGLVAQAYGANDIHAQHKLLVQGAILAILLGMGVIALQAPILNLALGLSEAS
FT                   REVEHYCREYFQVRIWSTPFALLNLVMLGWLLGRQQPKAAMWQLILANLANIILDLVFV
FT                   LGLGWGVKGAALASIFADITAFSVAFTMVRQQLKRAPDFHLSQLFPHVTLMGYGKLLRL
FT                   NTDIFIRSLCLQTAFAFMTFHGAGLGDNTVAANAVLLNLLLLISYALDGIAYYAEAEVG
FT                   KAYGQKRAQQLHEAVVLAWCWSAITALGFTLIFSLWGSHIIELLTSIDEVRTTAQTYLI
FT                   WLVLLPLWSFSSYLFDGVYIGAAQGKVMRNSMILATFGAFFPTWYLLQALLLPEQANHA
FT                   LWAAMTVFMLTRSLTLGAHYRFSKTFQLHS"
FT   gene            151585..152631
FT                   /locus_tag="Sputw3181_0124"
FT   CDS_pept        151585..152631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0124"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   she:Shewmr4_3801 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22977"
FT                   /protein_id="ABM22977.1"
FT                   /translation="MVKRALLALFGLMTFSANAVVILQYHHVSETTPAATSVTPAQFRE
FT                   QMQFLADDGFKVIPLTQVVEAIKQKQDLPAKTVAITFDDGYRSIATTAHPILKEFGFPY
FT                   TLFVAIEPIKQKFTEMMTWDELVRLSKEGADIANHSWAHEHLIRRLDNESQAQWLARVT
FT                   TNILETEKALADATGHNFKMLAYPYGEYNQALQDMLTQNGFVAFGQQSGASGPYSPLTA
FT                   LPRFPVAGQYADLKSLKAKLYSLNMPVLSQNVSDPELKNGQWRPELRLTLDMSDISAKQ
FT                   VMCYIQGQGAKSPTWLSETEFSVQADSALPAGRSRYNCTAPSKTRNGYYWFSQPWVRPR
FT                   DDGSWIKE"
FT   sig_peptide     151585..151644
FT                   /locus_tag="Sputw3181_0124"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 20"
FT   gene            complement(152632..153264)
FT                   /locus_tag="Sputw3181_0125"
FT   CDS_pept        complement(152632..153264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0125"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; electron transport protein
FT                   SCO1/SenC; KEGG: shm:Shewmr7_3873 electron transport
FT                   protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22978"
FT                   /protein_id="ABM22978.1"
FT                   /translation="MQKNMLIIAILLIGLGGLFAVKFNPPKPIELDNGFIFPQAFEIAP
FT                   FELIDQHDKAFTNADLQGKWNLFFIGFTFCPDICPTTLNKLAAAYPELNKIAPIQVVFL
FT                   SVDPNRDTPEKLLTYVNFFNTEFKAVTGEHTQIFPLTRSLGLAYAMVGEGDNYQVDHSA
FT                   GYVLVSPQGTRVAVFKPTATLGQPPQILNNELISDFGKIVSQYKSNL"
FT   sig_peptide     complement(153202..153264)
FT                   /locus_tag="Sputw3181_0125"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.742 at
FT                   residue 21"
FT   gene            complement(153269..154174)
FT                   /locus_tag="Sputw3181_0126"
FT   CDS_pept        complement(153269..154174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0126"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: she:Shewmr4_3799 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22979"
FT                   /db_xref="GOA:A1RE84"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RE84"
FT                   /protein_id="ABM22979.1"
FT                   /translation="MAKPLTITSSHSHFSLAWRAYFEMTKPKVVALMLLTVLVGMCLAV
FT                   PTAVPVQPLIAGMFGIALMAGSAAALNHLIDRRIDGMMARTYNRPLPKGRVSAKRALIF
FT                   AASIGGLGFVVLYVLVNPLTAWLTFASLIGYALVYTAYLKRATSQNIVIGGLAGAMPPL
FT                   LGWTAVTNQFHGHALLLVIIIFTWTPPHFWALAIHRRAEYAKVDIPMLPVTHGVEFTKT
FT                   CILLYTVLLAIACLLPVLVGMCGPMYFVCSSLLSSVFIYKAWQLKYRDHDGLAMQVFRF
FT                   SIYHLMLLFMALLIDHYLWS"
FT   sig_peptide     complement(154040..154174)
FT                   /locus_tag="Sputw3181_0126"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.968) with cleavage site probability 0.939 at
FT                   residue 45"
FT   gene            complement(154189..155166)
FT                   /locus_tag="Sputw3181_0127"
FT   CDS_pept        complement(154189..155166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0127"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG: son:SO4613
FT                   cytochrome oxidase assembly protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22980"
FT                   /protein_id="ABM22980.1"
FT                   /translation="MQLTWILRLTLVFTLMVILMGAYTRLSDAGLGCPDWPGCYGHIKV
FT                   PTQDHEIARAQTMFPDHDIQTEKAWLEMIHRYIAAGLGLLILFIFIKCLKTPTAPKKLP
FT                   TFILLLLIFQAALGMWTVTMKLMPIVVMSHLIGGFSLISLLLILYLRIRQKQVDISGLQ
FT                   TQNLAILALVSLIILIGQIMLGAWTSSNYAALACTTLPICEGNWMDNLAIADAFSPFQG
FT                   QHPSFEFGVLDYPARMTIHIAHRFGAIITTGVLLLLAYKLFVSTRALKKLSLLLVALVI
FT                   LQVALGISNIVMHLPLGIAVSHNGGAALLLLTLVTINYFLWRKA"
FT   sig_peptide     complement(155077..155166)
FT                   /locus_tag="Sputw3181_0127"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.738) with cleavage site probability 0.305 at
FT                   residue 30"
FT   gene            complement(155166..155726)
FT                   /locus_tag="Sputw3181_0128"
FT   CDS_pept        complement(155166..155726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4612 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22981"
FT                   /protein_id="ABM22981.1"
FT                   /translation="MRGASMNSQSKSTHKALGLLLVAFIAPVVIAKLVLSLNLYHGGAT
FT                   NFGELINPATSYTSLGVTNPKPKEWQLLYLLPSQCDDNCRERLYILRQSHTALGPDQAR
FT                   VEPLILVSPESDINALKAFHFNTSPINNRLNEWLNAQQLIIVDPLGNLVLRYPQAHSKE
FT                   AHLAQGKALIADLRKLLKLSRVD"
FT   sig_peptide     complement(155631..155726)
FT                   /locus_tag="Sputw3181_0128"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.995 at
FT                   residue 32"
FT   gene            complement(155789..156598)
FT                   /locus_tag="Sputw3181_0129"
FT   CDS_pept        complement(155789..156598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22982"
FT                   /protein_id="ABM22982.1"
FT                   /translation="MINSNSRTKTNLKINRAFMRYPYCLLNKLTVFLLVLTVTVFVILV
FT                   KLGLWQLHRGEEKALLLAQMESRQALAPLTFKQLLQKIHLEDVTGYRLSITASPANAQI
FT                   WLLDNQVYQGQVGYLAFQALEVEPEKPWLLVELGFIAATSSRDELPQIEPLSGKLSLVG
FT                   KLYQKQTNPLSHALMAEAGTHIRIQNLNIPEITQLVGHPLVTAVLQPDQLPNLELAHPW
FT                   QPFPLSAQKHWGYALQWFSMAAVFAGLMLWQGVKYVKHHHSANSMGK"
FT   gene            complement(156769..157644)
FT                   /locus_tag="Sputw3181_0130"
FT   CDS_pept        complement(156769..157644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0130"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /note="PFAM: cytochrome c oxidase, subunit III; KEGG:
FT                   shm:Shewmr7_3867 cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22983"
FT                   /protein_id="ABM22983.1"
FT                   /translation="MTTKHQTYYVPSQSIWPIVGAIGLFFIAVGAGLFVQQMKSGASGG
FT                   GYLLLLGIAVIVFMLVGWFSAVIKESTTGLYSAQMDRSFRQGMSWFIFSEVMFFAAFFG
FT                   ALFYARAIAVPWLGGASNNAMTHEILWPSFEAVWPLISTPDGTKTEAMPWTGLPLINTL
FT                   ILLTSSVTLHFAHISLEKAKRSAVVLWLGITILLGIGFVGLQVEEYRHAYQEMGLTLTS
FT                   GIYGNTFFLLTGFHGMHVTLGTVFLVVLFIRVLKGHFTADKHFAFQAGSWYWHFVDVVW
FT                   LCLFIFVYVL"
FT   gene            complement(157641..158207)
FT                   /locus_tag="Sputw3181_0131"
FT   CDS_pept        complement(157641..158207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0131"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: shm:Shewmr7_3866 cytochrome c oxidase
FT                   assembly protein CtaG/Cox11"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22984"
FT                   /protein_id="ABM22984.1"
FT                   /translation="MTSTTRSNRKLISLLVLGCVGMFGFGFALVPLYDVLCEKLGINGK
FT                   PASTASNYQAITVDTSRTVTVEFISQVQTGMPWKFEPQIKRLVVHPGELVHTAFLARNE
FT                   SNHATVGQAIPSVSPGQGAAYFNKTECFCFNKQPLAAATSAELPLIFFVDPQLPESIHT
FT                   LTLSYTLYDITDKQLASAIEQGAAK"
FT   sig_peptide     complement(158121..158207)
FT                   /locus_tag="Sputw3181_0131"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.988 at
FT                   residue 29"
FT   gene            complement(158209..159801)
FT                   /locus_tag="Sputw3181_0132"
FT   CDS_pept        complement(158209..159801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0132"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="PFAM: cytochrome c oxidase, subunit I; KEGG:
FT                   shm:Shewmr7_3865 cytochrome-c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22985"
FT                   /protein_id="ABM22985.1"
FT                   /translation="MSTMTQEHTAVHDDHHHGAPKGIMRWLLTTNHKDIGTLYLWFSFI
FT                   MFLTGGAMAMVIRAELFQPGLQLVEPNFFNQMTTVHGLIMVFGAVMPAFTGLANWLIPM
FT                   MIGAPDMALPRMNNWSFWILPFAFAILLGSLFMEGGGPNFGWTFYAPLSTTYSPDSTAL
FT                   FVFSIHIMGISSIMGAINVIVTIVNLRAPGMTWMKLPLFVWTWLITAFLLIAVMPVLAG
FT                   VVTMVLTDKFFGTSFFEAAGGGDPVMFQHIFWFFGHPEVYIMILPSFGIISAIVPAFSR
FT                   KKLFGYASMVYATASIAILSFLVWAHHMFTTGMPVFAELFFMYCTMLIAVPTGVKVFNW
FT                   VATMWRGSLTFETPMLFAVAFIILFTIGGFSGLMLAITPADFQYHDTYFVVAHFHYVLV
FT                   TGAIFSIMAAAYYWLPKWTGHMYNERLAQWHFWCSVISVNVLFFPMHFLGLAGMPRRIP
FT                   DYSIQFADINQIVSIGGFAFGLSQLIFLVLVIKCIRGGEKAPAKPWEGSEGLEWTLPSP
FT                   APYHSFTTPPEVK"
FT   gene            complement(159811..161349)
FT                   /locus_tag="Sputw3181_0133"
FT   CDS_pept        complement(159811..161349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0133"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="PFAM: cytochrome c oxidase, subunit II; cytochrome
FT                   c, class I; cytochrome C oxidase subunit II, transmembrane
FT                   region; KEGG: she:Shewmr4_3791 cytochrome c oxidase,
FT                   subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22986"
FT                   /protein_id="ABM22986.1"
FT                   /translation="MKQLLYCLLVVLFAPPLNAADSRFNMTTGVTEISGKVYHLHMTIL
FT                   YICCAIGLVVFGVMIYAMINHRKSKGAVAAHFHESTKVEIAWTILPFIILILMAIPATK
FT                   TLIAMEDTSNADITIKVTGSQWKWHYSYFDQDIDFYSILSTPRTQIDGSEPKGEHYLLE
FT                   VDKPLVVPINRKIRFLMTSEDVIHSWWVPAFAVKKDANPGFINEAWTRIDKPGIYRGQC
FT                   AELCGKDHGFMPIVVKALPEAEFDAWITEQKQAAQTAAATAQAALSQTLSQADLMTQGE
FT                   QVYMARCAACHQPNGEGLKGVFPGLKGSPIATGPLTPHLEIIIHGKAGTAMQAFANQLT
FT                   AQEIAAVTTYERNAWGNNMGDAVQAKDVNDYMNGDRQPKTSTTQTQQVAALPTEPTVQG
FT                   ASIDPASLPTLTHDALMTEGEAIYISSCAACHQVNGLGIPPAFPSLVNSNIVTGPIANH
FT                   IEIVMHGKTGTAMQAFDKQLSPQQLAAVITYERNAWGNNTGDTVQAADIVKHGQ"
FT   sig_peptide     complement(161290..161349)
FT                   /locus_tag="Sputw3181_0133"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(161745..162257)
FT                   /locus_tag="Sputw3181_0134"
FT   CDS_pept        complement(161745..162257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22987"
FT                   /protein_id="ABM22987.1"
FT                   /translation="MSNLLGNAPRHPGLWLDNIREPDANWQYAPISCVPTQTQGRTELI
FT                   QLSTQLAQLSQQGRWVVLINPPSIGYKQLLTSAGVRMDRILLVHAKDEVETLWAMEKAL
FT                   TSGTSSAVITWTTSLDARDNRRLQIVAKSARAMGIVLEEVNNHLQDKVRLEQHTHFKQA
FT                   TFFSPVH"
FT   gene            complement(162254..162874)
FT                   /locus_tag="Sputw3181_0135"
FT   CDS_pept        complement(162254..162874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0135"
FT                   /product="SOS-response transcriptional repressor, LexA"
FT                   /note="KEGG: shm:Shewmr7_3862 SOS-response transcriptional
FT                   repressor, LexA; TIGRFAM: LexA repressor; PFAM: peptidase
FT                   S24, S26A and S26B; LexA DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22988"
FT                   /db_xref="GOA:A1RE93"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RE93"
FT                   /protein_id="ABM22988.1"
FT                   /translation="MRPLTPRQAEILELIKRNIADTGMPPTRAEIATRLGFKSANAAEE
FT                   HLKALAKKGCIEIMPGTSRGIRLPAEEEVVVEYGLPLIGQVAAGEPILAQEHVEQYYQV
FT                   DPSMFHPTADFLLRVKGDSMKNIGILEGDLLAVHKVQQARNGQVVVARVDDDVTVKRFE
FT                   KKGNLVYLYAENEDYSPIKVDLSCQSLTIEGLAVGVIRNGDWL"
FT   gene            163225..165648
FT                   /locus_tag="Sputw3181_0136"
FT   CDS_pept        163225..165648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0136"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   she:Shewmr4_3788 glycerol-3-phosphate O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22989"
FT                   /db_xref="GOA:A1RE94"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RE94"
FT                   /protein_id="ABM22989.1"
FT                   /translation="MPKQDSLWLKSLRWIQKHLVHTIVVPQDPFADLNLDTSRPLAYVM
FT                   KTESLSDIAALSEVTEKLGLPSPYEPLVVNGVVAPRVVCLQGRKPLFGERAGNEPFLEC
FT                   FMRLLAVHKERPELDIQLVPVSLYWGRTPGKEDDTMKAAVLERENPTWLRKCFMILFLG
FT                   RHNFVQFSNAVSLRYMADEHGTDMGIAHKLARVARVHFRRQRKVMTGPLLPNRQALFDS
FT                   LLKSESLRKAIQEEAVSKKISETQSRETAIEYLDEIAANYSDSLVRIAERFLTWLWNKL
FT                   YSGINIKGAEHIRQLHHDGHEIVYVPCHRSHMDYLLLSYILYYQGMVPPHIAAGINLNF
FT                   WPAGPLFRRGGAFFIRRSFNGNKLYTAVFREYLDQLFAKGYSVEYFSEGGRSRTGRLLA
FT                   PKTGMIAMTMNSVLRGIERPVTLVPVYLGYDHVMEVATYHKELSGKKKQKESVWQVFGA
FT                   IRKLGNFGQGYVNFGEPITLQTFLNEMAPNWRAELADDPEQKPTWLTPAVNVLANRVMT
FT                   RINDAAAASSVTLTSLALLASEQNALERCLLERQLDLYLTLLKRVPYTSFTSVAEGDGK
FT                   HLVQQGIDLNKFSVSSDPLGEIVSIDANQAISMTYYRNNIIHLFIIPSLIASCLTHNEQ
FT                   SQRQQIVAIVNDFYPLLKAELFMGIKDIPSYVNQVLDLFIEQGLITESDNLSVVTEHSS
FT                   QLVLLSGSVSETLQRYAIIFNLLAHRPKMERSELESESHLLAQRLGALHGITAPEFYDK
FT                   KLYGTLSVKLKELGYLSDKDDKSDVKRIRDQANSLLRASVRQTIVASVTAEHIS"
FT   gene            165648..166904
FT                   /locus_tag="Sputw3181_0137"
FT   CDS_pept        165648..166904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0137"
FT                   /product="aromatic amino acid transporter"
FT                   /note="TIGRFAM: aromatic amino acid transporter; PFAM:
FT                   aromatic amino acid permease; Amino acid transporter,
FT                   transmembrane; KEGG: son:SO4601 tryptophan-specific
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22990"
FT                   /protein_id="ABM22990.1"
FT                   /translation="MTNHMNAVKHKTAGKSLLGGAMIIAGTTVGAGMFSLPVVGSGMWF
FT                   GYSIVMLLGIWFCMLMSGLLLLETNLHFEPGASFDTLTKQTLGQFWRIVNGVSIAFVLY
FT                   ILTYAYISGGGSIVNHSLQGMGIELPQSVAGLVFAIVLASIVLISTKAVDRITTIMLGG
FT                   MIITFFLAIGNLLIEIDVTKLLEPDGTTRFAPYLWAALPFGLASFGYHGNVPSLVKYYG
FT                   KDSATIIKAIFVGTFIALIIYACWLVATMGNIPRSQFSDIIAQGGNMGVLVGALSKVMA
FT                   SSWLNSMLTLFANLAVASSFLGVTLGLFDYLADLFGFDDSRNGRIKTAAVTFVPPTVFG
FT                   LLFPDGFLIAIGFAALAATVWAVIVPALMAYKSRQLFPESTGFKVKGGTPIIVIVVLFG
FT                   IITGTCHLLAMANLLPQYS"
FT   sig_peptide     165648..165770
FT                   /locus_tag="Sputw3181_0137"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.975) with cleavage site probability 0.789 at
FT                   residue 41"
FT   gene            complement(166995..168152)
FT                   /locus_tag="Sputw3181_0138"
FT   CDS_pept        complement(166995..168152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0138"
FT                   /product="ribonuclease T2"
FT                   /note="PFAM: ribonuclease T2; KEGG: son:SO4599
FT                   ribonuclease, T2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22991"
FT                   /protein_id="ABM22991.1"
FT                   /translation="MTMPLRLTASPKRLQQELLRQPLMLYRIVSILLLGITPAIAAPAS
FT                   GEFISNKRCELFQSKNKQTNPEQLQSNIGERYTVQEILGNTTNPQWLRVKTNAATSPLR
FT                   WISGSCGQYLTSVTNNDLSTPVSAMEPSQTTTASDIKAINRDSLKEHSTKDQRQVSHCQ
FT                   LEGNLDSHVLALSWQSTFCELNGNRKAECSDLNKTDESPLWQQFSLHGLWPNRKQCGTR
FT                   YGYCSTVKLQPSDFCSYPEIELNASVRKNLEEVMPSARYGTCLERHQWWKHGTCRNQEP
FT                   NDYFLLATQLTQTINASAWVKNFIHGNIGKQVTRQELNTSFDKSFGQGAHTKMSLECAK
FT                   GLLSEIRINLPEVIKGSDSIPALLAKANKAGKGSCPDTIIINNSN"
FT   sig_peptide     complement(168027..168152)
FT                   /locus_tag="Sputw3181_0138"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.908) with cleavage site probability 0.872 at
FT                   residue 42"
FT   gene            168410..169435
FT                   /locus_tag="Sputw3181_0139"
FT   CDS_pept        168410..169435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0139"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: son:SO0213 UDP-N-acetylmuramate dehydrogenase;
FT                   TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine reductase;
FT                   PFAM: FAD linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22992"
FT                   /protein_id="ABM22992.1"
FT                   /translation="MSLSHSLKSFNTFGLSQCCSALVEAHSKEDIKHICLPLWQDQQPL
FT                   LVLGGGSNVVFTDDFHGTVVRVLSKGIKVSEDAVYFYLEVEAGENWHELVEFTLANGMP
FT                   GLENLALIPGTLGAAPIQNIGAYGVEFCDVCDWVEYLDLDSGDFFRLTATECQFSYRES
FT                   IFKGALRGRAVITAVGLRLVKQWQPHLAYGPLQSFDPASVTAADIFNKVCQVRREKLPD
FT                   PNVLGNAGSFFKNPIVSAACYLELAQRFSTIVGYAQADGSVKLAAGWLIEQAGLKGFIL
FT                   GKAAVHDKQALVLVNRGGATGQDICRLAQHVIERVNDTFGVLLEAEPKIIGVTGEGDLH
FT                   V"
FT   gene            169428..170387
FT                   /locus_tag="Sputw3181_0140"
FT   CDS_pept        169428..170387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0140"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="KEGG: she:Shewmr4_0182
FT                   biotin--acetyl-CoA-carboxylase ligase; TIGRFAM:
FT                   biotin--acetyl-CoA-carboxylase ligase; PFAM: regulatory
FT                   protein, ArsR; biotin protein ligase domain protein;
FT                   biotin/lipoate A/B protein ligase; Helix-turn-helix, type
FT                   11 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22993"
FT                   /protein_id="ABM22993.1"
FT                   /translation="MSDNWVRKREILTLLSSEHFVSGEQLASELGISRAAVSKHIDALE
FT                   TYGVAIYSVKGRGYKLANPISLIDASRLVQSIDHRCFYFDEIPSTNGFMLSHINELKSG
FT                   DVCVAEYQAAGRGRRGRTWVSPYGHHLYFSLFWSFPQGMAQAMGLSLVVACTLVEVLKS
FT                   YGVENIGVKWPNDIYLDHKKLAGILIEMAGQADSECQLIIGIGVNMAMSEDHGKGIDQP
FT                   WSDLSTLATMPDKTDLVIELQKQLKRDIQLFEREGLNAFKTRWQAADLFYGKPIRLLMG
FT                   ENHIDGICMGVDAQGAVLLDTADGIQAFIGGEISLRPR"
FT   gene            complement(170398..171348)
FT                   /locus_tag="Sputw3181_0141"
FT   CDS_pept        complement(170398..171348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0141"
FT                   /product="pantothenate kinase"
FT                   /note="TIGRFAM: pantothenate kinase; PFAM:
FT                   phosphoribulokinase/uridine kinase; KEGG: she:Shewmr4_0183
FT                   pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22994"
FT                   /db_xref="GOA:A1RE99"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RE99"
FT                   /protein_id="ABM22994.1"
FT                   /translation="MTSKNPIQKALYLTFERAQWSELRDSVPLTLSERDLENLRGINEK
FT                   VSLSEVTDIYLPLSRLLNLIVKSKQQRGLVLDEFLGQKPFHSPYIISIAGSVAVGKSTT
FT                   ARVLQALLQHWPEHPKVDLVTTDGFLYPLADLKRKGLLQRKGFPESYDMKMLVEFISAV
FT                   KSGQPHTKAPIYSHVTYDRVRNQHQIVSQPDILILEGLNVLQTGLDSPVDTRRPFVSDF
FT                   VDFSIYVDAEESLLKQWYQERFLQFRKGAFSDAKSYFHHYANLTDDEANAIAANIWDTI
FT                   NGPNLQLNIQPTRERAHLILQKGQDHLMSHVLMRK"
FT   gene            171582..171657
FT                   /locus_tag="Sputw3181_R0004"
FT   tRNA            171582..171657
FT                   /locus_tag="Sputw3181_R0004"
FT                   /product="tRNA-Thr"
FT   gene            171665..171749
FT                   /locus_tag="Sputw3181_R0005"
FT   tRNA            171665..171749
FT                   /locus_tag="Sputw3181_R0005"
FT                   /product="tRNA-Tyr"
FT   gene            171786..171859
FT                   /locus_tag="Sputw3181_R0006"
FT   tRNA            171786..171859
FT                   /locus_tag="Sputw3181_R0006"
FT                   /product="tRNA-Gly"
FT   gene            171869..171944
FT                   /locus_tag="Sputw3181_R0007"
FT   tRNA            171869..171944
FT                   /locus_tag="Sputw3181_R0007"
FT                   /product="tRNA-Thr"
FT   gene            172061..173245
FT                   /locus_tag="Sputw3181_0142"
FT   CDS_pept        172061..173245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0142"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein; KEGG:
FT                   son:SO0229 translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22995"
FT                   /protein_id="ABM22995.1"
FT                   /translation="MAKAKFERIKPHVNVGTIGHVDHGKTTLTAAISHVLAKTYGGEAK
FT                   DFSQIDNAPEERERGITINTSHIEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVASTDGPMPQTREHILLSRQVGVPFIIVFMNKCDMVDDEELLELVEMEVRELLSEYDF
FT                   PGDDLPVIQGSALKALEGEPEWEAKILELAAALDSYIPEPQRDIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVRVGDEVEIVGVRATTKTTCTGVEMFRKLLDEGRAGENCGILLRG
FT                   TKRDDVERGQVLAKPGSINPHTTFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMVVTLICPIAMDEGLRFAIREGGRTVGAGVVAKIIA"
FT   gene            173521..173892
FT                   /locus_tag="Sputw3181_0143"
FT   CDS_pept        173521..173892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0143"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: son:SO0218
FT                   preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22996"
FT                   /protein_id="ABM22996.1"
FT                   /translation="MTTNTENQNNSLDIVKWGVVIVLLAAAVIGNQMFSEASAVIRALG
FT                   VIVAFAIAGFIALQTEKGKKAFAFARESQIEVRKVVWPTRQEALNTTFIVLAATGILAL
FT                   VLWGMDAVLMRIVNFITGV"
FT   gene            173902..174453
FT                   /locus_tag="Sputw3181_0144"
FT   CDS_pept        173902..174453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0144"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="KEGG: shm:Shewmr7_0182 NusG antitermination factor;
FT                   TIGRFAM: transcription termination/antitermination factor
FT                   NusG; PFAM: transcription antitermination protein NusG; KOW
FT                   domain protein; SMART: NGN domain protein; KOW (Kyrpides,
FT                   Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22997"
FT                   /protein_id="ABM22997.1"
FT                   /translation="MTEAKEAKKRWYVVQAFSGYEGRVCKSLIEYIKMHGMEQYFGEVL
FT                   VPTEEVIEMRAGQRRKSERKFFPGYVLVQMEMNDDSWHLVKSIPRVLGFIGGTSDRPAP
FT                   ISDKEADAILRRLQETTASPTHRVIFEPGEVVRVCDGPFADFNGTVEEVDYDKSRVKVS
FT                   VMIFGRSTPVELDFSQVEKG"
FT   gene            174581..175009
FT                   /locus_tag="Sputw3181_0145"
FT   CDS_pept        174581..175009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0145"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="PFAM: ribosomal protein L11; KEGG: shm:Shewmr7_0183
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22998"
FT                   /db_xref="GOA:A1REA3"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REA3"
FT                   /protein_id="ABM22998.1"
FT                   /translation="MAKKIDAYIKLQVKSGSANPSPPVGPALGQKGVNIMEFCKAFNAR
FT                   TEKMEKGMPIPVVITVYSDRSFTFETKTPPASFLLKTAAGLKSGSPRPNTQKVGTIARA
FT                   KIQEIAETKAADMTGADIEAMTRSIEGTARSMGLVVED"
FT   gene            175014..175715
FT                   /locus_tag="Sputw3181_0146"
FT   CDS_pept        175014..175715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0146"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="PFAM: ribosomal protein L1; KEGG: shm:Shewmr7_0184
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABM22999"
FT                   /db_xref="GOA:A1REA4"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REA4"
FT                   /protein_id="ABM22999.1"
FT                   /translation="MAKLTKRMRVIREKVDGTKLYEINDAVALLKELATAKFVESVDVA
FT                   VNLGIDPRKSDQNVRGATVLPHGTGRDVRVAVFTQGANAEAAKAAGAELVGMDDLAEQI
FT                   KAGEMNFDVVIASPDAMRVVGMLGQILGPRGLMPNPKTGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHTTIGKVDFTPVQLKENLEALISALKKAKPAVAKGVYVKKVSISTTMGAGV
FT                   AVDQATLDTAN"
FT   gene            175982..176482
FT                   /locus_tag="Sputw3181_0147"
FT   CDS_pept        175982..176482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0147"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="PFAM: ribosomal protein L10; KEGG: shm:Shewmr7_0185
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23000"
FT                   /db_xref="GOA:A1REA5"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REA5"
FT                   /protein_id="ABM23000.1"
FT                   /translation="MALRLEDKKAIVAEVNEAAKGALSAVAADSRGVTVGAMTGLRKKA
FT                   REAGVYVRVVRNTLARRAVEGTAFECLAETFTGPTLIAFSLEHPGAAARLLKDFAKEQA
FT                   NFEVKGAAFEGNFIPAAEIDRLAKLPTYEEALAQLMMTMKEASAGKFVRTLAALRDQKQ
FT                   EAA"
FT   gene            176537..176905
FT                   /locus_tag="Sputw3181_0148"
FT   CDS_pept        176537..176905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0148"
FT                   /product="LSU ribosomal protein L12P"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12-like; KEGG: son:SO0223 50S ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23001"
FT                   /db_xref="GOA:A1REA6"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REA6"
FT                   /protein_id="ABM23001.1"
FT                   /translation="MSITKDQILEAFAAMSVMEVVELIEAMEEKFGVSAAAAVVSGGGE
FT                   AAAAVEEQTEFNVILTAHGDNKVAVIKAIRGATGLGLKEAKAMSEAAPVAVKEGVSKEE
FT                   AEALKKELVEAGASVEIK"
FT   gene            177146..181177
FT                   /locus_tag="Sputw3181_0149"
FT   CDS_pept        177146..181177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0149"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: shm:Shewmr7_0187 DNA-directed RNA polymerase,
FT                   beta subunit; TIGRFAM: DNA-directed RNA polymerase, beta
FT                   subunit; PFAM: RNA polymerase Rpb2, domain 6; RNA
FT                   polymerase Rpb2, domain 7; RNA polymerase Rpb2, domain 2;
FT                   RNA polymerase beta subunit; RNA polymerase Rpb2, domain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23002"
FT                   /db_xref="GOA:A1REA7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REA7"
FT                   /protein_id="ABM23002.1"
FT                   /translation="MVYSYSEKKRIRKDFGKRPQVLDIPYLLSIQLDSFKKFTDQDPTG
FT                   ERGLEAAFRSVFPIKSFSGNSELQYVSYKLGEPVFDVKECQIRGVTYSAPLRVKLRMVL
FT                   YDREAAAGTVKDIKEQEVYMGDIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDHDRGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDALFVRIDRRRKLPATIILRALEYSTQEILD
FT                   LFFERVEFKIKKDTLVMALVPERLRGETASYDIKDAEGSVLVEAGRRITARHIRQLEKT
FT                   NTTELEVPVEYIVGKYAAQDYIDPDTGEVLVSANSEISLEDLAKLSLAGIKDISTLYIN
FT                   ELDHGAYISDTLRIDSTTNRLEALVEIYRMMRPGEPPTKDAAEALFQNLFFSEERYDLS
FT                   KVGRMKFNRRLSIPDDEGSGVLSKEDIVAVMKNIIHIRNGFDEVDDIDHLGNRRIRSVG
FT                   EMAENQFRVGLVRVERAVRERLSLGDLNELMPQDLINAKPISAAVKEFFGSSQLSQFMD
FT                   QNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHPTHYGRLCPIETPEGPNIGLINSL
FT                   ASFARTNSYGFLETPYRKVIDGVITDEVEYLSAIEEGRYVIAQANIEVDANGRMVEEQI
FT                   ACRHKGESTFMRASDIQYMDVSPQQIISVAASLIPFLEHDDANRALMGANMQRQAVPTL
FT                   RSEKPLVGTGIERTLAVDSGVVVVAKRGGYIDYVDASRIVVKVNEDELRPGEAGIDIYN
FT                   LTKYTRSNQNTCINQRPCCAVGEPVVRGDVLADGPSTDLGDLALGQNMRIAFMPWNGYN
FT                   FEDSILISERVAQEDRFTTIHIQELSCIARDTKLGSEEITADIPNVGESALSKLDESGI
FT                   VYIGAEVKGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNSVKGTII
FT                   DVQVFTRDGVEKDKRAVEIEEMHIAQARKDLSEEFKILEEGVLSRARNLLLGAGFTETQ
FT                   IAAMPRKDVLVQVIDDEAKQTELEQLAEQHEELKADFDKKFEIKRRKITQGDDLAPGVL
FT                   KIVKVYLAVKRTIQPGDKMAGRHGNKGVISKICPIEDMPYDEQGNPVDIVLNPLGVPSR
FT                   MNIGQVLEVHMGAAAKGIGNKITAMLEEQRELAEVRGYIKQVYELGDEVQQRVDIDSFT
FT                   DDEVMRLAQNLKGGIPIATPAFDGAKEKEIKQMLELAGLPTSGQLKLYDGRTGNEFERQ
FT                   VTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGA
FT                   AYTLQEMLTVKSDDVNGRTQMYKNIVDGNHQMQPGMPESFNVLLKEIRSLGINIELDQE
FT                   "
FT   gene            181261..185478
FT                   /locus_tag="Sputw3181_0150"
FT   CDS_pept        181261..185478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0150"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: shm:Shewmr7_0188 DNA-directed RNA polymerase,
FT                   beta' subunit; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase, alpha subunit; RNA
FT                   polymerase Rpb1, domain 3; RNA polymerase Rpb1, domain 1;
FT                   RNA polymerase Rpb1, domain 5; RNA polymerase Rpb1, domain
FT                   4; SMART: RNA polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23003"
FT                   /db_xref="GOA:A1REA8"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REA8"
FT                   /protein_id="ABM23003.1"
FT                   /translation="MKDLLKFLKQQSKTEEFNGIKIGLASPDLIRSWSFGEVKKPETIN
FT                   YRTFKPEREGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IELASPVAHIWFLKSLPSRIGLMLDMTLRDIERVLYFESFVVIEPGMTSLERGQMLTEE
FT                   TYLDALEEYGDEFEAKMGAEAVLELLRAIDLAKEIEQMREELPSINSETRRKKVTKRLK
FT                   LMEAFFTSGNKPEWMILKVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIYGKLEGRGLATTIKAAKK
FT                   MVEREVAEVWDVLDEVIREHPVMLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPVITPSQDVVLGLYYTSRER
FT                   INGRGEGMAFMSVAEVEKAYATGAAELHARVKVRITETIIGDDGERTEQRRIVDTTVGR
FT                   ALLSLILPAGLSFDLVNQNMGKKQISKLLNTCYRQLGLKDTVIFADQLMYTGFRFATIS
FT                   GASVGIDDMVIPDEKYTLVADAEAEVLEIQEQFQSGLVTAGERYNKVIDIWASANEKVS
FT                   KAMMENLSTETVINRDGVEEKQASFNSIYMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVIED
FT                   DCGTHEGLTMKPLIEGGDVVEPLRERVLGRVVAVDVFYPGTEDVLAPRNTLLDEAWCDK
FT                   LEEHSIDEVIVRSVITCDTDFGVCAACYGRDLARGHIINHGEAIGVVAAQSIGEPGTQL
FT                   TMRTFHIGGAASRASAENNVQVKNSGSLKLHNAKHVTNSDGKLVIVSRSSELAIIDELG
FT                   REKERYKVPYGTVLEKLEEAAVEAGDIIANWDPHTHPIISEVAGSIKFVDMIDGVTMTR
FT                   QTDELTGLSSIVILDVGQRGTAGKEMRPMIRLLGANGSDLMIPGTEVPAQYFLPGSAIV
FT                   NLDDNAQIAVGDALARIPQESSKTRDITGGLPRVADLFEARKPKEPAILAEISGTISFG
FT                   KETKGKRRLVITPADGGDQYEEMIPKWRNLNVFEGEKVERGEVIADGPEAAHDILRLRG
FT                   IHNVANYIVNEVQDVYRLQGVKINDKHIEVIIRQMLRKCLITSAGDTEFLEGEQVEVSR
FT                   VKIANRELIAQGKVPATFERELLGITKASLATESFISAASFQETTRVLTEAAVGGKSDQ
FT                   LRGLKENVIVGRLIPAGTGYAYHKTRNDARAKKDEPVVVNKVTASEAEQNLADLLNMAG
FT                   SQD"
FT   gene            185658..186032
FT                   /locus_tag="Sputw3181_0151"
FT   CDS_pept        185658..186032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0151"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: shm:Shewmr7_0189 ribosomal protein
FT                   S12"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23004"
FT                   /db_xref="GOA:A1REA9"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REA9"
FT                   /protein_id="ABM23004.1"
FT                   /translation="MATVNQLVRKPRAPKVDKTNVPALNACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDC
FT                   AGVSSRRQGRSKYGAKRPKS"
FT   gene            186113..186583
FT                   /locus_tag="Sputw3181_0152"
FT   CDS_pept        186113..186583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0152"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="PFAM: ribosomal protein S7; KEGG: sfr:Sfri_0144
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23005"
FT                   /db_xref="GOA:A1REB0"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REB0"
FT                   /protein_id="ABM23005.1"
FT                   /translation="MPRRRVVGQRKILPDPKFHSELLAKFINVIMQDGKKSTAEKIIYK
FT                   ALDVVAEKKSENHLVILEAALDNVRPSVEVKSRRVGGSTYQVPCEVRPVRRNALAMRWL
FT                   VEAARKRGEKSMALRLAGEMLDASENKGTAVKKREDVHRMAEANKAFAHYRW"
FT   gene            186662..188758
FT                   /locus_tag="Sputw3181_0153"
FT   CDS_pept        186662..188758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0153"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: shm:Shewmr7_0191 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23006"
FT                   /protein_id="ABM23006.1"
FT                   /translation="MARITPIERYRNIGICAHVDAGKTTTTERVLFYTGLSHKIGEVHD
FT                   GAATTDWMVQEQERGITITSAAVTTFWRGMDAQFTEHRINIIDTPGHVDFTIEVERSLR
FT                   VLDGAVVVFCGSSGVEPQSETVWRQADKYRVPRLVFVNKMDRAGADFERVVKQIRTRLG
FT                   ATCVPIQLNIGSEENFRGVIDLIKMKAINWNEEDQGMTFTHEEIPAELAAKAAEMHEYL
FT                   VEVAAESSDELMDKYLEEGTLSEEEIKKALRQRTINNEIVLATCGSAFKNKGVQAVLDA
FT                   VVEFLPAPIDVPPIKGIDENEQEVERPSDDNAPFAALAFKIATDPFVGTLTFIRVYSGV
FT                   LESGSGVYNSVKQKRERIGRIVQMHANDRTELKEVRAGDIAAAIGLKEVTTGDTLCDND
FT                   HRVILERMEFPEPVITIAVEPKSKADQDKMGIALQKLAAEDPSFRVETDEESSQTLISG
FT                   MGELHLDIIVDRMRREFGVECNVGKPQVAYRETIRGSVEAEGKFVRQSGGRGQFGHVWL
FT                   KLEPNEEGAGYEFINAIVGGVVPREFIPAVDKGIQEQMKNGVLAGFPVLDVKVTLFDGS
FT                   YHDVDSNEMAFKIAGSMGFKKGALEANPVLLEPCMKVEVTTPENYMGDVVGDLNRRRGL
FT                   IEGMDDGFGGIKIVHAVVPLSEMFGYATDLRSATQGRASYSMEFLKYSDAPQNIAKAII
FT                   ESRS"
FT   gene            188777..190015
FT                   /locus_tag="Sputw3181_0154"
FT   CDS_pept        188777..190015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0154"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein; KEGG:
FT                   son:SO0229 translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23007"
FT                   /protein_id="ABM23007.1"
FT                   /translation="MLLWSSFDWTILKRKEYIVAKAKFERIKPHVNVGTIGHVDHGKTT
FT                   LTAAISHVLAKTYGGEAKDFSQIDNAPEERERGITINTSHIEYDTPSRHYAHVDCPGHA
FT                   DYVKNMITGAAQMDGAILVVASTDGPMPQTREHILLSRQVGVPFIIVFMNKCDMVDDEE
FT                   LLELVEMEVRELLSEYDFPGDDLPVIQGSALKALEGEPEWEAKILELAAALDSYIPEPQ
FT                   RDIDKPFLLPIEDVFSISGRGTVVTGRVERGIVRVGDEVEIVGVRATTKTTCTGVEMFR
FT                   KLLDEGRAGENCGILLRGTKRDDVERGQVLAKPGSINPHTTFESEVYVLSKEEGGRHTP
FT                   FFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMVVTLICPIAMDEGLRFAIREGG
FT                   RTVGAGVVAKIIA"
FT   gene            190350..190661
FT                   /locus_tag="Sputw3181_0155"
FT   CDS_pept        190350..190661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0155"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10; KEGG: shm:Shewmr7_0193
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23008"
FT                   /db_xref="GOA:A1REB3"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REB3"
FT                   /protein_id="ABM23008.1"
FT                   /translation="MQNQRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERYTILISPHVNKDARDQYELRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG"
FT   gene            190689..191327
FT                   /locus_tag="Sputw3181_0156"
FT   CDS_pept        190689..191327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0156"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="PFAM: ribosomal protein L3; KEGG: shm:Shewmr7_0194
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23009"
FT                   /db_xref="GOA:A1REB4"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REB4"
FT                   /protein_id="ABM23009.1"
FT                   /translation="MAIGLIGRKVGMTRIFTEDGVSIPVTVIEVAGNRVTQVKTLETDG
FT                   YRALQVTTGTKKANRITKPEAGHFAKSGVEAGRGLWEVRLEDGEGEGIEVGAELNVDIF
FT                   ADVAKVDVTGQSKGKGFQGGVKRWNFRTQDMTHGNSLSHRSNGSIGQNQTPGRVFKGKK
FT                   MSGHMGAERVTTQNLVVVRVDVERNLLLVRGAVPGATNGDLIIKPAVKA"
FT   gene            191345..191950
FT                   /locus_tag="Sputw3181_0157"
FT   CDS_pept        191345..191950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0157"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: sdn:Sden_0171
FT                   ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23010"
FT                   /db_xref="GOA:A1REB5"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REB5"
FT                   /protein_id="ABM23010.1"
FT                   /translation="MELVLKDAQSALEVSETTFGRDFNEALVHQVVVAYAANARQGTRA
FT                   QKTRAEVTGSGKKPWRQKGTGRARAGSVKGPIWRGGGVTFAAKTQDHSQKVNKKMYRGA
FT                   LKSILSELVRQERLVVVESFGVEAPKTKELKAKLKAMNLEDVLIVTAEVDENLFLAARN
FT                   LYKVDVRDVAGLDPVSLIAFNTVLVTADAVKQIEEMLA"
FT   gene            191947..192252
FT                   /locus_tag="Sputw3181_0158"
FT   CDS_pept        191947..192252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0158"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: son:SO0233
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23011"
FT                   /protein_id="ABM23011.1"
FT                   /translation="MMIREERLLKVILAPHISEKSTVNAEKHNTVVFRVAIDATKAEIK
FT                   AAVAKLFEVEVDSVRTLVSKGKTKRTGGRTGRRSDWKKAYVTLAAGADIDFVGGAE"
FT   gene            192269..193093
FT                   /locus_tag="Sputw3181_0159"
FT   CDS_pept        192269..193093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0159"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="PFAM: ribosomal protein L2; KEGG: son:SO0234 50S
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23012"
FT                   /db_xref="GOA:A1REB7"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REB7"
FT                   /protein_id="ABM23012.1"
FT                   /translation="MAVIKCKPTSPGRRHVVKVVNTDLHKGKPFAGLLAKKSKSGGRNN
FT                   TGRITVRHVGGGHKQHYRLIDFKRDKDGIPAKIERLEYDPNRTANIALVLYADGERRYI
FT                   LAAKGMQAGDKIQSGVEAEIKTGNAMPLRNIPVGSVVHAVEMKPGKGAQIARSAGAYVQ
FT                   VVARDGAYATLRLRSGEMRKVPVDCRATFGEVGNAEHMLRQLGKAGAKRWRGIRPTVRG
FT                   VAMNPVDHPHGGGEGRTSGGRHPVTPWGVPTKGYKTRSNKRTDKYIVRRRNK"
FT   gene            193108..193386
FT                   /locus_tag="Sputw3181_0160"
FT   CDS_pept        193108..193386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0160"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: shm:Shewmr7_0198 ribosomal protein
FT                   S19"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23013"
FT                   /db_xref="GOA:A1REB8"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REB8"
FT                   /protein_id="ABM23013.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEKAMEAGDKKPIKTWSRRSMIIPNMI
FT                   GLTIAVHNGRQHVPVFVTDEMIGHKLGEFSPTRTYRGHAADKKAKKR"
FT   gene            193402..193734
FT                   /locus_tag="Sputw3181_0161"
FT   CDS_pept        193402..193734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0161"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: shm:Shewmr7_0199 ribosomal protein
FT                   L22"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23014"
FT                   /db_xref="GOA:A1REB9"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REB9"
FT                   /protein_id="ABM23014.1"
FT                   /translation="MEVLAKHRFARTSAQKARLVADQIRGLPVAKALEILTFSPKKAAV
FT                   LVKKVLDSAIANAEHNEGADIDELKVGAVFVDEGPTMKRIMPRAKGRADRIMKRTSHIT
FT                   VVVSDR"
FT   gene            193744..194436
FT                   /locus_tag="Sputw3181_0162"
FT   CDS_pept        193744..194436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0162"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="KEGG: shm:Shewmr7_0200 ribosomal protein S3;
FT                   TIGRFAM: ribosomal protein S3; PFAM: ribosomal protein
FT                   S3-C-terminal domain protein; KH, type 2 domain protein;
FT                   Ribosomal protein S3, N-terminal domain; SMART: KH domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23015"
FT                   /db_xref="GOA:A1REC0"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REC0"
FT                   /protein_id="ABM23015.1"
FT                   /translation="MGQKVHPNGIRLGITKPWISTWYADKSDYANNLNSDWEVRKFLVE
FT                   KLQAASVSKIVIERPAKSIRVTIHTARPGVVIGKKGEDVEVLRAAVSKLAGTPAQINIA
FT                   EIRKPELDAKLVADSIAQQLERRVMFRRAMKRAVQNAMRIGAQGIKVQVSGRLGGAEIA
FT                   RDEWYREGRVPLHTLRADIDYSTSESHTQYGVIGVKVWIFKGEVLDGMLPQIEEPKQQQ
FT                   PKRKPRGK"
FT   gene            194448..194858
FT                   /locus_tag="Sputw3181_0163"
FT   CDS_pept        194448..194858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0163"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="PFAM: ribosomal protein L16; KEGG: shm:Shewmr7_0201
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23016"
FT                   /db_xref="GOA:A1REC1"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REC1"
FT                   /protein_id="ABM23016.1"
FT                   /translation="MLQPKRMKFRKMFKGRNRGLANGTEVSFGTFGLKAVGRGRLTARQ
FT                   IESARRAMTRHIKRQGQIWIRVFPDKPITSKPLEVRMGKGKGNVEYWVCQIQPGKVLYE
FT                   MNGVSEVIAREAFALAAAKLPIKTTFVTKTVM"
FT   gene            194858..195049
FT                   /locus_tag="Sputw3181_0164"
FT   CDS_pept        194858..195049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0164"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: ribosomal protein L29; KEGG: shm:Shewmr7_0202
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23017"
FT                   /db_xref="GOA:A1REC2"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REC2"
FT                   /protein_id="ABM23017.1"
FT                   /translation="MKASELREKSVEELNAELLGLLREQFNLRMQHATGQLTQTHQLKL
FT                   VRRNIARVKTIITSKAGA"
FT   gene            195049..195297
FT                   /locus_tag="Sputw3181_0165"
FT   CDS_pept        195049..195297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0165"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="PFAM: ribosomal protein S17; KEGG: shm:Shewmr7_0203
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23018"
FT                   /db_xref="GOA:A1REC3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REC3"
FT                   /protein_id="ABM23018.1"
FT                   /translation="MSDKIRTLQGRVTSNKMDKSITVAIERQVKHPIYGKYIKRTTKIH
FT                   AHDETNQCNEGDLVAIRECRPLSKTKSWTLVEVVSKA"
FT   gene            195476..195844
FT                   /locus_tag="Sputw3181_0166"
FT   CDS_pept        195476..195844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0166"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: shm:Shewmr7_0204 ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23019"
FT                   /db_xref="GOA:A1REC4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REC4"
FT                   /protein_id="ABM23019.1"
FT                   /translation="MIQMQSTLDVACNSGARRVQCIKVLGGSHRRYAGIGDIIKVSVKE
FT                   AIPRAKAKKGDVYNAVVVRTKKGVRRPDGSVIRFDRNAAVLLNNNLQPIGTRIFGPVTR
FT                   ELRNEQFMKIVSLAPEVL"
FT   gene            195856..196170
FT                   /locus_tag="Sputw3181_0167"
FT   CDS_pept        195856..196170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0167"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="KEGG: shm:Shewmr7_0205 ribosomal protein L24;
FT                   TIGRFAM: ribosomal protein L24; PFAM: KOW domain protein;
FT                   SMART: KOW (Kyrpides, Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23020"
FT                   /db_xref="GOA:A1REC5"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REC5"
FT                   /protein_id="ABM23020.1"
FT                   /translation="MAAKIRREDEVIVLAGKDKGKRAKVSQVLPTGKLILEGINLVKKH
FT                   QKPNPQLGVAGGIVEKEAPIQASNVAIFNSATGKADRVGFRFEDGKKVRFFKSNSELVK
FT                   "
FT   gene            196183..196722
FT                   /locus_tag="Sputw3181_0168"
FT   CDS_pept        196183..196722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0168"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="PFAM: ribosomal protein L5; KEGG: son:SO0243 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23021"
FT                   /db_xref="GOA:A1REC6"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REC6"
FT                   /protein_id="ABM23021.1"
FT                   /translation="MAKLHDKYQETVVAELAKKFGYTSVMQVPRIEKITLNMGVGEAVA
FT                   DKKVMEHALRDMTAIAGQKPVVTVARKSVAGFKIREGYPIGCKVTLRGERMWEFLERLV
FT                   DIAIPRIRDFRGLSAKAFDGRGNYAMGVREQIIFPEIDYDKIDKIRGMDIVITTSAKTD
FT                   EEGRALLDAFNFPFKK"
FT   gene            196733..197038
FT                   /locus_tag="Sputw3181_0169"
FT   CDS_pept        196733..197038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0169"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="PFAM: ribosomal protein S14; KEGG: shm:Shewmr7_0207
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23022"
FT                   /db_xref="GOA:A1REC7"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REC7"
FT                   /protein_id="ABM23022.1"
FT                   /translation="MAKTSMKAREVKRAQLVAKYAEKRAALKAIIVSPASSDEDRWDAV
FT                   LKLQALPRDSSASRKRNRCNQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW"
FT   gene            197063..197455
FT                   /locus_tag="Sputw3181_0170"
FT   CDS_pept        197063..197455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0170"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="PFAM: ribosomal protein S8; KEGG: shm:Shewmr7_0208
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23023"
FT                   /db_xref="GOA:A1REC8"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REC8"
FT                   /protein_id="ABM23023.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAANKVSVKMPSAKLKVAIAKLLKEEGY
FT                   IADYAVADEAKPELEITLKYFQGQPVVETIQRVSRPGLRIYKGKNELPKVMGGLGVAIV
FT                   STSKGLMTDRAARLAGMGGEVICYVA"
FT   gene            197466..197999
FT                   /locus_tag="Sputw3181_0171"
FT   CDS_pept        197466..197999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0171"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="PFAM: ribosomal protein L6; KEGG: shm:Shewmr7_0209
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23024"
FT                   /db_xref="GOA:A1REC9"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REC9"
FT                   /protein_id="ABM23024.1"
FT                   /translation="MSRVAKAPVSIPAGVEVTLNEQTLTVKGAKGSLTRVINNAVNVVI
FT                   EDGVVKFLPVEGVVNAWAQAGTTRALVNNMVVGVSQGFERKLKLVGVGYRAKLVGADID
FT                   LTLGFSHPLVHKLPAGVTAECPSQTDIVLRGVDKQLIGQVAAEIRGYRPPEPYKGKGVR
FT                   YDDEEVRRKEAKKK"
FT   gene            198010..198360
FT                   /locus_tag="Sputw3181_0172"
FT   CDS_pept        198010..198360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0172"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: shm:Shewmr7_0210 ribosomal protein
FT                   L18"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23025"
FT                   /db_xref="GOA:A1RED0"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RED0"
FT                   /protein_id="ABM23025.1"
FT                   /translation="MDKKTSRLRRAIRARKKIQELGVNRLVVHRTPRHIYAQVINPEAQ
FT                   VVAAASTVEKAVKEQLKSTGNVDAAKAVGKFVAERAIEKGVTSVAFDRSGFKYHGRVAA
FT                   LADAAREAGLQF"
FT   gene            198373..198876
FT                   /locus_tag="Sputw3181_0173"
FT   CDS_pept        198373..198876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0173"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5-like; KEGG:
FT                   shm:Shewmr7_0211 ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23026"
FT                   /db_xref="GOA:A1RED1"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RED1"
FT                   /protein_id="ABM23026.1"
FT                   /translation="MAKLEAQQKDDLQEKLIAVNRVSKVVKGGRIFSFTALTVVGDGNG
FT                   KIGYGYGKAREVPAAIQKAMEKARRNMVTVELNAGTLHHPVKGRHTGSRVYMQPASQGT
FT                   GIIAGGAMRAVLEVAGVHNVLSKAYGSTNPINIVRATVDALVHMKSPSQIAAKRGLNVD
FT                   EIRG"
FT   gene            198883..199065
FT                   /locus_tag="Sputw3181_0174"
FT   CDS_pept        198883..199065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0174"
FT                   /product="LSU ribosomal protein L30P"
FT                   /note="PFAM: ribosomal protein L30; KEGG: son:SO0249 50S
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23027"
FT                   /db_xref="GOA:A1RED2"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RED2"
FT                   /protein_id="ABM23027.1"
FT                   /translation="MATKTVKVTQTKSGIGRLPKHRATLTGLGLRRIGHTVELEDTPSV
FT                   RGMINKVYYMVKVED"
FT   gene            199069..199503
FT                   /locus_tag="Sputw3181_0175"
FT   CDS_pept        199069..199503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0175"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="PFAM: ribosomal protein L15; KEGG: shm:Shewmr7_0213
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23028"
FT                   /db_xref="GOA:A1RED3"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RED3"
FT                   /protein_id="ABM23028.1"
FT                   /translation="MRLNTLSPAAGSKHAPKRVGRGMGSGLGKTAGRGHKGQKSRSGGG
FT                   VRPGFEGGQMPLKIRLPKFGFTSRRAMVTAEVRVLELAKVNGDVIDLNALKDANVITRN
FT                   IQFAKIVLSGTIERPVTVKGLKVTKGARAAIEAAGGKIEE"
FT   gene            199511..200851
FT                   /locus_tag="Sputw3181_0176"
FT   CDS_pept        199511..200851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0176"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: son:SO0251 preprotein translocase, SecY
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23029"
FT                   /protein_id="ABM23029.1"
FT                   /translation="MAKPGLDLKSAKGGFSELKARLLFVIGAIIVFRAGSFVPIPGIDA
FT                   AVLAELFAQQSGTILSMFNMFSGGALERASIFALGIMPYISASIIMQLLTVVHPALAEL
FT                   KKEGESGRKKISQYTRWGTLVLGTFQSVGIATGLPNLVPGLVVNIGFGFYFVAVVSLVT
FT                   GTMFLMWLGEQITERGIGNGISILIFAGIVAGLPSAIGQTAEQARQGDLNVLVLLLLAV
FT                   IVFAVTYFVVFVERGQRRIVVNYAKRQQGRKVFAAQSTHLPLKINMAGVIPPIFASSII
FT                   LFPGTLAQWFGQNESMSWLSDFSLAVSPGQPLYSLLYAAAIIFFCFFYTALVFNPRETA
FT                   DNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAGALYITFICLIPEFMLIAWKVQFYFG
FT                   GTSLLIMVVVIMDFMAQVQTHMMSHQYESVMKKANLVNKANLDRFGR"
FT   gene            200873..200986
FT                   /locus_tag="Sputw3181_0177"
FT   CDS_pept        200873..200986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0177"
FT                   /product="LSU ribosomal protein L36P"
FT                   /note="PFAM: ribosomal protein L36; KEGG: shm:Shewmr7_0215
FT                   ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23030"
FT                   /db_xref="GOA:A1RED5"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RED5"
FT                   /protein_id="ABM23030.1"
FT                   /translation="MKVRASVKKICRNCKIVKRSGVVRVICVEPKHKQRQG"
FT   gene            201103..201459
FT                   /locus_tag="Sputw3181_0178"
FT   CDS_pept        201103..201459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0178"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="PFAM: ribosomal protein S13; KEGG: shm:Shewmr7_0216
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23031"
FT                   /db_xref="GOA:A1RED6"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RED6"
FT                   /protein_id="ABM23031.1"
FT                   /translation="MARIAGINIPDQKHTVIALTAIFGIGRTRARAICAATAIAETAKI
FT                   KELSEAQIDTLREEVAKYLVEGDLRREISMNIKRLMDLGCYRGLRHRRSLPLRGQRTKT
FT                   NARTRKGPRKPIRK"
FT   gene            201475..201867
FT                   /locus_tag="Sputw3181_0179"
FT   CDS_pept        201475..201867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0179"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="PFAM: ribosomal protein S11; KEGG: shm:Shewmr7_0217
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23032"
FT                   /db_xref="GOA:A1RED7"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RED7"
FT                   /protein_id="ABM23032.1"
FT                   /translation="MAKVPSRSPRKRVRKQVADGMAHIHASFNNTIVTITDRQGNALSW
FT                   ATSGGSGFRGSRKSTPFAAQVAAERAGAAAQDYGLKNLEVFVKGPGPGRESAIRALNAV
FT                   GYKITNITDVTPIPHNGCRPPKKRRV"
FT   gene            201900..202520
FT                   /locus_tag="Sputw3181_0180"
FT   CDS_pept        201900..202520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0180"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: shm:Shewmr7_0218 ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23033"
FT                   /db_xref="GOA:A1RED8"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RED8"
FT                   /protein_id="ABM23033.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDSKCKLETAPGQHGARK
FT                   PRLSEYGTQLREKQKVRRIYGVLEKQFRNYYKDAARLKGNTGENLLQLLETRLDNVVYR
FT                   MGFGATRAESRQLVSHKSVMVNGRVVNIPSFKVSANDVVSIREKSRTQARIKAALEVAA
FT                   QREKPTWVEVDSAKMEGAFKRVPERSDLSAEINEQLIVELYSK"
FT   gene            202545..203534
FT                   /locus_tag="Sputw3181_0181"
FT   CDS_pept        202545..203534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0181"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: shm:Shewmr7_0219 DNA-directed RNA polymerase,
FT                   alpha subunit; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase, alpha subunit domain
FT                   protein; RNA polymerase, dimerisation; RNA polymerase,
FT                   insert; SMART: RNA polymerase, RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23034"
FT                   /db_xref="GOA:A1RED9"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RED9"
FT                   /protein_id="ABM23034.1"
FT                   /translation="MQGSVTEFLKPRLVDIEQVNSTRAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIDGVLHEYSSKEGVQEDILEILLNLKGLAVTIEGKDEAMLTLSK
FT                   SGAGPVIAADITHDGDVTIVNPDHVICHLTGNNDISMRIRVERGRGYVPASARAQTEDD
FT                   DRPIGRLLVDASFSPVARIAYNVEAARVEQRTDLDKLVIDMTTNGTIDPEEAIRRSATI
FT                   LAEQLDAFVELRDVTEPELKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLV
FT                   QRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASLADDL"
FT   gene            203575..203970
FT                   /locus_tag="Sputw3181_0182"
FT   CDS_pept        203575..203970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0182"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="PFAM: ribosomal protein L17; KEGG: son:SO0257 50S
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23035"
FT                   /db_xref="GOA:A1REE0"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REE0"
FT                   /protein_id="ABM23035.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNMASSLVRHEIIKTTVAKAKELR
FT                   RVVEPLITLAKSDSVANRRLAFARTRDAEVVGKLFTELGPRYQERPGGYTRILKCGLRA
FT                   GDKAPMAYIELVGRPEAAQAVDVEAAE"
FT   gene            complement(204039..204386)
FT                   /pseudo
FT                   /locus_tag="Sputw3181_0183"
FT   gene            complement(204640..205128)
FT                   /locus_tag="Sputw3181_0184"
FT   CDS_pept        complement(204640..205128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0184"
FT                   /product="CcmE/CycJ protein"
FT                   /note="PFAM: CcmE/CycJ protein; KEGG: son:SO0259 cytochrome
FT                   c biogenesis protein CcmE"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23036"
FT                   /db_xref="GOA:A1REE1"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REE1"
FT                   /protein_id="ABM23036.1"
FT                   /translation="MNPRRKKRLTLAVALIGGVAAIASLLLYALNSNLNLFYTPSEIVN
FT                   GKTDTGVKPDVGQRIRVGGMVTVGSMVRDPDSLHVQFAVHDSLGGEILVTYDDLLPDLF
FT                   REGQGIVAQGVLTAEGKLEATEVLAKHDENYMPPEVAEAMGQKHEKLDYSQQKAPDTK"
FT   sig_peptide     complement(205039..205128)
FT                   /locus_tag="Sputw3181_0184"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.850 at
FT                   residue 30"
FT   gene            complement(205125..205325)
FT                   /locus_tag="Sputw3181_0185"
FT   CDS_pept        complement(205125..205325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0185"
FT                   /product="Heme exporter protein D (CcmD)"
FT                   /note="PFAM: Heme exporter protein D (CcmD); KEGG:
FT                   shm:Shewmr7_0223 heme exporter protein D (CcmD)"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23037"
FT                   /protein_id="ABM23037.1"
FT                   /translation="MQFDSISDFFNMGGYAFYVWLSYGVTFFCLSVLIITSARQKRKVL
FT                   IEIAKKMNREERLKETRSTKS"
FT   gene            complement(205325..206071)
FT                   /locus_tag="Sputw3181_0186"
FT   CDS_pept        complement(205325..206071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0186"
FT                   /product="heme exporter protein CcmC"
FT                   /note="TIGRFAM: heme exporter protein CcmC; PFAM:
FT                   cytochrome c assembly protein; KEGG: son:SO0261 heme
FT                   exporter protein CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23038"
FT                   /protein_id="ABM23038.1"
FT                   /translation="MWKWLHPYADPERAYKLSGTLFPWFAILACLFIAVGTIWGLIFAP
FT                   TDYQQGDSYRIIFIHVPAASMSMAAYMGMATAAFIGLVWQVKLADWAAASIAPIGAVIT
FT                   FIALFTGAAWGKPMWGTWWVWDARLTSELVLLFLYLGVISLYASFEDKVLAARAAGILA
FT                   IVGVINIPIIKYSVEWWSSLHQPSTIRITEKSTMPAEMLYPLLINILGFGLMIGAITIV
FT                   RFKAEILARNGMRPWVRELAKAEEVK"
FT   gene            complement(206073..206759)
FT                   /locus_tag="Sputw3181_0187"
FT   CDS_pept        complement(206073..206759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0187"
FT                   /product="heme exporter protein CcmB"
FT                   /note="TIGRFAM: heme exporter protein CcmB; PFAM:
FT                   cytochrome c-type biogenesis protein CcmB; KEGG: son:SO0262
FT                   heme exporter protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23039"
FT                   /protein_id="ABM23039.1"
FT                   /translation="MKRGISFTQAFFTLLQRDLKIAVRHRGDIFNPLLFFIMVVTLFPL
FT                   GIGPEPQMLARVAPGIIWVAALLASMLSLERLFKADFSDGSLEQMLLSPQPLSILVLAK
FT                   VLAHWILTGVPLIIIAPLLAVLLNLDTNSYGALIATLTLGTPVLSLLGAIGVALTVGLR
FT                   KGGVLLSLLILPLYIPVLIFATSAIDAAGMNLPYDGQLAIIGAMLIGSLTLAPFAIGAS
FT                   LRVSTN"
FT   gene            complement(206771..207421)
FT                   /locus_tag="Sputw3181_0188"
FT   CDS_pept        complement(206771..207421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0188"
FT                   /product="heme exporter protein CcmA"
FT                   /note="KEGG: shm:Shewmr7_0226 heme exporter protein CcmA;
FT                   TIGRFAM: heme exporter protein CcmA; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23040"
FT                   /protein_id="ABM23040.1"
FT                   /translation="MTNITSVNTLVSASKLTCIREERILFDELSFNINAGDIVQIEGPN
FT                   GAGKTSLLRILAGLSRPYAGQTFYLSEDINRCRDEYNEDLLYLGHLAGVKCELTAEENL
FT                   NFNLRISGYDEFDTASILAKVNLTGFEEALAGHLSAGQHRRTALARLWHSNCKIWILDE
FT                   PFTAIDKKGVEELEQLFIEHADNGGCVILTTHQDMSIITDDRLRKIRLDYRFI"
FT   gene            207742..208041
FT                   /locus_tag="Sputw3181_0189"
FT   CDS_pept        207742..208041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0189"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: shm:Shewmr7_0227
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23041"
FT                   /protein_id="ABM23041.1"
FT                   /translation="MKKLLAMTAVAALTMSVNVSAQEAEAIYNKACTVCHSMGVAGAPK
FT                   THNTAEWEPRLAKGIDTLLHSVKTGLNAMPPGGMCTDCTDDDYKAAIQFMSTAK"
FT   sig_peptide     207742..207807
FT                   /locus_tag="Sputw3181_0189"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.989 at
FT                   residue 22"
FT   gene            complement(208103..209350)
FT                   /locus_tag="Sputw3181_0190"
FT   CDS_pept        complement(208103..209350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0190"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: son:SO0265
FT                   cytochrome c-type biogenesis protein CcmH"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23042"
FT                   /protein_id="ABM23042.1"
FT                   /translation="MTTFWIFIALVVLVSLTLIWIPHFRQQKLLRTEEAGVRKQTNLEL
FT                   FNERLATLEKELSEELLDQTEFDALKKELEISLLQDIKQAGDDSLVNQIKPKTILWPSI
FT                   MSVGLLAISGYLYQHLGAFENIGTAQPANPHAGMDTAQIMGQRIQAIEAQVQAEPENSQ
FT                   AWFSLGHAYISANQFDKAIAAFDKVMELVGKHAELLGPKATAMYYKAGQQMTPQIQAII
FT                   DESLAMDPQDPSTLLLVGMNSFFLADYKKAITSWQTILDSDRTDVDRAALMNAIETANL
FT                   RMQAETTGMPDDDVHKQAAVGKKSVSIAISISPELAAKASPEDTIFVFARATEGPKVPL
FT                   AATKVSASALPVTVTLDDSTGMGGDAKLSQATSVEVIAVLSKHGNIKPQAGDIQGKISK
FT                   VIVGETANLVLDTQVQ"
FT   gene            209747..211726
FT                   /locus_tag="Sputw3181_0191"
FT   CDS_pept        209747..211726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0191"
FT                   /product="cytochrome c-type biogenesis protein CcmF"
FT                   /note="TIGRFAM: cytochrome c-type biogenesis protein CcmF;
FT                   PFAM: cytochrome c assembly protein; KEGG: shm:Shewmr7_0229
FT                   cytochrome c-type biogenesis protein CcmF"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23043"
FT                   /protein_id="ABM23043.1"
FT                   /translation="MIPELGHFSLIIGVAFAFLLVSVPLIGVARKDQYLVRYAWPLAYG
FT                   MFFFISLSVVSLGYSFAVDDFSVAYVAHHSNSQLPIFFKIAAVWGGHEGSLLFWVFSLA
FT                   TWAASVALFSKGLEEVFTARVLAVLAVIVIGFSLFMLLTSSPFERLFPMPAEGRDLNPM
FT                   LQDVGLIFHPPMLYLGYVGFSVSFAFAIAALMSGRLDSAWARWSRPWTLAAWVFLTGGI
FT                   SLGSWWAYYELGWGGWWFWDPVENASFMPWLVGTALVHSLIVTEKRGAFRNWTVLLSIF
FT                   AFSLSLLGTFIVRSGVLTSVHSFAADPSRGMFILLLLGLAIGGSLTLFAFRASEMSSPA
FT                   RFELKSKETMLLICNVLLTVATGTVLLGTLYPLLIDALGMGKISVGPPYFNAVFVPIVL
FT                   VLFAFMGVGPIIRWKKSKAGELRRQLLIPALISVAIGIVTPFIVDGAFNAWVAFGIAAA
FT                   VWIILATARAAYNIVKPKEGDISVARMGRSQFGMILAHFGIAVSVIGATMVSNYSVEKS
FT                   VRMGPGVSQELAGYTFKYLETKNVVGPNYTAQQGQIEIYKDDKLLTLLKPDRRQYNVRT
FT                   MDMTEAGIDWGLFRDLYVTMGDPISATEFAVRLNYKPFVRWLWFGSIFMMIGGFFAASD
FT                   KRYRSKVAAIVKPQVDKAKLATAQ"
FT   gene            211738..212292
FT                   /locus_tag="Sputw3181_0192"
FT   CDS_pept        211738..212292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0192"
FT                   /product="periplasmic protein thiol--disulphide
FT                   oxidoreductase DsbE"
FT                   /note="TIGRFAM: periplasmic protein thiol--disulphide
FT                   oxidoreductase DsbE; PFAM: Redoxin domain protein; KEGG:
FT                   son:SO0267 thiol:disulfide interchange protein DsbE"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23044"
FT                   /protein_id="ABM23044.1"
FT                   /translation="MKKLVLFIPLVLFLAMGVFLYKGLFLNPQKLDSALEGKPIPAFQL
FT                   ERLETPDELITNEQLKGKVALLNVWATWCPSCKYEHPFLNMLSRKNILPIYGINYRDER
FT                   APAIAELRRQGDPYTLNIFDKDGRLGLDLGVYGAPESFIVDHNGIIRFRYAGPIDQNVW
FT                   SETLFPMIQQLQAEAAKDNVS"
FT   sig_peptide     211738..211806
FT                   /locus_tag="Sputw3181_0192"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.841) with cleavage site probability 0.386 at
FT                   residue 23"
FT   gene            212289..212768
FT                   /locus_tag="Sputw3181_0193"
FT   CDS_pept        212289..212768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0193"
FT                   /product="cytochrome C biogenesis protein"
FT                   /note="PFAM: cytochrome C biogenesis protein; KEGG:
FT                   son:SO0268 cytochrome c-type biogenesis protein CcmH"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23045"
FT                   /protein_id="ABM23045.1"
FT                   /translation="MKILLKLVSGLVLVLSMVTSAIATPVDTYEFKSPDNQKRALSLAH
FT                   SLRCPQCQNQNLIDSNSPVASDLRLEVFKMVDEGKGDDEIIEFMTSRYGEFVLYKPKME
FT                   AKTYILWLGPIGLLIIGLAIGYIFIRKQRISGNTPQEISAEDQQALDALLKRNSK"
FT   sig_peptide     212289..212360
FT                   /locus_tag="Sputw3181_0193"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.933 at
FT                   residue 24"
FT   gene            212765..213352
FT                   /locus_tag="Sputw3181_0194"
FT   CDS_pept        212765..213352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0194"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: shm:Shewmr7_0232
FT                   redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23046"
FT                   /protein_id="ABM23046.1"
FT                   /translation="MKHKLAIAFMLSSILLGFTVGVVHAYPGMQQGTNPVTSTIDLISV
FT                   LPKAFPIEPAPFNDVDGKSIDFSQYKGKVVMVNVWATWCPPCVRELPAIERLATKFKAE
FT                   DFALLPISIDADGKQQVQPFLNTLGMAGFNSYYDPEQNLGQVFPLDTIPATFILDQNGQ
FT                   LIAFVRSFVDWDDAKAVTLIQGFIDKGHAKPD"
FT   sig_peptide     212765..212842
FT                   /locus_tag="Sputw3181_0194"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            213887..215421
FT                   /locus_tag="Sputw3181_R0008"
FT   rRNA            213887..215421
FT                   /locus_tag="Sputw3181_R0008"
FT                   /product="16S ribosomal RNA"
FT   gene            215901..218793
FT                   /locus_tag="Sputw3181_R0009"
FT   rRNA            215901..218793
FT                   /locus_tag="Sputw3181_R0009"
FT                   /product="23S ribosomal RNA"
FT   gene            218976..219091
FT                   /locus_tag="Sputw3181_R0010"
FT   rRNA            218976..219091
FT                   /locus_tag="Sputw3181_R0010"
FT                   /product="5S ribosomal RNA"
FT   gene            219128..219204
FT                   /locus_tag="Sputw3181_R0011"
FT   tRNA            219128..219204
FT                   /locus_tag="Sputw3181_R0011"
FT                   /product="tRNA-Asp"
FT   gene            219543..220055
FT                   /locus_tag="Sputw3181_0195"
FT   CDS_pept        219543..220055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23047"
FT                   /protein_id="ABM23047.1"
FT                   /translation="MLYDLTVVQFSKMLKNLSVILEKGECFANLKKVDMAVLLNSRLAP
FT                   DQFNLIRQVQIACDTAKIGVARLTDNLDTVPKHDDSETTLAELQARISSVLDYLATFKA
FT                   EDFANAAAIHVSQPRWEGKYLTGYEFAIEHAIPNIYFHITTAYAILRHNGVEIGKKDYL
FT                   GAMPYKS"
FT   gene            220466..220675
FT                   /locus_tag="Sputw3181_0196"
FT   CDS_pept        220466..220675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0196"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23048"
FT                   /protein_id="ABM23048.1"
FT                   /translation="MSIESHVIESPTGVTVTDLPMKSKKAKKVAIASGLRIKDKLTQDT
FT                   RRRIEILHEQRQLSNRFGVDIEID"
FT   gene            221141..222544
FT                   /locus_tag="Sputw3181_0197"
FT   CDS_pept        221141..222544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0197"
FT                   /product="anion transporter"
FT                   /note="TIGRFAM: anion transporter; PFAM: sodium/sulphate
FT                   symporter; KEGG: bsu:BG12951 similar to
FT                   2-oxoglutarate/malate translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23049"
FT                   /protein_id="ABM23049.1"
FT                   /translation="MNKKIISWLIILAVGGGIWLTPVPAGVDPTAWHLLAIFAATVLGL
FT                   ILEPIPMGAVAIGGITITALTGTLTIKDSLTGFSNDVIWLIVTAFFISRAFIKSGLGAR
FT                   IGFVFMRLLGKKTLSLSYGLLLTDLILAPAIPSNTARTGGIVFPLANSVADAYGSKAEE
FT                   GTSGKLGSFLMTTVFHGTTITGAMFLTGMAANPLAAKLAADMGVEITWGQWALAALVPG
FT                   IIALILMPLFAYMLNKPSITSTPQAPQIAAKALADMGKMKLTEWVTLGTFIALIALWIG
FT                   GPALGVSGTTAAMVGLIILVTANVLSWDDVLKEKGAWNTLVWFSALVMMATFLNKLGLI
FT                   TWFGTNIATNLSGLDWPVALFSLVLIYFYIHYAFASATAHVAALYSVFLAVAIQLGAPG
FT                   LLAALIFGFTSNLYACGTHYGTGPAPILFGAGHVSLPKWWSVGFAMGLLQIAIWTLVGG
FT                   IWWKVIGLY"
FT   sig_peptide     221141..221224
FT                   /locus_tag="Sputw3181_0197"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.968) with cleavage site probability 0.831 at
FT                   residue 28"
FT   gene            222612..224120
FT                   /locus_tag="Sputw3181_0198"
FT   CDS_pept        222612..224120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0198"
FT                   /product="fumarase"
FT                   /EC_number="4.2.1.2"
FT                   /note="TIGRFAM: hydro-lyases, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit; hydro-lyases, Fe-S type,
FT                   tartrate/fumarate subfamily, beta subunit; PFAM: Fe-S type
FT                   hydro-lyases tartrate/fumarate alpha region; Fe-S type
FT                   hydro-lyases tartrate/fumarate beta region; KEGG:
FT                   ppr:PBPRA2409 putative fumarate hydratase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23050"
FT                   /protein_id="ABM23050.1"
FT                   /translation="MTTIKKVDFIDSIEDALQYISYYHPLDFIRAMEKAYHAEKSVAAK
FT                   DAIAQILINSRMAAEGKRPICQDTGIVTCFVKIGMQVQWDTDMTVQEMVDEGTKRAYNC
FT                   VTNPLRMSVVSDPAGARKNTNTNGPAVVHIEMVLGDKVDIMIAAKGGGSENKTKMAMLN
FT                   PSDDIAAWVEKTVPLMGAGWCPPGMLGIGIGGTAEKAALMAKEALMGSVDIHELQARGS
FT                   QTTEEELRLDIFERVNKLGIGAQGLGGMTTVVDIKIKTAPTHAASKPVCIIPNCAATRH
FT                   VHFTLDGNGPAKLTPPKLADWPEVTWEVGKNVRRVDVNKLTKADIAEWRSGETVLLSGK
FT                   ILTGRDAAHKRIQDMLARGESFPVDFQNRFIYYVGPVDAVGDEVVGPAGPTTSTRMDKF
FT                   TDMMLEQAGLMGMIGKSERGAATVESIKKNQAVYLMAVGGAAYLVAKAIKSAKILAFED
FT                   LGMEAIYEFDVEDMPVTVAVDSLGGNVHETGPQTWKLKIAEMTA"
FT   gene            complement(224204..224881)
FT                   /locus_tag="Sputw3181_0199"
FT   CDS_pept        complement(224204..224881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0199"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; Helix-turn-helix,
FT                   type 11 domain protein; KEGG: vpa:VP1711 response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23051"
FT                   /protein_id="ABM23051.1"
FT                   /translation="MIIEDDPKASYALESIIHQHPDFEVVVVSETYQDALMHYDLYKPQ
FT                   LVFVDITLPDGSGINVIKQLRSQGANCYFIMTTAEREATTVEQVVQLGVSDYLVKPLRM
FT                   SRVRQALDDYKLYRQKLACHETMDQCVIDHILGKRTNLPMRRTPKGIDANTLDTLKDIL
FT                   RKEQLTEFSGDDISDRMNVSRITIRRYLEYLESEGVIKMVLNYKTGGRPSRVYQLIDVD
FT                   LLG"
FT   gene            complement(224871..226538)
FT                   /locus_tag="Sputw3181_0200"
FT   CDS_pept        complement(224871..226538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0200"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; KEGG: bld:BLi01245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23052"
FT                   /protein_id="ABM23052.1"
FT                   /translation="MLSTNKRFGLVKPMKFKKHLITSIFMAMVLILTIMVAATFHLLKS
FT                   THDESLKQRGLELASILALDPVVIDAVERANVTPEVSIRSYIENLRAQTSVSFIVVVNK
FT                   EGIRLSHPEESKLHHPFVGDDLKPVLSEGIKVSTFAEGSLGPAIRSFSPVMSNGKVIGA
FT                   VAVGILTKEVSLLFLQSHANLLFVVILVLTIAVLLIIVVLSKLKRTMQYLEPELVMKRL
FT                   MEHDRIFNAIHDPIISVSNDFTISAINDIATQVLPMGSMSKQDYIGQPLAHFSAALSQI
FT                   TKASHREASSERLRLGKLDYRVCIYPWQINQEQHGYVIIFLADMELNDLRKELLHYKNY
FT                   SEQLRSKTHEYSNKLNVLSGMLQLKHYDEVIEFIDRESKGHQRIIGNIVRSIHNSLVAS
FT                   ILLAKYNKATETNVKYVLDEDNNLLNYSKLVSEKLATILGNLIDNAIVAAWNNRSNVPP
FT                   EVQVYVSDRSQHIILEVQDSGSGVIPEIADTIFDFGVTSKTDQEQSGIGLYLVNELVKQ
FT                   FSGSLDWERTEDNTTLFSIYIEKSEVKRYEAESHHHDY"
FT   sig_peptide     complement(226404..226538)
FT                   /locus_tag="Sputw3181_0200"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.349 at
FT                   residue 45"
FT   gene            complement(226722..227087)
FT                   /locus_tag="Sputw3181_0201"
FT   CDS_pept        complement(226722..227087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0201"
FT                   /product="succinate dehydrogenase subunit D"
FT                   /EC_number="1.3.5.1"
FT                   /note="PFAM: fumarate reductase, D subunit; KEGG:
FT                   vfi:VF2337 fumarate reductase, 13 kDa hydrophobic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23053"
FT                   /db_xref="GOA:A1REF8"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REF8"
FT                   /protein_id="ABM23053.1"
FT                   /translation="MINYSPKRSDEPIWWGLFGAGGVWFAMITPVTVLLMGILLPLHGF
FT                   GVVDIGYDKVYAFVSHPIGGAFTVLSLSLPMWHAMHRVHHGLHDLQIHLGTVGKYACYL
FT                   AAALVTVLATVWVIQLS"
FT   gene            complement(227100..227483)
FT                   /locus_tag="Sputw3181_0202"
FT   CDS_pept        complement(227100..227483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0202"
FT                   /product="fumarate reductase, subunit C"
FT                   /note="PFAM: fumarate reductase, subunit C; KEGG:
FT                   vch:VC2658 fumarate reductase, 15 kDa hydrophobic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23054"
FT                   /protein_id="ABM23054.1"
FT                   /translation="MQNRKPYVRPMQRTWWSENNFFSWYMVRELTIVPLILFTLNLCAG
FT                   LFALVSSSDAWNNWLYFSSHPVMLLINVLALIGALYHAKTFFGMMPQVMPIKLGEKVVP
FT                   TGAIVTVQWLLLVLVSLVAIACI"
FT   gene            complement(227485..228225)
FT                   /locus_tag="Sputw3181_0203"
FT   CDS_pept        complement(227485..228225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0203"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: vpa:VP2841 fumarate reductase, iron-sulfur
FT                   protein; TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: ferredoxin; 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23055"
FT                   /protein_id="ABM23055.1"
FT                   /translation="MTEHNIQTVNILRYDPERDNEPFLETFKVPADNTTSIQDALTYIK
FT                   DHMDKSLSYRWSCRMAICGSCGVMVNKVPKLACKTFLRDYPEGITLEPLANFAIEKDLV
FT                   VDKAPFLERLEAMKPYIIGNDRKPEDGPNRQTPAQMAKYKQFAGCINCGLCYAACPQFG
FT                   LNPEFIGPAAITLAHRYNLDSRDLGKVERMKLINGKDGAWGCTFVGYCSKVCPKHVDPA
FT                   AAVNQSKVESAKDFLINMITTKEA"
FT   gene            complement(228225..230000)
FT                   /locus_tag="Sputw3181_0204"
FT   CDS_pept        complement(228225..230000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0204"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: vfi:VF2334 fumarate reductase flavoprotein
FT                   subunit; TIGRFAM: fumarate reductase, flavoprotein subunit;
FT                   succinate dehydrogenase or fumarate reductase, flavoprotein
FT                   subunit; PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23056"
FT                   /protein_id="ABM23056.1"
FT                   /translation="MKTITTDVAVIGAGGAGLRAAIAAAEANPKLSIALISKVYPMRSH
FT                   TVAAEGGSAAVIKDEDSLDNHFNDTVAGGDWLCEQDVVEYFVENALREMTQLELWGCPW
FT                   SRKPNGEINVRRFGGMKIERTWFAADKTGFHMLHTLFQTSMKYSNIVRYDEFFVLDLIV
FT                   VDNEVQGVIALCIAEGELVCFKAKSVILATGGGGRVYHFNTNGGIVTGDGMAIAYRHGV
FT                   PLRDMEFVQYHPTGLPGTGILMTEGCRGEGGIMVNKDGYRYLQDYGLGPETPVGQPQNK
FT                   YMELGPRDKVSQAFWHEQRKGNTIKHPLGDVVHLDLRHLGEDYLKERLPFICELAKAYV
FT                   NVDPAKEPIPIRPTAHYTMGGLETDPQTETQIKGLFAVGECSSVGLHGANRLGSNSLAE
FT                   LVVFGRLAGETAAKRAAEFQGWNYDAINEQAAAVEARLDALLAQKGTENWSDVRTEMCK
FT                   SMESGCGIYRDEAGMQATIDKLAELRLRYKNIQITDKGKVFNTDLLYAIEVGFSLDVAE
FT                   AMAHSAIQRRESRGAHQRLDEGCNSRNDKDYLKHSLALYNPNSVPTIKYSEVKITKSQP
FT                   QARLYGDAAKQQEKV"
FT   sig_peptide     complement(229929..230000)
FT                   /locus_tag="Sputw3181_0204"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.411 at
FT                   residue 24"
FT   gene            complement(230316..230792)
FT                   /locus_tag="Sputw3181_0205"
FT   CDS_pept        complement(230316..230792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0205"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   son:SO4489 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23057"
FT                   /protein_id="ABM23057.1"
FT                   /translation="MKVIDLKSAPQHIPQLAEWHHQAWAHLSSADASVTTLIEEMNEYL
FT                   TDAAMPKMFICEQANQVMGSSSLIAADMDSRTDLSPWLANVYVNANHRNKGLGKLLVNA
FT                   VVEHARAIGLQKIYLFTADKADFYQALGWSMISREEYKGEMVTIMEYQLTPPRR"
FT   gene            complement(230895..232211)
FT                   /locus_tag="Sputw3181_0206"
FT   CDS_pept        complement(230895..232211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0206"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; KEGG: son:SO4488 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23058"
FT                   /protein_id="ABM23058.1"
FT                   /translation="MYSLKGYLTRNLLITLTFAMVLLLYFLYQGIQVLTQDFVASRLQH
FT                   DADSLISALNHNPDGTWALTTDRLPNVYHRVNSGHYFAIQIGEQTLRSRSLFDHNVNMP
FT                   KLTAGEQHQATEFVSKEHWLMFSQAVIKDDQLVTLWVTEDISALEQTQIHFLVFASAAV
FT                   LLTIVILLMAQYQLLKRGFKPLERMPEAIRQMRTQGQEINPDQVPSEIVPLIEEIDRLV
FT                   NQLGQRVQRSRNALGNLAHEMKRPLQGLQSYLESLPPEQRSEGSKVLANLHHIIERELK
FT                   RTKIVGLSTPGRYTVLDDDLAPLIQVMQRIYPDRIIHSHYTSGLVMPFDRDDLLELLGN
FT                   LLDNACKHGRKNIEIRISQQNVPTTGYGIEVSDDGEGVSDAALSVIIERGIRLDESIQG
FT                   HGLGLSICKDIVDSYQGELGFSHAKQGGLNASVFLPLPN"
FT   gene            complement(232216..232875)
FT                   /locus_tag="Sputw3181_0207"
FT   CDS_pept        complement(232216..232875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0207"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: shm:Shewmr7_3781 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23059"
FT                   /protein_id="ABM23059.1"
FT                   /translation="MRLLLIEDDTDLVARLIPALNKAGYTVEHADNGIDGAFLGEEENF
FT                   EAVILDLGLPGKPGLQVLGQWRQKGLAMPVLILTARDAWHERVDGLKAGADDYLGKPFH
FT                   IEELLARLEVLIRRHFGRADNVLQHAGVSLDVDKQAVTNVDGAVIELTKIEYRLLHYLM
FT                   VNPSKIVSKSELSERIYEEDQIKDSNVIEVYVNRLRQRLGKDYIETRRGQGYRLKE"
FT   gene            complement(232875..233141)
FT                   /locus_tag="Sputw3181_0208"
FT   CDS_pept        complement(232875..233141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0208"
FT                   /product="Propeptide, PepSY amd peptidase M4"
FT                   /note="PFAM: Propeptide, PepSY amd peptidase M4; KEGG:
FT                   shm:Shewmr7_3780 propeptide, PepSY amd peptidase M4"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23060"
FT                   /protein_id="ABM23060.1"
FT                   /translation="MISSPSTDAHDDDLSSKVVEWVKEGKVLPFDTIMQRYESRLQGRL
FT                   LDLEVEQKHGRIIYELEILRDDGIVYEIKIDAKTGEWLKEKVD"
FT   gene            complement(233134..233697)
FT                   /locus_tag="Sputw3181_0209"
FT   CDS_pept        complement(233134..233697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0209"
FT                   /product="diheme cytochrome c"
FT                   /note="KEGG: son:SO4485 diheme cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23061"
FT                   /protein_id="ABM23061.1"
FT                   /translation="MTQQAHPISWILGSSLTAAALAIGVIGISLTLTGTGYADDGRELS
FT                   RAIPQNAEYIAECGSCHMAYPANLLPADKWRAITENLENHFGDNASVDPQVTARIEEYL
FT                   VQHAAQNGKVMKNSTPLLAGMGPQKITEQAFFIRKHDEIPRRMVQDNPKVGSFSQCSNC
FT                   HNLAEKGIFDEDTVNIPGFGRWDD"
FT   sig_peptide     complement(233581..233697)
FT                   /locus_tag="Sputw3181_0209"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.944) with cleavage site probability 0.711 at
FT                   residue 39"
FT   gene            complement(233801..234247)
FT                   /locus_tag="Sputw3181_0210"
FT   CDS_pept        complement(233801..234247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0210"
FT                   /product="cytochrome c-type protein Shp"
FT                   /note="KEGG: shm:Shewmr7_3778 cytochrome c-type protein
FT                   Shp"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23062"
FT                   /protein_id="ABM23062.1"
FT                   /translation="MNRLTRHTNKSRLAIIAISTLLLTSLSVSAVNSKVQSLPLSAERI
FT                   GTQLQRYQAQGAGPFTAAAGQKLWLQDMDGRSCASCHTAKVTDMGMHQNTRKPIDPMAP
FT                   SITADRLTDSAKIEKWFTRNCNWTFKRDCTPQEKGDALLWLSLQ"
FT   sig_peptide     complement(234155..234247)
FT                   /locus_tag="Sputw3181_0210"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.949 at
FT                   residue 31"
FT   gene            complement(234301..234888)
FT                   /locus_tag="Sputw3181_0211"
FT   CDS_pept        complement(234301..234888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0211"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: son:SO4483 cytochrome
FT                   b, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23063"
FT                   /protein_id="ABM23063.1"
FT                   /translation="MSSNTLQTIKVWDLLIRIFHWSLVGFFTLAYLTEGEDEWMTIHSY
FT                   AGYSILILLVFRLLWGVMGTHNARFSNFITRPKEVLVYLKGLITGKAKDYIGHNPAGAM
FT                   MIVALIASIAITGFSGMALYATDVYGPLATSFFATWPEGAIKEVHELFANFTVFLVVIH
FT                   VGGVIVSSLLHKENLVRAMVTGKKQRPVEQED"
FT   gene            235105..235569
FT                   /locus_tag="Sputw3181_0212"
FT   CDS_pept        235105..235569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23064"
FT                   /protein_id="ABM23064.1"
FT                   /translation="MSTAVIRAFISRNPSRKSFCIYAVLLFLTEVLIALYAPAGFIRGF
FT                   VGDVLVVILLFCMVRAVVPVDSPAEKSLAQNAGEGMKRFFQTPWLAFSVLLFAFAIEFG
FT                   QYWGLVDKLGLGGNRLARIVIGSHFDPLDLVAYFVGYLILLSCYWKSRQS"
FT   gene            235650..236153
FT                   /locus_tag="Sputw3181_0213"
FT   CDS_pept        235650..236153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23065"
FT                   /protein_id="ABM23065.1"
FT                   /translation="MQPITGFSLLTEHTDGLEPNPLKMPLYFNGQPTHTFIAGLVIEGQ
FT                   YRCVLPNKTSGYLVITSFDCPFEESTEFSLLDEGFKLIATTSLAQMYDSFLLYAHWPMT
FT                   DNRLRLHYYGQFVLDLVMTTGSSWLPFQPKLKLVEVVDPQSDPQTASSLAELAQRLARI
FT                   NNIN"
FT   gene            complement(236319..237839)
FT                   /locus_tag="Sputw3181_0214"
FT   CDS_pept        complement(236319..237839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0214"
FT                   /product="Aldehyde dehydrogenase (NAD(+))"
FT                   /EC_number="1.2.1.3"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: son:SO4480
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23066"
FT                   /protein_id="ABM23066.1"
FT                   /translation="MIYAQPGTAGAIVNFKEKYANFIGGKWIAPVNGKYFDNRSPVNGQ
FT                   NFCQIPRSDAQDIELALDAAHAAKEAWGKTSVTERSNLLLRIADRVEQNLEYLAVAETW
FT                   ENGKAVRETLNADLPLFVDHFRYFAGCIRAQEGSAADIDGNTVSYHFPEPLGVVGQIIP
FT                   WNFPLLMAAWKIAPALAAGNCVVLKPAEQTPVSILVLLELIEDLLPAGILNVVNGFGAE
FT                   AGQALATSKRIAKLAFTGSTEIGYHILKCAAESLIPSTVELGGKSPNVFFADVMDHEDE
FT                   YLNKAVEGMLLAFFNQGEVCTCPSRVLVQESIFDRFIEKVLARAQTIKQGDPLDTDTQV
FT                   GAQASKEQFDKILSYLAIGKAEGAEVLLGGTLCQLDGGQSEGYYISPTIMKGHNKMRIF
FT                   QEEIFGPVISVTTFKDEAEALAIANDTEYGLGAGVWTRDMNTAQRMGRGIQAGRVWINC
FT                   YHAYPAHAAFGGYKKSGIGRETHKMMLNHYQNTKNLLVSYDVNPLGFF"
FT   gene            238100..240001
FT                   /locus_tag="Sputw3181_0215"
FT   CDS_pept        238100..240001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0215"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; GAF domain protein;
FT                   SMART: AAA ATPase; KEGG: shm:Shewmr7_3771 GAF modulated
FT                   sigma54 specific transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23067"
FT                   /protein_id="ABM23067.1"
FT                   /translation="MTVKPHLPSTQAWLADSWQRSIGAGLSEFQLPQELRLDASELKQK
FT                   HEQYQMLIALVQSHALPLFNQLMAHSNSRLLLSDAEGYVLRHWGVSRYSTKLADVALDI
FT                   GVNWLEQHKGTNAIGTALTAKQAVSVVGEQHFIRQNRFMSCTACPIFSPQGEMLGVIDI
FT                   TSEQQRHTQQTLMLVSSLAQQVETALLCHLPDSHYRIDLAAQPNLLNSGWQGIVIADSD
FT                   GRIVGCNPMAKQLLNHAKVGDAVEQYLGDNWSRVGGFNQHLALHLQTQSLNIPSAKGRV
FT                   AISNKSLNQLGVRFRDPQLERAWQHANKVITKQIPLLVLGETGVGKEQFVKKLHAQSAR
FT                   RTEPLVAVNCAALPAELVESELFGYQAGAFTGANRTGFIGKIRQAHGGFLFLDEIGEMP
FT                   LAAQSRLLRVLQEREVVPVGSNQSFKVDIQIIAATHMDLEQQVTQGLFRQDLFYRLNGL
FT                   QVRLPALRERQDIERIIHKLHRKHRIAAQDICPELLGQMMQYDWPGNLRELDNLMQVAC
FT                   LMAEGDNTLNWQHLPDYLAAKLTCEPLKGDLLQAASLCDEFKEVSRQRSASPLPSGKLA
FT                   VEPNVTKVQSDSLNEAIYSNVLQAFQACNGNVSQCAKRLGISRNALYRKLKQMGLKA"
FT   gene            complement(240044..241393)
FT                   /locus_tag="Sputw3181_0216"
FT   CDS_pept        complement(240044..241393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0216"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: son:SO4478 sensor protein CpxA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23068"
FT                   /protein_id="ABM23068.1"
FT                   /translation="MPNRLFIKLLLGFWLCSSLIIALVGLLPLLQQKHDRAPIPPHLEN
FT                   ALSNIAIRFQENPSLFESDFLRRWERQRNMEGKPLRIYLANSEGQVINTQKISRGVRSF
FT                   MLMTDEDKRPISHQFKDELVFGPYHFNVNGETYSLYGRLPDHHPRPWFFFFVENKLLTL
FT                   SLAILLSGLLCGLLAWHLGKALNSLKKSANALAEGDLSNRVDKATTKRNDEIGQLASAF
FT                   NSMADSIETMVKNQQRLMGDISHELRTPLTRLQLSLALARKKGQQTTETDRIGYEAEQL
FT                   EKLIAELLELSRVKLNTNETKVRLGLAESLSQVLDDAEFEADQQDKKITIDIDEDIELT
FT                   HFPKSLSRAIENLLRNAIRYAKNDIYIHASATADEVYITIKDDGPGIDASELDAIFKPF
FT                   YRPDSARQRESGGWGLGLAITEAAITAHKGKIKAKNRVPHGLEVNITLPV"
FT   sig_peptide     complement(241292..241393)
FT                   /locus_tag="Sputw3181_0216"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.851) with cleavage site probability 0.391 at
FT                   residue 34"
FT   gene            complement(241408..242094)
FT                   /locus_tag="Sputw3181_0217"
FT   CDS_pept        complement(241408..242094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0217"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: son:SO4477 transcriptional
FT                   regulatory protein CpxR"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23069"
FT                   /protein_id="ABM23069.1"
FT                   /translation="MSRILLIDDDLGLSELLGQLLELEGFTLTLAYDGKKGLDLALTTD
FT                   FDLILLDVMLPKLNGFEVLRALRQHKQTPVLMLTARGDEIDRVVGLEIGADDYLPKPFN
FT                   DRELIARIRAIIRRAHLTAQEIHAAPAQEFGDLRLDPSRQEAYCNEQLIILTGTEFTLL
FT                   HTLALHAGELMNKEELNEIVLGKKLMPFDRSLDMHLSNLRKKLPERSDGRPRVKTIRGK
FT                   GYIWLP"
FT   gene            242361..242852
FT                   /locus_tag="Sputw3181_0218"
FT   CDS_pept        242361..242852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0218"
FT                   /product="protein of unknown function, Spy-related"
FT                   /note="PFAM: protein of unknown function, Spy-related;
FT                   KEGG: she:Shewmr4_0253 protein of unknown function,
FT                   Spy-related"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23070"
FT                   /protein_id="ABM23070.1"
FT                   /translation="MMKTLSPLKAGLFAILASSTVFATTVSAEPTQGCDHSRGEFHKKG
FT                   NRMEHGGMHKMFEGLDLTDAQKADIKKLFAEQKSSRSDERPTKEELLAHRNEMQAVITA
FT                   ATFDETQAKALLNARQDKRQAQAIERMKIQNQIYNLLTPEQQAKFKARFEAQAGKEPRG
FT                   "
FT   sig_peptide     242361..242447
FT                   /locus_tag="Sputw3181_0218"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.958 at
FT                   residue 29"
FT   gene            242903..243784
FT                   /locus_tag="Sputw3181_0219"
FT   CDS_pept        242903..243784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0219"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   shm:Shewmr7_3767 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23071"
FT                   /protein_id="ABM23071.1"
FT                   /translation="MTQTSQYDFWVKLASRASVATALTLIIIKLLAWLYSGSASMLASL
FT                   TDSFADALASIVNFIAIRYAIVPADQDHRYGHGKAEPLASLAQSAFIMGSAFLLLFYGG
FT                   ERLITPAPVEYATLGVVVSVVAIALTLALVMLQKRALAATNSTVVEADSLHYKSDLFLN
FT                   AAVLLALVLSQYGWWWADGLFAVLIAFYIGHQAFGLGYRSIQALLDRELDEETRQQIKQ
FT                   IAKEDPRVQGLHDLRTRQAGKTVFIQFHLELDGNLSLNEAHSIADTTGLRVKAAFEDAE
FT                   VIIHQDPVKLEE"
FT   gene            243803..244264
FT                   /locus_tag="Sputw3181_0220"
FT   CDS_pept        243803..244264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23072"
FT                   /protein_id="ABM23072.1"
FT                   /translation="MMAWMQKQSHRLDYSTKLICRYHWLSTRFELIAESLLNDVSAPED
FT                   ATLTTLAENLPMIPIPIQVDRAASPAIKRAWSQLVLRKHLYYLPQKIDINIANQSYRVH
FT                   IWPLFLWRTRITCVATGRVVVSECLDVRRRRSLIRWLYASFIGLLRVLS"
FT   gene            complement(244351..245763)
FT                   /locus_tag="Sputw3181_0221"
FT   CDS_pept        complement(244351..245763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0221"
FT                   /product="nitrogen metabolism transcriptional regulator,
FT                   NtrC, Fis family"
FT                   /note="KEGG: shm:Shewmr7_3764 nitrogen metabolism
FT                   transcriptional regulator, NtrC, fis family; TIGRFAM:
FT                   nitrogen regulation protein NR(I); PFAM: response regulator
FT                   receiver; sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23073"
FT                   /protein_id="ABM23073.1"
FT                   /translation="MRISEQVWILDDDSSIRWVLEKALQGAKLSTASFAAAESLWQALE
FT                   ISQPRVIVSDIRMPGTDGLSLLERLQIHYPHIPVIIMTAHSDLDSAVSAYQAGAFEYLP
FT                   KPFDIDEAISLVERALTHATEQSPAPVQETQVKTPEIIGEAPAMQEVFRAIGRLSRSSI
FT                   SVLINGQSGTGKELVAGALHKHSPRKDKPFIALNMAAIPKDLIESELFGHEKGAFTGAA
FT                   NVRQGRFEQANGGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGHNAVQVDVRIIAAT
FT                   HQDLELLVQKGGFREDLFHRLNVIRVHLPPLSQRREDIPQLATHFLASAAKEIGVEPKI
FT                   LTKETAAKLSQLPWPGNVRQLENTCRWLTVMASGQEILPQDLPPELLKDPVSITHATKV
FT                   GQDWQSALTEWIDQKLSEGNSDLLTEVQPAFERILLETALRHTQGHKQEAAKRLGWGRN
FT                   TLTRKLKELSMD"
FT   gene            complement(245801..246847)
FT                   /locus_tag="Sputw3181_0222"
FT   CDS_pept        complement(245801..246847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0222"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; PAS fold-4 domain protein; KEGG: shm:Shewmr7_3763
FT                   signal transduction histidine kinase, nitrogen specific,
FT                   NtrB"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23074"
FT                   /protein_id="ABM23074.1"
FT                   /translation="MDKETLLNHLVTAVLVIDKDLKPCYANAAAEQLLGVGSHRLIEQA
FT                   LPAHYQILGIDTQLLSSAVKASQGLTVNTATLVTLDGQHHTVDLTLVPLEDEAELSLLE
FT                   LRQVDQQRRIHQQLSQDAQQQAAQFLVRNLAHEIKNPLGGLRGAAQLLSRELDDPAQKE
FT                   FTTLIIEQADRLRNLVDRLLGPQRPTQHSLHNIHKVVQKVYKLVEMALPANIQLKRDYD
FT                   PSIPDIEMDPDQMQQAVLNILQNAVQALEHTGGEILIRTRTQHQVTIGSQRHKLVLTLS
FT                   IIDNGPGIPPELMDTLFYPMVTSREQGSGLGLSIAHNIARLHSGRIDCLSSAGHTEFTI
FT                   SLPILNAK"
FT   gene            complement(246969..247508)
FT                   /locus_tag="Sputw3181_0223"
FT   CDS_pept        complement(246969..247508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23075"
FT                   /protein_id="ABM23075.1"
FT                   /translation="MMRSLTLIGLLLFSMLAQATVYKWVDKDGKIHYSDEPRANAEVVE
FT                   LNEKTLNQIALPPVKIGSDNNNQVIEDIQYQINIISPEEEATVRDNNGDFEVVATVSPE
FT                   IKSQFLMQLKLNGQIIAPPQVGGRFKLTNIDRGEHTIIVDAMTQNGKVFASSSPRKIFL
FT                   HQAAMAPHPKKQPKSN"
FT   sig_peptide     complement(247449..247508)
FT                   /locus_tag="Sputw3181_0223"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            complement(247694..248056)
FT                   /locus_tag="Sputw3181_0224"
FT   CDS_pept        complement(247694..248056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0224"
FT                   /product="glutathione S-transferase-like protein"
FT                   /note="KEGG: sdn:Sden_1385 glutathione S-transferase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23076"
FT                   /protein_id="ABM23076.1"
FT                   /translation="MFGYSYLQWLHFAESSAMLPLLLRMFVQKDGCKTNFLEGYAAIEV
FT                   SKISHYFNDMLADKTYLVADKLTGADIMMSFVVELLANSGDLVKFEHIQRYAIQLSQHA
FT                   AWVKANEIEKQLDASL"
FT   gene            complement(248217..248582)
FT                   /locus_tag="Sputw3181_0225"
FT   CDS_pept        complement(248217..248582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0225"
FT                   /product="Glutathione S-transferase, N-terminal domain"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   KEGG: vvu:VV20508 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23077"
FT                   /protein_id="ABM23077.1"
FT                   /translation="MITLHHLNKSRSKRIIWLLEELGQPYEIKRYQRDSQTFLAPPELK
FT                   QIHPLGKSPVIEMDGQVIAESGAITEYLIEKYAADTLAPARDSADYVYPSYLKIRVSER
FT                   LGCFNSRRINERMSATF"
FT   gene            complement(248716..249408)
FT                   /locus_tag="Sputw3181_0226"
FT   CDS_pept        complement(248716..249408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0226"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: psb:Psyr_3319
FT                   ThiJ/PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23078"
FT                   /protein_id="ABM23078.1"
FT                   /translation="MKMNILMVLTSHDKLGDTGLKTGFWLEEFASPFYVFKDKGFDITL
FT                   ASPQGGQPPLDPKSDEPDFQTEATARFSKDPEAQALLANTTRLSAINAADYDAVFYPGG
FT                   HGPLWDLAEDKHSIALIEQFYQANKPLGLVCHAPAALLHPKTSDGKPLVSGKRVTGFSN
FT                   SEEEAVQLTHVVPFLVEDMLQKKGGNYVKGDDWTSFVVADGHLITGQNPGSSEAVAETI
FT                   VAQLNARG"
FT   gene            complement(249480..250637)
FT                   /locus_tag="Sputw3181_0227"
FT   CDS_pept        complement(249480..250637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0227"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   son:SO4469 alcohol dehydrogenase, iron-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23079"
FT                   /protein_id="ABM23079.1"
FT                   /translation="MLNFNYYNPTRIRFGKDTIAEIDSLVPSDAKVMILFGGSSARKTG
FT                   TLDEVKQSLGNRFVVEFDGIEPNPTYETLMKAVAQVREQNIDFLLAVGGGSVIDGTKFV
FT                   AAAAVFEGEPWDILTSWGAKVTQAMPFGSVLTLPATGSEMNNASVVTRKSLQAKLPFRN
FT                   DLVYPQFSILDPTKTFTLPERQVANGVVDAFVHITEQYLTYPVNAAVQDRFAEGLLQTL
FT                   IELGPQVLVQPEDYDIRANLMWVATMALNGTIGVGVPHDWATHMIGHELTALYDIDHAR
FT                   TLAIVLPALLQCTKEAKREKLLQYADRVWHINTGTDDERIDAAIAKTKAFFEAMGIPTH
FT                   LSAYDLDASLVDTVVKQLELHGMVALGEHGNIDPAMSRDILTLAL"
FT   gene            complement(250780..251388)
FT                   /locus_tag="Sputw3181_0228"
FT   CDS_pept        complement(250780..251388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0228"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG:
FT                   shm:Shewmr7_3760 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23080"
FT                   /protein_id="ABM23080.1"
FT                   /translation="MLGAMKTETQSTRQHILDIGYKLIVRKGFSCVGLSLLLQEAEVPK
FT                   GSFYHYFKSKEQFGEALITDYFEKYQLDLDTLFNNSTLTGYERLMQYWQQWLHVQTDGC
FT                   VDQKCLVVKLSAEVADLSEAMRLALLQGSAGIIDRLTTCVQVGITDKSIAEQDPQSTAE
FT                   MLYHMWLGASLMNKLGHSPAALERALVTTEAILTPKTVP"
FT   gene            complement(251670..251981)
FT                   /locus_tag="Sputw3181_0229"
FT   CDS_pept        complement(251670..251981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0229"
FT                   /product="protein of unknown function DUF1255"
FT                   /note="PFAM: protein of unknown function DUF1255; KEGG:
FT                   shm:Shewmr7_3759 protein of unknown function DUF1255"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23081"
FT                   /db_xref="GOA:A1REI6"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REI6"
FT                   /protein_id="ABM23081.1"
FT                   /translation="MSLLEQVSVSKKANIYFDGKVASRSVFLADGSKQTLGVVLPGEYE
FT                   FSTSQGEVMEVTSGRFEVLLPESTVWQEFSEGTQFELAANVSFKIRNTAIAEYCCSYL"
FT   gene            252340..254295
FT                   /locus_tag="Sputw3181_0230"
FT   CDS_pept        252340..254295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0230"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   shm:Shewmr7_3758 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23082"
FT                   /protein_id="ABM23082.1"
FT                   /translation="MGFTRKIQLISLLIVLLPLIFATAIVTYIARDELFAEAQSRLVAV
FT                   REIKQRQIVSMFQDFSDNLQAVSAVIASQKNLDTLTDIDQTLQSLNKSLGFYDLFIIRD
FT                   DGTVLYTVEKESDFGTNLRTGPFHDSGLAQLFNKALGSAGTVLLQDFSAYAPSNGQPAA
FT                   FIGQSIQFNQQRLVVAAQVSIDRINRVMQIREGMGQSGETYLIGPNNRMRSDSFLDPVN
FT                   RTVTASFAGTVAQNGVDTQAVKEALAGKTGVMQVSDYNNNPVLSAYSPVVELGLRWGLM
FT                   AEIDVSEIAAPAYRMLFIGLSVCVAALVLAFAAAKLVTGFVLKPLGGEPEDMCNLTSMI
FT                   ASGDLTHHLPHIQTDNHLMSWLARMQTKLKEIISQLVGVGHELESAAEQNSAAMSQADC
FT                   SIQMQAKETDMLATAVEEMSYAAAEISTNTMRSSDEVSACTHSSEILSQNLASTRKSLK
FT                   VTLNSFATIHQQVGSLEADSQKIGSVLAVINAIAEQTNLLSLNAAIEAARAGEHGRGFA
FT                   VVADEVRQLAVKVQLATQDIGQVLKGIQQQSGVLALHSVTCSTEASKTAEDADGMQAAV
FT                   DDIALRLETLKALMIQTATAAEEQTTVSATIAQGIAGLSVAAEENSAAISQVAASTRSL
FT                   LGLANQLGLTTAQFKV"
FT   sig_peptide     252340..252414
FT                   /locus_tag="Sputw3181_0230"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.939) with cleavage site probability 0.562 at
FT                   residue 25"
FT   gene            complement(254428..256530)
FT                   /locus_tag="Sputw3181_0231"
FT   CDS_pept        complement(254428..256530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0231"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   shm:Shewmr7_3757 protein of unknown function DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23083"
FT                   /protein_id="ABM23083.1"
FT                   /translation="MPVLQTLKLTGENERLKRQELKQYFNQTWALYESLFDLIQDDSAY
FT                   YLKAEPLRHPLIFYFGHTATFYINKLKLGKFLDERVNDNFESMFAIGVDEMSWDDLNEQ
FT                   HYPWPDVAEVRSYRQQVNAVVNRVIDEMPLTLPITQNSPAWIILMGIEHERIHLETSSV
FT                   IIRQLPLEYVAPNHLWPACQDTAPAETNSLLAVKGQKVTLGKTEQDQTYGWDNEYGHKI
FT                   FNVNDFKAAKFLVSNQEYLAFVEAGGYRSPQFWNEEGQAWLAYTQAQMPRFWRLRQDKW
FT                   WQRNLAEEIPLPLNWPVEVNQLEAKAFCNWKAEQKQSNIRLLTEAEWYILRENVPADAP
FT                   DWHEVPGNIALAYYASSCPVNRFEHNGFFDIVGNVWQWTESAIDGFDGFAVHPLYDDFS
FT                   TPTFDGKHNLIKGGSWISTGNEAIASSRYAFRRHFYQHAGFRYVESTQNPAQMAEVNVY
FT                   ETDELISQYLEFHYGAEYFGVANFCVNGVQQALSEIQLNHTTKALDIGCSVGRASFELA
FT                   KVFDHVDGIDFSARFIQQAYALTEQGEKRYTIRTEGDLQEFKSASLAKLGYELEAKKVN
FT                   FMQGDACNLKPIYTGYDLVYASNLIDRLNDPKHFLTSIAQRINHGGYLVIASPYTWLED
FT                   YTPKDKWLGGVKIKGENFTTLDGLTETLIGQFELVAVKEIPFVIRETKRKFQHSISEMT
FT                   IWRKRS"
FT   gene            256815..257684
FT                   /locus_tag="Sputw3181_0232"
FT   CDS_pept        256815..257684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0232"
FT                   /product="prolyl 4-hydroxylase, alpha subunit domain
FT                   protein"
FT                   /note="KEGG: son:SO4463 prolyl 4-hydroxylase, alpha subunit
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23084"
FT                   /protein_id="ABM23084.1"
FT                   /translation="MQQLFVQLLEERYFNRLPEALVLKFATESADFVRFWLVHCLRSMV
FT                   SERELAIALFFSAEWELEELASLKSFWGSYVVMADLQQEQSFKTQFCYFLPWLKTISPR
FT                   HADAIRVFSALLAFDRRPTSVGKKLQSATLSYTQLPVNLLDDIKRLSLPHLRPITVYGH
FT                   QGKGSVETGVRNNMHYPTPIPNDNIALACAERVIAKFAGIKLAFAEPIVVLRYETGQFY
FT                   QWHYDAIHAYTDEIQAELERFGQRSRTAILYLNDDFQGGETEFKAPYIQVKPPPVSGLL
FT                   SPLNNHYV"
FT   gene            257712..258212
FT                   /locus_tag="Sputw3181_0233"
FT   CDS_pept        257712..258212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0233"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   sdn:Sden_2169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23085"
FT                   /protein_id="ABM23085.1"
FT                   /translation="MARYSPERKEAILKKLLPPHNLTVAEVAREEGIAVQTLYHWRDIA
FT                   RKEGRPVPGKTLTADDWSAEAKLAVIIETAPLSEAEINQYCREKGLFREQVQQWKQDCL
FT                   AGFQTSEVQTKTIKQQAKADKAEIKSLQRELRYKEKALAEAAALLVLRKKLNALWGDDS
FT                   EES"
FT   gene            258218..259267
FT                   /locus_tag="Sputw3181_0234"
FT   CDS_pept        258218..259267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0234"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   sdn:Sden_2168 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23086"
FT                   /protein_id="ABM23086.1"
FT                   /translation="MPERIALIALIQEAYTQGARLYKACAETGLSKRTYRRWYREGQVQ
FT                   ADLRPTAARPEPANKLEEHERQQILSVCNQAEYASLPPSQIVPTLLDNGIYIASESSFY
FT                   RVLNAHGQLNHRGRTQAAVNRSKPLSYRADGPNQVWSWDITYLASIVKGQFYYLYLFED
FT                   IYSRKIVGYEVHEQESGEYAAALIQRCLLREQCFNTPLVLHSDNGAPMKSLTMKAKLEE
FT                   LGITASLSRPRVSNDNPFSESLFKTLKYRPQWPASGFSCLATAREWVEKFVTWYNDEHK
FT                   HSQLNFVSPGQRHALQDGAILAKRKKVLEAAKERKPMRWSTEIRNCEAVGAVTLNPDKA
FT                   PEEGVINAA"
FT   gene            259326..259472
FT                   /pseudo
FT                   /locus_tag="Sputw3181_0235"
FT   gene            259605..260000
FT                   /locus_tag="Sputw3181_0236"
FT   CDS_pept        259605..260000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23087"
FT                   /protein_id="ABM23087.1"
FT                   /translation="MTINALWIPAWYELDPSIVVGVTEEFIFHKPTTNGALRFYSGAEN
FT                   IDAVRATGAISSIYHAVLGDIESVDAQGLDYTIVLKDGRRLLVNAEEDPGLIYEWVDDS
FT                   WQPSEMTISDWQLEVKFTSLSPLTSVD"
FT   gene            260377..261231
FT                   /locus_tag="Sputw3181_0237"
FT   CDS_pept        260377..261231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0237"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: son:SO4458
FT                   carbohydrate kinase, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23088"
FT                   /protein_id="ABM23088.1"
FT                   /translation="MANILLVANLNCDRILLLDKPLKTGGRFHYQDGGQRLGGGGANTG
FT                   LGLVWAGHRVALVSQVGRDEMGDWAIAEASTQGLDCRLVQRRSGNTCEMLLVMTPDGER
FT                   TIIRPQRPIFELSVPPKWQQWDALYFNTSAEGTVSWAKTALEHCLVVAQLAKDDRPRPC
FT                   HVLLASMSDMQGRCDSAFWEYGKSIGGDSLRYFIVTDGINGANVYTKDKVQHVQAVPAK
FT                   VVDTTGAGDAYAAGLIHSLCSGQSITDAMAEGAIWAAFAVATDSSIPGDALKGYLEVKG
FT                   SLS"
FT   gene            261536..262996
FT                   /locus_tag="Sputw3181_0238"
FT   CDS_pept        261536..262996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0238"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: son:SO4457 GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23089"
FT                   /protein_id="ABM23089.1"
FT                   /translation="MGNNVWNERRKFIWLLSILLLFAFLVTSSISYKVAHDSLSQQIES
FT                   NTLPLTSDNIYSEIQQDLLRPIFISSLMAQDTFVRDWTLNHEQEPEKLIRYLKEIQEKY
FT                   GTVTSFFVSEKSRNYYHSTGILKQIQDVEPDDAWYFRVRSLPESEYYEINIDADTADRS
FT                   KTTVFVNYKVFDFEGKFIGVTGVGLAVEKVKLLVELYQKRYNRRVFFTDRLGNVTLHGD
FT                   AYDGSDSLQTSTGLEQLATRILTSPSAAFSYKKNGKTVYLNSRLVSEFKWYLIVEQEDA
FT                   PQEQDLLNTFWGNLALSLIVTMGILFISNMTLGRYQRKLEMMASTDKLTGAANRQVFEE
FT                   YFRQALDKAKLTQSPISILLLDIDHFKKVNDSYGHGMGDLVLKTMANMLRGLLQPQDIL
FT                   CRWGGEEFLILLPEMDLSRAAEFAEQIRDLISLREIKVNGLHISITASIGVAEHQAQEP
FT                   AEDLIKRADLALYQAKAAGRNQVVLNHP"
FT   sig_peptide     261536..261622
FT                   /locus_tag="Sputw3181_0238"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.974) with cleavage site probability 0.447 at
FT                   residue 29"
FT   gene            263125..263820
FT                   /locus_tag="Sputw3181_0239"
FT   CDS_pept        263125..263820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0239"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: 3-alpha; MOSC domain containing protein; KEGG:
FT                   she:Shewmr4_0269 MOSC domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23090"
FT                   /protein_id="ABM23090.1"
FT                   /translation="MSKLLINKLSGLYLGTQLQEVAGVATGIDGKQAAQQLLVHIDHVE
FT                   GDAQADPKHHGGLDRVLHHFPREHYGQYRRWDLITQFEDAPSMGENISTVGLNETQVNI
FT                   GDILQIGAVKVQVTQPRSPCFKLNLQFGHREFALAMQQSQLCGWFYRILTPGVIELHDR
FT                   IELIERRTDISVAEAMSLYFSPTFNASAYDRLASCEGLALSWINSLQRRLASQTVEDWQ
FT                   MRLYGPSGI"
FT   gene            263857..264213
FT                   /locus_tag="Sputw3181_0240"
FT   CDS_pept        263857..264213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23091"
FT                   /protein_id="ABM23091.1"
FT                   /translation="MIESVTKSDKDFGLLVYASSFIGYLVPLGSILGPLIIWLMKREES
FT                   AFVDQCGRSCLNFKLSLLIYVIISGVLAFIGIGFIFLIVLAILDLVCTVLGIIKASEGQ
FT                   VYRYPLTIKFISMD"
FT   gene            complement(264281..266197)
FT                   /locus_tag="Sputw3181_0241"
FT   CDS_pept        complement(264281..266197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0241"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: shm:Shewmr7_3750
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23092"
FT                   /protein_id="ABM23092.1"
FT                   /translation="MILNNLTIKQKILLTVTFAVLLSTILVGVLSQNSAKRVVEQRMLG
FT                   SEMPSLMMQIRNKIELDISSLMNAAEQLASSRMLLQWLENDRPQEQEAQVVAQLKDITL
FT                   QYKLAQASYADRQTAAYYTQDGFLRVLTPAQDGWFFGYRDSGQERMLNVFTEANGEVKL
FT                   FINYQQPNGRGLVGLAKSLDDMVRLLGSFKIEKTGFVYLVDAKGEVKLHPDTSQIGKST
FT                   LNNLYKDASSNSLLNRGDFNLINTKINGKDMLVASSYIASMDWYLVAQVPEAEVFALLA
FT                   DAAYQILIWTLLIAAGFIVLAIAVAGSVSRPIAQVAAMFRDIGEGEGDLRQRLPVNGED
FT                   EIAQLAKGFNSFISKIQESVIEVAQTSEQLGFSAKDVSNQAQQTLEDSHEQKDRTMMVV
FT                   TAINEMGATVNEIASNAAQAAVAARDADTEASSGQVVVTRARDTINQLSKDVGQVGEVI
FT                   ESLATHTKSIGGILDVIRAISEQTNLLALNAAIEAARAGEAGRGFAVVADEVRNLASRT
FT                   AASTNEVQGMIDKLQSEATRAVNAMAQSRTRSHEGVVAVDEASQSLVGISDRIGLISDM
FT                   NIQVAAATEEQSTVVEDINRNVTEINDITQRTANTAQAAAQASLALNQLAHRLDTLVAK
FT                   FKV"
FT   sig_peptide     complement(266102..266197)
FT                   /locus_tag="Sputw3181_0241"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.662 at
FT                   residue 32"
FT   gene            complement(266543..268192)
FT                   /locus_tag="Sputw3181_0242"
FT   CDS_pept        complement(266543..268192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0242"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; electron
FT                   transfer flavoprotein-ubiquinone oxidoreductase; KEGG:
FT                   shm:Shewmr7_3749 electron-transferring-flavoprotein
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23093"
FT                   /protein_id="ABM23093.1"
FT                   /translation="MERESMEFDVVIVGAGPAGLATACRLMQISQDSGKKITVCVVEKG
FT                   SEVGAHILSGAVFETKVLDELFSDWREKDAPIKTAVTHDEIYLLSSATDGRVMPNAFVP
FT                   KTMHNDGNFIISVGNLSRWLASRAEELGVEIFPGFAASELLFNEDNSVKGILIGDMGIG
FT                   ADGEPKDSYMPGMELHAKYTVFSEGCRGHLGKQLIEKYHLDNGKTPQHYGLGFKEIWKV
FT                   PAEQHEQGKVVHTGGWPLTEGASGGGFLYHMEDNQIAVGLIIDLNYKNPHLSPFDEFQR
FT                   YKTHPVIAKYLTGGERLSYGARAITKGGLNSLPKMSFPGGLIIGCNAGTLNFAKIKGTH
FT                   TAMKSGIVAAETLATAMMAGVEGGKDLDCYQTHFEESWLHEELYKSRNFGPAMHKFGTY
FT                   LGGAFNYIDQNWFGGKFPITLRDEHPDYAQMAPVSAYSKIDYPKPDGKLSFDKLSSVYL
FT                   SSTYHEEDQPCHLRLKDSSIPLGINLTQFNEPAQRYCPAGVYEIVEEAGQPKFVINAQN
FT                   CIHCKTCDIKDPSQNITWVTPEGGGGPNYPNM"
FT   gene            268529..269542
FT                   /locus_tag="Sputw3181_0243"
FT   CDS_pept        268529..269542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0243"
FT                   /product="GTP cyclohydrolase subunit MoaA"
FT                   /note="KEGG: she:Shewmr4_0273 molybdenum cofactor
FT                   biosynthesis protein A; TIGRFAM: molybdenum cofactor
FT                   biosynthesis protein A; PFAM: Radical SAM domain protein;
FT                   molybdenum cofactor synthesis domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23094"
FT                   /protein_id="ABM23094.1"
FT                   /translation="MLSPPTLGKVIMSQLQDSFGRKFHYLRMSVTDVCNFKCSYCLPDG
FT                   YHPDGKPKFLSLNEIENLVSAFSQVGTQKIRITGGEPTLRKDFTDIIRVVADNPRIHTV
FT                   ATTTNGYRLEKHAKEWFDAGLRRINVSVDSLDPKMFYQITGENKFDEVMRGIDAALSAG
FT                   FERVKINAVLLKGLNDKDLPRFLHWIKHTPIDLRFIELMETGLGREYFQAHHLAGADIK
FT                   AQLLADGWQFDTPSASDGPAQNFSHSDYKGRIGLIMPYANNFCATCNRLRVSAKGKLHL
FT                   CLFTESGVDLRDLLQHADQQAELIERLHGQLAQKKETHYLHQGITGVTQHLASIGG"
FT   gene            269640..270116
FT                   /locus_tag="Sputw3181_0244"
FT   CDS_pept        269640..270116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0244"
FT                   /product="GTP cyclohydrolase subunit MoaC"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: shm:Shewmr7_3747 molybdenum cofactor biosynthesis
FT                   protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23095"
FT                   /db_xref="GOA:A1REK0"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REK0"
FT                   /protein_id="ABM23095.1"
FT                   /translation="MSNVFTHINADGNAHMVDVTEKAVTEREARAEAFIEMASTTLEMI
FT                   MSGSHHKGDVFATARIAGIQAAKKTSDLIPLCHPLMLTKVEVDLEAQPEHNRVRITSLC
FT                   KLSGKTGVEMEALTAASVAALTIYDMCKAVQKDMVISQVRLLEKRGGKSGHFKV"
FT   gene            270140..270391
FT                   /locus_tag="Sputw3181_0245"
FT   CDS_pept        270140..270391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0245"
FT                   /product="molybdopterin synthase subunit MoaD"
FT                   /note="TIGRFAM: molybdopterin converting factor, subunit 1;
FT                   PFAM: thiamineS protein; KEGG: son:SO4450 molybdenum
FT                   cofactor biosynthesis protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23096"
FT                   /protein_id="ABM23096.1"
FT                   /translation="MINVLFFAQVRELLGTAKLSLEASEQTQTAEALRATLAATDDKWA
FT                   KVLTSDKLLVAVNQTISQWDTPVKDGDEVAFFPPVTGG"
FT   gene            270393..270854
FT                   /locus_tag="Sputw3181_0246"
FT   CDS_pept        270393..270854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0246"
FT                   /product="molybdopterin synthase subunit MoaE"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE; KEGG:
FT                   she:Shewmr4_0276 molybdopterin biosynthesis MoaE"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23097"
FT                   /protein_id="ABM23097.1"
FT                   /translation="MRLLPAVRVQEVDFSVSDEYRQLAQDDSDGAVVTFVGKVRDFNDG
FT                   AAVTDLTLEHYPGMTEAVLEQIVAEARSRWPLNRVTVIHRVGTMSLGEQIVFIGVTSAH
FT                   RKAAFAACEFLIDFLKTKAPFWKLEAGEQGKSWVEAKDADEQAAKLWQA"
FT   gene            270911..271723
FT                   /locus_tag="Sputw3181_0247"
FT   CDS_pept        270911..271723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0247"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; KEGG: she:Shewmr4_0277
FT                   molybdenum ABC transporter, periplasmic molybdate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23098"
FT                   /protein_id="ABM23098.1"
FT                   /translation="MVGLTRFFNSVFLSVCCLLSTLSLSIQAATNTSTASVPAIAAASD
FT                   LRFALDEISQKFTHETGLKVNISYGSSGNFATQIQNGAPFELFLSADEKYIQQLHSAGI
FT                   ARDAGVLYAQGQLAIVVPKAGSLSVDPELKGLAEALAAGKITRFAIANPDHAPYGEKAK
FT                   EALQFVQLWDAIQPKLILGENVSQAGQFAISGSTQGGIIALSLAMSPTFSKLSDYAIVP
FT                   AKMHTPLFQRMALMAKAGETAQHFYDYLRADSARRILADYGFSLPEQP"
FT   sig_peptide     270911..270997
FT                   /locus_tag="Sputw3181_0247"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.981 at
FT                   residue 29"
FT   gene            271720..272403
FT                   /locus_tag="Sputw3181_0248"
FT   CDS_pept        271720..272403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0248"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: shm:Shewmr7_3743 molybdate
FT                   ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23099"
FT                   /protein_id="ABM23099.1"
FT                   /translation="MMDWQALWLSVKLSGITVLVLIPLAILAGRALAYRQFVGKSWVEA
FT                   LIMVPLVLPPTVIGYYLLVGLGSQSWLGQWIEQVIGQQLVFHFSGLVIASVLVNIPFAV
FT                   QPIQRAFETVPNDVRDAAACCGMSRLKILLKIELPMVWPGVLTALVLCFSHVLGEFGVV
FT                   LMMGGNIAGETKTISIAIYDSVQSFDFNAAGTMSLVLLLFAVTALALTTSLSRRLGGQR
FT                   GANHR"
FT   sig_peptide     271720..271821
FT                   /locus_tag="Sputw3181_0248"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.607) with cleavage site probability 0.578 at
FT                   residue 34"
FT   gene            272384..273487
FT                   /locus_tag="Sputw3181_0249"
FT   CDS_pept        272384..273487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0249"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: shm:Shewmr7_3742 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23100"
FT                   /protein_id="ABM23100.1"
FT                   /translation="MAQIIADLQCQIQNHKHINLSADFRCKAGEVLAVVGPSGGGKTTL
FT                   LRMIAGLNHPDTGQIHFGDRPWFDDKARIALSPQQRHIGYMPQHFGLFPNLTALENVVA
FT                   GLDHIPKAERIPRAKDWLERVNLQGLPDRLPAHLSGGQRQRVALARALAREPSVLLLDE
FT                   PFSAVDRETRERLYLELARLKEQLLCPVIMVTHDLNEALLLADSMILISQGKMLQQGAP
FT                   FEVLSRPRNEAVARQMGLRNIFDGEVVFQDSTKNLTWLKFGEQLIACDYGKDRPVGSRV
FT                   RWVIPNQGIRFNSISKGRLCRSFNKLTVTIDAMLVMGESVRLICYVAGTQLQINTEVSL
FT                   HFAQKLALTKGMQTTVALKSEQIHILE"
FT   gene            273704..274225
FT                   /locus_tag="Sputw3181_0250"
FT   CDS_pept        273704..274225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23101"
FT                   /protein_id="ABM23101.1"
FT                   /translation="MRLWLLGFILVSGAVSAAQSLYSMLGSGQYQPPLKVMQQIEKDFP
FT                   GVIAEFEMEMQEGELVYQFELINPLANAITHFEYRARDGKLLKQKAGKVSADDLGEVEA
FT                   TRLITSKHQTFSGLITMAIKDHKGFLTDAKLDHDLGISYLELKLLDDTGKYKLAFDVDN
FT                   LRQLPLLKWD"
FT   sig_peptide     273704..273757
FT                   /locus_tag="Sputw3181_0250"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.859 at
FT                   residue 18"
FT   gene            274267..274944
FT                   /locus_tag="Sputw3181_0251"
FT   CDS_pept        274267..274944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0251"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: son:SO4428 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23102"
FT                   /protein_id="ABM23102.1"
FT                   /translation="MKILLVEDDATTIDYIVKGFLEQGHNIETANDGHQGLSLATSCQY
FT                   DLVILDRMLPQLDGLKLLAALRATGNQTPVLILSALAHVDERVKGLRAGGDDYMTKPFA
FT                   FSELLVRAEKLMQRGQSTPISTDLVVGGLKMELLTRNVTLDGQELMLQPKEFQLLKYLM
FT                   EHANQVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRKFEELGHGELIETVRGAGYRLR
FT                   QRH"
FT   gene            274994..276250
FT                   /locus_tag="Sputw3181_0252"
FT   CDS_pept        274994..276250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0252"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: son:SO4427 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23103"
FT                   /protein_id="ABM23103.1"
FT                   /translation="MTVIIGALLFALYRQLIIEQQYQVTQYLESETQRYQQLALTVDRR
FT                   SFAAQIRAADPQTALIAWRNSYDMVGALSFMPEGMPMLPQTRDFPILTGGPDKLHILTG
FT                   GLVMTRYGPVLIATRTDNLATLIDKFISAAATAVMLTIVLTLALGYLFSKAILRRLVQY
FT                   NRLSEQIERGHYDTRLPLSWRQDEFDMLALQFNNVLDILENNLMAVRGATDNIAHDLRT
FT                   PLSHIRIGLEELATKSHDDISEGCAILIEELDHCLATFDAMLSLTRIEEGQQTLDLQEL
FT                   SLAQLCTDLLEMADAVAESNEQTLSLSLLSDHTVLGDKYLLFQALYNLVDNAMKYSGQG
FT                   ARIDIIQSGAQIQIRDNGPGIPDESKDKVFERLVRLDPSRHLQGTGLGLSMVKAILSRH
FT                   NAQIKLSDNHPGLVVTIQF"
FT   gene            276284..276973
FT                   /locus_tag="Sputw3181_0253"
FT   CDS_pept        276284..276973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0253"
FT                   /product="pseudouridine synthase Rlu family protein,
FT                   TIGR01621"
FT                   /note="TIGRFAM: pseudouridine synthase Rlu family protein,
FT                   TIGR01621; PFAM: pseudouridine synthase; KEGG:
FT                   she:Shewmr4_0283 pseudouridine synthase Rlu family protein,
FT                   TIGR01621"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23104"
FT                   /protein_id="ABM23104.1"
FT                   /translation="MYQIIADEADFLVISKFPKVHFHSQDGTAGVVAQVEQDLGIKLFA
FT                   VHRLDTPTSGLLILAKSTAAAKQFTELFTAHKVQKYYLALAKGKPKKKQGWVIGDMAKS
FT                   RRSMFKLLRTKENPAITQFFSVSVGDGLRLYLLKPHSGKTHQLRVALASLGVPILGDEL
FT                   YGGAVADRCYLHAYCLHFRYQDAVTGWRDYTYLNISQQGEAFQLEAVSDALALWHKPET
FT                   LAWPSKE"
FT   gene            277094..277261
FT                   /locus_tag="Sputw3181_0254"
FT   CDS_pept        277094..277261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0254"
FT                   /product="protein of unknown function UPF0057"
FT                   /note="PFAM: protein of unknown function UPF0057; KEGG:
FT                   shm:Shewmr7_3736 protein of unknown function UPF0057"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23105"
FT                   /protein_id="ABM23105.1"
FT                   /translation="MDTNKLLLVIIAILLPPVAVFLKAGAGKDLLINIVLCLFFWFPGL
FT                   LHALWVVTKD"
FT   sig_peptide     277094..277162
FT                   /locus_tag="Sputw3181_0254"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.928) with cleavage site probability 0.525 at
FT                   residue 23"
FT   gene            complement(277335..279506)
FT                   /locus_tag="Sputw3181_0255"
FT   CDS_pept        complement(277335..279506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0255"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug; KEGG: she:Shewmr4_0286 TonB-dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23106"
FT                   /protein_id="ABM23106.1"
FT                   /translation="MTFKSSLVALAILTALTQSAAAQDASDNSNKDQEIEKITVTASRM
FT                   DKSPSAIPNTVTIIDRLQLEEQFRTTKDLSTIIGNLAPSFSPSRQKMSNTGETLRGRPP
FT                   LIMIDGVPQSNPLRSGGREGQTIDPAMIERIEIIHGANAMHGLGAQGGIINYITKKPSG
FT                   HNEHVVSFDVTVPDSMKSNGMSFGTSYAFSGESELVDMLGSVSYRNNGVYYDANHDLVG
FT                   VDTTQGESMDSQSADFFIKLGHNFAESRIELMVNHYNMDNNGDWMPIAGDKPNGVPTGA
FT                   IKQNQPWEAANNQVTTTSLTYTHENIAGQQLNLQLFNQDFKAVYGGGCFESFYDPAFEG
FT                   SDQVIQCGVGSKGESLYYDQSRNSSVKWGLKSALIAKDIAGSGIDAAYGIDLFRDTTEQ
FT                   DLVKTGFSWVPESTYDNIAPYLQLDYDLIKNLTLSTGIRYEHAELSVDDYKTLWGAGNK
FT                   QIAGGEASFNKTLLNIGISYKITPDIRIYTSYNEGFGMPDIGRILRDGKSFPGANPSIS
FT                   DSLALTPIVTDNVEVGADYQGKYLRAKISYYRSATDFGSRLALNSDGFYDVKREKSVID
FT                   GIEANVTAYLTSNDDLGMNIAIQQGEYDSNGDNKVDTDLDGANIAPNRINLYWTHNFDN
FT                   EMSTRVQANYFMDRDFKNAAGTQYAEFDGYTTVDASFSMPLYTGTLSLGLQNLLNKDYF
FT                   NYYSQTMGTNDRYFKGMGRTATIGYTLPF"
FT   sig_peptide     complement(279438..279506)
FT                   /locus_tag="Sputw3181_0255"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.977 at
FT                   residue 23"
FT   gene            279826..279990
FT                   /locus_tag="Sputw3181_0256"
FT   CDS_pept        279826..279990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0256"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23107"
FT                   /protein_id="ABM23107.1"
FT                   /translation="MNRKKKINQTLKNKAKKANAKLQTCNKPKYIAKADREALVPAVLP
FT                   ESEPSDAAA"
FT   gene            complement(280007..280519)
FT                   /locus_tag="Sputw3181_0257"
FT   CDS_pept        complement(280007..280519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0257"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: shm:Shewmr7_3731
FT                   peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23108"
FT                   /protein_id="ABM23108.1"
FT                   /translation="MKLKYIGLALVLLLISGYLVPESPIIPVKGASSKDWNSQTFWYEP
FT                   WGASGVHKGIDIFAPKNTAVIAPTSMLIIYRGGFFQGGKVVVGLGPKWQIHYFAHLATI
FT                   AADTGLIVAKGETLGAVGDTGNAQGKPPHLHYSILSLLPKPWLIDTSTQGYKKAFYQNP
FT                   IRYLEAQ"
FT   gene            complement(280559..281137)
FT                   /locus_tag="Sputw3181_0258"
FT   CDS_pept        complement(280559..281137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0258"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23109"
FT                   /protein_id="ABM23109.1"
FT                   /translation="MSLLAWFTKCVNLIKSSKQDVALPEVFNQIQMPYITIPLQQTYPL
FT                   VMPMAQDDIYAYQIHCLLTLEGKQAIDTLINNAGFKALPEHSAPFNGLIMHSNQSSCVF
FT                   LNKYADFAGICLNLITNDQTLLEQLISFKSPLPDPWKSFPDIDPDTLGSLQGNLDFWCH
FT                   YFWRPYWLSLSQKERLQYPEPWREFSEFH"
FT   gene            complement(281143..281790)
FT                   /locus_tag="Sputw3181_0259"
FT   CDS_pept        complement(281143..281790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0259"
FT                   /product="CHAP domain containing protein"
FT                   /note="PFAM: CHAP domain containing protein; KEGG:
FT                   son:SO4418 trypanothione synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23110"
FT                   /protein_id="ABM23110.1"
FT                   /translation="MIKRISILFLGLGILLSLIYCAYRLITQHNFNTKYQVGDVIDSLN
FT                   GVEIYYNGGVNTSDGRNLSIDGYNLGIKYQCVEFVKRYFYQRHQHKMPDTYGHARDFFD
FT                   NSLADGAWNEKRAMLQYVNGSQLTPQADDLLVFAPWLFNPYGHVAIIAEVHDHQVEIVQ
FT                   QNPGPFGPSREYFPLTQHDGLWYIDAPRLKGWLRLQTPTIAPSLFSNHAAEE"
FT   sig_peptide     complement(281722..281790)
FT                   /locus_tag="Sputw3181_0259"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.782) with cleavage site probability 0.769 at
FT                   residue 23"
FT   gene            282099..283277
FT                   /locus_tag="Sputw3181_0260"
FT   CDS_pept        282099..283277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23111"
FT                   /protein_id="ABM23111.1"
FT                   /translation="MKPATYNTEAFDDWIRTRFVELNSELERLYYLQSDRANVLNIGDE
FT                   AKQRLESEGRELIKTLLDEGNTDEGFDSAFDLLGNVGLHMAACRRHEITEPSRETTSPL
FT                   AEASALAMHIGASIGVTPRFATAHLTTHNRAHRGIYKRFTDLPDEKLFVDYNTKGILAY
FT                   KRAADALLKIQPLGISHPISLDLLRVAKQALQDVIESNTQLFNRLDTDRFFYCVRPYYK
FT                   PYRVGSVVYRGANAGDFAGINVIDLTLGLCFANESSYSQMLVDKFLYMMPEDQQLLREC
FT                   MRRPNLMDDFLQAKNSVNQDWYQQNLKLFIEVCELHGATAIQHHNQLVTKYIAEPSTTM
FT                   AQQHLAKVTASGQPLSVLLGSLEKLRDRRAATKRSDIRTRYDDLNCLKESLR"
FT   gene            283282..284403
FT                   /locus_tag="Sputw3181_0261"
FT   CDS_pept        283282..284403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0261"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V; KEGG:
FT                   shm:Shewmr7_3724 aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23112"
FT                   /protein_id="ABM23112.1"
FT                   /translation="MFSDFKKDFCLANPGYLLSHSVGRPLKSTEQVFKEAFFAPWQDSG
FT                   REPWGQWLSVIDDFTFALSKLFNGHQKDFCPQVNLSSALAKILMSLARLNREHAVVLMS
FT                   EIDFPSMGFAIKKALPASCEVRFIPKTLDITDANVWDAHMGSDIDLVFVSHAYSNTGQQ
FT                   APLANILAMARQYGCLSVVDVAQSAGIIPLNLAQLQPDFLIGSSVKWLCSGPGAAYLWV
FT                   NPSIIDSCQPKDVGWFSHENPFEFNIHDFRYHNSALRFWGGTPSIAPYAIAAHSIHYFA
FT                   DIGVEQLRKGNQLLIDIVAEALDQEFVSPREIEKRSGTLVLQFGEQQGQIMAALAKANI
FT                   SVDARSMGIRISPHIYNDKADIQLLLSVIKAHR"
FT   gene            complement(284492..284815)
FT                   /locus_tag="Sputw3181_0262"
FT   CDS_pept        complement(284492..284815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23113"
FT                   /protein_id="ABM23113.1"
FT                   /translation="MRWLIWSVVCCSLTGCATITSRMGENSTWGHSFSSVQTAVDNGEE
FT                   CMVISALAAPPLLLFTIPLTLVDMGSALLVDAVMLPADLAITPSDPKLHTPRPMVCRYD
FT                   YKI"
FT   sig_peptide     complement(284741..284815)
FT                   /locus_tag="Sputw3181_0262"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.963) with cleavage site probability 0.954 at
FT                   residue 25"
FT   gene            285573..286445
FT                   /locus_tag="Sputw3181_0263"
FT   CDS_pept        285573..286445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0263"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vch:VCA0021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23114"
FT                   /protein_id="ABM23114.1"
FT                   /translation="MNNKVAPQQSASTEQETQPLDDSRYEDLPRSEFLQLPQEEQDRLN
FT                   KLRQQRVREAPTLHEWDIKVATVYAMGWLVVIIPCGIMVLIGLVAYWYESDQWYGFFFM
FT                   ALIFAPFIRYLWLADKQYHYRLTTEGLVTTYHDAIPDVAYAVVRGLAWFGVVVCIVGVA
FT                   FLGPAVLVGAGGFAVMAFFFTGFKNIETTYESPIKNGHRHLIKVTRNRPFIACQSDVRT
FT                   MGLRASIRLHCPLDKMHIILSLLMTQLPDSEIRVFKNERVLDGVPFASFESGEPAQLAD
FT                   FAPENTHAV"
FT   gene            286628..287500
FT                   /locus_tag="Sputw3181_0264"
FT   CDS_pept        286628..287500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vch:VCA0021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23115"
FT                   /protein_id="ABM23115.1"
FT                   /translation="MNKRAAPQQSASTEQDTQPLNDSRYEDLPRSEFLQLPQEEQDRLN
FT                   KLRQQRVREAPTLYEWDIKVATVYGIGWIMVLIPCGITALVGLVTYWYGFEQWYYFLII
FT                   VMIFGPFMRYLWLADKQYHYRLTTEGLVTTYHDVIPDAAYAVVRGLAWFGVVVCIVGVA
FT                   FLGPAALVGAGSFAVMAFFFTGFKNVETTYESPIKNGHRHLIKVTRNRPFIACQSDVRT
FT                   MGLRASIRLHCPLDKMHIILSLLMTQLPDSEIRVFKNERVLDGVPFASFELGEPAQLSD
FT                   FAPENPQPS"
FT   gene            287683..288555
FT                   /locus_tag="Sputw3181_0265"
FT   CDS_pept        287683..288555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0265"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VF1233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23116"
FT                   /protein_id="ABM23116.1"
FT                   /translation="MNKRAAPQQSASTEQETQPLDDSRYEDLPRSEFLQLPKEEQDRLN
FT                   KLRQQRVREAPTLYEWDIKVATVYGLFWLTFLIPCGCLALIGCYLLSGDTSLGIGLIIM
FT                   ASIMCLSARYLWFADKQYHYRLTSEGLVTTYHDAIPDAAYAVVRGLAWFGVVVCIVGVA
FT                   FLGPAALIGAGGMALGAFFFTGFKNVETTYESPIKNGHRHLIKVTRNRPFIACQSDVRT
FT                   MGLRASIRLHCPLDKMHIILSLLMTQLPDSEIRVFKNERVLDGVPFASFESGEPAQLSD
FT                   FAPDNPQPS"
FT   gene            complement(288882..290291)
FT                   /locus_tag="Sputw3181_0266"
FT   CDS_pept        complement(288882..290291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0266"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="KEGG: son:SO4410 glutamine synthetase, type I;
FT                   TIGRFAM: glutamine synthetase, type I; PFAM: glutamine
FT                   synthetase, catalytic region; glutamine synthetase,
FT                   beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23117"
FT                   /protein_id="ABM23117.1"
FT                   /translation="MSVESVLKQLEELEVKFVDLRFTDTKGKEQHVSIPTHQVDADFFE
FT                   DGKMFDGSSIAGWKGINESDMVLMPDPTTFVLDPFTEETTALIRCDILEPGTMTGYDRD
FT                   PRSIAKKAEEYLRSTGIADTVLIGPEPEFFLFDDVRFGTDMSGCFVKIDAKEAAWNSGT
FT                   SYEGGNTGHRPFVKGGYFPVAPVDSSQDLRSAMCLVLEEMGQVVEAHHHEVATAGQNEI
FT                   ATRFNTLTKKADEIQILKYVVHNMAHAYGKTATFMPKPIVGDNGSGMHVHQSLSKDGVN
FT                   LFAGDKYAGLSETALYYIGGIIKHARALNAFTNPSTNSYKRLVPHFEAPVMLAYSARNR
FT                   SASIRIPVVPSPKGRRIEARFPDPHANPYLGFAALLMAGLDGIQNKIHPGEAMDKDLYD
FT                   LPAEEAAEIPQVATSLENALENLQADHEFLTRGGVFSEDFIQSYIALKTAEAERVARTT
FT                   HPLEFEMYYSL"
FT   gene            291326..293137
FT                   /locus_tag="Sputw3181_0267"
FT   CDS_pept        291326..293137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0267"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein TypA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor, GTP-binding; elongation factor
FT                   Tu, domain 2 protein; KEGG: son:SO4408 virulence regulator
FT                   BipA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23118"
FT                   /protein_id="ABM23118.1"
FT                   /translation="MLENLRNIAIIAHVDHGKTTLVDKLLSQSGTLATRGEATERVMDS
FT                   NDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVLSMVDSVLLLVDAVDG
FT                   PMPQTRFVTKKAFAQGLKPIVVINKIDRPGARPDWVIDQVFDLFDNLGATDEQLDFPIV
FT                   YASALNGFATLDPDVVSEDMTPLFQTIVEKVSFPDADADGAFQMQISQLDYNSYVGVIG
FT                   VGRINRGSIKTNQQVTIIGADGKTRNGKMGQVLGYMGLDRTEVEVANAGDIVAITGLGE
FT                   LKISDTVCAAGNVEALPPLSVDEPTLTMTFQVNTSPFAGKEGKYVTSRNILERLQQELV
FT                   HNVALRVEETDSPDRFRVSGRGELHLSILIENMRREGYELAVSRPEVILKTIDGELCEP
FT                   FETLTVDVEEEHQGTVIEKLGTRKAEMKDMQLDGKGRVRIDFIIPSRGLIGFQTEFMTA
FT                   TSGTGLIYHSFDHYGPHKGGDIGQRANGVLISNATGKALTFALFGLQDRGRLFIGHAAE
FT                   VYEGQVVGIHARSNDLTVNCLKGKQLTNMRASGTDEAQVLTTPITMTLEQALEFIDDDE
FT                   LVEVTPKSIRVRKRHLTENDRKRNNRG"
FT   gene            complement(293209..294249)
FT                   /locus_tag="Sputw3181_0268"
FT   CDS_pept        complement(293209..294249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0268"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: son:SO4407 GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23119"
FT                   /protein_id="ABM23119.1"
FT                   /translation="MRQRRLQLMQSLFDEYIEMYSSRNDKLTTRFSDNFSGYAGSSDVL
FT                   ITNKEEWIRITRQDFAQVPERIHIEMLDLSLQDLAEDILVVTAFFHIHLPIPESILCQE
FT                   TARLVLIFHQENKDWKIAHSGISIPYGLANNGEIYPMTSLEERNRELESMIEARTRELA
FT                   EANSRLEKLSNTDGLTNIGNRRLFDHILQMEWSRGQRSSAPLALIMLDIDHFKLFNDHY
FT                   GHLAGDDCLKLLAKGLSQSGRRAGELVARYGGEEFVILLPNTDQQTALDTAQYIHQLIQ
FT                   SLAIPHVKTDLGTVTVSLGVTCIEPSEQHSALELVRQADAALYLAKSAGRNCIRYMSPS
FT                   VNKLET"
FT   gene            294658..296844
FT                   /locus_tag="Sputw3181_0269"
FT   CDS_pept        294658..296844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0269"
FT                   /product="catalase/peroxidase HPI"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: she:Shewmr4_0311 catalase/peroxidase HPI;
FT                   TIGRFAM: catalase/peroxidase HPI; PFAM: Haem peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23120"
FT                   /db_xref="GOA:A1REM5"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REM5"
FT                   /protein_id="ABM23120.1"
FT                   /translation="MDKTHSSQGKCPVMHGGNTSVTTNNMDWWPKALNLDILHQHDKKT
FT                   DPMDPTFNYSEAFKTLDLAAVKQDLYALMTDSQDWWPADWGHYGGLMIRMAWHSAGTYR
FT                   IADGRGGAGTGNQRFAPLNSWPDNANLDKARRLLWPIKKKYGNKLSWADLIILAGNVAY
FT                   ESMGLKTYGFAGGRADIWHPEKDIYWGSEKQWLAPSDNPNSRYSGERDLENPLAAVMMG
FT                   LIYVNPEGVDGNPDPLRTAQDIRITFARMAMDDEETVALTAGGHTVGKCHGNGKAQNLG
FT                   PEPEAEDVEAQGLGWLNKHGRGVGRNTVTSGIEGAWTTHPTQWDNGYFSLLLGYDWELK
FT                   KSPAGAWQWEPINIKEEDKPVDVEDPTIRHNPIMTDADMAMKMDPEYRKISEKFYKDPA
FT                   YFSEVFARAWFKLTHRDLGPKSRYLGPEVPAEDLIWQDPIPQVDYRLSDDDITALKAKI
FT                   LASGLSIAELVTTAWDSARTFRGSDYRGGANGARIRLAPQKDWEGNEPVRLQKVLKVLT
FT                   DIQTGLSQKVSIADLIVLGGTAAVEKAAQDAGVNIRVPFASGRGDASQEMTDIESFAVL
FT                   EPLHDAYRNWQKKDYVVQPEELMLDRTQLMGLTAHEMTVLIGGMRVLGANYAGSAHGVF
FT                   TDRVGVLSNDFFVNLTDMSYNWKPAGNNLYQIIERKTGTVKWTATRVDLVFGSNSVLRS
FT                   YAEIYAQDDAKEKFVHDFVNAWTKVMNADRFDLA"
FT   gene            complement(296915..298129)
FT                   /locus_tag="Sputw3181_0270"
FT   CDS_pept        complement(296915..298129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0270"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: shm:Shewmr7_3712 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23121"
FT                   /protein_id="ABM23121.1"
FT                   /translation="MTFIESLTLMLALMYLASLSYWSGQKWGAIATLLCSLAAVAISLY
FT                   WPLALGLLIALPAAFAVNKFAPDSLKQEIKINTLREGTQHLLALSLLLVAIQYTINTIL
FT                   LKQGITPWLMRPDVVDAFLPIAGGIELKAIISLNLWDQTHPAAAVMLAAVLVTGLLCKR
FT                   AFCGWACPLGLAGEYLYAFRKRFIKAELAPPAWLDWPLRMLKYLLLFALCYIVIGMPAQ
FT                   TIPYYLEGNYHKIADLKMALFFITPGLVTLLCFGLILALAAWRRQGFCRYLCPYGAMLG
FT                   ILSFASPLKIRRDTQHCLIDAKGMKCDKCTRACPANIIVHTKTTVRSDECQACMRCVAA
FT                   CPKSAALGLSLKSGHRLGHKGLLALVLLALFALPLGAYLGGFWHSQTPDNIRMELIKVI
FT                   DRVGH"
FT   sig_peptide     complement(298058..298129)
FT                   /locus_tag="Sputw3181_0270"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.947) with cleavage site probability 0.724 at
FT                   residue 24"
FT   gene            complement(298624..298845)
FT                   /locus_tag="Sputw3181_0271"
FT   CDS_pept        complement(298624..298845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23122"
FT                   /protein_id="ABM23122.1"
FT                   /translation="MSQQGSAGNVIAAIASLFFPGLGQLLQGRIIAALLFFVITVVGYA
FT                   LWWLIVPAVIGAIFHLWAIIDAARFKAD"
FT   gene            298927..299811
FT                   /locus_tag="Sputw3181_0272"
FT   CDS_pept        298927..299811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0272"
FT                   /product="tRNA-processing RNAse BN"
FT                   /EC_number="3.1.-.-"
FT                   /note="TIGRFAM: putative ribonuclease BN; PFAM:
FT                   ribonuclease BN; KEGG: shm:Shewmr7_3708 putative
FT                   ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23123"
FT                   /db_xref="GOA:A1REM8"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REM8"
FT                   /protein_id="ABM23123.1"
FT                   /translation="MTKKIEVAQIRVLFLGIWRFLQHLRLRLVEDQINIRAGHLAYVTL
FT                   LSLVPLVAVTMSMLSAFPVFKGIRGQIEAFVYENFLPAAGDTVQIYINEFVGNASKGTA
FT                   VGIAALVVVAIMLISAIDKSLNNIWRTKEKRSVVVAFSMYWMVITLGPVLVGASLVATS
FT                   YVVSLKLFEDDTFSGVVPLFIERLPMLFSVAAFLLLYMVVPNQKVKFLHALLGALVAAL
FT                   LFELGKKAFALYVTQFPSYEAIYGALATIPILFVWVYLSWMIVLLGAEITAAMPEYLDY
FT                   ESSFDKDEASTKT"
FT   gene            299883..300320
FT                   /locus_tag="Sputw3181_0273"
FT   CDS_pept        299883..300320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0273"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-tyrosyl-tRNA(Tyr) deacylase; KEGG:
FT                   shm:Shewmr7_3705 D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23124"
FT                   /db_xref="GOA:A1REM9"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REM9"
FT                   /protein_id="ABM23124.1"
FT                   /translation="MIALIQRVSRASVVVDNQTLGSIDKGLLVLLGVEREDNREKMEKL
FT                   ATKVMSYRVFSDENGKMNLNLEQVGGSLLVVSQFTLAADTGRGLRPSFSGAGTPDQALT
FT                   LYEEFVAFCRDKGVTTETGQFGADMQVSLVNDGPVTFNLQV"
FT   gene            300410..300859
FT                   /locus_tag="Sputw3181_0274"
FT   CDS_pept        300410..300859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0274"
FT                   /product="thioesterase domain, putative"
FT                   /note="TIGRFAM: thioesterase domain, putative; KEGG:
FT                   son:SO4397 hypothetical acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23125"
FT                   /protein_id="ABM23125.1"
FT                   /translation="MRMDQLLIKLRQTWHSTIPVSEFMQIVPLDYSEGEFRVTAPITPN
FT                   INLHQTMFAGSIYTLMTLTGWGAVWLNQQLIGVAGDIVLADAHMRYLAPVSSQPVARVV
FT                   WQDANLAGLSAGRKAKVRLVVELYCGEQRCAEFTGLYISIPNITK"
FT   gene            301016..302236
FT                   /locus_tag="Sputw3181_0275"
FT   CDS_pept        301016..302236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0275"
FT                   /product="peptidase S1 and S6, chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6, chymotrypsin/Hap; KEGG:
FT                   mag:amb2240 TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23126"
FT                   /protein_id="ABM23126.1"
FT                   /translation="MRFLSSVLIVLFCFHLSGCANTKLNANKLPKGVVLNKSITLPVDV
FT                   SVAYYLPHSQLNNRFYLEKWNIWVDPGKSLSDGVKDGFGAYFSNAKLLDRTQANQYGLL
FT                   IDIDPEWKFESGKAEMIMSYRVFNGSDKPIREGQKSFKTDIGYLGDGLGLYNASLRATQ
FT                   LVIVDVLNALTPSASNYPAQYAMKDVSANLLANMKKPVSTGTGFYINPQGQIVTAAHVL
FT                   KNCMVTQVNVGDKSFDAVVEASSTLLDLAVVSTGTPVEQYLPLRKGTEIFLGEAITNVG
FT                   YPLQGLLAASPNLTRGNISSREALKGAVGQFQFSAPIQPGSSGGPVVSDGGELLGITVS
FT                   TLNVTSLRESGALPQNVNFALDAKYAARFLDKHHISYQSVEPNMKGDIRTANAAALGAV
FT                   VQLNCYQ"
FT   sig_peptide     301016..301078
FT                   /locus_tag="Sputw3181_0275"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.609 at
FT                   residue 21"
FT   gene            302248..302781
FT                   /locus_tag="Sputw3181_0276"
FT   CDS_pept        302248..302781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23127"
FT                   /protein_id="ABM23127.1"
FT                   /translation="MPFMLRILMLGLLLISPFVKAQTTVLPPVFFISTIDSTDFYNKLK
FT                   GTPLFEKMDKENIGNPLKLIVTYNMEPTAGGEAAGLTSAILAGGSLGLLPMVTNNDLVL
FT                   TYEFRVHNEVVASVSYRENFTKAHNMYSNEGLYSLDKDSLAWAMTTTDKFIEDIQKVPE
FT                   LSHLINEYNYYFVQ"
FT   sig_peptide     302248..302313
FT                   /locus_tag="Sputw3181_0276"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            302970..303566
FT                   /locus_tag="Sputw3181_0277"
FT   CDS_pept        302970..303566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0277"
FT                   /product="(Acyl-carrier-protein) phosphodiesterase"
FT                   /EC_number="3.1.4.14"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase; KEGG: shm:Shewmr7_3703
FT                   (acyl-carrier-protein) phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23128"
FT                   /db_xref="GOA:A1REN3"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REN3"
FT                   /protein_id="ABM23128.1"
FT                   /translation="MSKVLILKSSILGGYSQSAVLIDHLASHWENQGAAITVRDLGGKD
FT                   VLPMVDGEIASGLRGGAELSARQQEMLALSDTLVAELKANDTIVIAAPMYNFTIPAQLK
FT                   NWIDFIARAGVTFTYTETGSKGLVEGKRAVLVTTRGGAHKDGPTDHVVPYLKTVLAFIG
FT                   ITNVEVVYAEALNMGPEAHDKGMSEAKHSIDLLTA"
FT   gene            complement(303702..304268)
FT                   /locus_tag="Sputw3181_0278"
FT   CDS_pept        complement(303702..304268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0278"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2,
FT                   conserved barrel domain protein; KEGG: shm:Shewmr7_3700
FT                   transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23129"
FT                   /protein_id="ABM23129.1"
FT                   /translation="MQTINSYLATTLKALRNQKGWSLDKAAQETGVSKAMIGQIERGES
FT                   SPTIATLWKIASGFNISLSTFLEPTPQSQGTVFRKPDELRQQPATDGMLVASLFPFEER
FT                   FGFEMFELTLLPNYERLSEPHETGVTEHVIVLSGTMEVLVDGEWQTLKQGEAVRFSADK
FT                   PHGYRNLNEQAVVFHDIIHYQRGSI"
FT   gene            304432..305619
FT                   /locus_tag="Sputw3181_0279"
FT   CDS_pept        304432..305619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0279"
FT                   /product="benzoate transporter"
FT                   /note="TIGRFAM: benzoate transporter; PFAM: Benzoate
FT                   membrane transport protein; Xanthine/uracil/vitamin C
FT                   permease; KEGG: shm:Shewmr7_3699 benzoate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23130"
FT                   /protein_id="ABM23130.1"
FT                   /translation="MWRDAGSLSKISAGFIAVLVGYSSSAVIIFQAAEAVGATPAQISS
FT                   WLWALGVGMGVTSIGLSLYYKNPILTAWSTPGAALMVTSLAGLSVNQAIGAFLVSSILI
FT                   TLCGVAGWMDKLIRIMPQSVASAMLAGILLQFGLGLFQAMQTQLSLILIMLLVFVVVKP
FT                   FAPRYIILLTLLVGIGMSFQLDLLKLDAVQLQLAMPVWTTPEFSLASVIGVALPLFVVT
FT                   MASQNMPGVAALHGNGYRPPISPLITSTGLIGVILAPFGGFAFNLSAITAAICMGKEAD
FT                   PNPATRYWAAVWGGVFYFITGLLGATVVGLFSAFPKELVLAIAGLALLGTIANSLTAAL
FT                   AKTEDREVAIITFLVTASGFSVLGIGSAFWGLLLGFIIHWWNGHRTASVVKRANT"
FT   gene            complement(305671..306147)
FT                   /locus_tag="Sputw3181_0280"
FT   CDS_pept        complement(305671..306147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0280"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   shm:Shewmr7_3696 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23131"
FT                   /protein_id="ABM23131.1"
FT                   /translation="MKSTIRAMKITLDDLKGPEIAALLQEHLNDMQATSPPESVHALDL
FT                   DGLRQPNIRFWTLWDGNNLAGCGALKWLDTEHAEIKSMRTAAPYKQQGIASKILQHLIN
FT                   DAKSAGVKRLSLETGSMDFFNPARLLYCKFGFEICGPFADYRLDPNSVFMTKRI"
FT   gene            complement(306599..307762)
FT                   /locus_tag="Sputw3181_0281"
FT   CDS_pept        complement(306599..307762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0281"
FT                   /product="HNH nuclease"
FT                   /note="SMART: HNH nuclease; KEGG: dar:Daro_1328
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23132"
FT                   /protein_id="ABM23132.1"
FT                   /translation="MMDQKLNKRRIPSVAMRAKLIAKHNNQCAMCTISGEEIPLELASI
FT                   TPFNEGGSMTEENFLLLCPNCHRYMTMGPKEIEFVNFLYQVIKETSPDQKIQLEAIIGE
FT                   SQRARADILIEDSRNAKILIECKSNKAITRSHSSKIVEQILEYGKLIGECKKVLAIPGR
FT                   LPNEIKQNIESNDIEVWDADYLIKNFKAGIQKADSSYFKMLLTAITGGKEGSRGQDLLS
FT                   KLKSCNPGRKDCYIYQRLIGEIIEELFCPPLDKPIQEVNDFTKSNRRDFIVPNYATDGF
FT                   WSFLREKYSADYVVIDAKNYSRKVKKSDVLQIANYLKPHGAGLFGIIFSRKGGDFAGCL
FT                   HTIREQWMVHQKLILVLDDTDVENMLLSSGGAADLIGAKIEEFRLSM"
FT   gene            complement(308340..308639)
FT                   /locus_tag="Sputw3181_0282"
FT   CDS_pept        complement(308340..308639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0282"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   shm:Shewmr7_3694 plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23133"
FT                   /protein_id="ABM23133.1"
FT                   /translation="MKNKRYKLSKLAQTHLLKIKDYTLQHFSESQWHKYKESLISGLQM
FT                   LADNPGLGRSCEDIYPNGFYFPIAKHTAYFTKEDDFILIVALLGQPQLPQNHLK"
FT   gene            complement(308648..308890)
FT                   /locus_tag="Sputw3181_0283"
FT   CDS_pept        complement(308648..308890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0283"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: shm:Shewmr7_3693
FT                   prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23134"
FT                   /protein_id="ABM23134.1"
FT                   /translation="MQTLTANDAKRNFGELLLNAQREPIKISKNSKDAVVVMSIHDFEQ
FT                   LEAMKADYLKHCFNAAKEDLAKGNIVDGEDFLNAL"
FT   gene            complement(309169..309912)
FT                   /locus_tag="Sputw3181_0284"
FT   CDS_pept        complement(309169..309912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23135"
FT                   /protein_id="ABM23135.1"
FT                   /translation="MKPLFAGMLLSISLLSSPLLAQEYTVETYQEIFRGDNQFKQKEAI
FT                   ESLTIAGLSDPAIFDALEAKLLASLPQATEKNAIDYSAWLVKGLAYSGNDKYSETINKI
FT                   VNGDYPKKLKKYAGQALENITIYKKWNAILADKSQYAADQSQQNNAFANALRSNDLELM
FT                   RLAAKRIMDDRQYDDFILAVLSNELKTPRLMANDKLAIDTYANMAKALASSGNTAYRDV
FT                   IENMATASSNKKLKNYAESYLKKYY"
FT   sig_peptide     complement(309847..309912)
FT                   /locus_tag="Sputw3181_0284"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(309944..311203)
FT                   /locus_tag="Sputw3181_0285"
FT   CDS_pept        complement(309944..311203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0285"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="PFAM: beta-ketoacyl synthase; KEGG: son:SO4383
FT                   3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23136"
FT                   /protein_id="ABM23136.1"
FT                   /translation="MSEATNQTRLGKRVVVTGIGGITALGHDWPTIAASLKAQKNCVVT
FT                   MGEWDKYDGLNTRLAAPISDFEVPSHYSRKKIRSMGRVSIMATRASELALIDAGLLDDP
FT                   IVSSGEMGIAYGSSTGSTDAIIAFGDMLKTGDMSGVTATSYIRMMAHTTAVNVGVFFGL
FT                   KGRIHTTSSACTSGSQGIGYAYEAIKYGHQTLMLAGGDEELCPTEAVVFDTLFATSTKN
FT                   STPELTPRPFDASRDGLVIGEGACTLVLEELEHAKARGAKIYAELVGFGTNSDGQHVTQ
FT                   PNAQTMEIAIRLALKDAQLEPSAIGYVNAHGTATDRGDIAESHATHAVFGAGMPISSLK
FT                   SYTGHTLGACGALEAWVSIEMMNAGWFAPTLNLESIDPQCADLDYIRSDLRPIDTDYVM
FT                   SNNFAFGGINTSLIFKRWAQ"
FT   gene            complement(311204..311929)
FT                   /locus_tag="Sputw3181_0286"
FT   CDS_pept        complement(311204..311929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0286"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative; PFAM: short-chain dehydrogenase/reductase SDR;
FT                   KR; KEGG: shm:Shewmr7_3690 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23137"
FT                   /protein_id="ABM23137.1"
FT                   /translation="MNNRVLVTGSSRGIGKAIALKLAAAGFDIALHYHSNQTAADATAA
FT                   EVRALGVNASLLKFDVADRATVRAAIEADIEANGAYYGVILNAGINRDTAFPAMTESEW
FT                   DSVIHTNLDGFYNVIHPCVMPMVQGRKGGRIITLASVSGIAGNRGQVNYSASKAGIIGA
FT                   TKALSLELAKRKITVNCIAPGLIETDMVADIPKDMVEQLVPMRRMGKPSEIAALAAFLM
FT                   SDDAAYITRQVISVNGGMI"
FT   gene            complement(312042..312575)
FT                   /locus_tag="Sputw3181_0287"
FT   CDS_pept        complement(312042..312575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0287"
FT                   /product="thioester dehydrase family protein"
FT                   /note="KEGG: son:SO4381 thioester dehydrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23138"
FT                   /protein_id="ABM23138.1"
FT                   /translation="MQLLKINQPFAEQNIADFIPHRAPMILLDKIIGYRRDNLETEVTI
FT                   TAKSPYFDDKHRAVPNYVGIEYMAQSIAALAGVEAKLRNDKIRVGFLLGSRKLTLYAKQ
FT                   YELGRTYRTQVSRLYQEGSGLAVFDCQIYLLPEAGSNLEKSLVAQANVNVFQPQDTQAY
FT                   LAGNQDAANRSLGH"
FT   gene            complement(312580..313797)
FT                   /locus_tag="Sputw3181_0288"
FT   CDS_pept        complement(312580..313797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0288"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="PFAM: beta-ketoacyl synthase; KEGG: shm:Shewmr7_3688
FT                   beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23139"
FT                   /protein_id="ABM23139.1"
FT                   /translation="MVKRHTMMNRVAITQIGLCTPLGQDPQQVLDRLIAGDTSAMLRSD
FT                   TLLFEHPTLVAPVTAALPTIPEKLIQFDCRNNQLLLCAALQIATTVEQAKRDFGHARIG
FT                   VVLGTSTSGISKGEAALSYRNQHGYFPADYHYFQQELGSTSDFLRQYFELDGPCYTIST
FT                   ACSSSAKVFASAKRLLQANLCDMVIVGGVDSLCQLTVNGFHALESVSKGHCNPFSINRD
FT                   GINIGEGAALFTLTLGESEVMLAGIGESSDAHHMSAPHPEGAGAITAMHAALQDAHIAA
FT                   KDIGYINLHGTATPKNDAMESRAVVEVFGVNTPPCSSTKPLVGHTLGAAGAIEAAFCYL
FT                   LLSAHNHRQALPPHQWDGQVDPQDPPIALIERHQVAAKGALNYVMSNSFAFGGSNASLI
FT                   FCRNEA"
FT   gene            complement(313826..314590)
FT                   /locus_tag="Sputw3181_0289"
FT   CDS_pept        complement(313826..314590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23140"
FT                   /protein_id="ABM23140.1"
FT                   /translation="MSLNFNAKWRVFPALLIISLGLTGCSELLFRQTCVGLAKDMRYCL
FT                   APLPHDFAPAADKPLTKPTAKPADISSPQTDSKVKLTSPQSFSQKVSIKVGDKSHELLT
FT                   QLELENERMTLVGLAPLGQALFTLVYDGNTLSSEQSVLLGDNFKAEYLMAMMQLIYWPE
FT                   QSIRAHLEGGHLVTGLCDTVGGNQGDALVGTRVNTIPCRQIYSQDTLISKSGQQTHVVQ
FT                   IRYQQNIGDALWQAHISLTMPQAKFELEIEPI"
FT   gene            complement(314595..315884)
FT                   /locus_tag="Sputw3181_0290"
FT   CDS_pept        complement(314595..315884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0290"
FT                   /product="monooxygenase, FAD-binding"
FT                   /note="PFAM: monooxygenase, FAD-binding; FAD dependent
FT                   oxidoreductase; tryptophan halogenase; KEGG:
FT                   shm:Shewmr7_3686 monooxygenase, FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23141"
FT                   /protein_id="ABM23141.1"
FT                   /translation="MPTPAHDLSAMPNSLAVDVAIIGAGPSGAIAASLLHQQGKRVLVL
FT                   EKQHFPRFSIGESLLPCCMQFIEEAGMLDALNAAGFQHKNGAAFRRNGTYTTFDFTDKF
FT                   TPGPGTTFQVQRASFDKLLADTAQSQGVDIRYGETVEAIDLTENPRLTVRNEQGELYQI
FT                   SAQYVLDASGFGRVLPRLLDLESPSCLPPRSAIFTHVEDNISDPSFDRNKILISVHPEH
FT                   KDIWYWLIPFSNGRCSLGVVAEPQLLARLQGSLEQQLMNIVNEEPGLKALLANAKVVQE
FT                   CATLKGYSANVSRLATDKFALLGNAGEFLDPVFSSGVTIAMQSASMAAKCVTKQLNGET
FT                   VDWQADYSAPLMQGVNTFRTYVQAWYDGRFQDVIFYEEPNPRIKQMICSILAGYAWDLN
FT                   NPFVKDSERRLNMVVELCQNQVSTPEFSEA"
FT   gene            complement(315908..318349)
FT                   /locus_tag="Sputw3181_0291"
FT   CDS_pept        complement(315908..318349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23142"
FT                   /protein_id="ABM23142.1"
FT                   /translation="MASNFAARANQALIQSSPKWRLAIWLLLMLSASLWTLQLWQNGAR
FT                   VQSDILAMLPHLQQDKLTERALNQVEATLADQVYIALVAKDETTAIAAAKLLMQKLETD
FT                   LVATGKNAALTDIRSADMQLGEALGQYYFPHRFKLLTAPQAEALATKDIGNLIEAATAQ
FT                   LYNAFSYANSNLLAQDPLLLFPANLLSLAPSSKVKASQGILLANQGDNVAAVVMAKGRE
FT                   SAFNPNAQLAQMTALTLGLDAVKQSYPDITLLKAGALFHAIAATQTAKSEISILGLASL
FT                   LGVIALVWLAFRSVMPLLLAIVTISSGLLLAATFTLSVFGELHLLTLVFGTSLIGIAID
FT                   YSFHFYCERLSDTERSAQATVAYIFPTVTLAFITSALAYVGIGLAPFPGMQQVAIFCAA
FT                   GLLGAYLTLILAYPQLAGSRLPSGSRPLALAGKYLANLTQLSNRLTTPLGMGMFALVIV
FT                   VWCLVGVTKLTVDDDIRHLQQSPASVTEPENKLRQLLSGGTDNQFLLVRAASEEALLQQ
FT                   LERVSPLLDAAIANQELGNYVSLSRYLPSHQRQDTAYRLQGEIYQTQIDTVLTNLGLDE
FT                   NLKPELQASYLAAKDQYIAPADFFKLEAGKQLAPLWLAPNGKATDYDALNDGGASAEYG
FT                   AIVLLGGIQQIDALKARFAHDESVQLIDKVADISAVMGHYRLLTLKLLALALGIALLLF
FT                   SLNFGIKKAAVVVAVPALAALLTLATLGLTGSPLSLFHALALILVFGIGIDYSLFFASA
FT                   QQHGKAVMMAVFMSACSTLLAFGLLAFSQTQAIHYFGLTLSLGIGFTFLLSPLILTTKK
FT                   S"
FT   sig_peptide     complement(318239..318349)
FT                   /locus_tag="Sputw3181_0291"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.619) with cleavage site probability 0.449 at
FT                   residue 37"
FT   gene            complement(318352..319140)
FT                   /locus_tag="Sputw3181_0292"
FT   CDS_pept        complement(318352..319140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23143"
FT                   /protein_id="ABM23143.1"
FT                   /translation="MNSVLAKSSALTKNPVLAKCALLLCLAFALISLPLKAETLASPGA
FT                   YQTLFSQSADTAQLVALSQKLNLGETVRGHFVQSRQLKVLKKPLISQGQFIFDQTQGLI
FT                   WQQIKPFESLLILKDKQLIQRDSQGRVQVSKADASTSAAAMGDLLPSLVRAMLGGDISG
FT                   LSENFELHFLITDRLKIESLSTDGQWQLGLTPKDPLMKKAIANMVLEGSDVLQSLVLLS
FT                   AAPSVSPQDMTRIDFSALSQGTLSETELAQYALAVEASKP"
FT   sig_peptide     complement(319027..319140)
FT                   /locus_tag="Sputw3181_0292"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 38"
FT   gene            complement(319140..319571)
FT                   /locus_tag="Sputw3181_0293"
FT   CDS_pept        complement(319140..319571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0293"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   shm:Shewmr7_3683 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23144"
FT                   /protein_id="ABM23144.1"
FT                   /translation="MKSLLSVDMEMQIPFHDVDSMGITWHGNYLRYFEIARCKLLDELG
FT                   YNYRQMQASNYAWPIIDLQIKYVKTSTFEQKITVRAELVEWENRLKINYQIRDVETGAR
FT                   ITKGYTIQAAVDMCTQELCFVTPEVFRDKIATLFAKVED"
FT   gene            complement(319568..321142)
FT                   /locus_tag="Sputw3181_0294"
FT   CDS_pept        complement(319568..321142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0294"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="PFAM: phenylalanine/histidine ammonia-lyase; KEGG:
FT                   she:Shewmr4_0344 histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23145"
FT                   /protein_id="ABM23145.1"
FT                   /translation="MSHTQAADSKNQSDLKTVEFGRQFLTLEQVVAVAKGAPVKLCDDA
FT                   DYQEYIQKGARFIDSLLHEEGVVYGVTTGYGDSCTVNVSLDLVHELPLHLTRFHGCGLG
FT                   ETLSIMQARAVMACRLNSLAIGKSGVTYELLKRIETLLNLNIIPVIPEEGSVGASGDLT
FT                   PLSYLAAVLVGEREVIYQGERQATQAVYAKLNITPHVLRPKEGLALMNGTAVMTALACL
FT                   AFDRAQYLARLSSRITAMASLTLKGNSNHFDEILFAAKPHPGQNQIATWIREDLNHHEH
FT                   PRNSDRLQDRYSIRCAPHIIGVLQDALPFMRQFIETEVNSANDNPIVDGEGEHILHGGH
FT                   FYGGHIAFAMDSLKNTVANLADLIDRQMALVMDPKFNNGLPANLSGSIGARRAINHGFK
FT                   AVQIGVSAWTAEALKHTMPASVFSRSTECHNQDKVSMGTIAARDCMRVLQLTEQVAAAA
FT                   LLAMTQGIGLRIAQNELDEASLTPSLAKTLAQVRGDFETLIEDRPLEAVLRKTVAKIQA
FT                   GEWEVCR"
FT   gene            complement(321139..322998)
FT                   /locus_tag="Sputw3181_0295"
FT   CDS_pept        complement(321139..322998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0295"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; lipid A
FT                   biosynthesis acyltransferase; KEGG: she:Shewmr4_0345
FT                   glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23146"
FT                   /protein_id="ABM23146.1"
FT                   /translation="MLTPPSDLVESAPIKLALVIPNYNHSAAIAQTLAELAQFNLPCYL
FT                   IDDGSNDETRYLLQSLAQTYPWVTLLLHPYNRGKGAAVMTGLRRAYRDGFSHALQVDAD
FT                   GQHNLADIPAMVARAQAKPDALISGKPEYDESVPKGRLYGRYITHFWVWVETLSFDIQD
FT                   SMCGFRVYPLAATERLLCQQALTERMDFDIEILVKLYWQGVEILFQPTKVIYPEGGVSH
FT                   FQGVADNVRITKLHTKLFFGMLKRLPWLLKRKQSQQQAYVSETSSKPQITATTHWSGMK
FT                   ERGSYWGIKLLVESYRFGGHWLCRAIMYPVICYFFLTGRVTREASLDFLRRVQTLEPQH
FT                   PKLNQPVGWRDSLNHFLAFGNAALDRIDAWCDRIQLSQVDFPDRQVLAGQLESGKGAVL
FT                   LVSHLGNLELCRAISIHQRKVKVNVMVLTSHAENFNKVLKQLNPDSTLNLIQVTDLNPA
FT                   TSMLLQQKIEAGELVVIAGDRTSSNTQGRVIYAPFMGQDAAFPQGPFILAGLLDCPVFL
FT                   MFCLREQGRYRVHLEHFAETLKGPRAGRMDRLQQAVNRYSERLEYFARREPLQWFNFFD
FT                   FWRKDSELERVSANSVQTDAVTAESTSPQIPEQDHKTDRTSHS"
FT   gene            complement(322992..323399)
FT                   /locus_tag="Sputw3181_0296"
FT   CDS_pept        complement(322992..323399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0296"
FT                   /product="thioester dehydrase family protein"
FT                   /note="KEGG: son:SO4372 thioester dehydrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23147"
FT                   /protein_id="ABM23147.1"
FT                   /translation="MIKSSLPPILHSNIGMDNIELRLLVAADLESFKGHFPEQAVLPGV
FT                   TQLDWAVRLGCQYFGYCETVANLEVLKFQQLILPGQEVTLSISNNAAKGKLTFAYSDGE
FT                   NRYASGRIAFDISPVNSKPSAANNSDGASQC"
FT   gene            complement(323392..324756)
FT                   /locus_tag="Sputw3181_0297"
FT   CDS_pept        complement(323392..324756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3679 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23148"
FT                   /protein_id="ABM23148.1"
FT                   /translation="MTQLLKNWLTQGPFAQQLISFNHHDIVTGALFTNQVAYFYEQLLA
FT                   APEKKWLLASDTSDLFAVGLCAALLAGKEIILPANTQTGTLSELTHQFEGILSDKPLCE
FT                   SQAFILLRKELSLPSKPWPASEAIGELVLFTSGSSGEPKAIRKTLQQLDVEVSVLEHTF
FT                   AEHLPHCSVVSTVSHQHIYGLLFKILWPLAASRPFLSEQIEYPETLSYYTALLPNLCLI
FT                   SSPAQLSRLPKALEHERQLRSPSLVFSSGGPLSFAAAQGISQCYGHLPIEIFGSTETGG
FT                   IAYRRQHEADEPWQVFDRILIDQDPSDGALLLKSPYLVDDEWLRCEDKIEPTENGQFRL
FT                   KGRLDRIVKIEEKRLSLAQMETLLGSHAYVEQAALVVLPQFKSQLGAVVTLSALGRSVH
FT                   QEQGKLSINNALKAHLLTQFERVTLPRRWRYPDILPLNTQGKRVTAQLVELFDHD"
FT   gene            complement(324753..325301)
FT                   /locus_tag="Sputw3181_0298"
FT   CDS_pept        complement(324753..325301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3678 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23149"
FT                   /protein_id="ABM23149.1"
FT                   /translation="MRALLQVLTALTLLAYPVAVYLGLSYLPAGTIALVLCLLLIVRLM
FT                   LQKQKVKTLVLPLLVGIVLTAGSYLAKRSDWLLYYPVVINLTMLALFSYSLHTGPSMIE
FT                   RLARLKEPDLPDEATGYLKKVTLLWCGLFIFNGTMAAYTAGFTSLATWTLYNGLIAYVL
FT                   MGLLLGGEWLYRSFWLKKT"
FT   gene            complement(325301..325549)
FT                   /locus_tag="Sputw3181_0299"
FT   CDS_pept        complement(325301..325549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0299"
FT                   /product="phosphopantetheine-binding"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG:
FT                   shm:Shewmr7_3677 phosphopantetheine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23150"
FT                   /protein_id="ABM23150.1"
FT                   /translation="MQNREQILAMLTTILVDEFEIDAEAITPEANLYEELDLDSIDAVD
FT                   LVIKLQQLTGKKIQPDEFKSVRTINDVINAIEGLVKT"
FT   gene            complement(325559..325813)
FT                   /locus_tag="Sputw3181_0300"
FT   CDS_pept        complement(325559..325813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0300"
FT                   /product="acyl carrier protein, putative"
FT                   /note="KEGG: son:SO4368 acyl carrier protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23151"
FT                   /protein_id="ABM23151.1"
FT                   /translation="MNLNNEIKQLIIDCLDLEDVSIDDIETDAPLFGEGLGLDSIDALE
FT                   LGLAIKKKFDVKIEANSDATKAHFHSVASLARFIESQRP"
FT   gene            complement(325797..326672)
FT                   /locus_tag="Sputw3181_0301"
FT   CDS_pept        complement(325797..326672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0301"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   she:Shewmr4_0351 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23152"
FT                   /protein_id="ABM23152.1"
FT                   /translation="MFDAAHSHDAAKDHQDSMLNAAYTLPETRRKGLNYVPRWLGGVSC
FT                   YIAFGLGGLLSSLTILPLLRFWPGTPEARIIRVQKAVHFMFKGFVAMLTWAGVIKVSSH
FT                   DAQKLHDAKGVIVIANHPSLVDVVVLISLMPNAGCIVKQALWRNPFLRGVVSCAGYIPN
FT                   RGAELMLEDCREVLARGTNLIIFPEGTRTVVGATINHFARGAANIALRAEADILPVVLR
FT                   TNVRGLTKEQPWYEIPRQTMGMAVEIGTIVSYQKYQAALGEHAKMARQLTRDLEHYYKQ
FT                   QLENNYELKQ"
FT   gene            complement(326665..327408)
FT                   /locus_tag="Sputw3181_0302"
FT   CDS_pept        complement(326665..327408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0352 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23153"
FT                   /protein_id="ABM23153.1"
FT                   /translation="MQLTFSILSWGAWAPQYPLNDSWQCWRKNSAEQTSGTSTTSELDT
FT                   TSPPLTHIPSMQRRRFSRLTKMMLEVSFRCSVTHNCRSIFASRHGELQRTIGLLEDIIA
FT                   KQPLSPLGFSQSVHNTASGIFGIVAANTAPSTSVAAGTETLSQAMVEAFAQLHQSPEPL
FT                   LLVFGDDPVPPVYDEFTQEFELPLALGLQLAPFDTPASTKLTVSHISKATALNPLTYGA
FT                   FIHALATAQNISGCLSQWHWRLEHV"
FT   gene            complement(327748..328647)
FT                   /locus_tag="Sputw3181_0303"
FT   CDS_pept        complement(327748..328647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23154"
FT                   /protein_id="ABM23154.1"
FT                   /translation="MQVNQDDRINPQETSSSSNRFALFAIVLVVLLSAGGYYYYSGDSD
FT                   SPKRIPNAPIVLPETPSSEPMTLESATEPEETTETTPTTTETNTNSTESSVTTEPEVVV
FT                   EPVPALAESDTFVQQKALAIINNNLLASSLVQQDIIRQFVVFVDNLAQGELTRKVSPIK
FT                   GPEKLFTVSEITNKVYLNPDSYHRYDAYVDSITKMDEQSLIRTYKQLTPLLEEAFSELG
FT                   YSNAKFNDRMQQAIKVLLAAPIVEDPIELSSISVNYQFVDPNLEALPSAQKLLIRMGPE
FT                   NTRKLKVALRKLENQLAQ"
FT   gene            complement(328830..330920)
FT                   /locus_tag="Sputw3181_0304"
FT   CDS_pept        complement(328830..330920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0304"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="KEGG: she:Shewmr4_0354 ATP-dependent DNA helicase
FT                   RecG; TIGRFAM: ATP-dependent DNA helicase RecG; PFAM:
FT                   helicase domain protein; nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23155"
FT                   /protein_id="ABM23155.1"
FT                   /translation="MSANDLQQLDLVPITDLKGVAKKVAEKLAKLGITTVQDLLFHLPL
FT                   RYEDRTQIYPIAALSPGSYGTIEAEIQSTQIIQGRKRMLVCNVRDDTGSLSLRFFNFSV
FT                   AQRNAMQNGLMIRAYGEVRRGSHQAEIVHPEYKVVYPGEDVHLSDTLTPIYPTTEGLKQ
FT                   ASWLKLTEQALVLLKEGGLTELLPPQLQPNNISLKQALQTLHRPPAGISQFDLELGQHP
FT                   AQQRLVQEELLAHNLSMLRLRQRSNLDAAVTMQATGQLLNPFLAALPFKPTGAQQRVVA
FT                   DIGKDLEKPHPMMRLVQGDVGSGKTLVAAMAALQAIENGYQVAMMAPTELLAEQHATNF
FT                   AAWFEPLGLKVGWLAGKLKGKARTQSLADIESGAAHMVIGTHAIFQQHVVFNKLALIII
FT                   DEQHRFGVHQRLGLREKGMSQGFHPHQLIMTATPIPRTLAMTAYADLDTSIIDELPPGR
FT                   TPVTTVAIADSRRNEVLERVRNAVITDQRQAYWVCTLIEESEVLECQAAEDTAEELRLA
FT                   LPDLNIGLVHGRLKSAEKQQIMADFKAGMIHLLVATTVIEVGVDVPNASLMIIENPERL
FT                   GLAQLHQLRGRVGRGAIASHCVLLYKAPLSHTATQRLSVLRQSNDGFIIAQKDLEIRGP
FT                   GEVLGTKQTGLAELKIADLVRDQALIPHIQKLANHVMTQAPEKVDAIILRWLGHRQHYV
FT                   QA"
FT   gene            331152..331865
FT                   /locus_tag="Sputw3181_0305"
FT   CDS_pept        331152..331865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0305"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   proteins; KEGG: yps:YPTB2345 multiple antibiotic resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23156"
FT                   /protein_id="ABM23156.1"
FT                   /translation="MYFQVVVLALLALLPMVNPPTTATLLLGLSKGMSREHVRHQVNLA
FT                   AIYLFCTLCVCFFIGSSILELFGISIPGLRLAGGLIIGFIGFRMLFPTPAQANNVDINE
FT                   SIAFVPLTMPSMCGPGTMALVISGAAQIAELPDEYSRFTIYSAMVTAFALMSLISWGVL
FT                   KLADPVCKILGATGIDAMTRIMGFLLVCMGMQFCINGIKEVAQDPVFHTPLIQKTALEM
FT                   GDSPTSLISPQPLAI"
FT   sig_peptide     331152..331223
FT                   /locus_tag="Sputw3181_0305"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.948) with cleavage site probability 0.665 at
FT                   residue 24"
FT   gene            complement(331982..333427)
FT                   /locus_tag="Sputw3181_0306"
FT   CDS_pept        complement(331982..333427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0306"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG:
FT                   she:Shewmr4_0916 OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23157"
FT                   /protein_id="ABM23157.1"
FT                   /translation="MGQNTLLSAVLLTTTAFGANAEQLFIPFSDAKSPEEKRIHFTPFD
FT                   IITAVNDNKLTLLTVSGQLTRQSVELPESYSPEHVINNYLAQMKKLNAEVLFNCKAASC
FT                   GDGQAMQSQLKPLREVNADYHSAYVAAKMKGTSGDVYSSIYAVNREGRYTYIQVDILEV
FT                   IPEPLDLIQANNSFLQQAPKEIEIKDKRSEDAQGSADHPLLGRMPGSYIAHYKQINFTQ
FT                   VPVIVGMTGSDYQTKPLAAKLTQISYRMPESYSLFEINSNYAAAAQKLAAERIFHCKGT
FT                   ACGDDDSLIKAMGLFKDDQDDEGQEYQLFQLSHPQGDVYFDIYSQGYSNGTPTDTTVRV
FT                   MELSALKDDRVAINLDALTDAISQTGKATLEGLLFDYDSERMLPESKPVLEVLATYLKQ
FT                   NPALSFYVVGHTDDKGERSYNQSLSERRAAAVIKQLNETFNIPSVQLTAHGNGEYSPVA
FT                   SNANDTGQRLNRRVELVLRSDKK"
FT   sig_peptide     complement(333362..333427)
FT                   /locus_tag="Sputw3181_0306"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.967 at
FT                   residue 22"
FT   gene            333580..333933
FT                   /locus_tag="Sputw3181_0307"
FT   CDS_pept        333580..333933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23158"
FT                   /protein_id="ABM23158.1"
FT                   /translation="MNMNIRNGIRLEGEGFDLLPELKKIYFTNGLCLRKALSNNEQQYI
FT                   NRVIFVDWTQKTSPALVLRHEKSTVYVAVVNHHDTQIEITLLRAGFHGQVVRNSSLVSH
FT                   LSAIDCQSIECFT"
FT   gene            334488..334844
FT                   /locus_tag="Sputw3181_0308"
FT   CDS_pept        334488..334844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23159"
FT                   /protein_id="ABM23159.1"
FT                   /translation="MEAEDGSAEGYQLYYRCQRWNNCKEVGGSASVFTEAFFRNHKKKL
FT                   GIPWELMRDGSAFGKDSSDFEDAKGHLYQYALKFSEDNWRLFEGRIPLETSDLAEQKFW
FT                   QWCSIQPLSIWENE"
FT   gene            335704..337050
FT                   /locus_tag="Sputw3181_0309"
FT   CDS_pept        335704..337050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0309"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein; KEGG: vvy:VV0798
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23160"
FT                   /protein_id="ABM23160.1"
FT                   /translation="MEQLTIQAYINGQWSDIAQLSFPESEQGNYRLTSLDYEQAYALAE
FT                   LDKDDLHAVSLNHPVSLFFDDLGRPGWLRFLDDIMPSGASRRYWLKYLDIADLTLDEQN
FT                   FVLLKFGTIAPVGNLRVKESLPKRTAIADTLKFTVDDVRNRAADFLDYAQHRGAAAGGA
FT                   TGAGGEAPKLLLRCDDEQNIWIDSYQDEPQNRDLHYLVKYPRGARLPIDCDILRAEYHY
FT                   YHELAEMGFETIPTANMRLEEGHSYPSLWLPRFDIYFNELGQQRYAMESVYSILGKGAG
FT                   VTLDHEQTIRALIDKITHSHMVLEQGYQFDVRAFVIEWVRRDLLNILFGNSDNHGRNTA
FT                   FLRGDGWIRLAPIYDFAPMKADPEGIARTTKWEAPLEIGGEYDFLGIAEVLTDLVPAQE
FT                   LLIDLKRTAQQCLGLKQRLIERGVPLRIIDMPAIGFAYLEDKLTRWGLA"
FT   gene            337047..337493
FT                   /locus_tag="Sputw3181_0310"
FT   CDS_pept        337047..337493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0310"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   vvu:VV10402 predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23161"
FT                   /protein_id="ABM23161.1"
FT                   /translation="MSDKQTTTETAKDTIARLRANRQQRSDIAIEASQHRQPVNIGDAP
FT                   IKPTPKRASKQSGGVNTVERKNAINAITQRLLRSELSQGQALKALRVEVLGLTQDEYAN
FT                   LVKVSRKTLSDVENDRGSFKTDILDRLFKPFGLKVGIVPISVGP"
FT   gene            complement(337490..337981)
FT                   /locus_tag="Sputw3181_0311"
FT   CDS_pept        complement(337490..337981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0311"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   bxe:Bxe_A0222 type I site-specific deoxyribonuclease HsdR"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23162"
FT                   /protein_id="ABM23162.1"
FT                   /translation="MSLKKSHKSYPQAFKDEAVLMVLEQGYSVADAAKSLGVSTSLLYN
FT                   WKEKHEAKKQGVSTEESERDESLGVSDDEVKFYDALANNEAAVLELGDEILKKIAHEPT
FT                   DNLRANISVDWSQRESVRAKLRIMVKRILRKYKYPPDQADGAVQLVLQQAEALGEQWAA
FT                   "
FT   gene            complement(338036..338317)
FT                   /locus_tag="Sputw3181_0312"
FT   CDS_pept        complement(338036..338317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0312"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: protein of unknown function UPF0150; KEGG:
FT                   plu:plu2506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23163"
FT                   /protein_id="ABM23163.1"
FT                   /translation="MLYPVAIEMGDNEHAYGIIFPDLPNCFSAGDTLDEALNNAHEAAE
FT                   MYLEDLAKRQIPPPQASNLETLQMVPEYPGWSWAIIDINIQPYCAVLV"
FT   gene            complement(338408..338824)
FT                   /locus_tag="Sputw3181_0313"
FT   CDS_pept        complement(338408..338824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0313"
FT                   /product="putative DNA-binding protein"
FT                   /note="KEGG: eca:ECA0367 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23164"
FT                   /protein_id="ABM23164.1"
FT                   /translation="MNIARVKKLVDDLQAEMPFIRRLNSKQDYLAALNLVEALIDDLDA
FT                   NGLLLDLLVLRINEYEEQSDEFKDFNNAVKNTDKGTAVLRVLMDLHGLKVTDFQHEIGD
FT                   ATTVSLIIDEKMPLSLAQRHKLAVRFNIPCADFI"
FT   gene            complement(339168..340421)
FT                   /locus_tag="Sputw3181_0314"
FT   CDS_pept        complement(339168..340421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0314"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein, HSR1-related; protein of unknown
FT                   function UPF0174; Miro domain protein; KEGG: ilo:IL0536
FT                   predicted C-terminal GTPase domain fused to uncharaterized
FT                   conserved domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23165"
FT                   /protein_id="ABM23165.1"
FT                   /translation="MSKALSLVDVLQRSLAQNKEDITPLLGYLGTNQDELALEMKRHTT
FT                   GADANKIADYLRKMGSNDFANLFRSGPGVEYNEIVCDVGEKLKVKGVSEGKSVEVNEEL
FT                   IIQHLFSDALKQMSDEERSALMRSMNLSEKDQGAIIAGALLASQVMLNQFGGFAVYRMS
FT                   VILANMLARSLLGNGLNFAANAALVRGVGAFLGPIGWIVSGAWLAVEIAGPAFRKTVPA
FT                   IVHIAMLRQNVLKRITISVVGDGSVGKDALFKSVFGVDTGNISPIAGSTSDTKVYDLGP
FT                   TGSIKLINFPGFHDIRSEVNDLVNDNIKHTDLFLLVVDVNRGVSDHDKETLKKLQAEGK
FT                   PILICLNKVDMLRPDDKEEMLQVAKARLQNLYLIETAFDPDPRLSQDGPIGTQAVFDWV
FT                   VDQLEAQGKETTHLKADQ"
FT   gene            complement(340479..340844)
FT                   /locus_tag="Sputw3181_0315"
FT   CDS_pept        complement(340479..340844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23166"
FT                   /protein_id="ABM23166.1"
FT                   /translation="MNIQIVTPDQISKLLAFISVQAKGTSFEIPASLLHNVESELRDFC
FT                   KARRISVEFEDPSSDRIFVFCATGAATGTVMGAILGGMIGALTGALLGTAAGAALAQIR
FT                   ITVAPIGDSDNLVLTLA"
FT   gene            340971..342656
FT                   /locus_tag="Sputw3181_0316"
FT   CDS_pept        340971..342656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0316"
FT                   /product="sigma-54 factor, interaction domain-containing
FT                   protein"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; SMART: AAA ATPase; KEGG: ilo:IL0537 possible
FT                   regulatory protein containing AAA-type ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23167"
FT                   /protein_id="ABM23167.1"
FT                   /translation="MMESSFGGSLNDEVDIMEFRVINFSEEKSPKDLAPYWHQVSLEST
FT                   QQTVSFTPYISDIISQAVMSEWKQALALIVGSENIKELAKKYSDFMPWVENIAEKGPEA
FT                   VLQNEHNLFSGLYITDRYDVAQDRNFVSQARAILARKTVFLLPDSSPSNSVLHRADERN
FT                   VFIRSFSALLSAGNTSIALAKSGYKTSGDSSIFNAVLASLFARNSQLRLDEDTGIHIKP
FT                   GPLLIEGDTGTGKSAAAKHLSMKMGKTMVEINLAAVSETLLETRMRGSSIGAFTGATNK
FT                   KGFFEEADNGVLFLDELQSANLASQTQLLDLLSAISNDVWISKVGDDAAKKKFNVKVVL
FT                   AVNEPVSRLLAEGRLRPDLFHRIRDVVKFKSLNELFAQENGQAFLTQILTFYRWKSLEL
FT                   PAFSTDGKAKQVLSQIFIIYEDGVLEKIMRAPWPGNFRQLERFAWDLFFVLGESVVVTN
FT                   DLIERLLREENSRIPSAFIEAVPIQSEQTVSKIFSEVETIIKKHHFNMAAARQELGIYN
FT                   LKSPPALRGFILRNKEQFSEGFLADSAITKIFTEAALERKTGAE"
FT   gene            342953..344677
FT                   /locus_tag="Sputw3181_0317"
FT   CDS_pept        342953..344677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0317"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /note="TIGRFAM: type I restriction-modification system, M
FT                   subunit; PFAM: N-6 DNA methylase; KEGG: noc:Noc_2903 type I
FT                   restriction-modification system M subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23168"
FT                   /protein_id="ABM23168.1"
FT                   /translation="MTQKLTLQQLESFLWEAADILRGNMDASEYKDYIFGMMFLKRLSD
FT                   AFEEAQESVVQYYLDKGKTQEQAEALAQDEDEYDKTFFVPQTARWSELKDLKHDIGATL
FT                   NKATEAIEEYNSSLEGVLVTIDFNIKNKLSDKKLRDLLSHFSKYRLRNEDFERPDLLGT
FT                   AYEYLIKMFADSAGKKGGEFYTPSEVVSLLVALLKPKAGMRIYDPTSGSGGMLVQTRNY
FT                   LAAHGENPGNLSLFGQEMNLNTWAICKMNMFLHGVLSADIRKGDTLREPKHTEGGELMA
FT                   FDRVIANPPFSLAKWGKDECDNDGFGRFPYGTPPKDAGDLAFVQHMIASTNAEGMVGVV
FT                   MPHGVLFRGSSEKAIRQGILEDDLLEAVIGLPSGLFYGTSIPACLLIINKRKAADRKGK
FT                   VLFINGELEYEEGKNQNKLRPQDIEKIVTTFNNYQNIKRYAQVVDISEIADNDYNLNIR
FT                   RYVDTAPPAEIFDVRAILHGGVPVREVESEYIQEEILQGFDVSSVFTLKSEGYYQFRTD
FT                   ISAKEQIREFATDATSAIISQLERWWDKYHVSLKQLDDEVATAESVMQGYLKELGYE"
FT   gene            344670..345923
FT                   /locus_tag="Sputw3181_0318"
FT   CDS_pept        344670..345923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0318"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: mja:MJ0130m type I
FT                   restriction-modification enzyme, S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23169"
FT                   /protein_id="ABM23169.1"
FT                   /translation="MSERVPDGWMLKIVRDTSKLSAGGTPSTQVTEYWENGTIPWMSSG
FT                   EVHKKRVHSVDNCITTLGLENSSAKMFPSKSILVALAGQGKTRGTVAISEIELTTNQSI
FT                   AAIIVKDKSVYPDFLYHNLDSRYEELRGVSGGSGRAGLNLAILGDLDVLLPPLPEQQKI
FT                   AKILTSVDQVIEKTQAQIDKLKDLKTGMMQELLTQGVGVDGKPHTEFKDSPVGWIPKTW
FT                   DLEPLANFTTFISYGFTNPMPEAEVGPYMITAKDVNDLKVQYSTSRKTTQEAFDNLLTR
FT                   KSRPQVNDILLTKDGTLGRVALVTDSNCCINQSVAVLTPNERVIPKFLLYLLASPRYQQ
FT                   EMLENAGGSTIKHIYITVVDKMLVGVPSVTEQQKLVDIFDSVFRKLELTENKLSKLNDT
FT                   KKALMQDLLTGKVRVNID"
FT   gene            345936..346781
FT                   /locus_tag="Sputw3181_0319"
FT   CDS_pept        345936..346781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23170"
FT                   /protein_id="ABM23170.1"
FT                   /translation="MLQAILHGKAGRIDGDKVQSISWREVFKGREDLMTAAVFGRFAYL
FT                   SAPVQATLMQRWLGVTEPAFDDFEKIDFWPSYQLVSNDQKRRVEPDVVLNFASATVILE
FT                   IKPPNGGDQDIDQWQREVESFLLSGERSQLPLFFLAIGRIPNKFVFGNWAKQLSKKLDG
FT                   INAVAWQRVVNDLLELDNGKLACEPNTQDKRIIADILQTAGLYQLRTQFYSWKTLLDHP
FT                   LPRLSLQQALLRDKPPPKAPVQPEPQPFSATQAPHSWHDLAAFATAHPISLKDISTWNK
FT                   "
FT   gene            346769..347446
FT                   /locus_tag="Sputw3181_0320"
FT   CDS_pept        346769..347446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23171"
FT                   /protein_id="ABM23171.1"
FT                   /translation="MEQVDDLLLQVRTAHRLLAAYYQRIVPAIGDMASMLELDFYYWGN
FT                   ADFNSVPSGQYNVTTYDPWRLLPAMNTSYLYYKFADKDKNKIDVGDYFVEFAVISDTGV
FT                   DSHGDGHSNELDALELTPNVDNALSLLRVTICAPYKLFDYNLYNTVWAATAYPEFSLEP
FT                   NPQKDENEVECFVCGFECSLGELMQKNGVEQVVERIQQHISSTVAAAEAEHERVAGGQG
FT                   VAS"
FT   gene            347443..350604
FT                   /locus_tag="Sputw3181_0321"
FT   CDS_pept        347443..350604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0321"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="KEGG: son:SO0380 type I restriction-modification
FT                   system, R subunit; TIGRFAM: type I site-specific
FT                   deoxyribonuclease, HsdR family; PFAM: type III restriction
FT                   enzyme, res subunit; protein of unknown function DUF450;
FT                   SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23172"
FT                   /protein_id="ABM23172.1"
FT                   /translation="MSNDEFDKVERPAIAQLHQLGWRYVPGKTLAPEHSNQERDYLRDV
FT                   VLVKRLTQAIERINPWINEENLRKVVREITHPQCAGLMEYNHGFYQTMVGYLSVEQDIG
FT                   KGKKGQTVKLIDFDDVSNNEFICTNQFKVEGTKQTIIPDIVCFVNGLPLAVIECKSPFI
FT                   STPVACGIDQLRRYANQRHPEDFEGAEKLFWYNQLMVSTCRDIARVGTISSPAQYYGDW
FT                   KDAYPLTDAQIAQVDSDNVVPLAKKLTVEQPVASVDAAGSEQPQVAEPPADYQVAKVTA
FT                   QQRLLAGMFSRENFLDIVRNFILFEPDDGRLIKKVARYQQFRAVNKVIHQLKTGKTRKE
FT                   KSGVVWHTQGSGKSLTMVMLAVKMRHDPELKQYKLVFVTDRTQLDEQLSTTFQGAQGET
FT                   VYNADSVAALRDLLKKDSSDLVTAMVQKFQDAEKEAQQQGDKSFVNINTSDKIIVLADE
FT                   AHRTQFGGLATTINAALPNAPKIGFTGTPLLKTQKMDTAFGGYIDKYKINEAVEDGATV
FT                   RLLYEGREVKTAVAGESLDALFEEYFGDYTKEEQQEIKRKYGVEKAVREAPARIRWVCI
FT                   DLLKHYRERIRPDGFKAMIVVGSRHAATLFKKTLDELKAPPSEVIISGDHNDPQYIAQY
FT                   TDKVHQKKVIANFKKPFGTDAPGTDEKQRKFDNTAFLIVKDMLLTGFDAPIAQVMYIDR
FT                   KLQDHTLMQAIARVNRNYKGKECGYVVDYYGLTSYLTDALELFSSDDIEGTYQSLKDEL
FT                   PKLQAAHTRLKAFFKGVTSDDVDDYVVVLKDDAVRAQFEVAYKRFAKQLNVILPDASAK
FT                   PYIPDMTFFGKVHHAARNRYRDDGMDLLDVGEKVRQLVDEHILSTGVDPKIPPVDLLAA
FT                   NFKEHVQKIKSPESKASEIESALKHHININLEDDPEYYRSLSLRLRDIIEKTAGNWERQ
FT                   LELLLDMTNDLSTAHKQAAQNFGLSETEFAFYNILLAEVTRIHDGDMIDEALHEQIKST
FT                   TQALVQVLDDATQIVDFFNKEDEIKRMKKKIKRVILEQPFGDKALVATLQDRFVELAKH
FT                   KFGNK"
FT   gene            350616..351323
FT                   /locus_tag="Sputw3181_0322"
FT   CDS_pept        350616..351323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0322"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   son:SO0379 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23173"
FT                   /protein_id="ABM23173.1"
FT                   /translation="MQEIEVIKQAGYEVRVERTSRRKSATIKVEEGVVAVVVPKALPSE
FT                   KVHQLLAAKHQWILEKLAIHAEARPLRGKEYVSGEAFPYLGRNYRLKVVSGKVSPTKLV
FT                   DGKITVTVPEYAKQAHFVRRALVHWYKRNADKKIREKVDRYQSVVGVETAVVRIKDFKS
FT                   RWGSCTPYGDLEFNWLIVLAPNRIVDYVVVHELCHLLHHDHSPQFWKEVERVMPDYREC
FT                   KEWLRDHAQLLVV"
FT   gene            351366..352676
FT                   /locus_tag="Sputw3181_0323"
FT   CDS_pept        351366..352676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0323"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bam:Bamb_0004 GTPase subunit of restriction
FT                   endonuclease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23174"
FT                   /protein_id="ABM23174.1"
FT                   /translation="MSFRKSDQKLKVILSAVNVWKEQCLLQSRGVFSNTRTWNYANFEK
FT                   LYEDFVKHPDPSSDKDFFTKLEHQLRNSSANTIRLAAEMLWFMSLASINISTRTKRSNI
FT                   KRVWEWSGEAFDEGHQLLTDGVLGGYAKTGVSFNTNRWRELTYFINVMLAFYKEKPEKR
FT                   GELLAEGQTLAQWLEGIEDTSNRQFRHILLFLLFPKQFERITSNTQRKQIVQAFENITS
FT                   RQVNKLFCWQIDELLLGIRKRESKRLGTDDIEFYRSPLKEVWDPVDSEIMTEDEQDISD
FT                   EQKAIKDEEQRSKEIEQSSRSDKNKKQLIEARNGHGKYRKNLSKVETDCRITKIKDKKF
FT                   LTASHIKPWRHCNDKECLDGYNGLWLAPHIDRLFDRGWITFDCSSGALLCANANVERVL
FT                   ELWGIEQGTSIDTLKKEQAHYMKYHNEQIFKGNAKKK"
FT   gene            352755..353414
FT                   /locus_tag="Sputw3181_0324"
FT   CDS_pept        352755..353414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppr:PBPRC0061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23175"
FT                   /protein_id="ABM23175.1"
FT                   /translation="MDFFEYWNSCLAMGLTKHPDDLVVLDELHHDLNKAIDCEFEFGLP
FT                   PGPFFGPLKTAKIVLCYANPSRDESTAEVVASTALKERLFAQLDGLQSYPYQIPGWDKW
FT                   FKPVANSLFDGNCELASKHISVFNLVPYASTNMDQVQSFATSLPSVWAAQEYLRRTLIP
FT                   QALREEILLVMCRSSQLWGLQTPHRANNIVINKTRIGFTDDTKMQVKLWCRQIGIN"
FT   gene            353500..353883
FT                   /locus_tag="Sputw3181_0325"
FT   CDS_pept        353500..353883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23176"
FT                   /protein_id="ABM23176.1"
FT                   /translation="MAFVKLLVSGDIDVFVLVAKPWGTRRSYEKELHSAYLFDSVPPEF
FT                   IRRLSHILDGVLLGGHISHEGGCEVICSIPRMISVLRGMGCDVTPDENYDTMLELAAIP
FT                   LTAAQKRARQADIKKERDEGIVY"
FT   gene            complement(354054..354329)
FT                   /locus_tag="Sputw3181_0326"
FT   CDS_pept        complement(354054..354329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23177"
FT                   /protein_id="ABM23177.1"
FT                   /translation="MIKNNPLIINKQRLAKEDGSKHLSFHTQTHICPPIFFASTELTPS
FT                   QFAAQMTFDMRAQRKHGDNYSHRVRNCAFVRNYQKEFKQHQMTLWD"
FT   gene            complement(354395..355330)
FT                   /locus_tag="Sputw3181_0327"
FT   CDS_pept        complement(354395..355330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0327"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO4260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23178"
FT                   /protein_id="ABM23178.1"
FT                   /translation="MTKQTATTNALSTSRNQNRHFCINSHNSALFPYKNHAYEVYKPKA
FT                   LDLDYRSLKTIIADYEIMLSHYCRVLVCRIDLHPQTASADNQAISLFLNNLESTLSSKY
FT                   RTKIIFHCAREQDGADKEHYHLELMLSGHRVQHSSKLLSLVKNMWKEQGTVAFVDKPYC
FT                   IIRRGNKASIKVAFYRSSYLAKEHTKELNGKAKGFISNKLKPSARFDLSTDLMLVDPHI
FT                   TFEQKHRKQLYKANPPATSSANPKAATKTKYGWFVTLDHSQQLKECIASRTSSLSHLLD
FT                   ATELEHAMPLDHTYRGLQAPHEPRSGHIPL"
FT   gene            complement(355753..355968)
FT                   /locus_tag="Sputw3181_0328"
FT   CDS_pept        complement(355753..355968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0328"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /note="PFAM: Prophage CP4-57 regulatory; KEGG: cps:CPS_2017
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23179"
FT                   /protein_id="ABM23179.1"
FT                   /translation="MNMNPSNHESSDRLVREAERKSITSISRTTAWQLERKGLFPKRRQ
FT                   LYPQSNHVCWLLSELNAWVSNRESIN"
FT   gene            complement(356078..356911)
FT                   /locus_tag="Sputw3181_0329"
FT   CDS_pept        complement(356078..356911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23180"
FT                   /protein_id="ABM23180.1"
FT                   /translation="MAVMPKNVKKARICDLKNMILPEMAPDQLKILGVKLEDFYPDNLA
FT                   DTQASNAGGIELIKLLERRTNELLRLGSELYVNKNHHSSSQIELVQQNIHVFMTQCMTL
FT                   LKLASPSMPESEPYYKIIDRLVETAVYIGYYAGSNDTLALTDRYTDLGFEATVTRTQAG
FT                   GQGKAKKTICLKELVIEMANCIYLDPDCVAASKENVAEAIYWIIRDFSAKGTNKGISAL
FT                   LKFSDRHPEQHTIYNWIKTITKPVNRLKTPKPSLAVIKAKLKRSFTDKQISSKIK"
FT   gene            complement(356921..358189)
FT                   /locus_tag="Sputw3181_0330"
FT   CDS_pept        complement(356921..358189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0330"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   sdn:Sden_0317 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23181"
FT                   /protein_id="ABM23181.1"
FT                   /translation="MNDKQIKSFLKSKELGRKAVGDGLYIRVQTEGVAYWEVRYSVNGK
FT                   RRSMVPNGGIYPAMSLVEAKAEAAKVKLLAKQGIDPLAERERQQEITIKTVNDLFDDWY
FT                   QCTAPRLKHPEIPMRMYTKDIKPAIGQLKVTDVNARDIRAILHKVVKSNRPTVANKTLL
FT                   FCKQLFNHACKLDVASGNPAAAFNTADAGGLEKNRTRVLSLNEIAAAFPVLRNSRPIFS
FT                   HENYLAVALLLCLGVRKGELIAAKWSEFDFNQQVWRMPKERSKTGVGITIPLSEFVIEW
FT                   LKELKIIACGSEYVFPARKASKRREYIANDTLNHALAKLFGQKHDSNKQPFENLLGKVG
FT                   VEHFTVHDLRRTCRTLLASLKVPPHIAERCLNHKLKGIEGTYNHHDYLEERREALDKLA
FT                   ALISPIINNQTNVISFIKPQSAK"
FT   gene            complement(358391..359254)
FT                   /locus_tag="Sputw3181_0331"
FT   CDS_pept        complement(358391..359254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0331"
FT                   /product="YicC N-terminal domain protein"
FT                   /note="PFAM: YicC N-terminal domain protein; domain of
FT                   unknown function DUF1732; KEGG: shm:Shewmr7_0351
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23182"
FT                   /protein_id="ABM23182.1"
FT                   /translation="MIQSMTAYARIEHKAQWGTASWEIRSVNQRYLETYLRLPEQFRSF
FT                   EPVLRDRLRKRLSRGKVEVNLRYELADNSNNELQLNQALAKQLLDAATWLKQEAGQGDV
FT                   NLTDILRWPGVLASGEQDMDAIGADLMTAFDSAIDQFIEARGREGEAIKDMLLSRLDGV
FT                   SEQIAIVREHMPTVMLYQREKLTNRLAEIKGELDPARIEQEMVLLAQKQDVAEEMDRLE
FT                   AHVAEARRILKKGGSEGRRLDFMMQEFNRESNTLASKSISTEITSAAVELKVLIEQMRE
FT                   QIQNVE"
FT   gene            359729..360442
FT                   /locus_tag="Sputw3181_0332"
FT   CDS_pept        359729..360442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0332"
FT                   /product="RNAse PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: son:SO4256 ribonuclease PH; TIGRFAM:
FT                   ribonuclease PH; PFAM: 3' exoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23183"
FT                   /db_xref="GOA:A1RET8"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RET8"
FT                   /protein_id="ABM23183.1"
FT                   /translation="MRPSNRTPAQTRPITITRQFTAHAEGSVLVEFGETKVLCTASFTE
FT                   GVPRFLKGQGQGWVTAEYGMLPRSTHSRMDREAARGKQSGRTQEIQRLIGRALRACVDM
FT                   KALGENTIVIDCDVIQADGGTRTASITGACVALVDALNWARGKGIIKSNPLKFLIAAVS
FT                   VGIYKGEAISDLEYIEDSAAETDMNVVMTETGKIIEIQGTAEGEPFTHEELIELLGLAK
FT                   NSIREIVDVQKAALN"
FT   gene            360610..361251
FT                   /locus_tag="Sputw3181_0333"
FT   CDS_pept        360610..361251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0333"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: she:Shewmr4_3603 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23184"
FT                   /protein_id="ABM23184.1"
FT                   /translation="MKAYQREFIEFALERQVLRFGEFTLKSGRISPYFFNAGLFNTGRD
FT                   LARLGRFYAAALVDSGIDYDLLFGPAYKGIPIATTTAVALCEHHDIDIPYCFNRKEKKD
FT                   HGEGGSLVGSELKGRVMLVDDVITAGTAIRESMEIIEAHKAQLAGVLIALDRQEKGKGE
FT                   LSAIQEVERDFGCGIVAIIKLADLISYLSEKPGMEVQLAAVSQYREQYGI"
FT   gene            complement(361310..361954)
FT                   /locus_tag="Sputw3181_0334"
FT   CDS_pept        complement(361310..361954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0334"
FT                   /product="GTP cyclohydrolase"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: GTP cyclohydrolase I; KEGG: son:SO4254 GTP
FT                   cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23185"
FT                   /db_xref="GOA:A1REU0"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REU0"
FT                   /protein_id="ABM23185.1"
FT                   /translation="MALSEAAVKVQAALLERGLETPMLPSVYSSEERKDKIEHHMKEIL
FT                   TLMSLDLSDDSLADTPRRIAKMYVDEIFSGLDYENFPKITVIDNKMGFDEMVRVQDISL
FT                   TSTCEHHLVTIDGTATIAYLPRKKIIGLSKINRIVRFFAQRPQVQERLTQQVLVALQTL
FT                   LETKDVAVKMDAVHYCVKSRGVMDSTSSTTTTALGGIFKSNPATRAEFLHQ"
FT   gene            complement(362178..362771)
FT                   /locus_tag="Sputw3181_0335"
FT   CDS_pept        complement(362178..362771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0335"
FT                   /product="cell division inhibitor SlmA"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: son:SO4251
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23186"
FT                   /db_xref="GOA:A1REU1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REU1"
FT                   /protein_id="ABM23186.1"
FT                   /translation="MAVSPKINRREHILQCLAQMLETSPGQRITTAKLASEVGVSEAAL
FT                   YRHFPSKARMFEGLIEFIEESLLSRINIIMDDEKDTMKRCQLMLQLLLIFAERNPGISR
FT                   VLNGDALLGENERLRSRISSLFAKIETQLKQILREKTLREGRGFNLDEAILANLLLAFA
FT                   EGRIAQFVRSEFKLKPTTHFDEQWRFIQHQLLQS"
FT   gene            complement(362804..363262)
FT                   /locus_tag="Sputw3181_0336"
FT   CDS_pept        complement(362804..363262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0336"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="KEGG: shm:Shewmr7_0357 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; TIGRFAM: deoxyuridine
FT                   5'-triphosphate nucleotidohydrolase Dut; PFAM: deoxyUTP
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23187"
FT                   /db_xref="GOA:A1REU2"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REU2"
FT                   /protein_id="ABM23187.1"
FT                   /translation="MKTPIELKILDSRIGSEFPLPAYATLGSAGMDLRAMIDTTMTIAP
FT                   GETQLIPTGIAIHVADPGLAAVILPRSGLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNR
FT                   SNSPFTLDIGDRLAQLVFVPVVQAQFKLVDEFDSSDRGEGGFGHSGTK"
FT   gene            complement(363259..364479)
FT                   /locus_tag="Sputw3181_0337"
FT   CDS_pept        complement(363259..364479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0337"
FT                   /product="Phosphopantothenate-cysteine ligase /
FT                   Phosphopantothenoylcysteine decarboxylase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="KEGG: shm:Shewmr7_0358 phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase;
FT                   TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23188"
FT                   /protein_id="ABM23188.1"
FT                   /translation="MMSVSLTNKNVLLGIGGGIAAYKSADLVRRLKERGFDVRVVMSQS
FT                   AMEFITPLTLQALSGHPVASSLLDPAAEAAMGHIELARWADLVIIAPATANLLARINAG
FT                   MADELITTTCLATEAQIALCPAMNQQMYRNLATQANLTSLASRGLTLWGPASGSQACGE
FT                   VGPGRMLEPLEIAELASDFFATKEVSAQPLAGQSVLITAGPTREAIDPVRYISNHSSGK
FT                   MGFALAKAAADMGAAVTLVSGPVNLSTPEGVARIDVESAQNMLDAVMDNIDKKDIFIGC
FT                   AAVADYRISDIATCKIKKSAEKMQLALERNPDILATVASLPNRPFVVGFAAETHDVETY
FT                   ARDKLKRKNLDMIAANDVSVTGQGFNADTNALCVFWPLGSQDLPATDKLTLARQLLSLI
FT                   VKEKTNT"
FT   gene            364602..365279
FT                   /locus_tag="Sputw3181_0338"
FT   CDS_pept        364602..365279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0338"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG:
FT                   she:Shewmr4_3597 DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23189"
FT                   /db_xref="GOA:A1REU4"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REU4"
FT                   /protein_id="ABM23189.1"
FT                   /translation="MGIKDWPEGEGPRDKLLQKGAAYLSDAELLAVLLRNGLAGLNAVD
FT                   LARSLISEFGGLRNLLCAPKNQVCRLPGVGPVKYAQLQAAAELARRVAQENLQRGQVLT
FT                   NPDLTRDYLMRQLTDRSYEVFAILLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVLE
FT                   KKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLDHMVVGDREIVSFAERG
FT                   WIN"
FT   gene            365401..365637
FT                   /locus_tag="Sputw3181_0339"
FT   CDS_pept        365401..365637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0339"
FT                   /product="LSU ribosomal protein L28P"
FT                   /note="PFAM: ribosomal protein L28; KEGG: shm:Shewmr7_0360
FT                   ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23190"
FT                   /db_xref="GOA:A1REU5"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REU5"
FT                   /protein_id="ABM23190.1"
FT                   /translation="MSRVCQVTGKKPMVGNNRSHAKNATRRRFLPNLQNHRFWLEEEKR
FT                   FVQLRVSTKGIRLIDKKGIEVVVAELRARGEKV"
FT   gene            365644..365817
FT                   /locus_tag="Sputw3181_0340"
FT   CDS_pept        365644..365817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0340"
FT                   /product="LSU ribosomal protein L33P"
FT                   /note="PFAM: ribosomal protein L33; KEGG: shm:Shewmr7_0361
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23191"
FT                   /db_xref="GOA:A1REU6"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REU6"
FT                   /protein_id="ABM23191.1"
FT                   /translation="MAKAKGNREKIKLVSSAKTGHFYTTEKNKRNMPEKMEIKKFDPVI
FT                   RQHVIYKEAKIK"
FT   gene            365987..367240
FT                   /locus_tag="Sputw3181_0341"
FT   CDS_pept        365987..367240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0341"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pha:PSHAa2360 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23192"
FT                   /protein_id="ABM23192.1"
FT                   /translation="MEHFYHLVETDEYFEIGDVEITDEFINSYHTEKSVSYEEIQFFFT
FT                   VDKPMSFKGVFMLFTSEGKPVFEPNAYILSRRIVEGTKDVKPTCFHLLRYYRYLDANNL
FT                   NWEDHEERLQRYPIFLYRAYLDNEIEKGNLSRSTAVAALSIVRRFYLFCYRHGYISQLP
FT                   FEITGTTKYGQTLTDCSIRSAIRETNLQPLNDLDLQHVRDNWRCNGLSQEFRLMISVAL
FT                   SVGLRAIEVTDIKPRHFAIPKGFKGKTLTGIWIGPDHDCKTKYDINRQVSMPVWLMESV
FT                   HEYHGSERYKKRQQLYFMKTGDTNPPAFINKDGDPFTTSSLNSLWSKLRTAIQENSNPH
FT                   FKHKEHDCRATFGAYKLESLTQIKELSMMQALKMLKDEMGHKDLETTMLYLKHYEGNPE
FT                   KNHIPEITMNLLEDEMLS"
FT   gene            367237..368979
FT                   /locus_tag="Sputw3181_0342"
FT   CDS_pept        367237..368979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0342"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vch:VC0184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23193"
FT                   /protein_id="ABM23193.1"
FT                   /translation="MTEVIDTEQTERARTYRSTPTTEMVTDNTLIAITKWKYVWKNSGG
FT                   GNSTCDFAQLKAYATDEHIRLLISKFQQSGWRETSKSTNFRYIRQVLSRAFNTQSGKQK
FT                   VKVQLSPETCTQYIHAAYLSMASTGVGLNGKPIKAKTLGWLSSNLNSICKKFGFGTIPK
FT                   AARNLDTRSASLDSNNYTPKQLRSIAFALLADRKALLARYQDESLPEAQRRTAFNRLVY
FT                   NAMFITIYYLGTGRTETLSMFLDDEWVCKKSGAGRISIEGFKARGNKVEQRYFTPRASC
FT                   KRFFESHLSLSKAHSVSLGLDKHYLFRKANGMVPNSNNFNNYSQNYLVNYSERIQLLIK
FT                   ENPDFRLNCNLLKSSIKQYAEQKLGRSKAAENTRNAPQTYDNSKYGKVSKGEARSQLAL
FT                   GLTALHNLGKNPDGGTVIAVAQAKEAVGLVISHEEWEVLKEAAAEYGVVKNQNGGFCKG
FT                   ANTPQKKEFQKNVDKSDFLSDEEKSQLGCGFVVKCFGCSNFGVVDDPHDIWRLLSFEQR
FT                   LNEAMVVHQNVEHFITNFGEVKANLNKLKARFKKAHLKAAMKLLERECHPLWDENSVMD
FT                   IFRG"
FT   gene            368983..370887
FT                   /locus_tag="Sputw3181_0343"
FT   CDS_pept        368983..370887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0343"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   vch:VC0183 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23194"
FT                   /protein_id="ABM23194.1"
FT                   /translation="MYSVSYDVGKFEQYAFPSMPGSFPMPCDETVVSVDKDGNPVSYFK
FT                   DDIWDFNAFFNLTNESKSLYQINFHPKKHNPELLIELKQRIYFLIWGSQGSLLHMEGDA
FT                   FRKFSHCHDLARWSNAALRVFKGTPIDSFPLLSNELVFGQLLYEGKKHSEETVSHRLKA
FT                   LSVLTQLNQHFPEPRRFSLGLPEGKTIKKMAKQYSAAGRGHYPTVIPVIYEQLMGRLIE
FT                   NVTTAHNKLEDLGDVKAYAKKYVVTERQAYDEFRAIGGACFMTLSAFTGMRISELTQID
FT                   STSYKEVDLDGIKLCTLRSWTRKLDKLPREDAWACAPICKKALEVLTVLNDSYRSNKGS
FT                   IHCSPRFRLDGSSGKGDNISSQLEDVVLNKQNLSSLFVYYSKHLDITYDPDEMDEVYGL
FT                   LNPVVPAIYIPIKERGDGSIYWHFTTHSLRRTFAHFVVGNGLVSLAALKHQFKHIRLSM
FT                   TAIYASHAEVLTLLGIENPANIKKAVEDAEMESHKTYLRDMIAHPEEQSGGFMKVFEGD
FT                   PRVMTEEQFEELAQKTKEANKSTGYGRCFAGFKCKMEHLFEQSSCLGRDCENLNINKDE
FT                   ALRWQARHGRIAVRLQQMKEMGFYNQNTLARELTDIRAAEKVMRDHNIEFKRFKLGAL"
FT   gene            370887..371285
FT                   /locus_tag="Sputw3181_0344"
FT   CDS_pept        370887..371285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23195"
FT                   /protein_id="ABM23195.1"
FT                   /translation="MANVKTKLLNAFESLKSEGKKISPYAVEKRAGVANGSCKNHPAVL
FT                   EIILDEKARYHPNPTVAKKGEPRQKKHIDKERYDDLEESNKRLRAESGQFRDEMKVMAT
FT                   FVAQLTWELHRYKTSTRQHSINVKNIKV"
FT   gene            371524..372624
FT                   /locus_tag="Sputw3181_0345"
FT   CDS_pept        371524..372624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sec:SC146 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23196"
FT                   /protein_id="ABM23196.1"
FT                   /translation="MELQTRLVFIDTSAFEEKNYQFGQHALGRLQELIEDKKIHLLITD
FT                   VTKKEINAHLKRKSEEAASMIKKMQRDAMFLRNTPDLDCHGIFTKVKGDDIYAVISEKF
FT                   DDFVENGHVETIDVSTVNPQVVFHAYFNNLPPFGKESKKHEFPDAFALEAIKKVSLARG
FT                   HLAYIVSDDGDMKSFCDQEDNFIHLENVDDLIDLIVRSDKAYEEPAKFADEVFEQLLEQ
FT                   IKADALQALEDGEFNYEDADPFDEIINSIEINSVNVEKKNLQNVDAEWAEYEVEFEVVV
FT                   TANYRVSDYDRSPWDPEDKQYVFVLSNESTVKHKETYTAHLTLAYDDGLKAKAYIEELY
FT                   FQDAYFELTDNDSEIIHFKELDINGE"
FT   gene            372626..373585
FT                   /locus_tag="Sputw3181_0346"
FT   CDS_pept        372626..373585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sec:SC145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23197"
FT                   /protein_id="ABM23197.1"
FT                   /translation="MKLYVIGNGFDVHHGLDTKYTSFGLYLKNNYWETYDLLIEHYGFG
FT                   DLNPDYPTSMSDLLWSEFETSMSLLDKDSVLEANMDAMPSYSSDDFRDRDRYTLEIEME
FT                   RILGLLTTDLYKAFKEFILSVQFPQFDHSRSVNIDRDAVYLTFNYTDTLSKYYAIPDEN
FT                   LLFIHGKADEHVDKLILGHGVDPENFKERLAEPPLGLSDEDLERWMEYQSDQYDYSFER
FT                   GKDAINQYFSATFKGTDQIIKNNEDFFAKLGNIDEVYVLGHSLADVDLPYFQKLEQSVR
FT                   PDAKWVATFYDSDDEEVHCDTLTGLGIANVSVVRMEQI"
FT   gene            complement(374421..374780)
FT                   /locus_tag="Sputw3181_0347"
FT   CDS_pept        complement(374421..374780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebB231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23198"
FT                   /protein_id="ABM23198.1"
FT                   /translation="MGWLLTKYMITAAVVVAASELAKRSDKLGALIVALPLVTILAMVW
FT                   LYVEKQPMEKIANHAWYTFWYVIPTLPMFLIFPSLLQRLGFWPSLLVSATITVICFWLF
FT                   ALFVKIFGIDLISWH"
FT   gene            374870..375247
FT                   /locus_tag="Sputw3181_0348"
FT   CDS_pept        374870..375247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0348"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; Penicillinase
FT                   repressor; KEGG: sfr:Sfri_2523 transcriptional repressor,
FT                   CopY family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23199"
FT                   /protein_id="ABM23199.1"
FT                   /translation="MQLGELEKQVLQHLWTESEADAKQVHAVLGLSRESSLNTIQSTLD
FT                   RLFKKGLLSRTKQGHAYFYRAKVDREALIAKLITNVTSDFVEEGEHSLIAAFSSVSANL
FT                   NDAQLDILEHLIEEQRQLRKG"
FT   gene            375256..376236
FT                   /locus_tag="Sputw3181_0349"
FT   CDS_pept        375256..376236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0349"
FT                   /product="peptidase M56, BlaR1"
FT                   /note="PFAM: peptidase M56, BlaR1; KEGG: sfr:Sfri_2522
FT                   peptidase M56, BlaR1"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23200"
FT                   /protein_id="ABM23200.1"
FT                   /translation="MFVGDLAITLNLLSVAVLAFAISVVFISIALRFTLPRLDYLTFRL
FT                   RKVILWSLVTAPWWIAINCVVFFWPKQQDLFSAAWLNEFVHWHHVDIFSFDSWHAVTLL
FT                   SASGFLIWSMIKTVYSRKKQSSTMASLLGFSDVYPQEANSQHRYYLLPLAIPAAFTTGL
FT                   ISPKIYLTTALQERVNEQELDIIIRHEMAHVAARDPLFKVIFATFAGFFPLGMKQHFVR
FT                   QFTLLTEQIADHAVTNEHDNLDVAQALVNVARMQRSVTLGCDGLQTSYFGNDQTSVRVQ
FT                   RLIYPVCTSSRLAIGLAIVLLVIAPVLTASTVDSLHHIIETFFTH"
FT   sig_peptide     375256..375321
FT                   /locus_tag="Sputw3181_0349"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.624) with cleavage site probability 0.528 at
FT                   residue 22"
FT   gene            376250..377533
FT                   /locus_tag="Sputw3181_0350"
FT   CDS_pept        376250..377533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0350"
FT                   /product="outer membrane efflux protein"
FT                   /note="KEGG: tcx:Tcr_2097 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23201"
FT                   /protein_id="ABM23201.1"
FT                   /translation="MKAILCKRTAKKPIGHRFSAALIGMSIILSVSAATDENPQKISLS
FT                   DAVTMTLTHHPDLQAFVSQQRVWEGRIQQASVGERPEIGLMIEDALGTGEHSALKSMQS
FT                   TLTFSWLLQQDLIDSRVNTAKTEATKLAIEKQIKALDLSSQVAKHFIDILVKQERLKLN
FT                   VMAKAQAENVVGTIAKRVQVGKSSAVEMQLAKAEFIRRGLAVEDIEHELQASQYQLASF
FT                   WGKPQASYYFNGDLLDMPTVPSVDSQLTLLKQNPRFQQFASAQRIAQSQMELARIEAKP
FT                   QWQFTAGVRRYEASDDFGLVAGVSIPWGTSDRNAGTIAALHAQQDVLANEQSALMQAQD
FT                   AQLYVLLQEMAHSAHVIDTVRNSIVPTLEKALSEASNAFDKGQLSYNQYNDVYRELLSA
FT                   QYQLLDAFESLHLQHIEIQRLTGTSISQ"
FT   sig_peptide     376250..376351
FT                   /locus_tag="Sputw3181_0350"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.613 at
FT                   residue 34"
FT   gene            377542..378786
FT                   /locus_tag="Sputw3181_0351"
FT   CDS_pept        377542..378786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0351"
FT                   /product="secretion protein HlyD"
FT                   /note="KEGG: tcx:Tcr_2096 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23202"
FT                   /protein_id="ABM23202.1"
FT                   /translation="MKNNHILSSLSLAILLSMGMNAVIPTPVMASSAPVAEQAEPEKGP
FT                   HRGRMLREGNFALELSIFETGVPPEFRVWLTYEGKPLDPKTVDLSVKLTRLGNVVDDIR
FT                   FNAQGDFLRGDMEIYEPHSFVVTIEAKYQGKTYLWQYDNFEGRTTIEQAVATAMDIQTD
FT                   IAGPATLHQTIPAYGTLALPVESQRAIAARFEGEITQLYVGLGDRVKKGQPLLTIESNE
FT                   SLKPYQIKAPSDGVVTQQFANSGEQTLGRSLLTLTDNSHYIAKLAVYPIDYQKVSIGAA
FT                   VTLQIEGSDETYQGTVSFIEPQVRDDQARIVWVKLANEKGAFTSGSFVHAKIEVATIEV
FT                   SLAVKRIGLQGFRDFTVVFAKVGEQYEVRMLELGRQGGEWVEVLGGLKPGTEYVTENSY
FT                   ILKADIEKSGASHDH"
FT   sig_peptide     377542..377634
FT                   /locus_tag="Sputw3181_0351"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.984 at
FT                   residue 31"
FT   gene            378798..381941
FT                   /locus_tag="Sputw3181_0352"
FT   CDS_pept        378798..381941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0352"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: tcx:Tcr_2095 heavy
FT                   metal efflux pump CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23203"
FT                   /protein_id="ABM23203.1"
FT                   /translation="MLESILRISIKRKFLVLVMVLALAGLGIWNFTKLPIDAVPDITNV
FT                   QVMINTEAPGYTPLEIEQRVTFPLETALAGLPGLTYTRSVSRYGLSQVVAIFSDDTDVY
FT                   FARQLVNERLSAARAELPVGLEPQLGPIATGLGEIFMFTVDALPDATHADGSPITPMDL
FT                   RTVHDWTIRPQLMRVPGVVEVNPIGGFEREILVAFKPEKLLAFGLTQADVVDAIAKNNQ
FT                   NQGAGFIEQNGAQWLLRMPGQAEDMATIGNIPLKSANGSALTIKDVAEIENGQGLRNGA
FT                   ATQNGREVVMSTVFMLIGENSRTVAHAVGEKLTEINATLPEGIVATAVYDRTTLVDKTL
FT                   QTVQTNLLEGAILVIVVLFVLLGNFRAAFLTALVIPFAMLMTITGMVQTRVSANLMSLG
FT                   ALDFGLLVDGAIIIVENCLRRLSQAGDDPLPLKERLELVFEATREVIRPALFGVFIITA
FT                   VYLPIFALEGVEGKMFHPMAITVVIALLSAMLLSVTFVPAMVALLFKKPVKEKHSPLIR
FT                   GAVFLYRPALSWVIKGRWMVVIAATLLVAIFGYQATKLGSEFAPNLDEGDIAMHALRIP
FT                   GTSLSQAIALQETLEDKIKQMPEVERVFAKIGTADVATDAVPPSVADNFIILKPREQWP
FT                   NPNKSKAQIVEELAALVAPIPGNRYEFLQPIQMRFNELLAGVRAELAIKVFGDDFDTLT
FT                   ALGAEIESAIAQVEGVADIQVEQSTGLTMLNIIPNRQKLMQHGISIMEVQSQVATAMGG
FT                   TVAGKFYQGDVRSDIVVRLDESRRQNIDALSYLPITLPGGQSIPLQELASLELVSGANQ
FT                   INRENGKRRMVVTANVRGRDLGSFVADIQTVIGEKVAIPAGYWLEYGGTYQKLQSASKR
FT                   LSIVVPVTLLMIIGLLMLALNSFKDAMIIFTGVPLALTGGIAALLLRDIPFSISAAVGF
FT                   IALSGIAILNGLVMVSFIRQLRKEGMGLDSAIFEGALTRLRPVITTALVASLGFIPMAL
FT                   NTGIGSEVQRPLATVVIGGIISSTLLTLFLIPALYRILHKEKESILTEVEAMELVDAK"
FT   sig_peptide     378798..378890
FT                   /locus_tag="Sputw3181_0352"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.649) with cleavage site probability 0.383 at
FT                   residue 31"
FT   gene            381931..382626
FT                   /locus_tag="Sputw3181_0353"
FT   CDS_pept        381931..382626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_2521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23204"
FT                   /protein_id="ABM23204.1"
FT                   /translation="MPNKLLKISLFLLIGLLGFISVDVLAHGVDDNTRAFLEQNQGVQF
FT                   IPFLYIGAKHMITGYDHLLFLVGVIFFLYRSKDVLLYVTMFTIGHSTTLLLGVMTDVQV
FT                   NAYLIDAIIGVSVIYKGFDNLGGFKRCFNWQPNTQMAVLIFGLFHGFGLATKLQEFELS
FT                   QEGLFTNLLAFNIGVEIGQFAALAFILIVINAWRHFPSFQRFSTLTNTALMSAGIMLMG
FT                   YQLTGYFVN"
FT   sig_peptide     381931..382011
FT                   /locus_tag="Sputw3181_0353"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.983 at
FT                   residue 27"
FT   gene            382646..383176
FT                   /locus_tag="Sputw3181_0354"
FT   CDS_pept        382646..383176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_2520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23205"
FT                   /protein_id="ABM23205.1"
FT                   /translation="MQHTVSSTTLVKASISATVIAAVALVTFILPAEYNIDPTGVGQKL
FT                   GLTTLAQAAEAEGVVSTQGLGEKNSQEFQTIEVVVPAGRGVEYKFAMPQYAKMTYEWLT
FT                   DGDALYFDLHGEPEGDTTGYFESYTIATSNEMKGSFTAPFAGSHGWYWKNKSDKPIAVQ
FT                   LLVKGQYDVIGLK"
FT   gene            383202..383534
FT                   /locus_tag="Sputw3181_0355"
FT   CDS_pept        383202..383534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_2519 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23206"
FT                   /protein_id="ABM23206.1"
FT                   /translation="MKKLITVVALCGLLMNGSALAHADHGVISGQGAIKVAAKSLNQMT
FT                   FKDFGFEVGKLDGSWKEVPESQLSIVTFEGNFYVISAVNPTTKKQVFLKIASNGELLEV
FT                   KDTNKF"
FT   sig_peptide     383202..383267
FT                   /locus_tag="Sputw3181_0355"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.913 at
FT                   residue 22"
FT   gene            384231..384962
FT                   /locus_tag="Sputw3181_0356"
FT   CDS_pept        384231..384962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23207"
FT                   /protein_id="ABM23207.1"
FT                   /translation="MPTLLWVKMPSDWLGKGILREHFSSRREKDISGEISALKIYICLC
FT                   LYSDRKMIPYPPILQVHLKVLRERELIGSSLTYDQLSEYCSLSRVLVSRGLKKLISCGL
FT                   IHKQGTTRKVVYEIVGLSISGWCKLPCRALLGPNGRVVSFTGLKNRYPSERDALKLFLY
FT                   LLSIRQNSLSEVSVSRGKISQTTGLSVYDIDSSIGVLRAIELIEDVKSLGYKMNTSSLP
FT                   QESDRLAQYLVKGGKSLNLKK"
FT   gene            385395..385748
FT                   /locus_tag="Sputw3181_0357"
FT   CDS_pept        385395..385748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_2217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23208"
FT                   /protein_id="ABM23208.1"
FT                   /translation="MAKNPIEFNYLSIGKYMHEFLAWYTSPLGTTIAWFCTVVGFIFSL
FT                   SQRNEKKKLKVQCESYQASNYEFKVKCEKLEANNYELQQQIISIKNNSTHDNQQDVKQE
FT                   GTTNCSGTLNLAT"
FT   gene            385793..386104
FT                   /locus_tag="Sputw3181_0358"
FT   CDS_pept        385793..386104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0358"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   vch:VCA0792 transposase OrfAB, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23209"
FT                   /protein_id="ABM23209.1"
FT                   /translation="MNKSKRARYSAAIKLETAQLVIDQGYTQEAAAKAMNVGKSTVSKW
FT                   VTQLQVERKGLTPKASPMTPEQIEIRALKREIERINLEKEILKKATALLMSDSLNNSR"
FT   gene            386143..386652
FT                   /locus_tag="Sputw3181_0359"
FT   CDS_pept        386143..386652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0359"
FT                   /product="IS911 ORF2"
FT                   /note="KEGG: sdy:SDY_4291 IS911 ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23210"
FT                   /protein_id="ABM23210.1"
FT                   /translation="MLCHAFNVNRSSYRYWVSHEHIVTSEQRRLECEIKALHAQSNQSA
FT                   GARNIATIASERGFALSRYRATRLMKKLGLVSCQQPKHHYKKTGKEHVTIPNILERQFA
FT                   VVEPNTVWCGDVTYIWAGNRWCYLAVVLDLFSRKAVGWAMSFSPDTELTAKHWKWHLNH
FT                   GVSLKT"
FT   gene            386616..386975
FT                   /locus_tag="Sputw3181_0360"
FT   CDS_pept        386616..386975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0360"
FT                   /product="transposase OrfAB, subunit B"
FT                   /note="KEGG: vch:VCA0791 transposase OrfAB, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23211"
FT                   /protein_id="ABM23211.1"
FT                   /translation="MAFESRGKPKNLIFHSDQGSHYTSLKYRQRLWKYQITQSMSRRGN
FT                   CWDNAPMERFFRSLKTEWVPTQGYKSFIEAKQDVTDYIIGYYSQVRPHHYNAGLSPNES
FT                   ERRFWEDSKAVAKFS"
FT   gene            387050..387598
FT                   /locus_tag="Sputw3181_0361"
FT   CDS_pept        387050..387598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_2216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23212"
FT                   /protein_id="ABM23212.1"
FT                   /translation="MTGTLVQIQEVNGDFNNSEPPESKVDSIINDVISELSQVQVTIDI
FT                   KDRTFPSKVSKKIKHNQLRNNRSIVLKYKSYSSHIESAYGTVEKNIVNGKQTALLILHD
FT                   MYEKALHKFNIDVWEPDMDAIKQHADGIIDDIRTQLTKFLYKSSNINFTKEQMALGVDI
FT                   VIAHAFVECYVLENPNDTD"
FT   gene            387808..389502
FT                   /locus_tag="Sputw3181_0362"
FT   CDS_pept        387808..389502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_2215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23213"
FT                   /protein_id="ABM23213.1"
FT                   /translation="MKLLKLTTKVDGCIIREIEFKDTLNIITNKRDSSLSGNQIGKSVP
FT                   GRIIDFLLDGSIGPIYIDEEFDTAEPHIHKLFNEHNVTCTLAYIGLDGNIAEIKRNLAI
FT                   ESTDRSYYVNDEVKSKKEYNNHILNTMFNVYSDKPTLRKLAPKFLRTDTHRMTKTVKFN
FT                   DDKFKISQADRNTLFLYLFNFGDTEILSAIQSIKTFLSNYDNKLKSFNGIIKDDKILST
FT                   INSTQKELRKLERSLLLSENNIDKLAIIGEINHIDNEQNKLSNQILSLDLKVNNIKKTQ
FT                   KLLESNKNHQLLSELETIYGYASVKLGAVINDYDNVLKFHNYLVETKTEFVTDGLDKLE
FT                   DQLLDNTLKLKALEQNKSSLYHELKSKKKIEEISESVKTIGELNKTLIELNAIVEKKNS
FT                   IEDRLKKETERLEGLSGRLAAELQNVHIFETEFKKHFKAYTNTFYGVEYNFNLNLDATN
FT                   GNCQPTVDDIQSNNDGGLKRLEVITFDLSYIKTVDSLGLKRPTFVVHDSIDEVDIKHIR
FT                   QLFDESIKLSGQQVVSMLVSQLEDNDYEKYKNYIVLELSQEDKYFKV"
FT   gene            389699..389893
FT                   /locus_tag="Sputw3181_0363"
FT   CDS_pept        389699..389893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_0575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23214"
FT                   /protein_id="ABM23214.1"
FT                   /translation="MKCKAIIMKLETQVTGNIGMYYACYKLSCMGWNVMPTARNARGID
FT                   IIRHSAANLGINYLIESTE"
FT   gene            complement(389858..391468)
FT                   /locus_tag="Sputw3181_0364"
FT   CDS_pept        complement(389858..391468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0364"
FT                   /product="transposase, IS4 family"
FT                   /note="KEGG: plu:plu4649 transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23215"
FT                   /protein_id="ABM23215.1"
FT                   /translation="MSTHPVIKRLDHLGLIAAFCHEIGLPRMIDAVIPKYSDHNVSHGD
FT                   AVLAMLLNGLGFHSRTLHMFSDFFKTKPVSKLLAKDIEAHHLTDDVLGRTLDALYEADV
FT                   SALYQVIAERVVDKLGLTTDSVHLDITSFHVDGEYAQDENTNVIKLVRGYSRDHRPELN
FT                   QVVLELICENQAGIPVYMQALSGNTNDAKAFAEVTKRHIHCLKAAQNSRYFIADAALYT
FT                   EESISSLDEQNQKFITRVPMTIKLAKQALLALEPEQLSTIGHGYSGCWIDSDYGKVNQR
FT                   WLLVHSEQATKREEITFFKNLEKNIAKEIKALEKLSKKPFACEVDAELAFNDFKKQCDL
FT                   LGFEQGTLIKQPTYSHSGRPKTDEAPTGYQYFIEAAPFTDLEKVKLAKLKVGMFILATN
FT                   DTDNEALTMAALLAHYKSQQKVERGFRFLKSPEFLTSSIFLKKPERIEALLMIMTLSLL
FT                   VYASLEHKIREQLAQTEAFFPSMVKNKTTSRPTARWVFLQFEGIDTLEINGQRFITGLQ
FT                   DHQTQLLKLLGRFYEVVYS"
FT   gene            391702..391905
FT                   /locus_tag="Sputw3181_0365"
FT   CDS_pept        391702..391905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23216"
FT                   /protein_id="ABM23216.1"
FT                   /translation="MGDFWLIINNVGKEPNVFVMFPEEIRNLAHRGEKNGIVSYWLQPT
FT                   SYDSSNFKEAWHRIGFGHEHQE"
FT   gene            392013..392675
FT                   /locus_tag="Sputw3181_0366"
FT   CDS_pept        392013..392675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nme:NMB1008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23217"
FT                   /protein_id="ABM23217.1"
FT                   /translation="MSSDNLLMKKQQIDPFSASFSSLLVIVFSKSNSKNFPLALNIAQG
FT                   AEKFVETTVSGKTTYSVCFGGNQVDAARAIAFLDYAASWKGVQIFSQGKLIPSSYHIVE
FT                   VLNCYLKSQSCRDYKAHCQTVIDDPFNTEIEKIGGIAFVIKITETPTIKQEIEIDRYAF
FT                   PCKHIFHRFRFQCDHPSCPEDQIQAKAVDLGCDWCPNFDADSWKKIGTKTVLKEFFE"
FT   gene            complement(392914..393819)
FT                   /locus_tag="Sputw3181_0367"
FT   CDS_pept        complement(392914..393819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0367"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spd:SPD_0493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23218"
FT                   /protein_id="ABM23218.1"
FT                   /translation="MSRKLAFVTSKDDGNVDFHVAKAAISKDVSRVYDDNSHILTDFLY
FT                   PLYLIHKVVSSNYEELDNIVDRAQRELDLQSSKPLITLDPYDQAIELMVELNRCLLNIL
FT                   TSQSLFLLKARQLVKDQFGENSEEYQEFECLRKQLHKASVSYRFCYELRNYAQHYGIPS
FT                   NKLAIDYISGEQPVLTVSIAKNKLLKGGYEWKTHGLEALNRMEDMFDLMPHIKNYRDVA
FT                   NKLFLQLYNSCEDKLTQFHSIVADIKEKAQAPQKVRFFFVCNFDDNDSQIDTEEIPYTF
FT                   ARKLENYISTFKDMSTTCNK"
FT   gene            394826..396145
FT                   /locus_tag="Sputw3181_0368"
FT   CDS_pept        394826..396145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0368"
FT                   /product="N-acetylglutamate synthase"
FT                   /EC_number="2.3.1.1"
FT                   /note="TIGRFAM: amino-acid N-acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase;
FT                   aspartate/glutamate/uridylate kinase; KEGG: son:SO4245
FT                   amino-acid acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23219"
FT                   /protein_id="ABM23219.1"
FT                   /translation="MRTTELVDGFRHSAPYVNAHRGKTFVVMLGGEALAQNQFRAILND
FT                   VALLHSLGIKVVLVYGARPQIDAALAANGIAPAYHEGVRITDEDSLKVIKQVAGALQFD
FT                   ITARLSMSLSNTPMQGAQINLVSGNFVIAQPLGVDNGVDFCLSGKVRRIDVQGLKRQLD
FT                   NHCIVLMGPIAASVTGESFNLTAEEIATQVAIKLKADKMIGFSSQNGILDRNGDVIAEL
FT                   MPNDAQNIMNKLAEQGSACVGTMAFLKASIDACRNGVPRCHLVSYLEDGALLQELFSRE
FT                   GIGTQIVTESAERLRRASIADIGGVLNLIRPLEEQGILVRRSREQLEIEIEQFMLIERD
FT                   GLVIGCAALYPFEEDNAGEFACLVVHPDYRDADRGSLLLKNIIGQARSRGYSRLFALTT
FT                   RSIHWFLEHGFVIEDVDALPQKKKQLYNYQRRSKILALDL"
FT   gene            396261..396779
FT                   /locus_tag="Sputw3181_0369"
FT   CDS_pept        396261..396779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0369"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23220"
FT                   /protein_id="ABM23220.1"
FT                   /translation="MSPQFFELAPLTQTSIFSFIVLLLGIVGILLMLWLKNMPKIAKSA
FT                   SLGILLVMMGGFSWVFYQSNSAELVLTDTELTLDVPFYKVQLSRADLLPAEARIVDLQQ
FT                   EADLTPSFKTNGIGMPGFQLGWFNLQGKTKAFLAITDKSQLVLVPTTKGYSLLLTVPQG
FT                   SEFLAQLQK"
FT   gene            complement(396826..397710)
FT                   /locus_tag="Sputw3181_0370"
FT   CDS_pept        complement(396826..397710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0370"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6, transmembrane;
FT                   KEGG: son:SO4243 rarD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23221"
FT                   /protein_id="ABM23221.1"
FT                   /translation="MPDREYRKGILLAVSAYCMWGFAPLYFKLLNHVSATEILLHRVIW
FT                   SFVFMLIIMQFIGGFSRLRLLFKQPKQLIVLVITSILIAGNWLLFIWAVNNDHMLDASL
FT                   GYFINPLLNVLLGMLFLGERLRKLQWFAVALASAGVLIQLISFGSIPIVSLALAGTFGF
FT                   YALLRKKVNVDAKAGLLVETAVLLPVALVYLVATLDTATASMLTNDWQLNLMLMAAGIV
FT                   TTIPLLCFAGAAVRIPLSMLGFFQYIGPSIMFILAVSLFNEPFDAEKGVTFGFIWSALL
FT                   VFTLDMAYKRKPA"
FT   gene            complement(397903..398367)
FT                   /locus_tag="Sputw3181_0371"
FT   CDS_pept        complement(397903..398367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0371"
FT                   /product="uncharacterized domain 1"
FT                   /note="TIGRFAM: uncharacterized domain 1; PFAM:
FT                   thioesterase superfamily protein; KEGG: she:Shewmr4_3591
FT                   uncharacterized domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23222"
FT                   /protein_id="ABM23222.1"
FT                   /translation="MTNPIQAEILSRVAEVFDQHVPFHNLLGLDIKRYDVDGVEVVINM
FT                   KPELIGNIHQQILHGGVTATVLDVVGGLTAFAGLVASREDWTIEELQQRLQTLGTIDMR
FT                   IDYLRPGRGLTFTGTGSVIRAGNRVSVCRMELHNEQGTHIAFGTGTYMVG"
FT   gene            398664..400487
FT                   /locus_tag="Sputw3181_0372"
FT   CDS_pept        398664..400487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0372"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: she:Shewmr4_3590 ATP-dependent DNA helicase
FT                   RecQ; TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23223"
FT                   /protein_id="ABM23223.1"
FT                   /translation="MEKLVLDTHDDPLSQRLAQVFGYRDFRDGQREVIERICGGQDCLV
FT                   IMPTGGGKSLCYQLPALMMNGITIVVSPLISLMKDQVDSLLQTGVAAAYLNSSLPREQS
FT                   AEVLRQLRHGELKLLYVSPERLLTADFIERMQSLQLAMFAIDEAHCISQWGHDFRPEYA
FT                   ALGQLKQLFPYVPMMALTATADQATRQSICERLGIDPYRLLSSFDRPNIRYTVAEKLNA
FT                   ANQLRHFLLQQNGSSGIIYCSSRRRVDEVADRLCLQGFNAKAYHAGMTQEDRGAVQDSF
FT                   LKDQIDIVVATVAFGMGINKSNVRFVVHYDIPKSIEAYYQETGRAGRDGLDAEAFMLFD
FT                   PADIGRVRHLIEQSEPGPQQQVEFHKLNTMAAFAEAQTCRRQVLLHYFDESALEPCGNC
FT                   DICLDPPKRYNGTEDAQKVLSCIYRLGQRFGINHLIEVLRGSKGAPIVDRGHDKLTTWG
FT                   IGKDKSHEYWLSVIRQLIHLGLASQDVTRGSSITLNPSARPVLKGEVALMLAEPRIQLT
FT                   TTKRKASQSKAPLNYDRKLFARLKLLRRTIAEQQDVPPYLVFNDATLAEMAAMMPTSAG
FT                   EMLAVNGVGERKLSRFGDDFLDEIAAYLAGE"
FT   gene            complement(400469..402247)
FT                   /locus_tag="Sputw3181_0373"
FT   CDS_pept        complement(400469..402247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0373"
FT                   /product="Tetratricopeptide domain protein"
FT                   /note="SMART: Tetratricopeptide domain protein; KEGG:
FT                   she:Shewmr4_3589 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23224"
FT                   /protein_id="ABM23224.1"
FT                   /translation="MDFRVLALSMLLWLVTLNACANSQLDELTEIIYQYPTKAFNQIAT
FT                   LEKQPVTEKASDIDQLRLSILKCQNLLQLGENKAAINLAQLGEAKAKRLKLDQARPYFL
FT                   TCQAEAHLNNNNIQNALPLLDSAITLARRYQQPQSLIDSLRLRGQLDTDTDNFSSAIED
FT                   LRLAIDIYPDIHSQTQNWIWPPQAYIYAAMGNLLYATHDFPQAMYYTNLALQSSDAKGK
FT                   VLHVILRNASRIAFDNQEFDYSDQLEKQAKALLPEIGSPLELAYSYAILASISLDKGRI
FT                   DTAEEYISISINSFQKQNQLVAVMRSTRLLAQIRFAQSQDEAALTLMQSAIEQGESLKQ
FT                   YSDLKEFYRILSDYYVDKGDFKQAYDFLLKRHQASEFANEAMNNTRILQFKARINQQDL
FT                   PQETAPNTQNPNILDELNLDWAYSTLFLLAMTILGGAIWYFIDKQNNRAPATDNDSQSL
FT                   SPIQQLESALNSAKQGNYPLALLLFNASQIRQVDLPPLQDELQHKLREHDKLIRYSMDE
FT                   IVIVLPHTSAMGAQRVVNQLTAAIQPWQGSNRVYIGIAALQQFDTLESLIKRAGINQLG
FT                   KIKISENSQDNHSPAK"
FT   sig_peptide     complement(402182..402247)
FT                   /locus_tag="Sputw3181_0373"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.946 at
FT                   residue 22"
FT   gene            402754..404322
FT                   /locus_tag="Sputw3181_0374"
FT   CDS_pept        402754..404322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0374"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: she:Shewmr4_3588 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23225"
FT                   /db_xref="GOA:A1REY0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REY0"
FT                   /protein_id="ABM23225.1"
FT                   /translation="MSNRVIIFDTTLRDGEQALAASLSVKEKLQIAMALERLGVDVMEV
FT                   GFPVSSPGDFESVQTIARTIKNSRVCALSRALEKDIDAAAQALSVADQFRIHTFISTST
FT                   IHVESKLKRSFDQVLEMAVGAVKYARRFTDDVEFSCEDAGRTPIDNLCRMVEAAILAGA
FT                   RTINIPDTVGYTVPSEFGNIIQTLFNRVPNIDQAVISVHCHDDLGLSVANSITAVQHGA
FT                   RQIECTINGIGERAGNCSLEEIAMILATRKGMLGLETGINAKEIHRTSNLVSQLCNMPV
FT                   QANKAIVGANAFTHSSGIHQDGMLKAQNTYEIMTPESIGLNRNNLNMTSRSGRHVIKHR
FT                   MEEMGYSEHDYNMDTLYEEFLKLADKKGQVFDYDLEALAFMEAQAEEDNHYQLQQLVVQ
FT                   SDSTEGVATATVRIEVGGEIKTEAATGNGPVDAAYNAIARATDRRIDIISYKLGAKGVG
FT                   QNALGQVDITAVYHEQNFHGVGLATDVVEASARALVHVMNLTCRADKVADYKQSMQKNR
FT                   ELGGV"
FT   gene            404393..405487
FT                   /locus_tag="Sputw3181_0375"
FT   CDS_pept        404393..405487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0375"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="KEGG: shm:Shewmr7_0369 3-isopropylmalate
FT                   dehydrogenase; TIGRFAM: 3-isopropylmalate dehydrogenase;
FT                   PFAM: isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23226"
FT                   /protein_id="ABM23226.1"
FT                   /translation="MSYQIAVLAGDGIGPEVMAEARKVLREVEARFDLNIEYTEYDVGG
FT                   IAIDNHGCPLPDATLKGCEAADAILFGSVGGPKWEKLPPNEQPERGALLPLRGHFELFC
FT                   NLRPAKLHDGLEHMSPLRSDISARGFDVLCVRELTGGIYFGKPKGRQGEGENEEAFDTM
FT                   RYSRREISRIARIAFEAARGRRKKVTSVDKANVLACSVLWRQVVEEVAVDFPDVELEHI
FT                   YIDNATMQLLRRPDEFDVMLCSNLFGDILSDEIAMLTGSMGLLSSASMNSTGFGLFEPA
FT                   GGSAPDIAGKGIANPIAQILSAALMLRHSLKQEEAACAIERAVSKALNSGYLTGELLSS
FT                   DKRSQAKSTAEMGDFIANAIKEGV"
FT   gene            405487..406911
FT                   /locus_tag="Sputw3181_0376"
FT   CDS_pept        405487..406911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0376"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   shm:Shewmr7_0370 3-isopropylmalate dehydratase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23227"
FT                   /db_xref="GOA:A1REY2"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REY2"
FT                   /protein_id="ABM23227.1"
FT                   /translation="MTTVPKNAVAKTLYQKVWDAHVVATPEGEAPIIYVDRHLVHEVTS
FT                   PQAFSGLKVAGRKLRAPEKTFATMDHNTSTRSASLDALSPMARTQVETLAQNCKDFGVR
FT                   LYDIHHPNQGIVHVMGPELGITLPGTVIVCGDSHTATHGAFGALAFGIGTSEVEHVLAT
FT                   QTLRQLKAKTMKIEVRGHVSDGVTAKDIVLAIIGKIGMDGGTGYVVEFCGEAIEALSME
FT                   GRMTVCNMAIEMGAKAGMVAPDQTTFDYLAGREFAPKGEDWAEAVAYWQAIKTDDGAVF
FT                   DAVVELDAADIAPQLTWGTNPGQVVAIDGKVPNPLDEANPSTRASMEKALEYIGLSAGT
FT                   PMTDISINKVFIGSCTNSRIEDLRSAAVHAKGRKVASGVTAIVVPGSGQVKAQAEAEGL
FT                   DKIFIEAGFEWRLPGCSMCLAMNDDRLEAGDRCASTSNRNFEGRQGRGSRTHLVSPAMA
FT                   AAAAVAGHFVDIRKPY"
FT   gene            406939..407544
FT                   /locus_tag="Sputw3181_0377"
FT   CDS_pept        406939..407544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0377"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   shm:Shewmr7_0371 3-isopropylmalate dehydratase, small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23228"
FT                   /db_xref="GOA:A1REY3"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REY3"
FT                   /protein_id="ABM23228.1"
FT                   /translation="MQPFTTHTGLAVMIDSTNIDTDQIIPKQFLSKVTRDGFGVHLFHD
FT                   WRYLDDAGDVPNPEFSLNQPRYKGASILVSQENFGCGSSREHAPWALADFGLRAIIAPS
FT                   FADIFYGNSINNGLLPVALTHAQVRQLMDEVAAEEGAQITVDLTSCKVISPSGAEFSFT
FT                   LAESARHKLLNGLDAIGLTLSHAAQISQYETQIQGWRS"
FT   gene            408064..409419
FT                   /locus_tag="Sputw3181_0378"
FT   CDS_pept        408064..409419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0378"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: shm:Shewmr7_0372 membrane
FT                   protein involved in aromatic hydrocarbon degradation"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23229"
FT                   /protein_id="ABM23229.1"
FT                   /translation="MIMKKRLLTLAVTAALLSSTTQLHAAGFQLAEYSSTGLGRAFAGE
FT                   AAMADNASAQGRNPAMLTYLEGRQLSAGGIYVMPNVDVKGDVSLSSPLLGPDPVKMQGG
FT                   DALDVADSALVPNFYYSNQLNDQWTWGLAVNSNYGLATELPATHAAAIFGNKTSVTTVE
FT                   FNPNVAYRINDAVSVGGGVRIVYGEGEIGASLPGWVDGIKPSLPAQVAAMLPPGGTELK
FT                   SMKGDDIGYGWQLGASWQITPAHRLGLAYHSGVKLDLDGHASGVIYTGGQDVSIEGYLP
FT                   LELPAFAEIASHHQLTDNWAMHASVNWTDWSVFDQLVAYFPGEVKPKGDLESDLVKEEH
FT                   FEDNWRFALGTTYQVNNAWLVRAGVALDKTAATDEWRTTTIPDSDRLWFSVGAGYQASK
FT                   NLNVDFAVTYIKATGDAPINEQQNLLNLATVNFNGEASGNVWLAGIQMSYKM"
FT   sig_peptide     408064..408141
FT                   /locus_tag="Sputw3181_0378"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            409599..411083
FT                   /locus_tag="Sputw3181_0379"
FT   CDS_pept        409599..411083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0379"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase,
FT                   FGGY; KEGG: son:SO4230 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23230"
FT                   /db_xref="GOA:A1REY5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REY5"
FT                   /protein_id="ABM23230.1"
FT                   /translation="MQKKYVVALDQGTTSSRAIVFDHDANIVSVSQREFTQLYPNPGWV
FT                   EHDPMEIWASQSSVLVEALARAGIHSDEVAAIGITNQRETTVIWEKATGKPIYNAIVWQ
FT                   CRRSAEICEQLKAQGLEEYVRENTGLLLDPYFSGTKIKWILDNVPNAREQADRGELLFG
FT                   TIDTWLVWKLTEGKVHVTDPTNAARTLLFNIHSLTWDNKLLEALDIPLSMLPDVKPSCS
FT                   VYGTTRIAGEGSEIQVAGMAGDQQAALFGQLCVEPGMAKNTYGTGCFLLMNTGTKAVRS
FT                   NHGLLTTVAVGPKGEVNYALEGSVFMGGATIQWLRDELGLIRDASDTEYFASKVADTNG
FT                   VYLVPAFVGLGAPYWDPNARGALFGLTRGANRNHIIRAALESIAYQSKDLLDAMIKDSG
FT                   VSLKRLKVDGGAVANDFLMQFQADITDVEVLRPSVCETTALGAAFLAGLAVGFWESVIE
FT                   LEHKACIDKHFIPNIDAQTRVQLYAGWQDAVARTRT"
FT   gene            complement(411190..411519)
FT                   /locus_tag="Sputw3181_0380"
FT   CDS_pept        complement(411190..411519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23231"
FT                   /protein_id="ABM23231.1"
FT                   /translation="MSGLDSIYAMLAQPVKAVLNPKRVVDQVHSATANAPDSHEAPQSQ
FT                   LPPTLERRDAKVRDRRKESETNKNKKRRASDKAKELKEGAVLEVTDDSAEIKKPQTQHI
FT                   IDVEV"
FT   gene            411978..412436
FT                   /locus_tag="Sputw3181_0381"
FT   CDS_pept        411978..412436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0381"
FT                   /product="MraZ protein"
FT                   /note="TIGRFAM: MraZ protein; PFAM: protein of unknown
FT                   function UPF0040; KEGG: she:Shewmr4_3579 MraZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23232"
FT                   /db_xref="GOA:A1REY7"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REY7"
FT                   /protein_id="ABM23232.1"
FT                   /translation="MFRGASAINLDTKGRIAIPVRYREPLQLEHQGRIVITVDIQSACL
FT                   LLYPIHEWELIEAKLLKLSDTDKTQRSLKRLLLGYAHEVELDGNGRILLPPPLRQYANL
FT                   DKRIMLVGQLNKFELWDEQAWLQQIDECQETIRSEELANNERLADFSL"
FT   gene            412468..413409
FT                   /locus_tag="Sputw3181_0382"
FT   CDS_pept        412468..413409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0382"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase; KEGG: shm:Shewmr7_0378
FT                   S-adenosyl-methyltransferase MraW"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23233"
FT                   /db_xref="GOA:A1REY8"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REY8"
FT                   /protein_id="ABM23233.1"
FT                   /translation="MSQEFAHLSVLLAETVGGLNIKDDGIYIDGTFGRGGHSRQILQRL
FT                   GDNGRLIAIDRDPQAIEAAKQFSDDPRFQIVHGGFGQLADYVEDLGLVGKIDGVLLDLG
FT                   VSSPQLDDAERGFSFLRDGPLDMRMDNSQGQTAAQWLAHAEIEDMAWVFKTYGEEKNAR
FT                   HIARCIAADRDKTPFLRTKDLADLIARITKNKERNKHPATRVFQAIRIYINSELDQIDQ
FT                   ALEGALAVLAPQGRLSIISFHSLEDRIVKRFIRRHSQGESVPYGLPITEDQINKSRKLR
FT                   AIGKAIMPSDEEIERNARARSSVLRIAERLDY"
FT   gene            413420..413734
FT                   /locus_tag="Sputw3181_0383"
FT   CDS_pept        413420..413734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0383"
FT                   /product="cell division protein FtsL"
FT                   /note="PFAM: cell division protein FtsL; KEGG:
FT                   she:Shewmr4_3577 cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23234"
FT                   /protein_id="ABM23234.1"
FT                   /translation="MSKPSLNLPRVVLHDLWSHKWILLLALLVLSNAVVVVYISHASRN
FT                   LATQWDQLLQERDRLDIEWRNLLLEEQTQTEHSRITRIASKELNMSRPLPSEEIVVKVP
FT                   "
FT   gene            413748..415499
FT                   /locus_tag="Sputw3181_0384"
FT   CDS_pept        413748..415499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0384"
FT                   /product="peptidoglycan synthetase FtsI"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   Penicillin-binding protein, dimerisation domain; KEGG:
FT                   son:SO4225 peptidoglycan synthetase FtsI"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23235"
FT                   /protein_id="ABM23235.1"
FT                   /translation="MIRQAKTKQASKKQKPQLIHWRLYVVVGFVFALFSSLVGRAAYIQ
FT                   IIEPDKLRHESDMRTLRTTSREVQRGLITDRNGDMLAVSVPVRAVWADPKQVNDSNSFA
FT                   DMRRWQALADVLHEPLADVLDRVRSNPTKRFTYLKRQVTPAVADYITQLKLPGVFLKSE
FT                   SRRYYPGGEITAQLIGITNIDDVGIEGVENAYNSWLTGTPSKQKVRKSRDGHVVEHLDI
FT                   VQEGESPNDLVLSIDHRIQQLAYRELKRTTEMNQATSGSIVVLDIHTGEVLAMVNTPSY
FT                   NPNSRDNLQTFRMRNRAMTDTFEPGSTIKPFVVAAALEAGTVKATDIIPTSPGWMRLGG
FT                   RQVRDPNNYGDMSLARILAKSSNVGISKLALSIPVQQLLGTYQSMGLGSFSGINLTGES
FT                   AGLIQDRHRWSDFERATLSFGYGLTATTLQLARMYATLGNGGTLYPVSILKLKKPPEGE
FT                   RVISAKVARDVLQMLVTVTEKGGTGTLAHIDGYPVAGKSGTSRKAVAGGYGDDYVALFA
FT                   GVAPANNPKLAIVVVVNEPKGDLYYGGSVAGPAFAKVMSGALQMLNVEPISDKEQVQLA
FT                   GIAGRAE"
FT   sig_peptide     413748..413873
FT                   /locus_tag="Sputw3181_0384"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.932) with cleavage site probability 0.840 at
FT                   residue 42"
FT   gene            415496..416998
FT                   /locus_tag="Sputw3181_0385"
FT   CDS_pept        415496..416998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0385"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetases;
FT                   PFAM: cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: son:SO4224
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23236"
FT                   /protein_id="ABM23236.1"
FT                   /translation="MMLLRDLLAPWFIYSGDQSFNELTLDSRAIRRGDVFLALPGYRVD
FT                   GRQFIDKALDLGAAGVLVHTDDADQHGKVLLGDNAERGVQIYFFQLNRQVSAIAAQRYP
FT                   LAHQFAVTPSLGIIGITGTNGKTSTSQLIAQLVTSLRRKAAVMGTLGNGLWGELVDSGN
FT                   TTADAITLMRQLHEFEAQGASVCAMEVSSHGLVQGRVDAVPFDVAVFTNLTRDHLDYHG
FT                   DMESYATAKQSLFRFSTLGHGLLNLDDPVGASWLIELKDMAAQIWGFSIEGHQAAAFYT
FT                   KNTQFDDQGVSTTLVWPEGETQIHSPLLGAFNLSNLLAALSALYLQGFDMEALAEQVQY
FT                   LTPVAGRMERFTTADNITLVVDYAHTPDAIEQALTALRRHCAGDLWCVFGCGGDRDKGK
FT                   RPLMGRAAEQYADRIMVTSDNARSEDPAQIISDIIQGLVTPERALTQVDRITAIKDVVG
FT                   LAKSGDLILLAGKGHETYQEAAGVRHNYDERALARQLAEQSK"
FT   gene            416995..418377
FT                   /locus_tag="Sputw3181_0386"
FT   CDS_pept        416995..418377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0386"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: son:SO4223
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl- D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23237"
FT                   /protein_id="ABM23237.1"
FT                   /translation="MIPLSLEVLSQHLGAHRVGNDVTIQDLSSDSRKVGDATLFVALKG
FT                   ERFDGHDFAATAIENGAAALMVERELALNIPQLIVTDCQKAMGAIGAYVRDQINPICVA
FT                   LTGSNGKTSVKEMIATILSAKYQVLYTAGNFNNEIGVPLTLLRLTPADEYGVFELGANH
FT                   KGEIDYTSGLVRPNVALVNNVGSAHLEGFGSQAGVAQAKSEIFNHLQADGTAIINADDA
FT                   FADVMSVKARPYKQLHFSQQEGAAKRRIDVIATGHKADADGCYRFMLNYLGESCDVKLP
FT                   LAGRHQVSNALAAASVCIALGLSLTDIAHGLSQLTPVKGRMQPSQLGRIRLIDDSYNAN
FT                   PVSVGAAIAWLKEISENRCLVLGDLGELGDNAPLLHAELGQLAKQQGIDALFCTGALSQ
FT                   HTSQAFGAEHHESVAVLVEKLIKHINQLPGQVTVLVKGSRSAAMERVVDGLTVAFGRGE
FT                   LV"
FT   gene            418378..419460
FT                   /locus_tag="Sputw3181_0387"
FT   CDS_pept        418378..419460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0387"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: son:SO4222
FT                   phospho-N-acetylmuramoyl-pentapeptide- transferase;
FT                   TIGRFAM: phospho-N-acetylmuramoyl-pentapeptide-transferase;
FT                   PFAM: glycosyl transferase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23238"
FT                   /db_xref="GOA:A1REZ3"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REZ3"
FT                   /protein_id="ABM23238.1"
FT                   /translation="MLVYLAEYLTRFYTGFNVFSYVTFRAILGLLTALIFSLWWGPKLI
FT                   ERLQLLQIGQVVRNDGPESHFSKRGTPTMGGLLILAAIFISVLLWGDLGSRYVWVMLFV
FT                   LGSFGLIGFIDDYRKVVRKDTKGLIARWKYILQSLAALLIAFFLYATAANPGETQLVVP
FT                   FFKDVMPQLGGVFIVLAYFTIVGSSNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHV
FT                   QFANYLHIPHLPGSGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLSLGAALGAIA
FT                   VLVRQEILLVIMGGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISIFLVLLGLATLKLR"
FT   gene            419467..420786
FT                   /locus_tag="Sputw3181_0388"
FT   CDS_pept        419467..420786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0388"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase; PFAM: cytoplasmic peptidoglycan synthetases domain
FT                   protein; Mur ligase, middle domain protein; KEGG:
FT                   she:Shewmr4_3572 UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23239"
FT                   /protein_id="ABM23239.1"
FT                   /translation="MQRQYSHIVLGLGATGLSVVRYLCGKGITPLVMDSRRQPPGADTL
FT                   AASFPEVQLITGGFDCRYLVQASQIIISPGIALDTAEVRAALDMGIEVIGDVELFAREI
FT                   ADRKPCVIGITGSNGKSTVTTLVGEMLREAGMAVAVGGNIGVPALDLLSENAEIFVLEL
FT                   SSFQLETTHSLNCVASTCLNVTEDHMDRYSDMDAYRKAKLRLYHQSRSIIFNRDDALTI
FT                   PTEPMNQNSFGLAPPEGDEWGICDSKIYHGRSEIMPITEVSLIGSHNHANLLAAMALVY
FT                   AVGVDKQVMAKVARTFTGLSHRCEVVGIKGGVTYVNDSKATNVGATVAALDGLSDHLGD
FT                   IILIAGGDGKGADFSPLVEPLSKVTHLITLGRDGNKIAALKEGAIKVDSMAAAVAKAAA
FT                   LATSGDIVLLSPACASLDMYSNFMARGDDFRNLVELLDGE"
FT   gene            420776..421987
FT                   /locus_tag="Sputw3181_0389"
FT   CDS_pept        420776..421987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0389"
FT                   /product="cell division protein FtsW"
FT                   /note="TIGRFAM: cell division protein FtsW; PFAM: cell
FT                   cycle protein; KEGG: son:SO4220 cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23240"
FT                   /protein_id="ABM23240.1"
FT                   /translation="MASDTRQFSLFGRLLSAMPNWQRDTEVPGVQLYDRALFTAVLSLI
FT                   AFGFVMVMSASMPEAQTLTGNPFHFMTRHVGYLMGCFVIAAFVLRVDMQTWQRLSPIML
FT                   LVVGLMLVAVLLVGTTVNGATRWLSIGPIRIQVAELAKFAFSVYMAGYLVRRHQEVREN
FT                   AKGFYKPIAVFAIYAILILMQPDLGTVVVLFVGTVGLLFLAGARLLDFFALIFTGVLAF
FT                   VALVLLEPYRMRRVTSFMDPWQDPFGSGYQLTQSLMAYGRGDWFGQGLGNSIQKLEYLP
FT                   EAHTDFIFAVIGEELGFIGIIAVLSVLLFVALRAIRLGNLCLVMDKAFEGYLAYAIGIW
FT                   ICFQTVVNVGASIGMLPTKGLTLPFVSYGGSSLWVMTAAAMTLLRIDYERRMSLVQAVQ
FT                   GRLK"
FT   gene            421987..423075
FT                   /locus_tag="Sputw3181_0390"
FT   CDS_pept        421987..423075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0390"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: shm:Shewmr7_0386
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase, family 28;
FT                   Glycosyltransferase 28, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23241"
FT                   /db_xref="GOA:A1REZ6"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REZ6"
FT                   /protein_id="ABM23241.1"
FT                   /translation="MTQEGKRILVMAGGTGGHVFPALAVAKYLAQQGWQVRWLGTADRM
FT                   EARLVPQYGFDIDFIDIKGVRGNGLVRKLAAPFKVIRSILQAKAVIAEFKPDVVLGMGG
FT                   FASGPGGVAARLAGIPLVLHEQNAIPGMTNKLLSRIATQVLCAFKNTFTTVKSKVVGNP
FT                   IRRELIALGAEPKPLADDALKVLVVGGSLGAKIFNDLMPSVVAALSKQQSITVWHQVGK
FT                   DNLAGVKAAYQQQGQEGGVNIAEFIDDMEAAYRWADVVLCRAGALTVSELAAVGLPSIL
FT                   VPYPHAVDDHQTRNGQVLVEAGAAFLLPQAILDVDKLVGKLQLLANDRTELARMGQRAR
FT                   DVAVLDATEQVAAVCISLAEKG"
FT   sig_peptide     421987..422061
FT                   /locus_tag="Sputw3181_0390"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.908) with cleavage site probability 0.879 at
FT                   residue 25"
FT   gene            423078..424544
FT                   /locus_tag="Sputw3181_0391"
FT   CDS_pept        423078..424544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0391"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate--alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: she:Shewmr4_3569
FT                   UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23242"
FT                   /db_xref="GOA:A1REZ7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1REZ7"
FT                   /protein_id="ABM23242.1"
FT                   /translation="MTKTERYIQLRSMIPEMRRIKRIHFVGIGGAGMGGIAEVLVNEGY
FT                   QVSGSDIAQNTVTDRLCLLGAKIQIGHAADNVQQVDVVVVSTAINAENPEIIAAKELRI
FT                   PIVRRAEMLAELMRYRHGVAIAGTHGKTTTTSLIASVYGQAGRDPTFVIGGLLNSAGTN
FT                   ARLGTSRYLIAEADESDASFLHLQPMVSVVTNIEADHMDTYGGDFEKLKSTFVDFLHNL
FT                   PFYGVAVVCIDDPVVREIMPRIGRHLVTYGFSDDADVQALNFSQQGHQCRFTVRRKGKE
FT                   DLDLLLNLPGQHNVLNALAAIAVATEDEIDDSALIQALAEFQGIGRRFQHLGKFATPKG
FT                   EVMLVDDYGHHPSEVAATIKAARAGWPEKRLVMAYQPHRYTRTRDLYEDFIEVLSQVDC
FT                   LLLLDVYSAGEAPITGADGRALCRSIRLRGQLDPIFIASPDQLAEVLPDVLQEGDLLLT
FT                   QGAGNIGALSRQLAVTELGFAKVEIAQVPA"
FT   gene            424696..425445
FT                   /locus_tag="Sputw3181_0392"
FT   CDS_pept        424696..425445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0392"
FT                   /product="Polypeptide-transport-associated domain protein,
FT                   FtsQ-type"
FT                   /note="PFAM: cell division protein FtsQ;
FT                   Polypeptide-transport-associated domain protein, FtsQ-type;
FT                   KEGG: shm:Shewmr7_0388 polypeptide-transport-associated
FT                   domain protein, FtsQ-type"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23243"
FT                   /protein_id="ABM23243.1"
FT                   /translation="MSRVNWYLWSGIGFLSLVIGSFVFAGYQLHKFLNDASTLPIEAVA
FT                   IKGERTYTTDRDIQIALQDLMQRSFFSADISLVQQALEALPWVYRASVRREWPAKLRVY
FT                   LQEQQPVAHWNGASWLNVHGEVFEAPARPELEYLPQLSGPDDMGVEVLTAYAQVNSLLK
FT                   INGFTLASLNLTPRHAWHATLENGIVLDLGREDKIARIQRFITVYPLLAKQDKPIARVD
FT                   LRYDTGLAVGWGDAQTRELIINDQKPR"
FT   sig_peptide     424696..424773
FT                   /locus_tag="Sputw3181_0392"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.960) with cleavage site probability 0.959 at
FT                   residue 26"
FT   gene            425426..426661
FT                   /locus_tag="Sputw3181_0393"
FT   CDS_pept        425426..426661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0393"
FT                   /product="cell division protein FtsA"
FT                   /note="PFAM: cell division protein FtsA; KEGG:
FT                   shm:Shewmr7_0389 cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23244"
FT                   /protein_id="ABM23244.1"
FT                   /translation="MTKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISIVGLGNHPSRG
FT                   MDKGGVNDLDSIVRSVQRALDQAELMADCQVSSVYLSISGKHIACQNENGMVSINDEEV
FT                   TQEDVDNVIHTARSVKIPTERRILHVLPQEYAIDVQDGIRSPIGMSGMRMEAKVHIVTC
FT                   ANDMAKNITKSVERCGLKVDDLVFSGIASADAVLTFDEKDLGVCIVDIGGGTTDIAVYT
FT                   NGALRHCAVVPVAGNQVTNDIAKIFRTPSSHAEQIKVQFACARSSMVSREDSIEVPSVG
FT                   GRPSRSMSRHTLAEVVEPRYQELFELVLKELKDSGLEDQIAAGIVLTGGTASIQGVVDI
FT                   AEATFGMPVRVASPLPIKGLYEYVDQSIYSTGVGLLHYGARRVLERQFERPERQGVTSA
FT                   WNRVQSWFKGEF"
FT   gene            426695..427882
FT                   /locus_tag="Sputw3181_0394"
FT   CDS_pept        426695..427882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0394"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ, GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   son:SO4215 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23245"
FT                   /protein_id="ABM23245.1"
FT                   /translation="MFEIMDTHSDDAVIKVIGVGGGGGNAVEHMVKHNIEGVEFVVTNT
FT                   DAQALRKSSAGSTIQLGRDVTKGLGAGANPDVGRAAAEEDRENIRAAIKGSDMIFIAAG
FT                   MGGGTGTGAAPVVAQIAREEGILTVAVVTKPFPFEGKKRMVYAEQGIAELAKHVDSLIT
FT                   IPNEKLLKVLGRGTSLLDAFAAANNVLLGAVQGIAELITRPGLINVDFADVKTVMSEMG
FT                   NAMMGTGVARGEDRAEEAAEAAVASPLLEDIDLAGARGVLVNITAGMDMSIEEFETVGN
FT                   HVKAYASDNATVVVGAVIDPEMSDELRVTVVATGIGAEKRPDIQLVSKPAPRPEPVVVE
FT                   PKVEAYVEEAVHVNYAAPKGNVLPTAAQPAPTPAPSTKHELDYLDIPAFLRKQAD"
FT   gene            428063..428983
FT                   /locus_tag="Sputw3181_0395"
FT   CDS_pept        428063..428983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0395"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="PFAM: UDP-3-0-acyl N-acetylglucosamine deacetylase;
FT                   KEGG: shm:Shewmr7_0391 UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23246"
FT                   /db_xref="GOA:A1RF01"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RF01"
FT                   /protein_id="ABM23246.1"
FT                   /translation="MIFQRTVQKMVKATGVGLHSGNKVTLSIMPAPVNTGIVLVRTDLS
FT                   PAVAIPAKAEQVRETTMCTALVNDEGIRISTIEHLFAALAGLGIDNAVIEVDAPEIPIM
FT                   DGSASPFVFLLQSAGIKEQAAPKKYLKIKRPVRVEDGDKWAELKPFKGFRVNFKIDFAH
FT                   PEIARSQQHVVMDFSTSAFVKEISRARTFGFMRDIEYLRANNLALGGSMENAVVLDEYR
FT                   VLNPDGLRYEDEFVKHKILDAFGDLYVAGHAILGEFTAYKTGHALNNQLVRALLAQQDA
FT                   WELVSFEKEADVPVSFSVPSGAVFA"
FT   gene            complement(428995..429441)
FT                   /locus_tag="Sputw3181_0396"
FT   CDS_pept        complement(428995..429441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0392 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23247"
FT                   /protein_id="ABM23247.1"
FT                   /translation="MKKPPQDLSQLLHQSGKLPDIAEKAELLLYLDQHVKQIVAGPVAE
FT                   QLKVANFRQGVLVIETTSAAWAARINFQKPKLLAQLQAETLTILTAIEVKVNPRLAMYD
FT                   AKPKQAHKELSPAAAEHIAALAENISGTLGEKLKRLASLASRNK"
FT   gene            429469..430368
FT                   /locus_tag="Sputw3181_0397"
FT   CDS_pept        429469..430368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0397"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: shm:Shewmr7_0393
FT                   peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23248"
FT                   /protein_id="ABM23248.1"
FT                   /translation="MSVTVFIQGRNGVTRWQPSKRWLLLPILLLATGTGIYQHNSARFE
FT                   NQQASVDNDRLVREQQKKQVLELKSATESQLAMLATHVARMQAKITRLEALGQQVAQQN
FT                   KLAEDFDFSSEVGVGGLSELGTNIELGQLIDDMDKLASRIDNNNVQLSLLETVSSNHHI
FT                   DDERYISGIPLDKGWLSSPYGLRNDPFNGRRSVHKGIDFTGREGAKVVATAAGVVTWAG
FT                   NMFGYGELVEIDHGNGFRTRYGHNKALSVTVGDVVAKGDTIASMGSTGRSTGAHVHYEV
FT                   LRGGQQIDPQKFVYRKAS"
FT   gene            430429..433158
FT                   /locus_tag="Sputw3181_0398"
FT   CDS_pept        430429..433158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0398"
FT                   /product="protein translocase subunit secA"
FT                   /note="TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   helicase domain protein; SEC-C motif domain protein; SecA
FT                   DEAD domain protein; SecA Wing and Scaffold; SecA
FT                   preprotein cross-linking region; KEGG: son:SO4211
FT                   preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23249"
FT                   /db_xref="GOA:A1RF04"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RF04"
FT                   /protein_id="ABM23249.1"
FT                   /translation="MFGKLLTKVFGSRNDRTLKGLQKVVIKINALEADYEKLTDEELKA
FT                   KTAEFRERLAAGETLDDIMAEAFATVREASKRVFEMRHFDVQLLGGMVLDSNRIAEMRT
FT                   GEGKTLTATLPAYLNALTGKGVHVITVNDYLARRDAENNRPLFEFLGLTVGINVAGIGQ
FT                   QEKKAAYNADITYGTNNEFGFDYLRDNMAFSPQDRVQRPLHYALIDEVDSILIDEARTP
FT                   LIISGAAEDSSELYTKINTLIPNLIRQDKEDSEEYVGEGDYSIDEKAKQVHFTERGQEK
FT                   VENLLIERGMLAEGDSLYSAANISLLHHVNAALRAHTLFERDVDYIVQDGEVIIVDEHT
FT                   GRTMPGRRWSEGLHQAVEAKEGVHIQNENQTLASITFQNYFRQYEKLAGMTGTADTEAF
FT                   EFQHIYGLDTVVVPTNRPMVRKDMADLVYLTANEKYQAIIKDIKDCRERGQPVLVGTVS
FT                   IEQSELLARLMVQEKIPHQVLNAKFHEKEAEIVAQAGRTGAVTIATNMAGRGTDIVLGG
FT                   NWNMEIDALDNPTPEQKAKIKADWQVRHDAVVAAGGLHILGTERHESRRIDNQLRGRAG
FT                   RQGDAGSSRFYLSMEDSLMRIFASDRVSGMMKKLGMEEGEAIEHPWVSRAIENAQRKVE
FT                   ARNFDIRKQLLEFDDVANDQRQVVYAQRNELMDAESIEDTIKNIQDDVIGAVIDQYIPP
FT                   QSVEELWDVPGLEQRLNQEFMLKLPIQEWLDKEDDLHEESLRERIITSWSDAYKAKEEM
FT                   VGASVLRQFEKAVMLQTLDGLWKEHLAAMDHLRQGIHLRGYAQKNPKQEYKRESFELFQ
FT                   QLLNTLKHDVISVLSKVQVQAQSDVEEMEARRREEDAKIQRDYQHAAAEALVGGGDEDD
FT                   ESIAAHTPMIRDGDKVGRNDPCPCGSGRKYKQCHGKLS"
FT   gene            433939..435473
FT                   /locus_tag="Sputw3181_R0012"
FT   rRNA            433939..435473
FT                   /locus_tag="Sputw3181_R0012"
FT                   /product="16S ribosomal RNA"
FT   gene            435717..435793
FT                   /locus_tag="Sputw3181_R0013"
FT   tRNA            435717..435793
FT                   /locus_tag="Sputw3181_R0013"
FT                   /product="tRNA-Ile"
FT   gene            435931..436006
FT                   /locus_tag="Sputw3181_R0014"
FT   tRNA            435931..436006
FT                   /locus_tag="Sputw3181_R0014"
FT                   /product="tRNA-Ala"
FT   gene            436447..439339
FT                   /locus_tag="Sputw3181_R0015"
FT   rRNA            436447..439339
FT                   /locus_tag="Sputw3181_R0015"
FT                   /product="23S ribosomal RNA"
FT   gene            439570..439685
FT                   /locus_tag="Sputw3181_R0016"
FT   rRNA            439570..439685
FT                   /locus_tag="Sputw3181_R0016"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(439857..440729)
FT                   /locus_tag="Sputw3181_0399"
FT   CDS_pept        complement(439857..440729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0399"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG:
FT                   shm:Shewmr7_3800 bile acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23250"
FT                   /protein_id="ABM23250.1"
FT                   /translation="MAYLMPHWFTDLRSSIVPLLMMIMLSMGLTLNLQDFTNAFKQKRA
FT                   VVTGLILQFSVMPLSALLISFLLGLDRDLTIGMVLVGSVAGGTASNVVCYLAKGDVALS
FT                   ITMTALSTLAGVVLTPLIIKLLVGEMIDIPFADMLLSLVKMVLIPVSVGVIINHFFKSL
FT                   VAKVAPALPLISILAIVMAITIIVALNANQFDKVGPFILLAVFLHNGLGLALGYFCCRL
FT                   LGFNHTVCKTISIEVGLQNSGLATALCIKFFSPISAIPSAIFSIWHNLSGAILASYWAN
FT                   LKESTKSNL"
FT   gene            441158..442495
FT                   /locus_tag="Sputw3181_0400"
FT   CDS_pept        441158..442495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0400"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; HemN domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; KEGG:
FT                   son:SO4520 coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23251"
FT                   /protein_id="ABM23251.1"
FT                   /translation="MSSVIQTLNGAIATPYQANITVPNWMLGSMERVMQYYVDKNLRLD
FT                   TLSAEMMPAPVEGKKYMLYAHVPFCHTLCSYCTFHRFMFKEDKARAYFISLRKEMEMVK
FT                   SLGYDFESMYIGGGTTTVLEDELARTIEHAKTLFPSIKEVSCESDPQHLDSPGFKQLKG
FT                   LVDRMSIGVQSFNDDILKMTDRLDKFGTGQQTFDKIMGAKELFPIINVDLIFGFRGQTD
FT                   EVIQHDLDMASRLDPRQITTYPLMITHQTRKSVKGKLAAPQADMANQYRQILNSLNGQY
FT                   NQLSAWAFGKANDEGFDEYVIDYDEYLGVGSGSFSFLNDTLYVNTFSLRKYQERIAAGQ
FT                   MGVEQQKNYSKKDVMQYRFLLGMFSGRLSRKYFRETFGVNLDTALFKEMTSMKLIGAIK
FT                   NDPTDPDNLIVTDNGKMMGLLMMKEFYAGMDNVRAQLRKPLKPCDM"
FT   gene            442609..442842
FT                   /locus_tag="Sputw3181_0401"
FT   CDS_pept        442609..442842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0401"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3731 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23252"
FT                   /protein_id="ABM23252.1"
FT                   /translation="MGFNEQEKQALLALKGVGPTVIKRFEEIGISSLQQLAQHEVDDIA
FT                   NLVASMLRTTCWKNSPQARNAISAAIDLARAQ"
FT   gene            442889..443830
FT                   /locus_tag="Sputw3181_0402"
FT   CDS_pept        442889..443830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0402"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23253"
FT                   /protein_id="ABM23253.1"
FT                   /translation="MSAHLAIPLFAIVLLVYGETASANDSSFGDANGSITLKYQPNISM
FT                   DKESLFISETEVRVDYMFTNTSSQDLIVPIAFPMPPMFFGSADHSSIDNFTLKVNGKTQ
FT                   PTQHRLVAQLADKTDISTELKQLGWGVDEVAYFAEYAEVPKGKSALPKQWLDENQQIAF
FT                   TLSDYFVWEQTFPAGKSVAISHSYTPSLSTGIPDTASSIIDTYTELACLDESAKQGIRK
FT                   RNLIVKQDGEDQEIGVEWSHLSYILVTANNWQGPIKDFKLILKKSQPTDLISLCFDGEL
FT                   KKTDPLTFEFQQKQFTPKQDLSILFIRKPNFE"
FT   sig_peptide     442889..442960
FT                   /locus_tag="Sputw3181_0402"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.977) with cleavage site probability 0.965 at
FT                   residue 24"
FT   gene            complement(443884..445884)
FT                   /locus_tag="Sputw3181_0403"
FT   CDS_pept        complement(443884..445884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0403"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug; KEGG: son:SO4523 iron-regulated outer
FT                   membrane virulence protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23254"
FT                   /protein_id="ABM23254.1"
FT                   /translation="MLLSRKKYLAQVISVLCLLPTIPVTNALADTAPDKEKMMERIVVT
FT                   ASGFEQQIRDAPASISVITREDLDNRFYRDLTDAMLEVPGVVITGGADRQDISLRGMGS
FT                   QYTLILVDGKRQSSRETRTNSDGPGVEGAWTPPLAAIDRIEIVRGPMSSLYGSDAIGGV
FT                   INIITRKVPNEWQGELRLDTTLQEKSDSGNVYQGNFFVNGGLIKDLLGMQLYGQYTQRE
FT                   EDNIYGGYRGRDATNLTARFALTPNENHDIMFEVGTSNQELDSSLGKTVAPLAPGASCG
FT                   RNGCPASSTTEYENSTFSLSHTGRWDFGTSDTYIKHEEYDNKSRKMKITNTDAQSSLIT
FT                   TLGQSHTATFGAAFNHQDLTDETGNQVSDLTDISRKQWSVFSEDEWRIVDNFALTMGLR
FT                   LDDDENFGNHVSPRVYGVWGLTDSTTLKGGVSTGFRAPSLRQTVPDWGQVSRGGNMYGN
FT                   PDLEPETSVNYELGLYSDLTESITASAGVFYNEFKDKITRVACPATQCTAGPNQFGSDP
FT                   TTYVNIDEAVTQGIELSIDYRIRSNLSLTGNYTYTDSEQKTGVYKGSPLNQLPKHLIQA
FT                   SFHYEPIDNLSTWLRVNYRGEESQPTTGPSSSSLIAPSYTLLDLGANYQLNDSLKFSAG
FT                   IYNAFDKEITQEEYGYIEDGRRYWLGMTYSF"
FT   sig_peptide     complement(445795..445884)
FT                   /locus_tag="Sputw3181_0403"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 30"
FT   gene            445952..446980
FT                   /locus_tag="Sputw3181_0404"
FT   CDS_pept        445952..446980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0404"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: son:SO4524 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23255"
FT                   /protein_id="ABM23255.1"
FT                   /translation="MLQLTQVRIWVITFKSYLRMNKNMIKGMIVFATIAEKGSMSAAAQ
FT                   QLNLSSSAVSQQVTKLEMDMGISLFHRNTRNLTLTEAGSLFYENCRKVISIVDSTEQKL
FT                   NNLKGIPSGELKIAAPVGFGGGLLSEPFQYLLATHPQISLNLVMQDGPIDIVNDGIDLA
FT                   ICIGPLSDSNLIARHLADWRMLLCTSPDYLPMHHNIKHPSELAAFNRINHNYTKGELLT
FT                   HHPSLECFELTGQRISVNNMQTLIQLTLDGLGYAALPEPEVLDYLDKGVLVPLLPEWSF
FT                   NTYSVYSVTSARDRQPAKVKEALNALSQYFSQTDFNHADQLKGGSYQTEHIKSGKEHRL
FT                   GT"
FT   gene            447112..447981
FT                   /locus_tag="Sputw3181_0405"
FT   CDS_pept        447112..447981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0405"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: shm:Shewmr7_3804 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23256"
FT                   /protein_id="ABM23256.1"
FT                   /translation="MKDVALVLEGGGLRAIYTAGVLDAFLQQSLNFSYVIGVSAGAIYP
FT                   ASYVSRQFGRNLQIQQQYLNDKRYMGVRHWLATGNYVNTDFTYRRMAYELLPFDFETFL
FT                   KSDTEFKVGAFNCNTGKTDYFSRVDFSCHDKLLDVLIASSSLPFMSKPCVINHNPYLDG
FT                   GIAEPIPVLQAQKDGYSRQVVILTQDQHYQKSPMKMNWLARKTYKRYPAVAHALSERHR
FT                   VYNRALLDIDQAVIAGKAFVIRPDKPLNLSRLDRNIDKVTAVYQQGLTDGNAILPTLLT
FT                   WLVKPEGG"
FT   gene            complement(447978..448919)
FT                   /locus_tag="Sputw3181_0406"
FT   CDS_pept        complement(447978..448919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0406"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: shm:Shewmr7_3805 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23257"
FT                   /protein_id="ABM23257.1"
FT                   /translation="MLKRLDLNLLPVLEILLEEQSVTAAAARLHLSQSAVSKQLTRLRE
FT                   VFDDPLFERTAYGLKPTPKALSLAPELRQCLQQLAQFTRPNTFEPVLSQRQFRMHLVET
FT                   TYSLTFPHFMPTLLTQAPGVSLNCQTWRLDTMDKLLRCDIDLAIGCREWDERSPMHVNN
FT                   IPDDLCHAELVQDYPVCLMRRDHPALTQEWNLDTFLSYRHLQVAFGGLEHWLLDDVLQL
FT                   EGRKRDIAVNMTDFQSALTLCEQSDLILCAPSRYALAVMKSFELQSLPSPIKLIPGAYL
FT                   LMWHKHFEHDLSHKWLRELIINRVHQSHSPQT"
FT   gene            complement(448948..449727)
FT                   /locus_tag="Sputw3181_0407"
FT   CDS_pept        complement(448948..449727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0407"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: shm:Shewmr7_3806 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23258"
FT                   /protein_id="ABM23258.1"
FT                   /translation="MSPYWVAVWRALPAGILMLMLRPRLPTLVWSKLGLLAFCNIGAFF
FT                   ALLFIGAYRLPGAVAGTLGATLPLIFLMLAWLIDKKRPGIKWLLLGLMGLGGVILLLNP
FT                   SADLDPIGVLCMLSATTLIAFSSRWMQKWDVGDFLVLTAWQLLLGGLMLIPLAWFMAGP
FT                   PQLPSMTLVPSLIWLVIANTAVAYWAWLWSMRNLGPEIMGMVALVNPVVAVSLGVLIVG
FT                   ETLDMRQWMGIAVILLSLLLMKLPQNLRLNPFKKVQP"
FT   gene            450233..451723
FT                   /locus_tag="Sputw3181_0408"
FT   CDS_pept        450233..451723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0408"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; Xanthine/uracil/vitamin C permease;
FT                   sulphate transporter; KEGG: sfr:Sfri_0790 sulphate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23259"
FT                   /protein_id="ABM23259.1"
FT                   /translation="MIQTMKKEWFSNIRGDLLAGIVVALALIPEAIAFSIIAGVDPKVG
FT                   LYASFCIAVVIAFTGGRPGMISAATGAMALLMVTLVKEHGLEYLLAATLLTGVLQIAAG
FT                   YLKLGSLMRFVSRSVVTGFVNALAILIFMAQLPELTNVTWHVYAMTVAGLGIIYLFPLI
FT                   PVIGKSVPSPLVCIVGLTLFAVYMGLDIRTVGDMGQLPDTLPIFLWPEVPLTLETLMII
FT                   FPYSAGLAVVGLLESMMTATIVDDLTDTQSDKNRECKGQGIANIGAGLMGGMAGCAMIG
FT                   QSIINVKSGGRGRLSSFAAGVFLLVMVVFLGEWLKLIPMAALVAVMIMVAIGTFSWDSI
FT                   RNLKHHPMSTNLVMVATVVVVVATHNLAIGVFVGVLLASLFFANKVGRFMVVKSTTTAA
FT                   DTGRHYQVIGQVFFASSDKFSNSFDFREVVDKVTIDLSQAHFWDITAVSALDKVVIKFR
FT                   REGTEVELIGLNEASATIVDKFGVHDKPEEVEKMMSGH"
FT   gene            451758..452612
FT                   /locus_tag="Sputw3181_0409"
FT   CDS_pept        451758..452612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0409"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: sfr:Sfri_0791 UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23260"
FT                   /protein_id="ABM23260.1"
FT                   /translation="MTNVIACIDGSNVTSAVCDASGWAAFQLNAPVILLHVLDKSAYPI
FT                   ESDLSGNIGLGTREHLLNEMVELEARRGKLALEQGKYMLQDAQTRIVEAQPAVVVKTLQ
FT                   RHGDLVETLLEQESHARLVVMGRQGEQHQDQAQAIGSHLENVIRTVKQPILVVMTEFEA
FT                   PKRFMIAYDGSITAKKALNQVLTSPLLKGLECHLVMVSDAQSQATAELALVTESLMAAN
FT                   FNVVTAVCQGEVQTALEIYQLEHHIDLMVMGAYGHSRIREFFVGSNTTKMISKSHIPLL
FT                   LLR"
FT   gene            452703..453035
FT                   /locus_tag="Sputw3181_0410"
FT   CDS_pept        452703..453035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0410"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="KEGG: sil:SPO2248 DnaK suppressor protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23261"
FT                   /protein_id="ABM23261.1"
FT                   /translation="MNEQLKQQLHLQLQQMLESLLAQIAAQTSDVQVVELDQSRLGRLS
FT                   RIDALQGQQMELETARRKQHQLQVIEGALLRINSDEYGSCFVCGEDIDLNRLMFDPTVT
FT                   RCINCS"
FT   gene            complement(453153..453773)
FT                   /locus_tag="Sputw3181_0411"
FT   CDS_pept        complement(453153..453773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0411"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain; KEGG:
FT                   sfr:Sfri_3477 resolvase, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23262"
FT                   /protein_id="ABM23262.1"
FT                   /translation="MSKVGYARVSSTGQSLEVQLGKLHRAECNKIYQEKRSGRTAERSE
FT                   FQSCMSYLREGDTLVVTRLDRLARSVVHLAQIASRFQSEGIDLLVIDQNIDTSTSTGRL
FT                   MFNMLAAIAEFENDLRTERQAEGIAKAHENGVKFGRPVKLTDTLKQAIYDKRAEGATIG
FT                   QLAKEYHLGEASIYRAINSVKQSIVSPYSIDVKELRDYGKYKT"
FT   gene            453943..454203
FT                   /locus_tag="Sputw3181_0412"
FT   CDS_pept        453943..454203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0412"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: sfr:Sfri_3472
FT                   prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23263"
FT                   /protein_id="ABM23263.1"
FT                   /translation="MNTLSANEAKIHFGDLLLKAQQAPIQINKNGKPVAVVISADAYQS
FT                   IETLKLHLLQSKAVKAITDIKMGNLVDGNTFFDELAAGQYD"
FT   gene            complement(454399..454806)
FT                   /locus_tag="Sputw3181_0413"
FT   CDS_pept        complement(454399..454806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0413"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein, MerR; KEGG:
FT                   abo:ABO_1367 transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23264"
FT                   /protein_id="ABM23264.1"
FT                   /translation="MRIGQLAQLVGVETQTIRFYEQQGLLPPPDRQDNGYRVYTEKHGE
FT                   GLAFIRRCRILGLSLAEIHELQSYQDDPHQPCTAVNALLDDHISHVRSQITALQALEKQ
FT                   LVSLRASCNDDREVEACGVLAGISEGNMHQQ"
FT   gene            454902..455798
FT                   /locus_tag="Sputw3181_0414"
FT   CDS_pept        454902..455798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0414"
FT                   /product="cation efflux system permease, putative"
FT                   /note="KEGG: abo:ABO_1368 cation efflux system permease,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23265"
FT                   /protein_id="ABM23265.1"
FT                   /translation="MSKSCGGACGGDATSAADTDIQASSEAPGRWVSVYAVPKMDCPSE
FT                   ERMIRLALNGFEEIRALSFDLSNRRLKVVHDGEVEPVTSKLKTLGLGASLQETVAANPE
FT                   TIKAAEFSAASAKQESGTLRWLLGINALLFVVEMTAGLIAQSTGLIGESLDNFADAAVY
FT                   GLALYAVGHSVKMQVRAAHLAGVLQLILAVGVLVEVVRRFVFGSEPESLVMMAIAFVAL
FT                   IANTSCLLLISKHREGGAHMKASWIFSANDVVINLGVITSGALVAWTGSNYPDLIIGTI
FT                   AGVIVLNGARRILALKD"
FT   gene            455802..456314
FT                   /locus_tag="Sputw3181_0415"
FT   CDS_pept        455802..456314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0415"
FT                   /product="signal peptidase II. Aspartic peptidase. MEROPS
FT                   family A08"
FT                   /EC_number="3.4.23.36"
FT                   /note="KEGG: bxe:Bxe_C0884 lipoprotein signal peptidase
FT                   LspA; TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   peptidase A8, signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23266"
FT                   /protein_id="ABM23266.1"
FT                   /translation="MSIFGKHLSPYALLSISGLLAASDQAVKWLVQQSMAYGESISVTS
FT                   FFNWVHVWNTGAAFSLFANGGGWQRYFFIGIAVVVSIFLIKLILENRHKGEAIACSLIL
FT                   GGAMGNLIDRVFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLLVSSSLLGKKANTN
FT                   AEPDGSD"
FT   sig_peptide     455802..455870
FT                   /locus_tag="Sputw3181_0415"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.961) with cleavage site probability 0.673 at
FT                   residue 23"
FT   gene            456546..457625
FT                   /locus_tag="Sputw3181_0416"
FT   CDS_pept        456546..457625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0416"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: bxe:Bxe_C0885 transposase, TnpA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23267"
FT                   /protein_id="ABM23267.1"
FT                   /translation="MVRRRYTCRACKTTFRPQLPEMVDGFRMTLRLHEYVEKESFNHPY
FT                   TFVAAQTGLDEKTVRDIFNARAEFLGRWHRFETPRILGIDELYLNKRYRCILTNIEERT
FT                   LLDLLATRRQNVVTNYLMKLKDRQKVEIVSMDMWNPYRAAVKAVLPQARIVVDKFHVVR
FT                   MANDALERVRKGLRKELKPSQSRTLKGDRKILLKRAHEVSDRERLIMETWTGAFPQLLA
FT                   AYEHKERFYGIWDATTRLQAEAALDEWIATIPKGQKEVWSDLVRAVGNWREETMTYFET
FT                   DMPVTNAYTESINRLAKDKNREGRGYSFEVMRARMLYTTKHKKKAPTAKVSPFYKKTIG
FT                   YGLPDFAEELNYGVDLSTI"
FT   gene            complement(457898..459010)
FT                   /locus_tag="Sputw3181_0417"
FT   CDS_pept        complement(457898..459010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0417"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   sec:SC2060 propanediol utilization: propanol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23268"
FT                   /protein_id="ABM23268.1"
FT                   /translation="MSLFTVKTRVYSGADSLTWLRTLHGKKIWIVCDGFLAGSPNLKMV
FT                   TDNIHEDNTVGLFSDIIPDPPVATVAAGIEAMSAIQPDVVIGFGGGSALDSAKAIIFFG
FT                   RKLGIMVENFVAIPTTSGTGSEVTSASVISDPASRIKYPLFDDSLYPDIALLEPRLVLS
FT                   VPPAVTANTGLDVLTHALEAYVAKGATDFTDALAEKAAQLVISFLPVVYRDGNELEART
FT                   RMHNASTLAGIAFSQAGLGMNHAIAHQLGGQLHIPHGLANALLLCHVIRFNSRDLAVRA
FT                   KYARLSKLCGLANFQSADEYCVASLITHLHNLMKQVNVADNLSALNITREQVTTAENAM
FT                   ITAALQDACLSTNPVTVSDTDIRAILRAII"
FT   gene            complement(459026..460420)
FT                   /locus_tag="Sputw3181_0418"
FT   CDS_pept        complement(459026..460420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0418"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: stm:STM2051
FT                   CoA-dependent propionaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23269"
FT                   /protein_id="ABM23269.1"
FT                   /translation="MNTTELENMIRNILADNLKGTATAPGNIQHTIFARVEDAITASYD
FT                   AYKKYMAEPLALRTRIITALKEELAPWIKEMSERAAEETGMGNAPDKISKNTAALNNTP
FT                   GIEDLTTSALTGDGGMVLFELSPFGVIGAIAPSTNPTETIINNTISMLAAGNAVYFSPH
FT                   PGAKKVSLWLIEKIEDIIYRVSGIRNLVTTVAEPTFDATREMMSDPRIALLAVTGGPAI
FT                   VNMAMKTGKKVIGAGPGNPPVLVDETACPVKAAKDIVDGASFDHNVLCIAEKCVIVVDS
FT                   IADRLMDNMQKNDAFLVKTPGDIARLRKVVINDKGEANKKLVGKSPAVILQAADLNTST
FT                   APRLIIVEVEQDDPLVMVEQLMPVLPVVRVSDFETGLALALKVENEQHHTAIMHSQNVT
FT                   RLNLAAKTMQTSIFVKNGPSYAGLGIGAEGFTTFTIATPTGEGTTSARSFARKRRCVLT
FT                   NGFSIR"
FT   gene            complement(460417..460926)
FT                   /locus_tag="Sputw3181_0419"
FT   CDS_pept        complement(460417..460926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0419"
FT                   /product="uncharacterized protein possibly involved in
FT                   utilization of glycolate and propanediol"
FT                   /note="KEGG: ccr:CC2181 GlcG protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23270"
FT                   /protein_id="ABM23270.1"
FT                   /translation="MPEQDIASLISEHRILLEEAVREVIRRYPQSLSPSENFSKHIFSS
FT                   EQLKNIIDTVLAEAWQQSAMVVITLCDEKGECVLTYRMPGTSAEDIAVAGRAAEAAVSF
FT                   AKENKQIIDPTLHNVIGGIDTSRGGCVVYCAGKVIGGIGISGASAEKNHLIALRAVDSL
FT                   KSGSQK"
FT   gene            complement(460959..461237)
FT                   /locus_tag="Sputw3181_0420"
FT   CDS_pept        complement(460959..461237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0420"
FT                   /product="Ethanolamine utilization protein EutN/carboxysome
FT                   structural protein Ccml"
FT                   /note="PFAM: Ethanolamine utilization protein
FT                   EutN/carboxysome structural protein Ccml; KEGG:
FT                   ssn:SSO_2069 putative propanediol utilization protein:
FT                   polyhedral bodies"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23271"
FT                   /protein_id="ABM23271.1"
FT                   /translation="MQLAKVVGSVVSTQKSASLTGKKLMVVTLVNLDGSTPLFQENTLE
FT                   VAVDSMGAGEGELVLVSRGSSARKIFPEPNQAIDLAIVGIVDTIDRF"
FT   gene            complement(461242..461727)
FT                   /locus_tag="Sputw3181_0421"
FT   CDS_pept        complement(461242..461727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0421"
FT                   /product="propanediol utilization"
FT                   /note="KEGG: sec:SC2056 propanediol utilization"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23272"
FT                   /protein_id="ABM23272.1"
FT                   /translation="MPMLDMIVSRVITLLQGRESRSLRVTQAELAAGLSKTVYLHNAQL
FT                   ILPLPDLAFIQSLVAYDHHHPAVSTVLEAWAYGVRLHLQIHQQLLTALPLRELRRLPVT
FT                   LTDHMSTPVKLAAAAGLSYASVIHWHDCWVLLEKQTLITALAREVMERQNIKLIWQE"
FT   gene            complement(461735..462370)
FT                   /locus_tag="Sputw3181_0422"
FT   CDS_pept        complement(461735..462370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0422"
FT                   /product="Propanediol utilization protein"
FT                   /note="PFAM: Propanediol utilization protein; KEGG:
FT                   sec:SC2055 propanediol utilization"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23273"
FT                   /protein_id="ABM23273.1"
FT                   /translation="MDHDLITKLTGQVIAQMRQRTIPLGISNRHVHLSAKDYQSLFPGQ
FT                   TLKIKKPLGQPGQFAAEQTVSLIGPRGQLKNVRILGPLRGQTQVEISYTDARQIGLTAP
FT                   LRLSGDLTGSVSVTLKSEAGEINLTEGVIIARRHIHMSPLDAAIFGVTQGETVKVGIEG
FT                   TDRKLIFDDVCIRVAEDMRLEMHIDTDEANAAGIDGGQAVARLLLTKR"
FT   gene            complement(462375..463241)
FT                   /locus_tag="Sputw3181_0423"
FT   CDS_pept        complement(462375..463241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0423"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: stt:t0828
FT                   putative propanediol utilization protein PduK"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23274"
FT                   /protein_id="ABM23274.1"
FT                   /translation="MQHSLGLIEVSGMSLAITVADVMAKTAQIRLIGVERTIGSGWMLV
FT                   KIAGDVAAVRTALSAGEETARAHQGFVACTTIARPAKGTGELVSTTKPPRAEPVQKITV
FT                   LPAVALTASAAHTTTGPESVQEDPDAEKAVPPIREAVEGSTGNIIQVDAINDPVETARE
FT                   ISKPNASAKSPPAEYGEKQSVATVKAFPVMGDIATDLDIPTASARSVAVAQQVKPGISL
FT                   HQFHYQEKPDDETADAGSQQTGETKQAVAISAKLLVTCKICGDPSCPRHKGQPRSRCIH
FT                   NQKSVLR"
FT   gene            complement(463269..463559)
FT                   /locus_tag="Sputw3181_0424"
FT   CDS_pept        complement(463269..463559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0424"
FT                   /product="microcompartment protein"
FT                   /note="PFAM: microcompartments protein; KEGG: ssn:SSO_2065
FT                   putative propanediol utilization protein: polyhedral
FT                   bodies"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23275"
FT                   /protein_id="ABM23275.1"
FT                   /translation="MNNALGMIETYGLIGAIVGADAMVKSANVQLVGYEKIGSGLVTVM
FT                   VRGDVGAVKASVEAGSAAAAGVGQVKSTHVIPRPHNEVETLLPVYQTATAE"
FT   gene            complement(463631..464458)
FT                   /locus_tag="Sputw3181_0425"
FT   CDS_pept        complement(463631..464458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0425"
FT                   /product="MIP family channel protein"
FT                   /note="TIGRFAM: MIP family channel proteins; PFAM: major
FT                   intrinsic protein; KEGG: stm:STM2037 Propanediol
FT                   utilization: propanediol diffusion facilitator"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23276"
FT                   /protein_id="ABM23276.1"
FT                   /translation="MNTTLPTLKQECLAEFLGTGLFLFLGISCLAAMKLAAASFGLWEI
FT                   CIVWGLSVALGVYLTAGISGGHLNPAVTIALWLFGNFSAHKVLPYILCQIMGAFGGAMV
FT                   VYLLYHNLFIDYELAHHIQRGSMDSLAQAGIFTTFPHPEINLLQAFASETIGTLTLMCL
FT                   IMALTDDGNGVPRGPLAPLLIGISVALIGVAIGALTGFALNPARDLGPRLFSYLAGWGS
FT                   NALTGGRAFPYFIIPLVAPIFGACLGAALYRGLTRLPLLPGKGGQGKSLSLPE"
FT   sig_peptide     complement(464345..464458)
FT                   /locus_tag="Sputw3181_0425"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.647) with cleavage site probability 0.558 at
FT                   residue 38"
FT   gene            complement(464493..465413)
FT                   /locus_tag="Sputw3181_0426"
FT   CDS_pept        complement(464493..465413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0426"
FT                   /product="glycyl-radical enzyme activating protein family"
FT                   /note="TIGRFAM: glycyl-radical enzyme activating protein
FT                   family; PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; Radical SAM domain protein; KEGG: ecc:c4538
FT                   putative pyruvate formate-lyase 3 activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23277"
FT                   /protein_id="ABM23277.1"
FT                   /translation="MAEIDYAQTGTVFNIQKFSLHDGPGIRTIVFLKGCYLACKWCSNP
FT                   ESQHTEPEIFYYDRNCIHCGRCVSACPVGAIDASRQGLIDRNACIHCGACAEVCPAGAM
FT                   VQSGKRMSVVEVIDELRKDETHYRRSGGGITLSGGEALAQPAFAAALLAACKARGWHTA
FT                   METTGIASRAVLEKVIPLLDIVLLDIKTFYSERHKEFTGHPNETVLRNALTISELAKNV
FT                   AVRIPVIPGFNDDEQSIEAIARFVTHMKNVSRLHLLPYHNYGQNKYNLLGRTYDMIEIK
FT                   PPEESRMHKYKDIVTSLGIDCVIGG"
FT   gene            complement(465552..468095)
FT                   /locus_tag="Sputw3181_0427"
FT   CDS_pept        complement(465552..468095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0427"
FT                   /product="pyruvate formate-lyase"
FT                   /EC_number="2.3.1.54"
FT                   /note="KEGG: ctc:CTC00936 formate acetyltransferase 2;
FT                   TIGRFAM: pyruvate formate-lyase; PFAM: formate
FT                   C-acetyltransferase glycine radical; pyruvate
FT                   formate-lyase, PFL"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23278"
FT                   /protein_id="ABM23278.1"
FT                   /translation="MSQLSQAFGEPTDRIRALREQILDTTPCIETDRARLITESYKETE
FT                   SLPMIIRRAKALEKILAELPVTIRAGELIVGSLTVTPHSTQIYPEYSNRWLQDEFDRLN
FT                   LRKGDRFTITDEAKQQLDSVFGYWEGKTTNELATSYMLPETLDCMAENVFTVGNYYFNG
FT                   VGHIAVDYARVLARGYKGIIQDVVAAMASADKKDPAFLKKESFYKAVIISCNAAINFAH
FT                   RYAVKARTLAEQASPVRKKELLKIAEICDKVPENGASNFYEACQSFWFAHAIIQLESNG
FT                   HSISPARFDQYMYPYLEKDSSLSEEQAQELLDCLWLKFNDVNKVRDEGSTKGFGGYPMF
FT                   QNLIVGGQTSGGQDATNRLSFMAMTATAHVRLHEPSLSVRVWSKSPDDLLLKACEVSRL
FT                   GMGIPAYYNDEVVIPALINRGLTLEDAREYGIIGCVEPQRPGKTEGWHDAAFYNMSKVL
FT                   EITLNNGRCGDKQLGPKTGELDSFQSIEDIIEAYRKQNEYFVYHLAMADNSVDLAHMER
FT                   APLPFLSCMVDDCISRGKSVQEGGAHYNFTGPQGVGVANVGDSLMAIKRLVFEEGQLSL
FT                   GHLKEALDANFGVSGGIEKPDTIATESTPKQDATYELVLEAVKKVLGESGALALTSLNS
FT                   NPPEPVKGANAGLTAVRQLLINGAPKFGNDIDEVDMLARTGAEIYCREVEKYTNPRGGL
FT                   FQAGLYPVSANVALGESVGATPDGRLAGQPLPDGVSPSRGMDTKGPTAAANSVAKLDHF
FT                   LASNGTLFNQKFHPAALKGDEGLYHLAALLRGYFDQKGMHVQFNVIDRNTLLAAQKEPE
FT                   KYRDLVVRVAGYSAQFVSLDKSVQDDIILRTEHVF"
FT   gene            complement(468120..468935)
FT                   /locus_tag="Sputw3181_0428"
FT   CDS_pept        complement(468120..468935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0428"
FT                   /product="microcompartment protein"
FT                   /note="PFAM: microcompartments protein; KEGG: sec:SC2047
FT                   propanediol utilization: polyhedral bodies"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23279"
FT                   /protein_id="ABM23279.1"
FT                   /translation="MSSDNLVENIIAEVLGKVGDLKTPSAASQPGISQQEPAIPRKLCG
FT                   LTEFVGTATGDSIGLVIANVDSALLDAMHLEKKYRSIGILGARTGAGPQIMAADEAVKA
FT                   TNTEVVAIELARDTKGGAGHGSLVLFGGQDVSDVKRAVEVALGELERTFGDIYANAAGH
FT                   VELQYTARASYALEKAFGAPLGRACGVIVGAPAAIGVLMADTAIKSANVDVVAYNSPAK
FT                   GTSFTNEVILIVSGDSGAVRQAVRSARDVGLTLLETMGGKAPSATTPYI"
FT   gene            complement(468932..469234)
FT                   /locus_tag="Sputw3181_0429"
FT   CDS_pept        complement(468932..469234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0429"
FT                   /product="microcompartment protein"
FT                   /note="PFAM: microcompartments protein; KEGG: ssn:SSO_2058
FT                   putative propanediol utilization protein: polyhedral
FT                   bodies"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23280"
FT                   /protein_id="ABM23280.1"
FT                   /translation="MQQEALGMVETKGLTAAIEAADAMVKSANVVLIGYEKIGSGLITV
FT                   LVRGDVGAVKAATDAGCASARQIGDVIATHVIPRPHSDIEKLLPAGLKPSEGVKQ"
FT   gene            complement(470247..471107)
FT                   /locus_tag="Sputw3181_0430"
FT   CDS_pept        complement(470247..471107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0430"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, mannose/fructose/sorbose
FT                   family, IID subunit; PFAM: PTS system
FT                   mannose/fructose/sorbose family IID component; KEGG:
FT                   bsu:BG10319 PTS fructose-specific enzyme IID component"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23281"
FT                   /protein_id="ABM23281.1"
FT                   /translation="MSIDNTNKDTTVTENKRLTSGDLRSMFLRSNVLLASANFERVQNL
FT                   GICYIMIPAIKRLYAPGPERIEALKRHLEWFNTQPYCASPILGVAAAMEEEKANGAQIE
FT                   GNSISGVKIGLMGPFAGVGDPIFWGTIRPVLAALGASLALTGNILGPIIFFVLFNAIRL
FT                   ALKYYGLNYGYQKGREILKDLGGDRLQKLTEGASILGLFVIGALVCKWTTINVPIVVSR
FT                   VTQADGHVTVTTLQNIFDQLLPGMLPLALTLLVARLLRKKLSPLLLIMLIFAFGILGYW
FT                   AGILA"
FT   gene            complement(471118..471915)
FT                   /locus_tag="Sputw3181_0431"
FT   CDS_pept        complement(471118..471915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0431"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIC
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, mannose/fructose/sorbose
FT                   family, IIC subunit; PFAM: phosphotransferase system PTS,
FT                   sorbose-specific IIC subunit; KEGG: bld:BLi02829 PTS
FT                   fructose-specific enzyme IIC component; RBL00186"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23282"
FT                   /protein_id="ABM23282.1"
FT                   /translation="METYQIIALVMVAALAGIGSVLDEAQTHRPLVVCTLVGIVLGDIK
FT                   TGIILGGTLEMMALGWMNVGLAMAPDTAIASVISTILVITTHQGIGQGIAIAVALAAAG
FT                   QVLTIFIRTIAVFFVHKADTYAESGNIRGIEFMHISALSLQALRVALPTLAVLMLDVTT
FT                   VQNVLNSIPEVVTKGLQIGGGIVVVVGYAMVVNMMNVRHLMPFLFAGFLIAAFTNFNLV
FT                   GLGGMGLVAAIIYLQVNPRFSAASKAVSSPSKATLSDEDDLDS"
FT   gene            complement(471931..472245)
FT                   /locus_tag="Sputw3181_0432"
FT   CDS_pept        complement(471931..472245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0432"
FT                   /product="PTS system sorbose subfamily IIB component"
FT                   /note="PFAM: PTS system sorbose subfamily IIB component;
FT                   KEGG: bsu:BG10317 PTS fructose-specific enzyme IIB
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23283"
FT                   /protein_id="ABM23283.1"
FT                   /translation="MKASVVTVEKMIKAYHSERYEGVTAFLLFGNPTDVLHLVEGGVKI
FT                   PSVNIGGMIYEEGRKQLTKSVSATPEDIASFKKLHEKGVQLELRQLPSDSAVDFYSKIE
FT                   "
FT   gene            complement(472311..473234)
FT                   /locus_tag="Sputw3181_0433"
FT   CDS_pept        complement(472311..473234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0433"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   sgl:SG1040 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23284"
FT                   /protein_id="ABM23284.1"
FT                   /translation="MAKQKFKITNWPTYNKALINRGSITFWLDDEAIQAWYESATPSSR
FT                   GRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFTLMNVPLRCPDYTSVSRRAKSVN
FT                   VSFKTFTRGEIAHLVIDSTGLKVFGEGEWKVKKHGQERRRIWRKLHLAVDSNTHEIICA
FT                   DLSLNNVTDSEAFPGLIRQTHRKIRAAAADGAYDTRLCHDELRRKKISALIPPRKGAGY
FT                   WPGEYADRNRAVANQRMTGSNARWKWTTDYNRRSIAETAMYRVKQLFGGSLTLRDYDGQ
FT                   VAEAMALVRALNKMTKAGMPESVRIA"
FT   gene            complement(473297..473638)
FT                   /locus_tag="Sputw3181_0434"
FT   CDS_pept        complement(473297..473638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0434"
FT                   /product="IS1 transposase"
FT                   /note="PFAM: IS1 transposase; KEGG: sec:SC1834 IS1
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23285"
FT                   /protein_id="ABM23285.1"
FT                   /translation="MPRHRTHYGHWSQPHFPPFKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   QWGYVGAKSRQRWLFYAYDRIRRTVVAHVFGERTMATLERLLGLLSAFEVVVWMTDGWP
FT                   LYESRGFVE"
FT   gene            473984..474586
FT                   /locus_tag="Sputw3181_0435"
FT   CDS_pept        473984..474586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0435"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   ecc:c0291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23286"
FT                   /protein_id="ABM23286.1"
FT                   /translation="MKTSPWNKDCIIGQKRPLQISHIWGIRIRLELEGKTRDLALFNMA
FT                   LDSKLRGCDLVKLKVSDVAYGSSVSSRATVLQQKTGSPVQFEITKGTREAVAALIKLGN
FT                   LHSKDFLFRSRVGTCQHISTRQYNRIFHGWIAKLGLENSLYSTHSMRRTKPYLIYKKTK
FT                   NLRVIQLLLGYKKLESTVRYLGIEVDDALEISESIEV"
FT   gene            474829..475860
FT                   /locus_tag="Sputw3181_0436"
FT   CDS_pept        474829..475860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0436"
FT                   /product="IS630 ORF"
FT                   /note="KEGG: sbo:SBO_P069 IS630 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23287"
FT                   /protein_id="ABM23287.1"
FT                   /translation="MPIIAPIPRDERRLMQKAIHKTRDKNYARRLTAMLMLHRGERVSH
FT                   VARTLCCARSSIGRWINWFTLSGAEGLKSLPSGRGRRWPFEHICALLRELVKHSPGDFG
FT                   YQRSRWSTELLAIKIRDVTGCPLHASTIRRWLPAAGLVWRRAAPTLRIRDPHKEEKMVA
FT                   IHEALAKCSAENPVFSEDEVDIHLNPKIGADWQLRGQQKRVVTPGQNEKYYLAGALHSG
FT                   TGKVSYVGGNSKGSSLFIRLLKHLKATYRRAKTITLIVDNYIIHKSRETLRWLKANQKF
FT                   RVIYQPVYSPWVNHVERLWQALHETITRNHQCRSMWQLLKKVHHFMDTVSPFPGGKHGL
FT                   AKV"
FT   gene            complement(476387..477268)
FT                   /locus_tag="Sputw3181_0437"
FT   CDS_pept        complement(476387..477268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0437"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: stm:STM2036 Propanediol utilization:
FT                   transcriptional regulation, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23288"
FT                   /protein_id="ABM23288.1"
FT                   /translation="MRNAHDILDNIVYDFANATGLGSVAVDLNGKEISPWYNFTSFCQQ
FT                   VRQIAAYHPYCQQCDRCGGFESTKAKQIQCYRCHAGLVDFSIPIFINGNLTGFVSCGQA
FT                   RVAENLPLPKIVENDKNLPTESKLIELYHEVPELSLMKIKSAAQLLNLIIENYLSKEYN
FT                   LRIVKNVSPVKNQKLETLGRHQATMEMILNHINQNFSDNLNLEQMASKANLSMFYFSRT
FT                   FKELTGTGFTAYLINKRMTEAHCLLEQTNWSIEKIARSVGYNDVHYFSRLFKKTFNRSP
FT                   SEFRNHSSGFSM"
FT   gene            complement(477517..477924)
FT                   /locus_tag="Sputw3181_0438"
FT   CDS_pept        complement(477517..477924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0438"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein, MerR; KEGG:
FT                   abo:ABO_1367 transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23289"
FT                   /protein_id="ABM23289.1"
FT                   /translation="MRIGQLAQLVGVETQTIRFYEQQGLLPPPDRQDNGYRVYTEKHGE
FT                   GLAFIRRCRILGLSLAEIHELQSYQDDPHQPCTAVNALLDDHISHVRSQITALQALEKQ
FT                   LVSLRASCNDDREVEACGVLAGISEGNMHQQ"
FT   gene            478020..478916
FT                   /locus_tag="Sputw3181_0439"
FT   CDS_pept        478020..478916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0439"
FT                   /product="cation efflux system permease, putative"
FT                   /note="KEGG: abo:ABO_1368 cation efflux system permease,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23290"
FT                   /protein_id="ABM23290.1"
FT                   /translation="MSKSCGGACGGDATSAADTDIQASSEAPGRWVSVYAVPKMDCPSE
FT                   ERMIRLALNGFEEIRALSFDLSNRRLKVVHDGEVEPVTSKLKTLGLGASLQETVAANPE
FT                   TIKAAEFSAASAKQESGTLRWLLGINALLFVVEMTAGLIAQSTGLIGESLDNFADAAVY
FT                   GLALYAVGHSVKMQVRAAHLAGVLQLILAVGVLVEVVRRFVFGSEPESLVMMAIAFVAL
FT                   IANTSCLLLISKHREGGAHMKASWIFSANDVVINLGVITSGALVAWTGSNYPDLIIGTI
FT                   AGVIVLNGARRILALKD"
FT   gene            478920..479432
FT                   /locus_tag="Sputw3181_0440"
FT   CDS_pept        478920..479432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0440"
FT                   /product="signal peptidase II. Aspartic peptidase. MEROPS
FT                   family A08"
FT                   /EC_number="3.4.23.36"
FT                   /note="KEGG: bxe:Bxe_C0884 lipoprotein signal peptidase
FT                   LspA; TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   peptidase A8, signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23291"
FT                   /protein_id="ABM23291.1"
FT                   /translation="MSIFGKHLSPYALLSISGLLAASDQAVKWLVQQSMAYGESISVTS
FT                   FFNWVHVWNTGAAFSLFANGGGWQRYFFIGIAVVVSIFLIKLILENRHKGEAIACSLIL
FT                   GGAMGNLIDRVFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLLVSSSLLGKKANTN
FT                   AEPDGSD"
FT   sig_peptide     478920..478988
FT                   /locus_tag="Sputw3181_0440"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.961) with cleavage site probability 0.673 at
FT                   residue 23"
FT   gene            479664..480743
FT                   /locus_tag="Sputw3181_0441"
FT   CDS_pept        479664..480743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0441"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: bxe:Bxe_C0885 transposase, TnpA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23292"
FT                   /protein_id="ABM23292.1"
FT                   /translation="MVRRRYTCRACKTTFRPQLPEMVDGFRMTLRLHEYVEKESFNHPY
FT                   TFVAAQTGLDEKTVRDIFNARAEFLGRWHRFETPRILGIDELYLNKRYRCILTNIEERT
FT                   LLDLLATRRQNVVTNYLMKLKDRQKVEIVSMDMWNPYRAAVKAVLPQARIVVDKFHVVR
FT                   MANDALERVRKGLRKELKPSQSRTLKGDRKILLKRAHEVSDRERLIMETWTGAFPQLLA
FT                   AYEHKERFYGIWDATTRLQAEAALDEWIATIPKGQKEVWSDLVRAVGNWREETMTYFET
FT                   DMPVTNAYTESINRLAKDKNREGRGYSFEVMRARMLYTTKHKKKAPTAKVSPFYKKTIG
FT                   YGLPDFAEELNYGVDLSTI"
FT   gene            481036..484116
FT                   /locus_tag="Sputw3181_0442"
FT   CDS_pept        481036..484116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0442"
FT                   /product="transposase Tn3 family protein"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   sfr:Sfri_3470 transposase Tn3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23293"
FT                   /protein_id="ABM23293.1"
FT                   /translation="MKNDVRRLSILSTDEIDELFGLPHFSDDDRRLYFDLSAKERELFD
FT                   NTRTFSVAAHLVLQLGYFKAKRQFFSYEQESSVLNDLDYIAALYFPTKTLSRLKSPSRP
FT                   IRAEQQRAILDLFQYKQCDNEVKVDLEDKAQRVAMLSTQPIFIFRELTQYLALHRIVMP
FT                   SYRYMQEMIGRVVAYERTRIARLLSTCMTSLIDQQLAALLRAESGVFRVSALKHEAKDF
FT                   SYKELRHEVARRQFFQPLHEFAKQFLITAGISNESGKYYASMVKFYTTYKLQRMKKETA
FT                   QLYLLFFAFHRFQQINDNLIEALLHWVDQYEKQAKRAAEEAMNNAVTNAAKNLQAAGHV
FT                   LSLFTDDTITDDTPFSIIKEKAYALLEQERFPLVADYLRNIAFDKTAFEWSHYTKLSAT
FT                   FKRNLRQLFTDLDFAGRVEDSPLLEAIAFLQNLLRTEKSPRQTDPNSFPTEIIPKGLRR
FT                   YLFSKEGKTFKTLDVDRYEFLVYRLLRNSLEAGDVYVKHSNEFRRFEDDLISDLRWQDK
FT                   ERVLQDIGAPILLAPIQDTLAVFHTMLAARYSAINQHISDGVNKHIKVIGAAEKRRWKL
FT                   LYPSSDESVNSDFYSQLPGIGIADLLWFVAGNTGFLNAFTHVLDRYVKHEADPREIFAC
FT                   IVAMGTNMGLAKMAEVSGLSSASMAGTSRNYLRLETLRAANDAISNATSQLPAFHLYDI
FT                   QDTLHSSSDGQRIETQINTLNARYSPKYFGLQKGVSAYTLVANHVPINAKIIGTHEHES
FT                   HYVFDLLHNNTSDIKPERHSTDTHGTNQVNFWILHAFGYHFAPRYRDLHKKMDTLVGSQ
FT                   HPNECGDWLIKPARKTNDELIEREWPNIQRIMASLAQKDVTQATIVRKLSSYSRQNQTK
FT                   KALWELENICRTLYILDFVDDVGLRQCVQKALNRGEAYHRLRRAVAFVNGGKFRVKTEE
FT                   EQQIWNECSRLITNAVIYYNTVLLSRVYEQKQTVGDQNALAQLHSISPVAWQHINMYGN
FT                   FEFSPSTSKIDIDALVARYAEPEYWKQALIENENSSE"
FT   gene            484439..484903
FT                   /locus_tag="Sputw3181_0443"
FT   CDS_pept        484439..484903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0443"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   2; PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   shm:Shewmr7_3807 RNA methyltransferase, TrmH family, group
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23294"
FT                   /protein_id="ABM23294.1"
FT                   /translation="MFHIALYEPEIAPNTGNIIRLCANNGCQLHLIEPLGFDLEEKKLR
FT                   RAGLDYADLTNVTRHKDFDAFLEAMTGKRIMACTTKGSRPHTELSFAKDDVLLFGPETR
FT                   GLPMAIIESIPTEQRLRIPMAATSRSLNLSNAVAIISYEAWRQLGFEGAI"
FT   gene            485572..486111
FT                   /locus_tag="Sputw3181_0444"
FT   CDS_pept        485572..486111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0444"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0915 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23295"
FT                   /protein_id="ABM23295.1"
FT                   /translation="MQIPIASFVPIDLYVAVAKSNKRFMPCKQRIITKMLRIMSKYRDK
FT                   FEYPENPASTEEIQALEKWLGTDLPSEHKKFLLETNGAETPIGVQEPDDSVVLWSAKEI
FT                   SELTEAYCYEQYLPGLVAIGSDGGGESIVFDTTHNISSEDWPVYRVPFGDLTKESMVLL
FT                   AANFNEWVSSGYSLKF"
FT   gene            486249..486680
FT                   /locus_tag="Sputw3181_0445"
FT   CDS_pept        486249..486680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0445"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0329 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23296"
FT                   /protein_id="ABM23296.1"
FT                   /translation="MNIEALIEQIENTDWLSQAEHILAISQLQIEWDWLPSSRDQSDPF
FT                   EGTYPTKPDEQLYDKEAEKVVYKAALKSLRSVGKTHPKLVDGPHNYTEAMKGSALFACR
FT                   HAAKEVLSNQPGKWVAILALYHTGVWPCGITQTGELVIL"
FT   gene            complement(487394..487945)
FT                   /locus_tag="Sputw3181_0446"
FT   CDS_pept        complement(487394..487945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23297"
FT                   /protein_id="ABM23297.1"
FT                   /translation="MQNKINLLKRYCLWGITLSVLTPFSAVATKISFNEFCAQFVGQWT
FT                   GDAAKVGEIPRKVTTTGLCSHDQRQLILSVSVGTRAPYSETWWFREQGEQVLLTYYDGI
FT                   SQEKQQVFSLYRKNGDYSLLGEGVVNARSALIQLYFQTQPSSSQHNAWQWTQNIQYLDD
FT                   DVDRYQLFRGIEMTPVTPSQ"
FT   sig_peptide     complement(487859..487945)
FT                   /locus_tag="Sputw3181_0446"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.942 at
FT                   residue 29"
FT   gene            488276..490303
FT                   /locus_tag="Sputw3181_0447"
FT   CDS_pept        488276..490303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0447"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9, prolyl oligopeptidase active
FT                   site domain protein; WD40 domain protein beta Propeller;
FT                   KEGG: son:SO4537 peptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23298"
FT                   /protein_id="ABM23298.1"
FT                   /translation="MKKAGILLLCLLMPFGSALAEQGKPLSVELLWQLKRIGSPVVSPS
FT                   GEHIIAPVTEYDLKEDKGSTQLWRFDGEGKNNRAITAKGLKVREPVFSPDGKTLAFVSE
FT                   RNEDDAGQIYLLPMDGPGEAQRLTDIPTGVNGIKWVGKHLYFISNIFPNQKWDEMKTQL
FT                   KTDKDNKVSARQWNALPYAQFDHWLDERRQAHVFRIPALGGEVEAVTQPLGYELPRSSQ
FT                   SSSSYDISPNERLIAFSAYGSDNRVDPKLDIFLATIGSGKAENITPENQAADVNPNFSP
FT                   NGKTLAFTRQKIPGFYADTARLMLLDIDSRKLNTLTPEWDRSVSQFNWTPDSKGFYAAI
FT                   DDAATSRIYHIDAKNGKVKAITEATDFGQPAIGKDGELIATNESFLHPARLVSINPRNG
FT                   KTVRLENFNDDILKDVDLGTYESVTYKGYQNQDIQMWVHYPPGFDRSKKYPLFMLVHGG
FT                   PHNAISDGFHYRWNAQTFASWGYVTAWPNFHGSSGFGQDFADAINPDWKNKSLEDVLKA
FT                   ADWFKQQSWIDSDRMVAGGASYGGYLTSIILGQPHPFKALLIHAAVYDMYSQMAADFAV
FT                   HSTRFGNYWDNPELYKAISPHYFAANFNTPTLVSHGQLDYRVPVGQGFELFRTLQTRNV
FT                   ESRMIYFPDENHWVMKPNNSIYWYNQVKDWMTHYAKPGGQ"
FT   sig_peptide     488276..488338
FT                   /locus_tag="Sputw3181_0447"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.991 at
FT                   residue 21"
FT   gene            complement(490386..491819)
FT                   /locus_tag="Sputw3181_0448"
FT   CDS_pept        complement(490386..491819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0448"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   shm:Shewmr7_3814 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23299"
FT                   /protein_id="ABM23299.1"
FT                   /translation="MKSFGKPSTLMAALALGTSLALAGCAAISAPKLVDTGSFAMPSYD
FT                   KFVLDNGLTVYLMPQREVPLITLNAVVRAGAVNDTTAGVAQMTAEGLLLGAAGKSKADI
FT                   EQQVDFLGASLGADADKEGSYLSADFMAKDIDLMLGLFSAAILTPDFDAAEFDKLKQRA
FT                   IAGLQQDKESPRAVIGRYFDKLVFGDHPYGNAASGNSDSLEQITVSQLRAFHKSYYQPA
FT                   NTAITVVGDFDVTAMKAKLTQTFGQWKDSEKLVQPNLNQGLPQLTEAKVLLVDKPDAIE
FT                   TTFLIGGLGISRNNPDYVGLTVVNTILGGRFTSWLNDELRVNAGLTYGARSGFTPYTDS
FT                   GVFTISTFTKTETTQEAIDLALKTYARLWEKGIDQATLDSAKAYVKGQFPPKFETSGQL
FT                   AGLLSGMYLYGFDDKFINEFQAKVDGLTLEETQRLVKAYFPQKDLQFVLIGNASKIAPV
FT                   AAKYGKVQTVDINATGFGQ"
FT   sig_peptide     complement(491730..491819)
FT                   /locus_tag="Sputw3181_0448"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.375 at
FT                   residue 30"
FT   gene            complement(491816..493147)
FT                   /locus_tag="Sputw3181_0449"
FT   CDS_pept        complement(491816..493147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0449"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   shm:Shewmr7_3815 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23300"
FT                   /protein_id="ABM23300.1"
FT                   /translation="MKRTLSALVLAMGLLNPLSQAQATTAEDIKSFTLDNGMKIMVLED
FT                   ASIPNANMYLFWKVGSRNEVPGITGISHFFEHMMFNGSKKYGPKMFDRTMEAAGGANNA
FT                   YTTEDMTVYTDWFPANALETMFDLEADRIANLDINPEMVESERGVVQSERSTGLENSNW
FT                   NALEGEIKGVAFLAHPYSWSVIGHESDIAAWSLEDLVQYHKTYYAPNNAVVVIAGDVKL
FT                   AQVKALADKYFAPIPAQTPPKAIRTVEPEQKGERRTFVQKASVSTPNVMLAYHIPAATH
FT                   ADFYALDLLSSILSQGNSSRLYQSLVDKQVALEAQTYMPMSVDPNLFYVMGVATPEVNA
FT                   STLERALIEQINSIASQGVTQQELDKVKNIKLMDFYRSMETINGKANTIGTYEMYFGSY
FT                   DKLFNAPEAYNKVTPADIQRVAQTYLRKSNRTVAVLAASEESDQ"
FT   sig_peptide     complement(493082..493147)
FT                   /locus_tag="Sputw3181_0449"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.879 at
FT                   residue 22"
FT   gene            complement(494625..495299)
FT                   /locus_tag="Sputw3181_0450"
FT   CDS_pept        complement(494625..495299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0450"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: son:SO4298
FT                   cyclic nucleotide binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23301"
FT                   /protein_id="ABM23301.1"
FT                   /translation="MQLHPELSSRFGDTLSEQRELFKQTLFQCQTASRQFAPGDIILQQ
FT                   GQNVRELYVVSVGKVAMYTSAHNGRRFQLGELNCDQHIFGEIEFFTKLPCQWTVMAEDQ
FT                   MEAEVICAAKLQQCIVTQPQLALFFASALAWDYQDSMAIYTNRLLHPIAVNIALDLLQR
FT                   SQNNIALGAFNKVEQEAERFGTSSRVYRRALNSLIELGLVEKRDQQLHIIDPKALVTFI
FT                   AE"
FT   gene            complement(495603..496328)
FT                   /locus_tag="Sputw3181_0451"
FT   CDS_pept        complement(495603..496328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0451"
FT                   /product="purine and other phosphorylases, family 1"
FT                   /note="PFAM: purine and other phosphorylases, family 1;
FT                   KEGG: son:SO4297 uridine phosphorylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23302"
FT                   /protein_id="ABM23302.1"
FT                   /translation="MSIQPHILVAPHQVSEKAVVCGEPNRVNRIAAHLTDVESLADNRE
FT                   FRLIRGRYGDTIITVCSTGIGAPSAIIALEEMYQCGVKQLIRIGSAGALQPQIAIGDVI
FT                   IAEAAVRDDGGSASYVKLSFPACANHRLVGKLQAYCAQHHICAHSGVVRSHDSFYTDQE
FT                   QELCHYWHRQGVLGADMETAALFTIGRLRQLEVAAILTNVVLFEQDVKAGVNDYVASSK
FT                   ASAQGEQHAILAALNALCD"
FT   gene            complement(496399..497604)
FT                   /locus_tag="Sputw3181_0452"
FT   CDS_pept        complement(496399..497604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0452"
FT                   /product="Na+ dependent nucleoside transporter domain
FT                   protein"
FT                   /note="PFAM: Na+ dependent nucleoside transporter;
FT                   nucleoside recognition domain protein; Na+ dependent
FT                   nucleoside transporter domain protein; KEGG: son:SO4296
FT                   NupC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23303"
FT                   /protein_id="ABM23303.1"
FT                   /translation="MIQSILGILVLLGVGLLFSDNRRLISWRAVIGAFGIIIALAFFVL
FT                   ATEIGADVLLAVSNTVGKVFGYGTEGIKFAFGSLVNFSVEGIGFVWALQVLPQIIFTAA
FT                   LTSLLYYLGIMQWFVLIIGGSLQKVLGTSRAESMNAAGNIILGQTEAPLLIKPYHRVLT
FT                   RAQIFAVMVGGLSSIAGSILAGLAGMGVALNYLIMACFMSAPAGLMFAKLLIPETEPTV
FT                   NEVPELPDDEKPSSFIDAIAKGAIAGMGIAAIVGAVIIACIGLMALLNGGLGAIGELFG
FT                   MPTLTVDMILGTLFAPVAWLIGIPWAEANTAGAFLGQKIAMNEFVAFANMGNVELSARS
FT                   NAIMTIALCGFANIGSVAMVCGALSQMIPQRAGLIGQLGMKVLLAATLANLMNAAIVSL
FT                   FI"
FT   gene            complement(497601..498152)
FT                   /locus_tag="Sputw3181_0453"
FT   CDS_pept        complement(497601..498152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0453"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   son:SO4295 NAD(P)H dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23304"
FT                   /protein_id="ABM23304.1"
FT                   /translation="MNILVLNGHPNLTLSVANASILALEAEQLGWHINSVAQFDGDTAT
FT                   EQQQLLDADVIVVQFPLYWSTYPAVLKHWIDEVFTYGFAFGPNGSQLQGKPVLFSITAG
FT                   ATEESYSETGFNFLPFNAYQQAYEHPFRAAAVDIIDTIISFEMNSTAAEGGNKSNTLSL
FT                   AKAHAERVIAAVNSYKDHSV"
FT   gene            complement(498540..500621)
FT                   /locus_tag="Sputw3181_0454"
FT   CDS_pept        complement(498540..500621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0454"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="TIGRFAM: flagellar biosynthesis protein FlhA; PFAM:
FT                   type III secretion FHIPEP protein; KEGG: sdn:Sden_3668
FT                   flagellar biosynthesis protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23305"
FT                   /protein_id="ABM23305.1"
FT                   /translation="MNWLRRTFSGNYSYIGIPVMLLAILAMVILPLPAWLLDILFTFNI
FT                   VLAVMVLLVSVSIRRPLEFSVFPTLLLLATLMRLTLNVASTRVVLIEGHEGGDSAGKVI
FT                   QAFGEVVIGGNYVVGAVIFLILMIINFVVITKGGERISEVSARFTLDALPGKQMAIDAD
FT                   LNAGTLTHEQARVRRQDVAREADFYGSMDGASKFVRGDAIAGLLILAINIIGGICIGIF
FT                   MHDLSAAEAFKTYALLTIGDGLVAQIPSLLLATAAAIIVTRVSDAEEMPTQLSRQLLAN
FT                   PKTLATAAIVMGILGITPGMPALVFLSFAILLGFAAWKQNQNRAAFTEEKTEELIETSL
FT                   TEPSAPSWESLPFIDIIEVRLGYRLVHLVEKTKGAELQKRLTGIRRTLSEQIGFLLSEV
FT                   RVRDNLALAPHAYQINFMGTQVAIAELEPDLLLAIKSGPVYGKIDGILTKEPAYQMDAI
FT                   WIQPDLKAKALNLGYSVVDNATIIATHVSKLLRESLPELLQHDDIMQLTDRLSKQAPKL
FT                   AESLSTSLTPIQLLKVFRLLLKEQVPLKDIRTIATTLLECSEQTKDPVLLAADVRCALR
FT                   NSILHQIAGSSAQLNVLTLTAELEQTLMTALNQSQQQGRVSLDSFPIEPNLLAQLQQKM
FT                   PQLLADTKEKGYNPILLVSPQLRPFLARYALAFARGLHVLSYNEVPETKELMIAGQLG"
FT   sig_peptide     complement(500511..500621)
FT                   /locus_tag="Sputw3181_0454"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.757) with cleavage site probability 0.753 at
FT                   residue 37"
FT   gene            complement(500637..501767)
FT                   /locus_tag="Sputw3181_0455"
FT   CDS_pept        complement(500637..501767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0455"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FlhB; PFAM:
FT                   type III secretion exporter; KEGG: sdn:Sden_3667 flagellar
FT                   biosynthetic protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23306"
FT                   /protein_id="ABM23306.1"
FT                   /translation="MSQTQQQDKTEEATPQKLRKARKEGQVPRSKDLASAALVLGCSVM
FT                   LTSNANWFATKVSGLTKYNMLLTRAELDQPDMMVRHLGTSLVEMLTILSPLFIMVALLA
FT                   AIAGALPGGPIFNVGNANFKYSRIDPIAGVGRIFSTQSLVELLKSCLKIVLLISIMLVF
FT                   LNGHLQSLLSYSHRPIDEAVRDGINLLSQGMLYLGVGLLVIAFIDVPYQYWHHKKQLRM
FT                   SRQEVKDEHTQQEGKPEIKAKIRQLQQRMARSRADTTIPKADVLLVNPTHYAVALKYNP
FT                   DLADAPYVLTKGTEELALYMRELAKKHGVEIIDIPPLTRAIYHSTQVDQQIPSALFIAI
FT                   AHVLSYVMQIKASRKGLQQKPEPLPHFFIPPHLRHD"
FT   gene            complement(501764..502462)
FT                   /locus_tag="Sputw3181_0456"
FT   CDS_pept        complement(501764..502462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0456"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliR; PFAM:
FT                   type III secretion system inner membrane R protein; KEGG:
FT                   sdn:Sden_3666 flagellar biosynthetic protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23307"
FT                   /protein_id="ABM23307.1"
FT                   /translation="MIMPLLGNAYVPVMVRIFLALSIAALLAPMLPPVPPVDAISLASL
FT                   FLAIEQLLIGFMLALFLTLLIHVMTMLGNIMSMQMGLAMAVMNDPANGDSSPIISEWFQ
FT                   IFGTLIFLALNGHLVAINIIVDSFRLWPIGHGIFELPLMGLVSRLAWLFAASLMLAIPA
FT                   VLAMLMVNITFGVLSRSAPSLNIFSLGFPMTMLMGLLCVFLSLSGIPSRYSDLCLDALT
FT                   AMYQFIGGIT"
FT   gene            complement(502545..502814)
FT                   /locus_tag="Sputw3181_0457"
FT   CDS_pept        complement(502545..502814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0457"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliQ; PFAM:
FT                   export protein FliQ, family 3; KEGG: sdn:Sden_3665 export
FT                   protein FliQ, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23308"
FT                   /protein_id="ABM23308.1"
FT                   /translation="MDINELTALFADSMFLVIMMVSALVTPGLILGLIVAVFQAATQVN
FT                   EQTLSFLPRLIITLLMVLFSGHWLIQQLSDLFDRLFMNIPHIIG"
FT   gene            complement(502819..503553)
FT                   /locus_tag="Sputw3181_0458"
FT   CDS_pept        complement(502819..503553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0458"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliP; PFAM:
FT                   type III secretion system inner membrane P protein; KEGG:
FT                   sdn:Sden_3664 flagellar biosynthetic protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23309"
FT                   /protein_id="ABM23309.1"
FT                   /translation="MIVRLLLLSTFLFVPHAIASEGLTLFTLDSGESSQAVNIKLEILA
FT                   LMTAISFLPVMLMMLTSFTRIIIVLAILRQALGLQQSPPNRVLVGIALILTIFIMRPVG
FT                   DKIYKEAYLPYDQGKIELMEAISIAKVPLTRFMLAQTRETDLEQMLKIANEPTHMKTAE
FT                   EVPFFVLMPAFVLSELKTAFQIGFLIFLPFLVIDLVVASVLMSMGMMMLSPLIISLPFK
FT                   LMIFVLVDGWAMTVSTLTASFG"
FT   sig_peptide     complement(503494..503553)
FT                   /locus_tag="Sputw3181_0458"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.948 at
FT                   residue 20"
FT   gene            complement(503550..503936)
FT                   /locus_tag="Sputw3181_0459"
FT   CDS_pept        complement(503550..503936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0459"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="TIGRFAM: flagellar motor switch protein FliN; PFAM:
FT                   surface presentation of antigens (SPOA) protein; KEGG:
FT                   sdn:Sden_3663 surface presentation of antigens (SpoA)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23310"
FT                   /protein_id="ABM23310.1"
FT                   /translation="MFTSMRRTTLAEQPILSDDDFLLDDDIFSEKSLSKQDTQSRKLKN
FT                   NNFFQQLPVQVTLELASAEMSLGELNRMGEGDVIALDRMVGEPLDIRVNGALLGRGEVV
FT                   EVAGRYGVRLLEIESIALDGTINE"
FT   gene            complement(503902..504783)
FT                   /locus_tag="Sputw3181_0460"
FT   CDS_pept        complement(503902..504783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3662 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23311"
FT                   /protein_id="ABM23311.1"
FT                   /translation="MKITAKARLIKASSDEMIRPIMLVQEKLARTRLLQQLVQLHRPLI
FT                   DAINNILSPLLRQGHSAVSSSHLTEPRKPIIPEHYYAWFILKHQQNILGYWRIDRCTLD
FT                   QLASNYYGSMSTPLNSPLRDPSQSEFRLARKLLLSVVDKLPNNTIDTSALEVELIKGQM
FT                   ELAVSAVWSFNFSQESQTPPMLFCLTEHLLGHLAEQPKKSEVSADLPAKLAIWLKNLPV
FT                   KIQVTLGQHNIPVHSLGQLNTGDILPINLYPKTLLSIGSTPLFHATVHSHEGLMVAKLT
FT                   QDVYQYEENDIG"
FT   gene            505859..507169
FT                   /locus_tag="Sputw3181_0461"
FT   CDS_pept        505859..507169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0461"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; SMART: AAA ATPase;
FT                   KEGG: sdn:Sden_3661 sigma-54 factor, interaction region"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23312"
FT                   /protein_id="ABM23312.1"
FT                   /translation="MRSLSIRIEGLNLSADLICKIMHENFCLWNDKMDLPWLTIVNLSD
FT                   CSPSDVKDYLARFPSRNQLALLAPEQGELAAAAMRAGVQDYLLIPVESEQLLASIHRLR
FT                   RLELPDSSLVVSASVSRQLLMLAHRAATTEASVLLLGESGTGKEPLARYIHRHSSRSHK
FT                   PFIAINCAAIPESILESVLFGHVKGAFTGAICDKAGKFEQANGGTLLLDEIGEMPLTLQ
FT                   AKLLRVLQEREVERLGGQHAIALDIRIIASTNRDLRQAVELGHFREDLFYRLDVLPLKI
FT                   SPLRDRKADILPLAEHFLDLYHQPDTTSTCYFSEHAKQALVSYDWPGNVRELENCIQRA
FT                   LVMRRGLAIQAADLGLNIQLEVQAVEHPEVTDGLRASKQQAEFQYIIDVLKRFNGQRTL
FT                   SAQALGMTTRALRYRLVQMREAGIDIEMLLEQAGRAA"
FT   gene            507196..507534
FT                   /locus_tag="Sputw3181_0462"
FT   CDS_pept        507196..507534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0462"
FT                   /product="flagellar hook-basal body complex subunit FliE"
FT                   /note="TIGRFAM: flagellar hook-basal body complex subunit
FT                   FliE; PFAM: flagellar hook-basal body complex protein FliE;
FT                   KEGG: sdn:Sden_3660 flagellar hook-basal body complex
FT                   protein (FliE)"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23313"
FT                   /protein_id="ABM23313.1"
FT                   /translation="MSSGAIVSSNMLMDTLSIHREVAKGAINISPNPADNGQAYGSFTD
FT                   LIKSKVAAVNQDQNQSSMAMTAVDSGKSDDLVGAMVASQKASLSFATMLQIRNRLVQAF
FT                   DDVMKMPI"
FT   gene            507547..509223
FT                   /locus_tag="Sputw3181_0463"
FT   CDS_pept        507547..509223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0463"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="TIGRFAM: flagellar M-ring protein FliF; PFAM:
FT                   secretory protein YscJ/FliF family protein; Flagellar
FT                   M-ring C-terminal domain protein; KEGG: sdn:Sden_3659
FT                   flagellar M-ring protein FliF"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23314"
FT                   /protein_id="ABM23314.1"
FT                   /translation="MSTTFVQSGQDITGTERSSGLIADMTQKWHKFNRGDRQVIALALL
FT                   AVVVASVIVLMLWTATAGYRPLYGSQENVDTSQVLNVLEAEGIHYRLEANTGAVLVAEE
FT                   QVGNARMLLAAKGVKAKVPSGMEALDNNALGTSQFMEQAKYRHSLEGELARTIMSLKLV
FT                   RAARVHLAIPKQSLFIRQEPELPTASVMLQLDPNTRLSESQVEAIVNLVAGSVTGLTAS
FT                   NIKVVDQDGRYLSENISGNQDLSQSRNKQLQYTRELEHSLVANAASMLEPVLGHDNFQV
FT                   RVTAKVNFNQVEETKESLDPQNVVTQERTSIDDSSNSIAAGIPGALSNKPPQVGTAATD
FT                   DKTRNLKQEESRQYDVGRSVRHVRYQQMQLENLSVSVLINSAAGQGVFNNEAQLVKFGN
FT                   MVKDAIGFSAARGDSFTINAFEFTPTVVAEIPTSPWWQSENYQSYLRYIIGGILGFGLI
FT                   LFVLRPLVKHLTRTAQITAPSIEPAALSAASANALDGPTVDYAPNQAHQLPSADWLGSQ
FT                   GLPEPGSPLTVKMEHLALLANKEPARVAEVIAHWIGDKDGE"
FT   gene            509240..510226
FT                   /locus_tag="Sputw3181_0464"
FT   CDS_pept        509240..510226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0464"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="PFAM: flagellar motor switch protein FliG; KEGG:
FT                   sdn:Sden_3658 flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23315"
FT                   /protein_id="ABM23315.1"
FT                   /translation="MDNYAQAAMLLLSMGEEGAARVMAHLDRNDVQHLSHKMARLSSIT
FT                   QQEAEAVLSRFFQRYKEQSGIARASRSYLQKTLDIALGDRLSKSLIDSIYGDEIKVLVK
FT                   RLEWVDPQLLAREITHEHCQLQAVLLGLLPAESAAKILKMLPSDSQDEVLVRIAQLGEL
FT                   DRNVVDELRELVERCMLMAMEKSHTQVAGVKQVADILNRFEGDREQLMEMIKLHDKQMA
FT                   IDVTDNMFDFIILGRQKQETLQTLLGQVPSETLSLALKGIDFELKDALLNALPKRMSSA
FT                   IETQIEALGGVPVSRASGARKEIMELAKQLMQEGEIELQLFEEQVVV"
FT   gene            510226..510933
FT                   /locus_tag="Sputw3181_0465"
FT   CDS_pept        510226..510933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0465"
FT                   /product="flagellar assembly protein FliH"
FT                   /note="PFAM: flagellar assembly protein FliH; KEGG:
FT                   sdn:Sden_3657 flagellar assembly protein FliH"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23316"
FT                   /protein_id="ABM23316.1"
FT                   /translation="MENKHSRWRLNPNLARRYRFPALHDAVDSSDTGSDFQSYQQAFDE
FT                   GYEEGVLQGKNAGYEAGIEEGRIAGHAAGFHQGKLEGVAAGKTSINEQLNSLLVPLGAL
FT                   RELLEDGHAKQVREQQNLILDLVRRVSQQVIRCELTLQPQQILKLVEETLSALPDDQSD
FT                   MKIHLEPNAVIKLKELAEDKIRGWNLIADSNISAGSCRIVSNKSDADASVETRLDTCMK
FT                   LVEAKLHEADIGG"
FT   gene            510911..512260
FT                   /locus_tag="Sputw3181_0466"
FT   CDS_pept        510911..512260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0466"
FT                   /product="ATPase, FliI/YscN family"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: sdn:Sden_3656 ATPase FliI/YscN; TIGRFAM:
FT                   ATPase, FliI/YscN family; PFAM: H+-transporting two-sector
FT                   ATPase, alpha/beta subunit, central region; H+-transporting
FT                   two-sector ATPase, alpha/beta subunit domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23317"
FT                   /protein_id="ABM23317.1"
FT                   /translation="MRPILEADFFQDDWPRVPVARVYGRLIRVNGLLLEAVGCQLGMGD
FT                   RCQIEGRHGRLIEAEVVGFHRDVLCLMPIEPTQGLMPGARVLPITHEQTIAIGDGLLGR
FT                   VLDGLGQPLDLFGDLTDVSQVQQSHTSYNPLLRQPIRQPLDVGIRAINSLLPIGRGQRL
FT                   GLFAGSGVGKSVLLGMMTRFTDADVVVVGLIGERGREVREFIEETLGEEGRKRAVIIAA
FT                   PADTTPLMRLRAMRLSHSIACAFRDQGKQVLLLVDSLTRYAQAQREIALSLGEPPATKG
FT                   YPPSAFAQLPRLVEMAGNGEHPTGTLTAFYTVLVEGDDQQDPVADAARAILDGHIVLSR
FT                   KLAEQGHFPAIDINASVSRLAMQIATASSIEQSQIFRHILSRYNEVRDLLPLGGYQAGQ
FT                   DPEMDLAVRVYPEMAKFLRQTTQTKINLAESLVQLEQLMGVMGYEPASSL"
FT   gene            512238..512660
FT                   /locus_tag="Sputw3181_0467"
FT   CDS_pept        512238..512660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23318"
FT                   /protein_id="ABM23318.1"
FT                   /translation="MSQRHLSKLCIQAEKKLAQLGQKREDSSQNVQLNQQQHQALSQMI
FT                   FTYRGAKEGGNVLLWQNSASMAQALEPMRVKLVQKDMFLQQEQQRIDRLWRKQLGRQQS
FT                   LKWLEKQTHLQEKARVARNEQAIVDDMAGIYYKKKS"
FT   gene            complement(512737..513192)
FT                   /locus_tag="Sputw3181_0468"
FT   CDS_pept        complement(512737..513192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3654 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23319"
FT                   /protein_id="ABM23319.1"
FT                   /translation="MENSQVNKRELVQSLIRDIRQDLDGYSQLKAMLKHQRELMQRRDN
FT                   DALLAHNERQTALCNKLALRAKQRSENLAILGFNGDNTGMKRLITALPDHLRPQIKMSW
FT                   DNLQLLVKDSQTANETNGRLLVMQQETINRILNRDGQHQEIDYGAKR"
FT   gene            complement(513182..513466)
FT                   /locus_tag="Sputw3181_0469"
FT   CDS_pept        complement(513182..513466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3653 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23320"
FT                   /protein_id="ABM23320.1"
FT                   /translation="MEINKINSALSTDFNTSKSVNTPKKPVASENLPASAKQDISDDWQ
FT                   LLEQTHKELHTISDVDTDKVAAIRQALSNGSFELSLDKIAEKILIQHGK"
FT   gene            complement(513566..514303)
FT                   /locus_tag="Sputw3181_0470"
FT   CDS_pept        complement(513566..514303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0470"
FT                   /product="SAF domain"
FT                   /note="PFAM: SAF domain; KEGG: sdn:Sden_3652 flageller
FT                   protein FlgA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23321"
FT                   /protein_id="ABM23321.1"
FT                   /translation="MNALRIDGKSFSLILLLSLLLLPLNVQAKGKLSATEQISQQMTNA
FT                   VSAEIARWQESQEIKKISKKISLHIPSSTAKLKTCSTALNIEAAKGLPFGRLQRKVSCS
FT                   SEGWSLYVRAKVDLSAYIPVTSKTLERDEVVTAENLQWKMLPLTASDQDIITDEKHILD
FT                   QAVARKIRKNKPIRTNNLSAPWLVSIGEEVIIEAASATFYANMLGVAMDAGKQGDAIRV
FT                   RNTSSGKIITAYPVAKGRVQTRF"
FT   sig_peptide     complement(514217..514303)
FT                   /locus_tag="Sputw3181_0470"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            514401..514751
FT                   /locus_tag="Sputw3181_0471"
FT   CDS_pept        514401..514751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0471"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgB;
FT                   KEGG: sdn:Sden_3651 flagellar basal-body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23322"
FT                   /protein_id="ABM23322.1"
FT                   /translation="MAINLDKALGIHPQTLDFRVERSKVLASNLINAETPGYKARDLDF
FT                   KAAMKQVEAGMQMNQQYSLAYRMPYQNSADDNTVELGKEQARYSQNAMDYQTSLTFLNM
FT                   KIAGLKSAIEGR"
FT   gene            514760..515176
FT                   /locus_tag="Sputw3181_0472"
FT   CDS_pept        514760..515176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0472"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgC;
FT                   PFAM: protein of unknown function DUF1078 domain protein;
FT                   KEGG: sdn:Sden_3650 flagellar basal-body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23323"
FT                   /protein_id="ABM23323.1"
FT                   /translation="MSFGDIYQIAGAGMNAQTIRLNTVASNLANAGAAAETPESAYRAL
FT                   KPVFATIYDSTQQGAIGASIEVSDIVQADAPLDMRYEPNHPFANEQGYVAYSNVNTIEE
FT                   MADMMAASRSFETSVEVMNRARSMQQGLLQLGNK"
FT   gene            515178..515840
FT                   /locus_tag="Sputw3181_0473"
FT   CDS_pept        515178..515840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0473"
FT                   /product="flagellar hook capping protein"
FT                   /note="PFAM: flagellar hook capping protein; KEGG:
FT                   sdn:Sden_3649 flagellar hook capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23324"
FT                   /protein_id="ABM23324.1"
FT                   /translation="MEVASATNNPVQNPAGALAAPGNDAASLKNEFMTLMIAQIKNQDP
FT                   TKPLNSAEYISQLAQFSQVESLEGMRKNQSNQMIMMENLGIVQSASLIGKNAMVPVSEF
FT                   KLDGETVEGKVYLENAVEALDIEIVNSEGQVVHTMQLGAQAVGDIRFAIDPDELGLEKG
FT                   QYEIKAKATLGENSLVAPTYIKAPIERIHFSSASGMMMAEMGHGVGVISVLNISEVS"
FT   gene            515862..517049
FT                   /locus_tag="Sputw3181_0474"
FT   CDS_pept        515862..517049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0474"
FT                   /product="flagellar basal body FlaE domain protein"
FT                   /note="PFAM: flagellar basal body rod protein; protein of
FT                   unknown function DUF1078 domain protein; flagellar basal
FT                   body FlaE domain protein; KEGG: sdn:Sden_3648 flagellar
FT                   basal body FlaE"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23325"
FT                   /protein_id="ABM23325.1"
FT                   /translation="MSFNIALSGLQATTQDLNTISNNIANASTNGFRGGRSEFASIYNG
FT                   GQAGGVSVMSTTQNFSKGGSLTYTGRQLDMGIQGEGFFVLKGTDGGAMYARAGMFHKDS
FT                   QGFITDPVGSRLQGYSVNATGKIQQGNVGDLQVQTASLAAKATTQVGLVSNLDARVDPI
FT                   AVAFDPKDINSYHSIGTTSVYDSLGAEHVVTQYYVKTAPNEWTVNYTLDGVQLTEQTTL
FT                   TFDAKGVLDPTTTKQAFDLTLPNGASNLQFEINFDKSTQYAAKYNNSSLSQDGYTSGEL
FT                   KGVRLDDNGMLYGTYTNGQEQLQGQVILANFSNPNGLSAVSNNAWVATNTAGQAITGAP
FT                   STGTMGTVTGGYLEGSNVDTTAEMVNLMSAQRNYQSNAKVLDVNSTMQQALLNAI"
FT   gene            517064..517798
FT                   /locus_tag="Sputw3181_0475"
FT   CDS_pept        517064..517798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0475"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgF;
FT                   PFAM: flagellar basal body rod protein; KEGG: sdn:Sden_3647
FT                   flagellar basal-body rod FlgF"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23326"
FT                   /protein_id="ABM23326.1"
FT                   /translation="MEKMLYTAASGAVRILEAQSIRANNLANAETAGFKADLERVNAVA
FT                   LAAQGNSLNTRVMAQTENSGFSHQSGVINPTGRTLDLAIRDRGLFTVAVEGGEAYTRSG
FT                   ALIANAEGELTIDGRPVLGNDGPIVLPEHKDLFIGEDGTVSVLPSEGGIIEEVGRLKLV
FT                   NPDLALMQKGQDGLLYGRDGQLMAQDDGVLVDSGFLESSNVQAVSELIASMDLSRQFEI
FT                   QVKLMKSAEKLAEAGNRLLGNV"
FT   gene            517810..518595
FT                   /locus_tag="Sputw3181_0476"
FT   CDS_pept        517810..518595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0476"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgG;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: sdn:Sden_3646
FT                   flagellar basal-body rod FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23327"
FT                   /protein_id="ABM23327.1"
FT                   /translation="MQSALWVSKTGLTAQDTKMTAIANNLANVNTTGFKRDRVAFNDLF
FT                   YQVQRQPGGQVDALNNLPSGLQLGAGTRVVGTQKIFTTGDMQNTSQQLDLAIQGHGFFQ
FT                   VEEPNGDLAYTRDGQFYRSSEGMMVTSQGLPLVPNIVIPEDALTVTIASDGVVTAQMAG
FT                   EAEPQDLGQITLVNFTNPAGLEARGDNLYRETAASGVAVEGVAGDQALGALRQGALEGA
FT                   NVNVVEEMVEMISTQRAYEMNAKVVSASDDMLKFLNQSV"
FT   gene            518606..519268
FT                   /locus_tag="Sputw3181_0477"
FT   CDS_pept        518606..519268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0477"
FT                   /product="flagellar L-ring protein"
FT                   /note="PFAM: flagellar L-ring protein; KEGG: sdn:Sden_3645
FT                   flagellar L-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23328"
FT                   /protein_id="ABM23328.1"
FT                   /translation="MHWLWLLCFALLSGCMSHIPDQETKPGTKEWAPPEIDYSLPDAKD
FT                   GSLYRPGYMLTLFKDKRAFREGDILTVALDEKTYSSKKADTKTNKEQDIGMGLKGNIGE
FT                   KTADADGKTSFSRGFNGAGSSTQQNQLSGSITVTVSKVLPNGTLLIRGEKWLRLNQGDE
FT                   YLRLLGIIRTDDIGNNNTISSQRIADARIIYGGQGAIADSNAMGWASRYFNSPWFPL"
FT   sig_peptide     518606..518674
FT                   /locus_tag="Sputw3181_0477"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.800) with cleavage site probability 0.503 at
FT                   residue 23"
FT   gene            519284..520402
FT                   /locus_tag="Sputw3181_0478"
FT   CDS_pept        519284..520402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0478"
FT                   /product="flagellar P-ring protein"
FT                   /note="PFAM: flagellar P-ring protein; KEGG: sdn:Sden_3644
FT                   flagellar P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23329"
FT                   /protein_id="ABM23329.1"
FT                   /translation="MLRCLLLLLLVSGTLQAQEQSQSRYLMDIVDVQGLRDNQLVGYGL
FT                   VVGLSGTGDRSQVKFTSQSVVNMLKQFGVQIDDKTDPKLKNVAAVAVHATITSLASPGQ
FT                   SLDVTVSSLGDAKSLQGGTLLMTPLRAVDGEIYAVAQGNLVVGGISAAGRNGSSVTVNV
FT                   PTVGTIPNGALLEAPIKSNFSDNEDIILNLKDPNFKTARNIERAVNELFGPDVARAQDH
FT                   AKVLIHAPKSNRERVTFMSMLEELKIDQGRRSPRIVFNSRTGTVVMGGDVVARKAAVSH
FT                   GNLTVTIVERQNVSQPNGAYLGNAAGETVVTNDSQVLVEQGNKRMFVWPEGTSIEEIVR
FT                   AVNSLGATPMDLMAILEALSEAGSLEADLVVI"
FT   sig_peptide     519284..519337
FT                   /locus_tag="Sputw3181_0478"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.930 at
FT                   residue 18"
FT   gene            520402..520809
FT                   /locus_tag="Sputw3181_0479"
FT   CDS_pept        520402..520809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23330"
FT                   /protein_id="ABM23330.1"
FT                   /translation="MKVENPNGYLSKLNADELIKANGEQGALKMVSQQFEAQFLQTVLK
FT                   QMRSATDAMADEDNPLTAKSNNGLYQDLHDAELANRLSQVNGMGLAEVMTKQLSRSFQS
FT                   EKDPVAFDPQQMTTTAMQPALIMRPIVKDFK"
FT   gene            520806..522179
FT                   /locus_tag="Sputw3181_0480"
FT   CDS_pept        520806..522179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0480"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="TIGRFAM: flagellar hook-associated protein FlgK;
FT                   PFAM: protein of unknown function DUF1078 domain protein;
FT                   KEGG: sdn:Sden_3642 flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23331"
FT                   /protein_id="ABM23331.1"
FT                   /translation="MSMLNIGKSGLLASMAALNATSNNVANAMVAGYSRQQVMLSSVGG
FT                   GAYGSGAGVFVDGVRRISDQYEVAQLWQTTSAVGFSKVQSSYLRQAEQVFGADGNNISK
FT                   GLDQLFAALNSSMEQPNLIAYRQSVLNEAKAVAQRVNAINDNIDSQRNQINGQLGTSVK
FT                   EINSQLAIIANFNRDIQAASVTGTIPPALQDGRDAAIDDLAAIIDIRVVEDSQGMLNIS
FT                   LARGEPLLTGNTAAKLTSAPDPANPKNNLVSIQFGASQFNVDQTAGGSLGALLNYRDTQ
FT                   LADSQAYIDELAVMLATEFNSILASGTDLNGATPSQDLFTYQANNPGGSLSLTAGFTPD
FT                   KLAFGQDGTQGDNTNLKALVQLANKELSFTSLGSSTSLAESFSSKVGQLGSASRQAISF
FT                   AKTSVDLQKDAQVQWASTSGVNPDEEGINLIIYQQSYMANAKVISTADQLFQTMLSSF"
FT   sig_peptide     520806..520892
FT                   /locus_tag="Sputw3181_0480"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.719 at
FT                   residue 29"
FT   gene            522191..523108
FT                   /locus_tag="Sputw3181_0481"
FT   CDS_pept        522191..523108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0481"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="TIGRFAM: flagellar hook-associated protein 3; PFAM:
FT                   flagellin domain protein; KEGG: sdn:Sden_3641
FT                   flagellin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23332"
FT                   /protein_id="ABM23332.1"
FT                   /translation="MRVTMQNLYTNNLNSLQNTTYDVARLNQMLSKGVSILAPSDDPIG
FT                   VVRVMDNQRDLALVQQYIKNIDSLSTSMSRSETYLSSMVETQQRMKEISIATNSSNLSV
FT                   EDRASYASEMEELLKGLVDNINATDESGNYLFSGNVIDKIPVVKDATGRYVYQGDANQR
FT                   TVQTSNSSWTTANVTAEQLLFSNAGQDILNQTMDYISVLKDPSLSPSDPAFSAAANGIQ
FT                   TALSETLDSIGAAITDFGGKQNNLALVKSSHEEMVLFSKQVIGETQELDYAAATAEFNV
FT                   KLTALKITQQTFVQISQLSLFNHM"
FT   gene            523121..524134
FT                   /locus_tag="Sputw3181_0482"
FT   CDS_pept        523121..524134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23333"
FT                   /protein_id="ABM23333.1"
FT                   /translation="MIKGIGESLTQLHQSQTVTSQYVAPISASPRSIPKARPIPKHRLE
FT                   AYGRWAKVTQEQHNISASQVVLQSLILAKQLMGQLNKQLQTCLFNKNTIIEDTLNRAEE
FT                   VRRQLIEIKPHYQGKRLLDHHLNLISVSQPAALHLFKFRRVDLTSPKNRDERITLFTEK
FT                   QTLHLLLPANKNRLALQEIIGPVLASIGIGIDRSSPHDTVFMAQDDTWTKLCGGILMVG
FT                   EGQRLPAGEPRNIPLEEIFSWQDPREWHFDNTEKLKITLAKIAKVEKKVTLQIEEINAS
FT                   HRLLLAKVKQLTASSQPKVELQHLHKFMQPYPFSYQVTSLMAQGNTNREQVSALLL"
FT   gene            524280..525083
FT                   /locus_tag="Sputw3181_0483"
FT   CDS_pept        524280..525083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0483"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: sdn:Sden_3639
FT                   flagellin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23334"
FT                   /protein_id="ABM23334.1"
FT                   /translation="MLGVHTNYASIVAQGAVNKSNNLLTNAMERLSTGLRINSASDDAA
FT                   GLQIANRMNANVKGMETASRNISDATSMLQTADGALEELTTIANRQKELATQAANGVNS
FT                   ADDLTALDAEFKELNKEISRILDNTTYAGNNLFTKLEAGVTFQIGAGTAETLAVTTTAI
FT                   DDAALAAGDLTTGANAAITLVDTFLAAVGTERSTLGANINRLGHTAANLASVTENTKAA
FT                   AGRIMDADFAVESANMTRNQLLVQAGTTVLSSANQNTGLVMGLLR"
FT   gene            525321..526133
FT                   /locus_tag="Sputw3181_0484"
FT   CDS_pept        525321..526133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0484"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: sdn:Sden_3639
FT                   flagellin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23335"
FT                   /protein_id="ABM23335.1"
FT                   /translation="MLGVHTNYASIVAQGAVNKSNNLLTNAMERLSTGLRINSASDDAA
FT                   GLQIANRMNANVKGMETASRNISDATSMLQTADGALEELTTIANRQKELATQAANGVNS
FT                   AADLTALNDEFTQLNAEITRIVENTTYAGNKLFDTGVLTTGTGVKFQIGAGTAETLDVK
FT                   LGAIPKTVAGTLTGGTANAAIALVDTFLETVGTERSTLGANINRLGHTAANLASVTENT
FT                   KAAAGRIMDADFAVESANMTRNQLLVQAGTTVLSSANQNTGLVMGLLR"
FT   gene            526430..527776
FT                   /locus_tag="Sputw3181_0485"
FT   CDS_pept        526430..527776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0485"
FT                   /product="flagellar hook-associated 2 domain protein"
FT                   /note="PFAM: flagellar hook-associated protein 2 domain
FT                   protein; flagellar hook-associated 2 domain protein; KEGG:
FT                   sdn:Sden_3638 flagellar hook-associated 2-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23336"
FT                   /protein_id="ABM23336.1"
FT                   /translation="MISGMNAAQFAQQLIGADRAGKDTLYKGKLTASKTQLDAYTLLEN
FT                   NMKKMATKLSELGGDAAKSKIATVTGENATATVKSDAPKGNYDLSVHKLAQAHQLTKAY
FT                   SSENELLPTSGVISIQVGSDPTKRMEIDLATVNGGAAISVSQLRDLINKQAGNPGVQAS
FT                   LVRTGNQIEFMLSSKESGVANQMKVEFNGADWGMTERRVAQDAELTLNGINITSSSNYL
FT                   ENVVDGVSLELVKVHAAGESSMIKVTDDFEANKKAVKDFVDSFNSLMTQINQLTRSMGV
FT                   KTSDSGTSDKDKEDKTTAVSEAQIGVLKGDTSIRLLQSRLRDSVFATAANGMRLSDIGI
FT                   EIGRDGKLKIDDAKLTDSFKSDPEKVQAMFTGPDSYVKSIEKTLKPFTQFNGYIDQKQE
FT                   ALNKQIKSVNDSMARHDYQMNQKYQIYLAQFTAMESTINQFNSASQLFS"
FT   gene            527790..528170
FT                   /locus_tag="Sputw3181_0486"
FT   CDS_pept        527790..528170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0486"
FT                   /product="flagellar protein FliS"
FT                   /note="PFAM: flagellar protein FliS; KEGG: sdn:Sden_3637
FT                   flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23337"
FT                   /protein_id="ABM23337.1"
FT                   /translation="MLNEYDPFNAYKQTALDAQVAAATPHDMVRMLLDGLLEELERAAG
FT                   HMEYQRFEAKGMSIHKCLNIVHGLDSMLDLENGGEVAISLHRLYDFCSRQLVSASVENS
FT                   AEALVPITQVITNVREGWTNLN"
FT   gene            528139..528465
FT                   /locus_tag="Sputw3181_0487"
FT   CDS_pept        528139..528465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23338"
FT                   /protein_id="ABM23338.1"
FT                   /translation="MSEKGGQISIKQWARFGHALRQYADAQDWTNVQKVNIALIKALQQ
FT                   AGEARDTEQKLAREALKRVHAQVLQELILARDELAVEMSRFREQQSGLAAYQLTQVSGA
FT                   LDDL"
FT   gene            528455..529636
FT                   /locus_tag="Sputw3181_0488"
FT   CDS_pept        528455..529636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0488"
FT                   /product="flagellar hook-length control protein"
FT                   /note="PFAM: flagellar hook-length control protein; KEGG:
FT                   sdn:Sden_3635 flagellar hook-length control protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23339"
FT                   /protein_id="ABM23339.1"
FT                   /translation="MISDLLSTRHMGTNPNVTTKVTSAVDQDKAESFTLLALPVEPSAE
FT                   SMPQERSLDITTEQSQESGYNPFLNQHINNLVESAPFTGVDAVTQGAMFNSEAEINSTS
FT                   IRLDDVAFASLNSLTTPTVVAPLVPVTLPIEASKTESVGQTSASLVGLSVASQRGALFS
FT                   SGMASSMALVGSASQPASMSTEISPISSALAKDAMTTPFSDSSRFDHLKADTSVFQRVL
FT                   AELRGHEAKDINAIGTQPIVSTQAASATQWGPVSLTPTASLAQQAQEILTPLREHLRFQ
FT                   VDQHIKKAELRLDPPELGKIDLNIRLEGDRLQVHMHAVNPAIRDALLNGLERLRMDLAM
FT                   DHGGQIDVDVGQGGSQQQQQETALFASSIAPETAMENGADVMTREKSQLDLLA"
FT   gene            529652..530119
FT                   /locus_tag="Sputw3181_0489"
FT   CDS_pept        529652..530119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0489"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL;
FT                   KEGG: sdn:Sden_3634 flagellar basal body-associated protein
FT                   FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23340"
FT                   /protein_id="ABM23340.1"
FT                   /translation="MAIVKSRVIKITLAFFVLISWTAGALWIGINGADWKLTELFASEP
FT                   EVEPVPVAKFYPLEKFVISIPGDKYPHYMLLEMSLKSYNPDMKTVLVEADPLIRNAMMK
FT                   MFSRKTFEQLNHLDQLDGLQAEALILMVKVLSDNKLPSDIDEVLFTRMVIQ"
FT   sig_peptide     529652..529729
FT                   /locus_tag="Sputw3181_0489"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.828) with cleavage site probability 0.752 at
FT                   residue 26"
FT   gene            530129..530845
FT                   /locus_tag="Sputw3181_0490"
FT   CDS_pept        530129..530845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0490"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG
FT                   family"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, FliA/WhiG
FT                   family; RNA polymerase sigma factor, FliA/WhiG; PFAM:
FT                   sigma-70 region 3 domain protein; sigma-70 region 2 domain
FT                   protein; sigma-70 region 4 domain protein; KEGG:
FT                   sdn:Sden_3633 RNA polymerase sigma factor, FliA/WhiG"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23341"
FT                   /protein_id="ABM23341.1"
FT                   /translation="MTTDGQLAYQQTCDYPIEERQSEQQVIRQYLPLIKRIVSQMRSHC
FT                   GVMLSLEDMEQIGMMALLESSRRYPGELDNGFISFAGQRIRGAILDELRRQDWRPRPVR
FT                   QQAHELNDVVRRLSREMGREPSDLEVASALGLSAEDYRERLYSTQAESMKSLDELLLVG
FT                   EHPVDRGNDVEQLMLKQTLIKVISKLNEREQLILSLYYHHELNLKEIAMALGLTETRIC
FT                   QLHKSAISQLKTILQR"
FT   gene            530868..531725
FT                   /locus_tag="Sputw3181_0491"
FT   CDS_pept        530868..531725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0491"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   sdn:Sden_3632 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23342"
FT                   /protein_id="ABM23342.1"
FT                   /translation="MSKLVGLLIILASVFGGYAWAGGALAALWQPAEILIIMGAGVGAL
FT                   IIANPQSVLKEMLEQLKELFNKGKEDPELYPQLFPLMGTLMAQIQSQGLKVLDEHLENP
FT                   QQSSIFLMYPAVLKHPNVLQFLIDNLRVQSIGKISPHDLEHILEEEIHRIEEDRLRPSE
FT                   AFSKVGEAMPGFGILAAVLGIIITMSNIDGPITMIGVKVAAALVGTFIGIFACYCFFDP
FT                   MAKALEHLVDRKSAQLRCIAAILVTFSKGKPPMMAIDAGRKQIQSENRPSFIELERWME
FT                   GQRS"
FT   sig_peptide     530868..530933
FT                   /locus_tag="Sputw3181_0491"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.737 at
FT                   residue 22"
FT   gene            531725..532642
FT                   /locus_tag="Sputw3181_0492"
FT   CDS_pept        531725..532642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0492"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: sdn:Sden_3631
FT                   OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23343"
FT                   /protein_id="ABM23343.1"
FT                   /translation="MLHKNEPIIIKRRKRGKRNHGHGGAWKVAFADFTLAMMALFMVLW
FT                   IMQIADQKERTMIVQYLRGDMNPTGPINPFELSQSSSIIDLEGNMSIAPTIIPSHPSPR
FT                   AGAEGIEEGALIPGQFDTQEQLTVLARQLNRVVQSSSMAENITVTIVPQGIRILIHDNV
FT                   NRFMFTRGSAQMQPYFEELLLSLGPILKNITNSMVISGHTDSTPYAGSLFTNWELSSER
FT                   ALLARRVLERGGVKRDQVIQVTGMADQVPYITSDTAAAANRRIEALILTSSAEQLLRGM
FT                   IGAPNETIQNGISINDIKRQTIAH"
FT   gene            532677..533111
FT                   /locus_tag="Sputw3181_0493"
FT   CDS_pept        532677..533111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0493"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   sdn:Sden_3630 type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23344"
FT                   /protein_id="ABM23344.1"
FT                   /translation="MNMYEEFVHSEDEVEPTLEYQIIEFDNRRTHQRLSLRHDKRVPLA
FT                   FACDGLTVNLSTTRWFILTPLGTANIKDISIGGVGILCSEPLSIGMKFYIELDQYRVLC
FT                   EVTREHSIKGHLKFLGARWINGNDTEVQNLIDAIKLRAKI"
FT   gene            533120..533407
FT                   /locus_tag="Sputw3181_0494"
FT   CDS_pept        533120..533407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0494"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23345"
FT                   /protein_id="ABM23345.1"
FT                   /translation="MAASFNRNGSDKLQKVFLYLILLNWLLLIVIAININTLRFSNGVM
FT                   ISVMIFIYNYFLAHLCFIRAARAQDAYLIYPVVIGALSSFFLVVYFFFLL"
FT   gene            complement(533557..533862)
FT                   /locus_tag="Sputw3181_0495"
FT   CDS_pept        complement(533557..533862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0495"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: helix-turn-helix, Fis-type; KEGG:
FT                   shm:Shewmr7_3626 helix-turn-helix, fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23346"
FT                   /db_xref="GOA:A1RFA1"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RFA1"
FT                   /protein_id="ABM23346.1"
FT                   /translation="MFDQTTNTEVHQLTVGKIETANGTIKPQLLRDAVKRAVTNFFAQL
FT                   DGQEAQEVYEMVLSEVEAPLLDIIMQHTRGNQTRAANMLGINRGTLRKKLKKYGMN"
FT   gene            complement(533879..534847)
FT                   /locus_tag="Sputw3181_0496"
FT   CDS_pept        complement(533879..534847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0496"
FT                   /product="putative TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: putative TIM-barrel protein, nifR3 family;
FT                   PFAM: dihydrouridine synthase, DuS; dihydroorotate
FT                   dehydrogenase; KEGG: son:SO0394 tRNA-dihydrouridine
FT                   synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23347"
FT                   /protein_id="ABM23347.1"
FT                   /translation="MQIGPYQLKNQLIVAPMAGVTDQVFRNLCLRYGAALAVSEMLSSN
FT                   PDVWETDKSRQRMMHSGEEGIRSVQIAGADPDLMAQAAQFNVEQGAHIIDINMGCPAKK
FT                   VNKKLAGSALMQNPPLVKAILQAVVAAVNVPVTLKIRTGWAPEHRNGVQIAQIAEDCGI
FT                   ASLAVHGRTRQCMYKGDAEYDTIKAIKQNVSIPVVANGDIDSPEKARFVLDYTGVDALM
FT                   IGRGAQGRPWIFREIQHYLETGNKLAPIEVAQQREVMLEHLTKLYDLYGEYKGIRFARK
FT                   HMGWYLDQEAQRQFRADFNRLETAAEQYSLVECYFDELAQN"
FT   gene            complement(535022..535903)
FT                   /locus_tag="Sputw3181_0497"
FT   CDS_pept        complement(535022..535903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0497"
FT                   /product="LSU ribosomal protein L11P methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: ribosomal protein L11 methyltransferase;
FT                   PFAM: methyltransferase small; ribosomal L11
FT                   methyltransferase; Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: son:SO0395 ribosomal
FT                   protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23348"
FT                   /db_xref="GOA:A1RFA3"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RFA3"
FT                   /protein_id="ABM23348.1"
FT                   /translation="MPWIQLRINTNSDDAETISDLLMEEGSVSITFEDGKDTPIFEPKL
FT                   GETPLWRDTVVVALFEADTDLTPTIEMLKTLPFLGDNFSHKIEQIEDKDWVREWMDNFH
FT                   PIQFGSRLWICPSWREIPDPTAVNVILDPGLAFGTGTHPTTALCLEWLDSLDLSNEEVI
FT                   DFGCGSGILAVAALKLGAKKVTGIDIDYQAIDASRANAERNNVADKLALYLPEDQPADL
FT                   KADVLVANILAGPLRELAPLIAERVKSGGKLALSGLLKEQAQEISDFYSQWFDMDEAAH
FT                   KEDWSRLTGKRK"
FT   gene            536358..537083
FT                   /locus_tag="Sputw3181_0498"
FT   CDS_pept        536358..537083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0498"
FT                   /product="fumarate reductase respiratory complex,
FT                   transmembrane subunit"
FT                   /note="PFAM: fumarate reductase respiratory complex,
FT                   transmembrane subunit; KEGG: shm:Shewmr7_3623 fumarate
FT                   reductase respiratory complex, transmembrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23349"
FT                   /protein_id="ABM23349.1"
FT                   /translation="MTSVTRVHNRVNTPALGHPWSARADKLQSATGLMLGCFLLLHMHF
FT                   ESSILLGKEAFYHVVQFLEGGMFSSTGHGFPIVTKIFSVFMLLVVIVHAAVALRRFPAQ
FT                   LGQWRALRSHLGGIKHKDTHAWFWQLITGFILFFLVPVHLFTMITNPEIGPHLSAERVY
FT                   HNNAWLLYALLLPAVVIHAMIGLYRVSVKWGLTTKRSSLRKVVKVLIIYLICLGTASLI
FT                   SYLFIGSELSLPVQPFVPQ"
FT   gene            537265..537936
FT                   /locus_tag="Sputw3181_0499"
FT   CDS_pept        537265..537936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0499"
FT                   /product="fumarate reductase respiratory complex,
FT                   transmembrane subunit"
FT                   /note="PFAM: fumarate reductase respiratory complex,
FT                   transmembrane subunit; KEGG: she:Shewmr4_0403 fumarate
FT                   reductase respiratory complex, transmembrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23350"
FT                   /protein_id="ABM23350.1"
FT                   /translation="MSINLKIKKWSAWLDLSQSLSGVILAVFLWTHLVLVSSILFGADA
FT                   MSWVARMMELSFLSSDGHGYPWVVTCIAIGIAVLAFIHVLVALQKLPMSLQQQRALRQQ
FT                   MQVIKHSDTRLWRWQAITGVVILLLLPVHLWLIGSAPETIGPQGSANRIWNQGVWMLYL
FT                   PLLLTVELHAAIGIYRVALKWGAARDLNSRARLRKLKTIISVVFVSVGIASLLAFLPHA
FT                   S"
FT   sig_peptide     537265..537393
FT                   /locus_tag="Sputw3181_0499"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.705) with cleavage site probability 0.491 at
FT                   residue 43"
FT   gene            538022..540028
FT                   /locus_tag="Sputw3181_0500"
FT   CDS_pept        538022..540028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0500"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: son:SO0398 fumarate reductase flavoprotein
FT                   subunit; TIGRFAM: succinate dehydrogenase or fumarate
FT                   reductase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23351"
FT                   /protein_id="ABM23351.1"
FT                   /translation="MKLIYTDSLVVGAGLAGLRVAIASKERGLDTLVLSLIPAKRSHSA
FT                   AAQGGMQASLGNAVKGMGDDEDVHFQDTVKGSDWGCDQEVARMFAHCAPKAVRELANWG
FT                   VPWSRVSAGPREVIVNAQKVTLHEAEEAHGLINARDFGGTKKWRTCYTADGTGHSLLYA
FT                   MDNKAISMDIPVHERVEALALIHDGKRCHGVVARCLITGELRAYVAKSTTIATGGYGRI
FT                   YEVSTNAIICEGVGHALALETGVATLGNMEAVQFHPTAIVPVGILTTEGCRGDGGLLRD
FT                   KDGYRFMPDYEPDKKELASRDVVSRRMTEHMRKGKGVDSPYGPHLWLDITLLGRKHIET
FT                   NLREVQEICENFLGIDPAKDWIPVRPTQHYSMGGIRTNATGESPQLKGLFSVGEAACWD
FT                   MHGFNRLGGNSLAETVVGGMIIGKYVADFCENNSLEINTQLAEKFMKQVQDEIDTLIEG
FT                   DGTESPFELKHEMQRIMMDYVGIFRNGPELEKAVAELKVLLERSRKLGLKCKKRHANPE
FT                   LVEALRVKRMLKVALTVACGAAARTESRGAHAREDYPQRNDRDWLNRTLASWPDPNALE
FT                   PMLNYEALDVMKMELPPGYRGYGIDNAIVHPDTQKREQQIAEILAGLGDDTDRYQRQRA
FT                   LMPFELPESLQPNNERLSDTLKKPSANALGEKS"
FT   gene            540028..540759
FT                   /locus_tag="Sputw3181_0501"
FT   CDS_pept        540028..540759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0501"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: shm:Shewmr7_3620 succinate dehydrogenase and
FT                   fumarate reductase iron-sulfur protein; TIGRFAM: succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein;
FT                   PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23352"
FT                   /protein_id="ABM23352.1"
FT                   /translation="MSQGRQLTFNIFRYDPQEPNDKPKMVRYQITETPGMTVFIALNKL
FT                   REEQDTSLQFDFVCRAGICGSCAMVINGFPTLACRTLTAKYPKGEITLMPLPGFELIGD
FT                   LSVNTGKFMRELAERLKLWLHPKPNDINVHRLEDPMDPDEAARLYELERCVECGVCVSA
FT                   CATKQMRDTFVGAVGMMKIARFEMDSRDARSAEDFYHVIGNQDGVFGCMTLLGCQDNCP
FT                   KDLPHMQQIAYLRRKMAMTLI"
FT   gene            complement(540810..541094)
FT                   /locus_tag="Sputw3181_0502"
FT   CDS_pept        complement(540810..541094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0502"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   she:Shewmr4_0406 antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23353"
FT                   /protein_id="ABM23353.1"
FT                   /translation="MKITVFAQIIANQGQSDTLFKILKQLVTDTHTEAGCIEYKLHHSL
FT                   DDENIFWIYEIWQSQAALDEHMASTHFQAFVAQTADIINRADIHKSYAC"
FT   gene            complement(541091..542113)
FT                   /locus_tag="Sputw3181_0503"
FT   CDS_pept        complement(541091..542113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0503"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   son:SO0401 alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23354"
FT                   /protein_id="ABM23354.1"
FT                   /translation="MKAIGYQTAGAITAPNALENITLAEPTATGFDLLVEIKAISVNPV
FT                   DTKIRASSSAPTGEYKIIGWDAVGVVKAVGEKVSLFNVGDEVWYAGDISRSGSYAEYQL
FT                   VDERIVGHKPKSLTYTQAAALPLTGITAWEILFDRLALPQDGSATDARILIIGAAGGVG
FT                   SIITQLAVKLTGAEVIGTASRPESAAWVHKLGADAVINHTRPLSKELANIGITDVTHVI
FT                   SLTQTDQHFDEIVQVLKPQGKLALIDDLKGPLDVMKLKRKSLSLHWELMFTRSLYQTED
FT                   MIAQHHLLNRLSALIDTGELQSTFGEHYGTINAQNLIKAHAQIESGKAIGKIVLEGFNQ
FT                   "
FT   gene            542248..543174
FT                   /locus_tag="Sputw3181_0504"
FT   CDS_pept        542248..543174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0504"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: she:Shewmr4_0408 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23355"
FT                   /protein_id="ABM23355.1"
FT                   /translation="MLINDLALFVRVADCGNISAAAAEMDISAASASAAIKRLEKQLDT
FT                   SLFIRTTRSLRLTVQGERYLIHCRRALSDLALGEQAIASDKGKISGTLSLSVSSDFGRN
FT                   LFVPWLDEFLLDFPQLLVRLHLGDNISSFYHDKIDVAVRYGKPQDSNQVAFPICSVDRV
FT                   LCASPEYLAKFGVLDSLEQLVEHNCLFYKLDDRTHDQWLFRRDGQEFKVRVTGNRSAND
FT                   AEIARRWAVAGKGLVFKSSLDLADDLISGRLVRLLPEYQGEPVDLYLVCPGREHVTPVV
FT                   LLLREMLRQRTLALSKNLSKILAVKKS"
FT   gene            complement(543226..544491)
FT                   /locus_tag="Sputw3181_0505"
FT   CDS_pept        complement(543226..544491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0505"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: shm:Shewmr7_3616 transcription termination
FT                   factor Rho; TIGRFAM: transcription termination factor Rho;
FT                   PFAM: H+-transporting two-sector ATPase, alpha/beta
FT                   subunit, central region; Rho termination factor domain
FT                   protein; Rho termination factor, RNA-binding; Ribonuclease
FT                   B, OB region N-terminal domain; SMART: AAA ATPase; Cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23356"
FT                   /protein_id="ABM23356.1"
FT                   /translation="MNLTELKDTPISDLVSLAENMKLENMARARKQDIIFSILKAHAKS
FT                   GEDIFGGGVLEILQDGFGFLRSSDGSYLAGPDDIYVSPSQIRRFNMRTGDTIFGKIRPP
FT                   KEGERYFALLKVNEVNFDKPENSRNKILFENLTPLHAEERMRMERGNGSTEDITARILD
FT                   LCSPIGKGQRGLIVAPPKAGKTLLLQGIAQSISYNNPEVVLMVLLIDERPEEVTEMQRL
FT                   VKGEVIASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSS
FT                   GKVLTGGVDANALHRPKRFFGAARNIEHGGSLTIIATALVDTGSKMDEVIYEEFKGTGN
FT                   QELHLSRKAAEKRVFPAIDFNRSGTRREEKLTTQEELQKMWILRKILNPMDEVSAMEFL
FT                   IDKLAMTKTNEEFFTAMKRTKS"
FT   gene            complement(544704..545030)
FT                   /locus_tag="Sputw3181_0506"
FT   CDS_pept        complement(544704..545030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0506"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: shm:Shewmr7_3615 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23357"
FT                   /protein_id="ABM23357.1"
FT                   /translation="MSDKIIYLSDDGFENDVLKSDLPVLVDFWAEWCGPCKMIAPILDD
FT                   VAEEYAGRVTIAKLNVDQNNVSPAKYGVRGIPTLLLFKNGELAATKVGALSKTQLKEFI
FT                   DAQI"
FT   gene            545183..546502
FT                   /locus_tag="Sputw3181_0507"
FT   CDS_pept        545183..546502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0507"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases-like;
FT                   KEGG: shm:Shewmr7_3614 DEAD/DEAH box helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23358"
FT                   /db_xref="GOA:A1RFB3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RFB3"
FT                   /protein_id="ABM23358.1"
FT                   /translation="MSETHLSTQKFADLPLHPEVKQALAENGFEFCTPIQALSLPVLLQ
FT                   SKDIAGQAQTGTGKTMAFLVATFNHLLSTPIPEGRQINQPRAIIMAPTRELAIQIAKDA
FT                   ILLAKHTRLKVGIVYGGESYDVQRKVLDQGVDILIGTTGRIIDYVRQGIISLTAIQAVV
FT                   LDEADRMFDLGFIKDIRFLFRRMPDANQRLNMLFSATLSMKVQELAYDHMNDPVKVDIA
FT                   PDEKTSKNIKEEVFYPSQEDKMRLLLTLIEEDWPEKAIVFSNTKHSCENLWSWLEGDGH
FT                   RVGLLTGDVPQKKRIRILEQFTSGQLDILVATDVAARGLHISDVSHVYNYDLPDDCEDY
FT                   VHRIGRTGRAGNKGVSISFACEEYALNLPAIESYINHSIPVSNYDSSALLEDIPAPVKI
FT                   PRKHPAGTRNLRERAGAGRPQGAHRSGGRPPRHDRTRRHS"
FT   gene            546503..547429
FT                   /locus_tag="Sputw3181_0508"
FT   CDS_pept        546503..547429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0508"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: shm:Shewmr7_3613
FT                   Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23359"
FT                   /protein_id="ABM23359.1"
FT                   /translation="MPTPAYAAITLGSNSFNMLIAKTKGGQPHIIAKYKRKVRLAEGIG
FT                   EDGKLNPEVMQRGLDCLAMFAQMLTQHKIHQDHVAVIATATLRSISNADEFNERALPLL
FT                   GHSIEIISGMREAELIYQGMVATTCGQGRRLVIDIGGASTEFIIGDGHQVLFKTSLPMG
FT                   SVTYNRQFFSNMPFQQLDFDDAKQQVLVTLAEHRKTLRDLGWHCVVGASGAVQSVVEVL
FT                   LHREQSETITLEVLNQLKAEILVQEDRQLLGIHGLSSERAPTFAAGVAILLALFELLGI
FT                   EHLSLSGGALREGVLIMLAQRILEEAI"
FT   gene            complement(547753..548289)
FT                   /locus_tag="Sputw3181_0509"
FT   CDS_pept        complement(547753..548289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3612 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23360"
FT                   /protein_id="ABM23360.1"
FT                   /translation="MHNNVKALLATTALFFSCQVLANSGCGFEEQQQGLIATCSEEKQE
FT                   VILTGIVEAQHLVNDLNEFTEGYKSYQVDTAAIAPLKNIKEPTEIIVIIGTWCPDCHRE
FT                   TPRFIRIMEEVANPNIKVTYIGVDRTKKDPEGLAAKYEFTRIPTFIIQQQGKEIGRIIE
FT                   RPTTSLEKDLAEILK"
FT   sig_peptide     complement(548221..548289)
FT                   /locus_tag="Sputw3181_0509"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            complement(548838..549242)
FT                   /locus_tag="Sputw3181_0510"
FT   CDS_pept        complement(548838..549242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0510"
FT                   /product="mutator MutT protein"
FT                   /note="TIGRFAM: mutator MutT protein; PFAM: NUDIX
FT                   hydrolase; KEGG: she:Shewmr4_0414 mutator MutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23361"
FT                   /protein_id="ABM23361.1"
FT                   /translation="MTKRIHVAVGIIVNKAQQVLLAKRPDHLHQGGKWEFPGGKVETGE
FT                   SVTQALMRELKEEVAIEVISSEPFMALSYDYPDKQVLLDIHTVIHFTGEAQGLEGQQIA
FT                   WVEKHDLINYDFPDANKPILEKLLENALPC"
FT   gene            complement(549294..549503)
FT                   /locus_tag="Sputw3181_0511"
FT   CDS_pept        complement(549294..549503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0511"
FT                   /product="protein of unknown function DUF329"
FT                   /note="PFAM: protein of unknown function DUF329; KEGG:
FT                   shm:Shewmr7_3610 protein of unknown function DUF329"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23362"
FT                   /db_xref="GOA:A1RFB7"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RFB7"
FT                   /protein_id="ABM23362.1"
FT                   /translation="MPLTVKCPICKTPVEWAPQSEFKPFCSERCKLIDLADWASEKHAI
FT                   PVKSEFDLDALDEFDLDEDAFFKE"
FT   gene            complement(549661..550395)
FT                   /locus_tag="Sputw3181_0512"
FT   CDS_pept        complement(549661..550395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0512"
FT                   /product="protein of unknown function DUF1342"
FT                   /note="PFAM: protein of unknown function DUF1342; KEGG:
FT                   she:Shewmr4_0416 protein of unknown function DUF1342"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23363"
FT                   /protein_id="ABM23363.1"
FT                   /translation="MTDLVYEQPLNEKIRSYLRLEYLDKQLRTNLNHDHQHRCFYPLFS
FT                   LCELSERCDYRNEVLKDIERHLLQLNKWQELEQADHQQINFYINALTQARELLQKPERF
FT                   GSQLKQDRFLSALRQRFGMPGACCSFDLPQLHFWLAKPWEERQQDYLAWIAHFDPLLTP
FT                   ITQLLQLTRSTSIFNNAIAHAGFYQGDSNQALSLVRVKLDASQGCYPTISGHKNRYAIH
FT                   FVQFDQQRHSDKPIDFLLATCV"
FT   gene            complement(550388..551005)
FT                   /locus_tag="Sputw3181_0513"
FT   CDS_pept        complement(550388..551005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0513"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="KEGG: shm:Shewmr7_3608 dephospho-CoA kinase;
FT                   TIGRFAM: dephospho-CoA kinase; PFAM: Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23364"
FT                   /protein_id="ABM23364.1"
FT                   /translation="MSKFVVGLTGGIGSGKTTVANLFAAEGITLVDADIVAREVVAKDS
FT                   KGLKAIVEHFGTEMLTPEGELDRAKLRERIFNQSAEREWLNQLLHPMIRQEMLEQVKNA
FT                   TSPYVIMVVPLLFENGLDRLVNRTLVVDISPELQISRTVIRDQVDAAQVNNIINSQCSR
FT                   SEKLARADDIIDNQGEISALKREVLALHQRYLQLSGIDNAHD"
FT   gene            complement(551348..552274)
FT                   /locus_tag="Sputw3181_0514"
FT   CDS_pept        complement(551348..552274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0514"
FT                   /product="type 4 prepilin peptidase 1. Aspartic peptidase.
FT                   MEROPS family A24A"
FT                   /EC_number="3.4.23.43"
FT                   /note="PFAM: peptidase A24A, prepilin type IV; peptidase
FT                   A24A domain protein; KEGG: son:SO0414 leader peptidase
FT                   (prepilin peptidase) / N-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23365"
FT                   /protein_id="ABM23365.1"
FT                   /translation="MTEFITLLGQSFEQSPWLFVTLSFIFAATIGSFLNVVIHRLPIMM
FT                   KREWQQECNQYLQEYHADIVNQVGIDRLNKPIDSYPEKYNIVVPGSACPQCKTAIKPWH
FT                   NLPVLGWLILRGKCAACHAPISTRYPIIELITGLLIAALAWHFGPSWQFVFASLLTFVL
FT                   IALTGIDLDEMLLPDQLTLPLLWLGLLLNLHHTFASPTDAIIGAATGYLSLWSIFWVFK
FT                   LLTGKEGMGYGDFKLLAVFGAWLGWQMLPLVILLSSLVGAVVGIGMIISKRNQMDNPIP
FT                   FGPYIAAAGWIALVWGNPIIDWYLGTL"
FT   gene            complement(552474..553739)
FT                   /locus_tag="Sputw3181_0515"
FT   CDS_pept        complement(552474..553739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0515"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   shm:Shewmr7_3606 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23366"
FT                   /protein_id="ABM23366.1"
FT                   /translation="MATATTVKKPRPKKIEPKSQPKIFTFEWKGTNRDGKKTGGELKGA
FT                   TVAEVKSQLKSQGVNPKVVRKKASPFFARNPDIKPMDIAMATRQIATMLAAGVPLVTTI
FT                   EILGRGHEKLKMRDLLGTILSEIQSGIPLSDALRPHRRYFDDLYVDLVAAGEHSGSLDA
FT                   VFDRIATYREKAEQLKSKIKKAMFYPAAVVVVAILVTTLLLLFVVPQFEDIFKGFGAEL
FT                   PAFTQMIIGISRWLQSSWYLFFIAITVGIWLFVRAHRNSQMVRDRVDEFVLKIPVIGEI
FT                   LHKAAMARFSRTLATTFAAGVPLIDGMESAAGASGNAVYRKALLKVRQEVMAGMQMNVA
FT                   MRTTGLFPDMLIQMVMIGEESGSLDNMLNKVANIYEMQVDDAVDGLSSLIEPIMMVVIG
FT                   TLVGGLIVGMYLPIFQMGNVVG"
FT   gene            complement(554190..555899)
FT                   /locus_tag="Sputw3181_0516"
FT   CDS_pept        complement(554190..555899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0516"
FT                   /product="type IV-A pilus assembly ATPase PilB"
FT                   /note="TIGRFAM: type IV-A pilus assembly ATPase PilB; PFAM:
FT                   type II secretion system protein E; General secretory
FT                   system II, protein E domain protein; KEGG: son:SO0416 type
FT                   IV pilus biogenesis protein PilB"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23367"
FT                   /protein_id="ABM23367.1"
FT                   /translation="MPTTGLHLGLSTLFIRKGLLNEEQMAGAIAKSRHNKQGLVATLVQ
FT                   GQLVSSRTIAELCYEEYGTPLLDLAEFDIRAIPEDFLNKKLIEKHRCLPLFKRGNRLYI
FT                   ATSDPTNITALEDFQFSAGLHAEAILVEEDKLAKALEKILEEDITSLDLGGMDEAALAG
FT                   IEITDTDRRNEEPTGDSSDDAPIVIYINKILTDAIRKGASDLHFEPYEKRYRIRFRIDG
FT                   ILHEVSEPPISLAGRLSARLKVMSKLDIAERRVPQDGRIKMKLSRTKSIDFRVSTLPTL
FT                   WGEKIVMRILDSSSAQLGIEKLGYEPDQEKLYLEMLAKPQGMILVTGPTGSGKTVSLYT
FT                   GLNILNTAERNISTAEDPVEINLEGVNQVHINLKAGLTFASALRSFLRQDPDVVMVGEI
FT                   RDLETAEIAIKAAQTGHLVLSTLHTNSAAETLTRLINMGVPGYNIASSVNLIIAQRLAR
FT                   RLCPECKQAEVIPEHELLRLGFSPAQITQGFTTFKPVGCEHCSGGYKGRVGIYEVMKMS
FT                   DEIARTIMEGGNSLQIASQAKAQGMRDLRQSGLLKVLQGVTSIAEVNRVTSF"
FT   gene            complement(555964..556422)
FT                   /locus_tag="Sputw3181_0517"
FT   CDS_pept        complement(555964..556422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0517"
FT                   /product="putative pilus assembly protein major pilin PilA"
FT                   /note="KEGG: par:Psyc_0240 probable pilus assembly protein
FT                   major pilin PilA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23368"
FT                   /protein_id="ABM23368.1"
FT                   /translation="MKGLTLKTGLNHKAKGFTLIELMIVVAIIGILAAIALPAYQSYVN
FT                   KAKFSEVIAATGSAKTAIDVCAQTVKAADLEADCLAAGNNAVGAMVGQYVASVTVTQTG
FT                   GVFTITATSQDIGSAAADYRLVGTATAGVGVDWEIDKTNSTCVAAGYC"
FT   sig_peptide     complement(556297..556422)
FT                   /locus_tag="Sputw3181_0517"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.613) with cleavage site probability 0.375 at
FT                   residue 42"
FT   gene            complement(557228..558307)
FT                   /locus_tag="Sputw3181_0518"
FT   CDS_pept        complement(557228..558307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0518"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: bxe:Bxe_C0885 transposase, TnpA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23369"
FT                   /protein_id="ABM23369.1"
FT                   /translation="MVRRRYTCRACKTTFRPQLPEMVDGFRMTLRLHEYVEKESFNHPY
FT                   TFVAAQTGLDEKTVRDIFNARAEFLGRWHRFETPRILGIDELYLNKRYRCILTNIEERT
FT                   LLDLLATRRQNVVTNYLMKLKDRQKVEIVSMDMWNPYRAAVKAVLPQARIVVDKFHVVR
FT                   MANDALERVRKGLRKELKPSQSRTLKGDRKILLKRAHEVSDRERLIMETWTGAFPQLLA
FT                   AYEHKERFYGIWDATTRLQAEAALDEWIATIPKGQKEVWSDLVRAVGNWREETMTYFET
FT                   DMPVTNAYTESINRLAKDKNREGRGYSFEVMRARMLYTTKHKKKAPTAKVSPFYKKTIG
FT                   YGLPDFAEELNYGVDLSTI"
FT   gene            complement(558539..559051)
FT                   /locus_tag="Sputw3181_0519"
FT   CDS_pept        complement(558539..559051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0519"
FT                   /product="signal peptidase II. Aspartic peptidase. MEROPS
FT                   family A08"
FT                   /EC_number="3.4.23.36"
FT                   /note="KEGG: bxe:Bxe_C0884 lipoprotein signal peptidase
FT                   LspA; TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   peptidase A8, signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23370"
FT                   /protein_id="ABM23370.1"
FT                   /translation="MSIFGKHLSPYALLSISGLLAASDQAVKWLVQQSMAYGESISVTS
FT                   FFNWVHVWNTGAAFSLFANGGGWQRYFFIGIAVVVSIFLIKLILENRHKGEAIACSLIL
FT                   GGAMGNLIDRVFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLLVSSSLLGKKANTN
FT                   AEPDGSD"
FT   sig_peptide     complement(558983..559051)
FT                   /locus_tag="Sputw3181_0519"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.961) with cleavage site probability 0.673 at
FT                   residue 23"
FT   gene            complement(559055..559951)
FT                   /locus_tag="Sputw3181_0520"
FT   CDS_pept        complement(559055..559951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0520"
FT                   /product="cation efflux system permease, putative"
FT                   /note="KEGG: abo:ABO_1368 cation efflux system permease,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23371"
FT                   /protein_id="ABM23371.1"
FT                   /translation="MSKSCGGACGGDATSAADTDIQASSEAPGRWVSVYAVPKMDCPSE
FT                   ERMIRLALNGFEEIRALSFDLSNRRLKVVHDGEVEPVTSKLKTLGLGASLQETVAANPE
FT                   TIKAAEFSAASAKQESGTLRWLLGINALLFVVEMTAGLIAQSTGLIGESLDNFADAAVY
FT                   GLALYAVGHSVKMQVRAAHLAGVLQLILAVGVLVEVVRRFVFGSEPESLVMMAIAFVAL
FT                   IANTSCLLLISKHREGGAHMKASWIFSANDVVINLGVITSGALVAWTGSNYPDLIIGTI
FT                   AGVIVLNGARRILALKD"
FT   gene            560047..560454
FT                   /locus_tag="Sputw3181_0521"
FT   CDS_pept        560047..560454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0521"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein, MerR; KEGG:
FT                   abo:ABO_1367 transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23372"
FT                   /protein_id="ABM23372.1"
FT                   /translation="MRIGQLAQLVGVETQTIRFYEQQGLLPPPDRQDNGYRVYTEKHGE
FT                   GLAFIRRCRILGLSLAEIHELQSYQDDPHQPCTAVNALLDDHISHVRSQITALQALEKQ
FT                   LVSLRASCNDDREVEACGVLAGISEGNMHQQ"
FT   gene            complement(560678..561565)
FT                   /locus_tag="Sputw3181_0522"
FT   CDS_pept        complement(560678..561565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0522"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: shm:Shewmr7_3603 nicotinate-nucleotide
FT                   pyrophosphorylase; TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23373"
FT                   /protein_id="ABM23373.1"
FT                   /translation="MLENDIRHAVKTALNEDLGGTDINEHTKAIAYGDITALLIPADKY
FT                   AEATLITREEGVFCGKAWAEQVFNQLGGEVALHWHVDDGDLILPNQVLCELSGPARSIL
FT                   TGERTAMNFIQTLSGVATLTKHYVDKLAGTHTRLLDTRKTIPGLRTAQKYAVTCGGGKN
FT                   HRIGLFDAFLIKENHIMACGGIRQAVDAARNLHPNKPVEVEVESLSELALALDSGTDII
FT                   MLDNFDITMMVEAVELNNQYRANGKAKGAKLEVSGNVTLDTLAEFAKTGVDYISVGALT
FT                   KHVRALDLSMRLKG"
FT   gene            561884..562426
FT                   /locus_tag="Sputw3181_0523"
FT   CDS_pept        561884..562426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0523"
FT                   /product="N-acetylmuramyl-L-alanine amidase, negative
FT                   regulator of AmpC, AmpD"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase, family 2;
FT                   KEGG: son:SO0421 AmpD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23374"
FT                   /protein_id="ABM23374.1"
FT                   /translation="MSFEFGWYSAARRSESPHFNQRPEAEVSLLVIHNISLPAGCFGLP
FT                   YIDQLFKGCLDTSADDSFTELAGLQVSAHFLIRRDGECVQYVSCHDRAWHAGVSCYGER
FT                   ENCNDFSIGIELEGTDTEPYVDAQYVRLVELTQALLIEYPLLNTKRIVGHCDIAPLRKT
FT                   DPGQSFDWERYLRALRC"
FT   gene            562626..563477
FT                   /locus_tag="Sputw3181_0524"
FT   CDS_pept        562626..563477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0524"
FT                   /product="signaling modulator of AmpD, AmpE"
FT                   /note="KEGG: she:Shewmr4_0426 signaling modulator of AmpD,
FT                   AmpE"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23375"
FT                   /protein_id="ABM23375.1"
FT                   /translation="MALFSLLVAILVERLKFLPSSWQFDRLLQSYQMTFFGDKASLTTP
FT                   MMALALVLPALVVYVLSWLVAGMFWGILSLALWVFVAAICFNHLKQREIFKKYMQAACR
FT                   SDVQACYLYAAELDCSECLDAVSEKDLGAKVGQSVAWINYRYYGAVALFLIFFGPVGTV
FT                   LYCTVRYYAEENARKSLNLPLVDEFIAVLDWIPSRLFAFGYALSGQFSEGLTAWRNNAL
FT                   RFNTSARRVITETAVAAQPLPEVSDAPICVQSTLALLVLSKRNFTLMVAIVSLLTIFGL
FT                   VS"
FT   gene            563987..564739
FT                   /locus_tag="Sputw3181_0525"
FT   CDS_pept        563987..564739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0525"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: shm:Shewmr7_3600 regulatory protein GntR,
FT                   HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23376"
FT                   /protein_id="ABM23376.1"
FT                   /translation="MAYSKINQPKISDVIMAQLEQMILEGSLKPGQKLPPERELAIQFE
FT                   VSRPSLREAIQKLEAKGLLMRRQGGGTYVKEQLWQTLADPIVELMNSDPESQYDLLEFR
FT                   HATEGMMAYFAALRGTDADMQNIKRMILEVEAASIIEQKAAAIVHFYRAVAEASHNVAM
FT                   LHLVLSLTPVLHKNVAQNLELLSRREEASTMANDHRRALLAAIVRRDPDAAREASNEHL
FT                   SYIEEVMLSVREEDSRLQRSLRRLKSGA"
FT   gene            564822..567488
FT                   /locus_tag="Sputw3181_0526"
FT   CDS_pept        564822..567488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0526"
FT                   /product="2-oxo-acid dehydrogenase E1 subunit, homodimeric
FT                   type"
FT                   /EC_number="1.2.4.1"
FT                   /note="TIGRFAM: 2-oxo-acid dehydrogenase E1 subunit,
FT                   homodimeric type; KEGG: son:SO0424 pyruvate dehydrogenase
FT                   E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23377"
FT                   /protein_id="ABM23377.1"
FT                   /translation="MSEDMLQDVDPLETQEWVDALQAVLEQEGPERAHFLLEKLIDKAR
FT                   RNGTHLPYNATTAYLNTIPAGQEPHMPGNQEMERRIRAIIRWNALAMVLRGSKKDLELG
FT                   GHISSFASSATIYDVCFNHFFRAPNEKDGGDLVYFQGHIAPGIYARSFLEGRLTEDQLA
FT                   NFRQEVDGKGLSSYPHPKLMPDYWQFPTVSMGLGPIQAIYQARFLKYLTDRGLKDCSAQ
FT                   TVYCFLGDGECDEPEALGAIGLAAREELDNLVFIVNCNLQRLDGPVRGNGKIIQELEGE
FT                   FRGAGWEVVKVIWGRYWDPLLARDTSGKLLQLMEETVDGEYQNCKAKGGAYTREHFFGK
FT                   YPETAEMVANMSDDDIWRLNRGGHDPVKVYAALDHAQKTKGRPTVILAKTVKGYGLGDA
FT                   GEGKNIAHNVKKMGIESIRYFRDRFNIPIPDDQLEDLPFYHPGPDSEEVKYMMSRREAL
FT                   HGSVPQRRQKFTEELEIPSLKIFDSILQGSNGREISSTMAFVRVLTALLKDKKIGKNIV
FT                   PIIPDEARTFGMEGLFRQVGIYAHEGQKYIPQDSDQVAYYREDKTGQVLQEGINELGAM
FT                   SSWVSAATSYSVNNVPMIPFYIYYSMFGFQRIGDMAWAAGDMRARGFLVGGTSGRTTLN
FT                   GEGLQHQDGHSHVLANTVPNCISYDPTYGYEIAVVVQDGIRRMYGENQEDIFYYLTTMN
FT                   ENYVQPEMPEGAEEGIVKGIYKLETVSGSGKGKVQLMSCGTILEQTRKAAQALAKDFGI
FT                   TADVFSVTSFNELTRDGQAVERWNMLHPTQTPKQAYISQVISSDAPAIAATDYMKIYGE
FT                   QLRAYMPTDYKVLGTDGFGRSDSRENLRHHFEVDAKFIVIAALKSLVDRKELPVDVLAN
FT                   AIKEYGIDADKINPQYA"
FT   gene            567501..569510
FT                   /locus_tag="Sputw3181_0527"
FT   CDS_pept        567501..569510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0527"
FT                   /product="pyruvate dehydrogenase complex dihydrolipoamide
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="KEGG: son:SO0425 pyruvate dehydrogenase E2 component
FT                   (dihydrolipoamide acetyltransferase); TIGRFAM: pyruvate
FT                   dehydrogenase complex dihydrolipoamide acetyltransferase;
FT                   PFAM: biotin/lipoyl attachment domain-containing protein;
FT                   catalytic domain of components of various dehydrogenase
FT                   complexes; E3 binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23378"
FT                   /protein_id="ABM23378.1"
FT                   /translation="MAELKEVFVPDIGGDEVQVIEICAAVGDTLAADESIITVESDKAT
FT                   MDIPAPFAGVLAELKVAVGDKVSEGTLIAMMQAAGAAAADPAPVAAPSSAPAAAPVQAA
FT                   PAPAVPAATSTQAVETKVVEVAVPDIGGDTDVSVIEVLVAVGDKIEVDSGLITLETDKA
FT                   TMDVPSPFAGVVKEVKVAVGDKVSEGSLVIMLEVGGAAPAVAASAPTVAAQAAPAATVA
FT                   PVAPASATPTASVVTVKEIQVPDIGDASNVDVIEVLVSVGDMITADQGLITLETDKATM
FT                   EVPAPFAGKLLSLTVKVGDKVSQGSVIATVETTAVGAAAPAPVAQAPAVQEVAPVAAQA
FT                   PASRPPVPHHPSAGAPVSTGAVHASPAVRRLAREFGVDLTQVTGSGRKGRIMKEDVQAY
FT                   VKYELSRPKATAATSVGAGNGGGLQVIAAPKVDFSKFGEVEEIPLSRIQKISGPNLHRN
FT                   WVTIPHVTQFDEADITEMEEFRKQQNDAAAKKKADYKITPLVFMMKAVAKTLQQFPVFN
FT                   SSLSSDGESLIQKKYFHIGVAVDTPNGLVVPVVRDVDKKGIIELSRELADISIRARDGK
FT                   LKSADMQGSCFTISSLGGIGGTAFTPIVNYPDVAILGVSKSEIKPKWNGKEFEPKLMLP
FT                   LSLSYDHRVIDGAMAARFSVTLSGILSDIRTLIL"
FT   gene            569658..571085
FT                   /locus_tag="Sputw3181_0528"
FT   CDS_pept        569658..571085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0528"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: shm:Shewmr7_3597
FT                   dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23379"
FT                   /protein_id="ABM23379.1"
FT                   /translation="MSNEIKTQVVVLGAGPAGYSAAFRAADLGLETIIVERFSTLGGVC
FT                   LNVGCIPSKALLHVAKVIEEAKAVAAHGVVFGEPTIDLDKLRSFKEKVIGQLTGGLGGM
FT                   SKMRKVNVVNGFGKFTGPNTLEVTAEDGTVTKVTFEQAIIAAGSRPIKLPFIPHEDPRI
FT                   WDSTDALELKAVPGKLLVMGGGIIGLEMGTVYSSLGSEIDVVEMFDQVIPAADKDVVRV
FT                   FTKQIKKKFNLILETKVTAVEAREDGIYVSMEGKSAPAEPVRYDAVLVAIGRTPNGKLI
FT                   DADKAGVKIDERGFINVDKQLRTNVPHIYAIGDIVGQPMLAHKGVHEGHVAAEVIAGMK
FT                   HYFDPKVIPSIAYTDPEVAWVGLTEKEAKEQGIAYETATFPWAASGRAIASDCSEGMTK
FT                   LIFDKDTHRVIGGAIVGVNGGELLGEIGLAIEMGCDAEDLALTIHAHPTLHESVGLAAE
FT                   MYEGSITDLPNPKAKKK"
FT   gene            571217..575680
FT                   /locus_tag="Sputw3181_0529"
FT   CDS_pept        571217..575680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0529"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: she:Shewmr4_0431 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; Two component
FT                   regulator propeller; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23380"
FT                   /protein_id="ABM23380.1"
FT                   /translation="MQIKIIKTFLACFILVLTSFHSVWAGGFVQRVFTDRDGLAATSIR
FT                   GLALDYYGFVWAATEQGLYRVSNAKVRRIDKIGFESRLADDFLTSVVNVDRNHLLVSTH
FT                   STIYLYNILNNQFTAFGSVKLFPQYVGGALLSAIRKDDQTWLLLTDAGYIYDFSPAKTE
FT                   LSVITQLPVNRDLPWRKLLPLPNGEMLVAGQQQLVLLDKNGESVFHYHWTETMGSILDM
FT                   LEDTKQRIWIATGRGVYQFELASRQIVPVPELPEWSTSIVEDPKGFLWFTSRVGLLKWS
FT                   PETRQVENYQKELKAQANMEILKAMLFDSSGLMWVGGSGDGLALLASSPDFILETYTAD
FT                   QPYQLSDAMTWSIYANNDGVWLGSSNLAFIGKHSQKAVDIPINGLEPHQSIYDINDFGE
FT                   HNLLISTTGGLFVVDKQTLQGNSFSQWASGQDGFKNKLIYKTYKDPQIKGRIWIATSTG
FT                   LYYWESGLSEPRPFDIDRPSNNTNEPTRPTIRTMYRASDGKLWLGGKKIFGYIDAQDEF
FT                   HDQRLLFNALATPPTVSHIEEMSSGVMWFGSYEKGLFEYHQHTEELKSLTTEWQLNCSS
FT                   VFFIQKTPKSNLVGCANSLIRQDVETGNIAIFNHRDGFISDEMNEGAYFYSPQAGFYLG
FT                   TPEGVMRLDVDRLINRINDDHVMLESVSVYYDDLTEVSLLPQPMMVIKPDANIVSLQIT
FT                   NLDYLDDSPMQFKYRLRYQGEDDNYVLLQGESQINLAGLAAGEYVLDILSQVNGIWSNK
FT                   PFSYSFYVEQHWWLSQGFKGLLMLLLLAIALSFAWYRQRQVNSFMLMNQALTESDDRLR
FT                   QSLRGSDSDLWEWHKDTQKFHLDNRGSVLGKHTNEIIVSLEDLPIHQLDRDKVLAQWNS
FT                   MLVGEVDRFEAEYRYQHREGHWGWLRVRGRPISRNKHTQEIERAAGIYSDITVQRLLED
FT                   EVKLLAQAFENTSEGVLILESNENIRVANHAAQQIIGSGDTDLVGLSFSQFLRMNDGLS
FT                   YEIKQLLDTETSWTGERELVNQRGHLCPVWLNVSMMQTANIKEHYYVVVFSDITERKRT
FT                   EADLRRLANYDVLTGLPNRSLFSNRLLQSIQVAQQTGEKLALLFLDLDRFKHVNDSYGH
FT                   SMGDALLVEASNRLQSCISSEHLLCRFGGDEFVILLRNASNIDEINHIAERLLAQIVAP
FT                   FKLFGREFYISTSIGISIWPDDAIQPEAFIKNADLAMYHAKEEGRGNFKYYSSERNAQA
FT                   LYHLRLEADLRKAIEREEFELYYQPQIDIVQGDKFIGMEALIRWRHPQEGFIRPDIFIK
FT                   VAESCGLIVDIDRWVLRQACLHGAKWIKAYSEPFKLSVNISAVHFRQADFIEGIQQILL
FT                   ETQMPPSSLGLEITEGVLMKELQVAKSHLNQLKSLGIEVAIDDFGTGYSSLAYLRHFDV
FT                   NTLKIDRSFLIDIATNTADQAIVSSIIELARNLKLNVVAEGIETVEQLEQVFSRGCYVI
FT                   QGYYFAKPMSVRDFELYIAAANRVHD"
FT   sig_peptide     571217..571294
FT                   /locus_tag="Sputw3181_0529"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            575774..577990
FT                   /locus_tag="Sputw3181_0530"
FT   CDS_pept        575774..577990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0530"
FT                   /product="Patatin"
FT                   /note="PFAM: surface antigen (D15); Patatin; KEGG:
FT                   she:Shewmr4_0432 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23381"
FT                   /protein_id="ABM23381.1"
FT                   /translation="MMRRILASLFLCLLFTPLIAAERPKIGVVLSGGGAKGAAHVGVLK
FT                   ILEEHNIPVDYIAGTSIGAYVAGMYALGYSASEVESIMMGVDWDSGYSDTIPRNILSFR
FT                   DKQLRDRYNIPLNIGYNEGEVRAPSGVLRGQTMSQLLRQSTDLVQQFGNFDDLAIPYRA
FT                   VATDLETSQPVIISHGSLVNAMQASATVPGALQPTQFEGKLLVDGGIANNMPVDVVKAM
FT                   GADIIIAVDIGSPLVKKDKLYSTIAVLDQLSNFLTNASTEKQKQLLTDKDVLIRPAIDA
FT                   LSTTDFTIMPLALTLGKEAANNHLDKLSSLSLSPDEYAAYVDAKRVKGKTLMTDVSHPI
FT                   HEIVFDNQSKVSLNLLKETLNLQKGQTVSKDELNEALKRIYSLNKFERVDAEFVEGEEG
FT                   RILTVTTKAKSWGPNYFQLGFNWEDDFNADSAISFDMAYTMTDLTFNGGEWRNEVKLGF
FT                   EKLFATEFYQPLDRDQEFFSRARYQYDIRNWDLFDNNSRVLIFDKKTHTVELGIGYNYT
FT                   LQGSIELGVVGEKGTIENDAWLIDDLDFSSYGAYLRFGYDSLDSISFPTSGNRITLNVY
FT                   VRNEDFDDVIDNNENNYSVQIEADWKGALSVGNHAFVGKTSIATNNNDGINTLHLSDLG
FT                   GFLNLSGYHKDSLTGAHKLFGAFIYQYDLGRDALGMTDYPLYLGWSLEAGNVWFERSEV
FT                   SLTDLIYASSLYVGTDTALGPAALGFGITDFGDRSFYLFVGKNF"
FT   sig_peptide     575774..575836
FT                   /locus_tag="Sputw3181_0530"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.987 at
FT                   residue 21"
FT   gene            578191..580233
FT                   /locus_tag="Sputw3181_0531"
FT   CDS_pept        578191..580233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0531"
FT                   /product="PgPepO oligopeptidase. Metallo peptidase. MEROPS
FT                   family M13"
FT                   /note="PFAM: peptidase M13, neprilysin; peptidase M13;
FT                   KEGG: son:SO0429 peptidase, M13 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23382"
FT                   /protein_id="ABM23382.1"
FT                   /translation="MKKISTLALGIALSLGLVACSSEPKTEVAAVSGIELQNFDTSVRH
FT                   QDDFYYSVNGKWLANTPIPADKSNYGAFSVLYDQSQDALKKIIDEAAAKKNAAPGSNEQ
FT                   KIGDFNASFMNTDLLETLGVTPLNPLLADIAAAKTHADLPAVMGKLLTSGAGIPFGFYV
FT                   NNDAKNSTQYAVYLSQSGLTLPDRDYYLKDDPKFAANRQAMAKYVTDLLTEAGYKDAKR
FT                   AAKNVADIEMMIAKNQWSRVESRDANKVYNKLDRAELQKLMGSFDFNAFANSAGLGDKA
FT                   SEVIVRQLSYFEKLGTSFDTFPVSAWQDYLTFHLVDSYAELLSKNFVDLNFAFKSKTLM
FT                   GIEEQQPRWKKAVDGADTVIGELVGEEYVKQYFKPEAKARMETMIKNLIKGFEVSINEL
FT                   EWMTPETKVAAQEKLAKFTYKIGYPDKWKDYSGLDIKADELVGNYLRYAKFEYQDMINK
FT                   LGKPIDRTEWHMTPQTVNAYYSPVSNEIVFPAAILQPPFFNMEADDAVNYGGIGAVIGH
FT                   EISHGFDDQGAKYDGDGNLRDWWSDKDREEFQKRGKQLSAQYSQYEALPGKFVNGDLTL
FT                   GENIGDLGGLTVAARSYIMSLNGQPAPVIDGLTGEQRFFIGWSQVWRRNYRDEELGRRL
FT                   LTDPHSPSHYRAMGTPRNIEAFYKAFEMKEGDKMYLEPNERVKIW"
FT   sig_peptide     578191..578256
FT                   /locus_tag="Sputw3181_0531"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.472 at
FT                   residue 22"
FT   gene            complement(580282..580608)
FT                   /locus_tag="Sputw3181_0532"
FT   CDS_pept        complement(580282..580608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0532"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23383"
FT                   /protein_id="ABM23383.1"
FT                   /translation="MKYYVLLALWTASLPALATDSMRCKQFVISVGDPLDIVLEKCGHP
FT                   SEAKEYSQPATYRNSAGDIVVDPSKLPIEYTEWIYDFGPSRLMRRIYAADQKIEKIETL
FT                   GYGH"
FT   sig_peptide     complement(580552..580608)
FT                   /locus_tag="Sputw3181_0532"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.999 at
FT                   residue 19"
FT   gene            complement(580663..581316)
FT                   /locus_tag="Sputw3181_0533"
FT   CDS_pept        complement(580663..581316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0533"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: son:SO0431 HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3 protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23384"
FT                   /protein_id="ABM23384.1"
FT                   /translation="MTSLSIQAVIFDMDGVLIDSEPLWQRIEYDVLSALGVPVTIETIQ
FT                   QTTGLRIDQCVDYWYHKAPWADYDNTKVSKAIVDKVAEEIRQTGEPMPGVQQAIAYCQA
FT                   KGLKIGLATSSPTALIDAVLARLKLKSQFMAVESAEALTYGKPHPEVYLNCATALGVDP
FT                   RYCLAIEDSFNGLIAARAANMQTVAIPALEQRGEAKWIIAHHQLESLSELNKVL"
FT   gene            581752..584349
FT                   /locus_tag="Sputw3181_0534"
FT   CDS_pept        581752..584349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0534"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /note="PFAM: aconitate hydratase domain protein; aconitate
FT                   hydratase 2; KEGG: son:SO0432 aconitate hydratase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23385"
FT                   /protein_id="ABM23385.1"
FT                   /translation="MLEAYRKHVAERAAEGVVPKPLDAHQVAELVKLVQTPPAGEEAFI
FT                   LDLLENRIPPGVDEAAYVKAAFLDAVAKGSVTSPILSAERATELLGTMQGGYNIEPLIA
FT                   QLDNPALAPLAVKALAHTLLMFDSFHDVVEKMEAGNEFAKQVVEAWANADWYLSRPKLA
FT                   DKVTLTVFKVSGETNTDDLSPAPDAWSRPDIPLHALAMLKNARDGIEPDVPGSVGPIKK
FT                   LDELKTKGFPLVYVGDVVGTGSSRKSATNSVLWFMGDDIPFVPNKRAGGFCLGGKIAPI
FT                   FFNTMEDAGALPIELDVSKMEMGDVIDIYPYAGIVKRHGSDEVISEFSLKTEVLLDEVR
FT                   AGGRIPLIIGRGLTDKAREVLGLPASDVFVRPQDVADTGKGYTLAQKMVGKACGVAGVR
FT                   PGQYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLTMQSFCHTAAYPKPVDVNTHH
FT                   TLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAF
FT                   AAATGVMPLDMPESVLVRFKGQMQPGITLRDLVHAIPLKAIELGMLTVEKKGKVNIFSG
FT                   RVLEIEGLESLKVEQAFELSDASAERSAAGCTIKLDKEPIIEYLNSNITMLKWMIAEGY
FT                   GDRRTIERRIKGMQEWLANPELMSADKDAEYAAVIEIDLNEIKEPILCAPNDPDDAVLL
FT                   SSVAQTKIDEVFVGSCMTNIGHFRATGKMLDKFAKTLPTRLWIAPPTKMDRDQLTEEGY
FT                   YAIFGRVGARIEIPGCSLCMGNQARVAEGATVVSTSTRNFPNRLGTGANVYLASAELAA
FT                   VAALLGRLPTVEEYQEYAKELDATAADTYRYLNFDQIDSYTKKAAEVIFQTAV"
FT   gene            complement(584428..584925)
FT                   /locus_tag="Sputw3181_0535"
FT   CDS_pept        complement(584428..584925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0535"
FT                   /product="regulator of RpoD, Rsd/AlgQ"
FT                   /note="PFAM: regulator of RNA polymerase sigma(70) subunit,
FT                   Rsd/AlgQ; KEGG: shm:Shewmr7_3591 regulator of RpoD,
FT                   Rsd/AlgQ"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23386"
FT                   /protein_id="ABM23386.1"
FT                   /translation="MECIMLRKLEKAERKWGGSNKLIDQWLENRRKLLVHYCQIAGLPP
FT                   YGKSEKSLPSLEHVKSFCDLLVDYVSEGHFEVYDQVVTACEKFGASSKTLAQQVLPKIT
FT                   PTTSAALDFNDKYAEAQDDHVLYQLDKDLSDLAHTMETRFELEDELLEVLYNKHSEQTQ
FT                   QV"
FT   gene            584986..585390
FT                   /locus_tag="Sputw3181_0536"
FT   CDS_pept        584986..585390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23387"
FT                   /protein_id="ABM23387.1"
FT                   /translation="MAFAIKNQMNKQAVLYEKIEIKSPTIESYRWASKVYSRLDATSFL
FT                   IVLASADFLYQRQGTGATFFCLTVTSGLIIKQYVIWLTFWIELAKWTSMMGISSHKLAH
FT                   IGYIIRVNAKLPTQRISISLGIKPNGRIKE"
FT   gene            585371..586435
FT                   /locus_tag="Sputw3181_0537"
FT   CDS_pept        585371..586435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0537"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: son:SO0435 uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23388"
FT                   /db_xref="GOA:A1RFE3"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RFE3"
FT                   /protein_id="ABM23388.1"
FT                   /translation="MAELKNDRYLRALLKQPVDMTPVWMMRQAGRYLPEYKATRAQAGD
FT                   FMSLCKNHELACEVTLQPLRRYELDAAILFSDILTVPDAMGLGLYFEAGEGPRFERPTD
FT                   TIDAIKKLSIPDPEDELGYVMKAVSTIRRELNGAVPLIGFSGSPWTLATYMVEGGSSKT
FT                   FEKIKKMAYAEPAALHMLLDKLADSVILYLNAQVANGAQSLMIFDSWGGALSHTAYREF
FT                   SLRYMQKIVDGLTRFADGRQVPVTLFTKGGGLWLEAMAETGCDALGLDWTVDIADARRR
FT                   VGHKVALQGNMDPSMLYAPIPRIEEEVSQILAGYGEGTGHVFNLGHGIHQHVDPEHAGA
FT                   FIKAVHAQSKQYHK"
FT   gene            586748..589327
FT                   /locus_tag="Sputw3181_0538"
FT   CDS_pept        586748..589327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0538"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: son:SO0437 sensory box protein; TIGRFAM: PAS
FT                   sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; histidine kinase,
FT                   HAMP region domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23389"
FT                   /protein_id="ABM23389.1"
FT                   /translation="MHIGKKILIFIVGFCLPAVVLVSYCLGSWYDHRVELLRQDSANRE
FT                   LANIQQQFQIDVDRLGFLTNIYALPLSQLDNTQLKDLESSWHASSMSANLSWYILRQGE
FT                   LQTFFPNERAFPNDNLREIATAVTEADDQRVEGAYLIGNQAYVVTAVKSAPNQYVLLVR
FT                   HLADNDLLEYAQALLVSKVSMSHAASVLPTIEGVHSEVIEVPSLLKNTPIYLQVQFSDG
FT                   PFREVRFKLDWVSMGFILLGVFIVGLGYIWLRRGLLKPFKNLMQQLALIDPMASVYQPV
FT                   TADGNEELEVLASRVNSLLARIYQQKERAKITLESIAEAVILTDVDARVIYMNPRAESL
FT                   LNMASCYAINQTLASLLKAGEQLNQAVFTCIRLGETAPQVEKIKLLTATPRIMERSISN
FT                   LRNHDKEIVGTVVILRDITQEELLKRQLQKRADFDSITLLLNRQAFDERLLSFADNAKA
FT                   IAVCYLDLEQFKLINDSCGHAAGDRMLAMVAKVMQACLGPQELLGRIGGDEFGLVICNR
FT                   SALSVVQLLKQISAQVSLQVLNDKNCNYKVGLSIGVAFGRAPYINAQELLKDADIACLA
FT                   AKAKGANQIHIYDDKDKELTYQRNAPKWAVRIAQAIEENELILYYQPIRGLGTGPQRQR
FT                   MEILLRIQEPCGRILAPAQFIAAAERFKLMPEIDKEVIRKAFLWLSLHPVLWPDHCISI
FT                   NLSGNSLGAEGMVEYIAQQQRVFDIPSQCICFEITETTAIQNRNRGMEMLKQLRKLGFS
FT                   FALDDFGSGFASYGYLRELPVDYVKIDGCFIKNLAVNAKDYAIVKSIQDVCRVMGIETV
FT                   AEFVENQDIIDRLQTIGINYAQGYAIGRPQPLSLYREQYEMGLAQRA"
FT   sig_peptide     586748..586831
FT                   /locus_tag="Sputw3181_0538"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.843) with cleavage site probability 0.804 at
FT                   residue 28"
FT   gene            589404..590207
FT                   /locus_tag="Sputw3181_0539"
FT   CDS_pept        589404..590207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0539"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: shm:Shewmr7_3588 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23390"
FT                   /protein_id="ABM23390.1"
FT                   /translation="MDGLTGKVVIITGASEGIGRALAVALARVGCQLVLSARNEIRLAS
FT                   LALDIANYGPAPFVFAADVASQEQCEALITASIAHYGHLDILINNAGMTMWSRFDELTQ
FT                   LSVLEDIMRVNYLGPVYLTHAALPYLKSRQGQIVVVASLAGLTGVPTRSGYAASKHAVI
FT                   GFFDSLRIELADDNVAVTVICPDFVVSEIHKRALDGKGKPLGKSPMQESKILSAQQCAE
FT                   MMLPVITARDRLLITSLRGRVGRWLKLIAPGIIDKIARKAIASGR"
FT   gene            complement(590211..590438)
FT                   /locus_tag="Sputw3181_0540"
FT   CDS_pept        complement(590211..590438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23391"
FT                   /protein_id="ABM23391.1"
FT                   /translation="MSFSIKDLIYQGEKSGVHNWQTLEGMSYYWHPDWLHIAEDMTGHK
FT                   ATAAIDINGEKATQSEAEQAIVQHLNNRDK"
FT   gene            complement(590622..591920)
FT                   /locus_tag="Sputw3181_0541"
FT   CDS_pept        complement(590622..591920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0541"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: son:SO0441 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; ATP-dependent
FT                   carboxylate-amine ligase domain protein, ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23392"
FT                   /protein_id="ABM23392.1"
FT                   /translation="MKVLIIGGGGREHALAWKAAQSAQVDTVYVAPGNAGTALEPNVEN
FT                   LAISATDIPALLDFAKTNQIELTIVGPEAPLVIGVVDAFNAAGLAIFGPTKAAAQLEGS
FT                   KAFTKDFLARHNIPTAGYKNCTEISDAKAFVRELTATTGYPVVIKADGLAAGKGVIIAQ
FT                   DQAEADAAIDDMLAGNKFGEAGSRVVIEEFLKGEEASFIVMVDGKNILPMATSQDHKAR
FT                   DNADHGPNTGGMGAYSPAPVVTQAVHDWTVANVIRPTVDGMAAEGNVYTGFLYAGLMIA
FT                   PDGSAKVLEYNCRFGDPETQPIMMRLKSDLVELCLAATRGELDKVTAEYDERAAVGVVL
FT                   AAGGYPDEYRKGDVIDGLSLGDNNGKVFHAGTEMKDGHVVTNGGRVLCATALGNTVTEA
FT                   QKAAYLLVDEIHWDDVYFRTDIGYRAIAREQQG"
FT   gene            complement(591991..593622)
FT                   /locus_tag="Sputw3181_0542"
FT   CDS_pept        complement(591991..593622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0542"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase / IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="KEGG: son:SO0442
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase /
FT                   IMP cyclohydrolase; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM: MGS domain
FT                   protein; AICARFT/IMPCHase bienzyme, formylation region"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23393"
FT                   /protein_id="ABM23393.1"
FT                   /translation="MTAANNARPIRRALLSVSDKTGILEFAKALHAQGVELLSTGGTAR
FT                   LLADNGVPVIEVSDYTGHPEIMDGRVKTLHPKVHGGILARRGLDESVMADNNINAIDLV
FT                   AVNLYPFAETVAKAGCTLEDAIENIDIGGPTMVRAAAKNHKDVTIVVNAADYSRVLAEM
FT                   TANNGSTTHATRFDLAIAAFEHTAGYDGMIANYFGTMVPMHRVPAHSTDECFEDSLSVD
FT                   GSKFPRTFNTQLVKKQDLRYGENSHQKAAFYVDTKIDEASVATAIQLQGKALSYNNIAD
FT                   TDAALECVKEFSEPACVIVKHANPCGVALGKDLLDAYNRAYQTDPTSAFGGIIAFNGEL
FT                   DAETASAIVERQFVEVIIAPSVSQAARDVIAKKTNVRLLECGQWNTKTQTLDYKRVNGG
FT                   LLVQDRDQGMVGLDDIKVVTKRQPTESELKDLMFCWKVAKFVKSNAIVYAKDGMTIGVG
FT                   AGQMSRVYSAKIAGIKAADEGLEVVNSVMASDAFFPFRDGIDAAAAAGISCIIQPGGSM
FT                   RDAEIIAAADEHGMAMVMTGMRHFRH"
FT   gene            593960..594430
FT                   /locus_tag="Sputw3181_0543"
FT   CDS_pept        593960..594430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0543"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Zn(II)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein, MerR; KEGG:
FT                   shm:Shewmr7_3583 transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23394"
FT                   /protein_id="ABM23394.1"
FT                   /translation="MYRIGELADLCEVKADTLRFYEKHGLLAPSSRTESGYRVYTEADA
FT                   ARLRFILRAKAVGFTLSEISELLSIDLDKSNWACADVKGMVDLKLAQVQVKIAELLHFQ
FT                   TSLQSLSDACCGGPRSAEHCSILEALESSTERVRVEHDHGADCTTTLEKSGN"
FT   gene            594433..595920
FT                   /locus_tag="Sputw3181_0544"
FT   CDS_pept        594433..595920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0544"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: son:SO0444 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23395"
FT                   /protein_id="ABM23395.1"
FT                   /translation="MLLKNFIDLFLDSAPWLLLGLILAGLLKVFVPMAWMQKQLGGHGF
FT                   KTVVKAALLGAPLPLCSCGVIPAAVGLRRSGASKAATTSFLVSTPETGVDSVTVSYVLL
FT                   GPFMAIVRPIAAITSAIVAGLLVGRDDDDSKSVVKVETQSDKPLEGVASCCASKSVAQP
FT                   EMVQAEAVKSCCSSTTPAITPVKSSCCGNDGVDAPAAEPKPKIKMTPMAAPSLMAGSSS
FT                   VMAVGGQTMGSVQTMGSVVKVNAAKAKSAGSCCGSQTTESEQIVVVKKGACCGSASAQT
FT                   NDKPDGESCCASTQDMATELKSESVLSRVGIGLKYAATDLVRDTTLWLLVGLFFAALVQ
FT                   TYVPADFLAKWGDGILAMLVMVLVSVPMYICATASTPIAAGLLLAGVSPGAVLVFMMAG
FT                   PATNIATLGVVGKELGKRALWGYLGGVLGVALVAGMLVNYLVDTFGFVVMPQIGEEHQM
FT                   LPEWLVAISGIVLALLMAKVVFEKIPRSWLRRSDCCS"
FT   gene            complement(596039..596926)
FT                   /locus_tag="Sputw3181_0545"
FT   CDS_pept        complement(596039..596926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0545"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: shm:Shewmr7_3581 band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23396"
FT                   /protein_id="ABM23396.1"
FT                   /translation="MIKNELNLPSTINLTKIIPILILLILFISLFGSWYTVDQGERGVV
FT                   LRNGKIIGTAEPGLGFKIPLIDTVVKISTQTHTTSYTSLQAYSRDQQPATLNASVTFSV
FT                   PPDKVEEVYANFKSIDAMVARLLDRQVPTQVENIFGKYTAISVVQERIKFGIDVTNAIT
FT                   NSVKGPVEITSVQIENIDFSNAYEKSVEDRMRAEVEVQTQLQNLEKERVSAQIAVTQAQ
FT                   AEADSQLARAKAEAESIRIKGDAEASAIKSRAEALAQNQNLVELTKAEKWDGKLPTTML
FT                   PTGTLPFIDAKKAN"
FT   sig_peptide     complement(596828..596926)
FT                   /locus_tag="Sputw3181_0545"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.607) with cleavage site probability 0.592 at
FT                   residue 33"
FT   gene            597328..597585
FT                   /locus_tag="Sputw3181_0546"
FT   CDS_pept        597328..597585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23397"
FT                   /protein_id="ABM23397.1"
FT                   /translation="MLQLILVLASVLACLLFYLSNKQQALLNQSLPKRPWRYLAYAVSL
FT                   SCLVGWLSLFTLSSAIFTWLALFILLMGLVPFLSLILNRK"
FT   sig_peptide     597328..597405
FT                   /locus_tag="Sputw3181_0546"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.942) with cleavage site probability 0.652 at
FT                   residue 26"
FT   gene            597589..597879
FT                   /locus_tag="Sputw3181_0547"
FT   CDS_pept        597589..597879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23398"
FT                   /protein_id="ABM23398.1"
FT                   /translation="MARLSDSEKLQPDWWTKTLAGLILGFTLALGLVGLFAWFGPGGID
FT                   AAVKVQFNMWLISPIWLLIVSFSFLFRTGWRAVGYLGLFNILVYVTLYSFR"
FT   gene            597885..599510
FT                   /locus_tag="Sputw3181_0548"
FT   CDS_pept        597885..599510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0548"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: shm:Shewmr7_3578 PepSY-associated TM helix domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23399"
FT                   /protein_id="ABM23399.1"
FT                   /translation="MKVRSDVLRIYQSIHTWTGIIAGIVLFIGFYAGALTMFKGAIEAW
FT                   STPPALTLPQVPTEKLDDLVTQVLARDDKAKTGFRLSLHDEHQSPMTWYQQGSERELSM
FT                   SNQIWHASLDEQGQLLTQLSTPSELAELVDQLHRTAGIAGEVGHDQAGVYVLGVAAFLY
FT                   FLALVSGVIFLLPSLTKTFFALRKNKGENRFWLDVHNLIGITSLPFHLVISLTVIVFAF
FT                   HDQLYDGLKHLVYGDKPLFAIPAPDRTLYSLTELPRIETVLTKVKQLAPEYQVNEMTYM
FT                   NLDNPRATLRLGLYNPNGFMRGPVTDYLYMHPYTLTVSNSTFDPSEEGIWSRTVAVFFG
FT                   LHFGSFGGDLGRWVYFFLGLSGAFLFYSGNLLWLEKRRKKQAAEQSHASRLMASATVGI
FT                   CLGSVAALAVSMLLGKWVYSYFSNINYVYLSAYYSVFVLLVAYAFWRGAARAALLILPL
FT                   CAIATFAMPFTSLLAFVFPQLGLWAPYSMATLGVDLVALAFSAVFFYGYRLTRQRALHG
FT                   PQDSVWALPVKQSLVENELSQQAQ"
FT   gene            complement(599587..600753)
FT                   /locus_tag="Sputw3181_0549"
FT   CDS_pept        complement(599587..600753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0549"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   she:Shewmr4_0452 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23400"
FT                   /protein_id="ABM23400.1"
FT                   /translation="MENIVLNQSTQKNSLFVPVAGLSLFALASGYLMSLIPLSLTFFEL
FT                   NTSLAPLLASIFYLGLLLGAPCIAPIVARIGHSKAFILFLNILLCSVVAMILIPQSGVW
FT                   LASRLVAGFAVAGVFVVVESWLLMADTQKQRAKRLGLYMTALYGGTAIGQLAIDYLGTA
FT                   GNLPYLVIMGLLAAASLPALLVKRGQPIASEQQSMSLSGLRNLSQPAIVGCLVSGLLLG
FT                   PIYGLLPIYVAIDMALDRQTGLFMALIILGGMLVQPLVSYLSPRVNKSGLIMGFCLLGT
FT                   AALFLLTQYSNMSLIIGFLLLGASAFALYPIAISLACDDLPASQIVSATQVMLLSYSIG
FT                   SVIGPLAASGFGQMEYGLLIYLGICCVLTSSYLFAQLVINTKPRFSSL"
FT   sig_peptide     complement(600667..600753)
FT                   /locus_tag="Sputw3181_0549"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.960) with cleavage site probability 0.840 at
FT                   residue 29"
FT   gene            601346..602746
FT                   /locus_tag="Sputw3181_0550"
FT   CDS_pept        601346..602746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0550"
FT                   /product="anion transporter"
FT                   /note="TIGRFAM: anion transporter; PFAM: sodium/sulphate
FT                   symporter; Citrate transporter; TRAP C4-dicarboxylate
FT                   transport system permease DctM subunit; KEGG:
FT                   she:Shewmr4_0455 anion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23401"
FT                   /protein_id="ABM23401.1"
FT                   /translation="MSLTQSTTVPPNKTPATAGLDKKKMLILAIDIILLFALYYGLPFE
FT                   QGVNTGLAILVFAAVLWLTEAIHISITAILVPILAVFFGVFQTQEAMSNFANPIIYLFF
FT                   GGFVLAAALHHQKIDTLIAQKLLLASKGKLSIACLMLFGVTALLSMWISNTATAAMMLP
FT                   LALGILQQLDRDKYHNTYVFLLLGIAYSANIGGIGTLVGSPPNAIAAAQAGLSFSDWLK
FT                   FGIPTVILMMPMMLIALYWYFKPDLSVKCDLNLEDQQLTFQGKFTLLIFLATVCCWIFS
FT                   VPLAKALGGISQFDTIVALGAVVLLSGLGLVGWKKIESTTDWGVLILFGGGLTLSAVLK
FT                   TTGTSVFLAHWMTDIFGSTHMSLFVFAVIAFVVMLTEFASNTASAALLVPVFAAIAEAL
FT                   GVSPVMLSVLIGIAASCAFMLPVATPPNAIVYGSGHIKQSEMVRVGMIINFISMIVLGI
FT                   IAHTFWDV"
FT   gene            complement(602825..603361)
FT                   /locus_tag="Sputw3181_0551"
FT   CDS_pept        complement(602825..603361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0551"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: son:SO0452 thioredoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23402"
FT                   /protein_id="ABM23402.1"
FT                   /translation="MPSFITSTRLVITSTPPLNIRPLAQYMKHTDVLFWSFAMIIACPH
FT                   CDTLNRVPNERLNQHPTCGKCKLSVFTAAPIELTSANFTNHVTKSELPLVVDFWASWCG
FT                   PCKSFAPIFSEAAKTWEPQFRFGKINTEQQQSLAAQFNIRSIPTLMIFKQGHILAQQAG
FT                   ALPKSAFDQWLTSYR"
FT   gene            603486..603821
FT                   /locus_tag="Sputw3181_0552"
FT   CDS_pept        603486..603821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0552"
FT                   /product="peptidylprolyl isomerase, FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase, FKBP-type; KEGG:
FT                   son:SO0453 peptidyl-prolyl cis-trans isomerase FkbP"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23403"
FT                   /protein_id="ABM23403.1"
FT                   /translation="MAELEVIDLVVGEGKEAVKGALITTQYRGFLEDGTQFDSSYDRRQ
FT                   AFQCVIGTGRVIKGWDQGIMGMKIGGKRKLLVPAHLAYGERQVGAHIKPHSNLIFEIEL
FT                   LEVLTRD"
FT   gene            603985..604959
FT                   /locus_tag="Sputw3181_0553"
FT   CDS_pept        603985..604959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0553"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: she:Shewmr4_0458 diguanylate cyclase with
FT                   PAS/PAC sensor; TIGRFAM: PAS sensor protein; diguanylate
FT                   cyclase; PFAM: GGDEF domain containing protein; PAS fold-3
FT                   domain protein; SMART: PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23404"
FT                   /protein_id="ABM23404.1"
FT                   /translation="MDSDTTALIQQLQAEIAQLKSENAHLSALNYRAEEKLFAALDGNG
FT                   LCLWEQHIPSGNLTIFNMRWGEMLGFSPEELAAHVDIWKSKLHPEDKAWVIQVFEDHVS
FT                   GKSDYYQAVYRMLHKDGSVTWVSDRGRIVERLADGTPLRMMGSHIDITQEKRYEMGLAQ
FT                   LAHSDPLTNLLNRQAITKAFDELLLSDAGGALLFIDLDGFKALNDRHGHKFGDSLLIHV
FT                   ANTLVLHAGEYAQIARFGGDEFVILHPSSEIASLTQLAQSLLDVYRQRFLLDGLEVEIG
FT                   LSIGIDIFGDGDSFTDSCERADMAMYDVKRQGKNGYCFYRKII"
FT   gene            605281..605496
FT                   /locus_tag="Sputw3181_0554"
FT   CDS_pept        605281..605496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23405"
FT                   /protein_id="ABM23405.1"
FT                   /translation="MSGKNLKALIISDDVIRNGIGVEFYIDDKLIVEIFRDDNEHTKML
FT                   SVFEQPVSLELIEECITLFKELVPIY"
FT   gene            complement(605830..606180)
FT                   /locus_tag="Sputw3181_0555"
FT   CDS_pept        complement(605830..606180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0555"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_2786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23406"
FT                   /protein_id="ABM23406.1"
FT                   /translation="MKNVTIIFALVLGIFAGSAIAKEKESVLLDQIHIAKGVKCASCHG
FT                   AEERQAVPMLKCVQCHNTKKLAEKTADVKPTNPHKNRHFDTETDCSKCHHIHKKSENYC
FT                   VSCHQPFNFVTP"
FT   sig_peptide     complement(606115..606180)
FT                   /locus_tag="Sputw3181_0555"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(606249..607916)
FT                   /locus_tag="Sputw3181_0556"
FT   CDS_pept        complement(606249..607916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0556"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: sfr:Sfri_3694 twin-arginine translocation pathway
FT                   signal"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23407"
FT                   /protein_id="ABM23407.1"
FT                   /translation="MSKESKEIDQYTASVLQNGISRRSFLTRAAVGSGSLAFAGLGIGS
FT                   ASAAPLQVGTEYGEIGGATLNFLPKPKPIADKDIATTQTFDVVVVGAGASGVPAALSAR
FT                   ESGATVACLQKQAIPVSQGNTGSGIDLKNSDKSAIEALVSRLMADNAHRSHPGLLRQWA
FT                   YNSGEAVNWVMDRMKQGGGQVVDQGTKVQHGIRGIADEGDRLSFVTSFCGPKPYTTGDA
FT                   IRALAKTAEKAGVKFFFNTPAQQLIQDESGKVIGVIAQTRDGKYHKYMAKKGVILSSGD
FT                   YQNNKAMCDFFIPELKNFERKQMDRTGDGFAMAYWAGGVIEPVGHTKMLHDFDAGPASM
FT                   CDMPFLAVNRKGERFVNEKVEMSLMNNYLKDEQNAGHYSQVFDSDYMTQAKDWPGRLYS
FT                   PEELKIYMPDVPGEKTGVFPSLINTHSANTLEELAVKLECDPKTFVANVNRYNELCKKG
FT                   KDEDFGKPASKMVPVVKPPFYGIHRRMRISTLCSGILVNENHQVLDADGKEIPGLFIVG
FT                   NLGAGFYGGVDYPLTVFGLSLGRCYTFGYLAGKYVAKL"
FT   sig_peptide     complement(607770..607916)
FT                   /locus_tag="Sputw3181_0556"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.979 at
FT                   residue 49"
FT   gene            complement(608471..610207)
FT                   /locus_tag="Sputw3181_0557"
FT   CDS_pept        complement(608471..610207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0557"
FT                   /product="Tannase and feruloyl esterase"
FT                   /note="PFAM: Tannase and feruloyl esterase; KEGG:
FT                   sfr:Sfri_3696 feruloyl esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23408"
FT                   /protein_id="ABM23408.1"
FT                   /translation="MKKKNLLLIPAVTISCFLFGGCGNNDNAEISIPQLTPAKTGTLNI
FT                   CNEIAAQYHFKNTVITDSKMIAAGNVEYNATESYRAPEHCLVKGYMNERIGTGIAGDTR
FT                   YAIGFEMRLPTNWNGRFYYQANGGLDGSVAKAVGRLLFSGGPDSAALNEGFAVISSDMG
FT                   HPAPTPHFGLDPQARQDYGYNAVAELTPMAKNLIEKAYGKQPDRSYFAGCSNGGRHTMV
FT                   AASRYADMYDGFLVGNPGFNLPQSAVAQLYGIQEYSKLVEFDGADILATLQKAITPEEF
FT                   SLVSQKVLEQCDALDGLNDGMIANTYACQKAFDLERDIPTCSNLRDNTCLTAKQKQVLG
FT                   NIMAGPHNSKTGEAIYADFPYDAGIGAKDWANWEYSMALTRDSGAVGFIFSSPPTPFNG
FT                   ESEQSSLDFIQSFSMDDDAQRIYATDSIYAESGVDFMTPPHPTDLTTLKNRGAKMMIFH
FT                   GTSDPVFSVNDTVNWYNDLGNANAGHAQTFARLFLIPGMNHCGKGPTTDKFNMVRTLVD
FT                   WVEKGVEPQSITAAVRAENTELPSDWSKSRTRVLCPYPQFAKYNGIGNIEDAANFTCVT
FT                   PE"
FT   sig_peptide     complement(610121..610207)
FT                   /locus_tag="Sputw3181_0557"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.976) with cleavage site probability 0.314 at
FT                   residue 29"
FT   gene            complement(610347..611585)
FT                   /locus_tag="Sputw3181_0558"
FT   CDS_pept        complement(610347..611585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0558"
FT                   /product="outer membrane porin"
FT                   /note="PFAM: outer membrane porin; KEGG: shm:Shewmr7_2788
FT                   outer membrane porin"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23409"
FT                   /protein_id="ABM23409.1"
FT                   /translation="MMNKSYLSVLVLSALAVPAIADTSIDQMFSQGTLKGEFRLFDFTR
FT                   DFDNTTNTKHDTSFGGLFYYNTAKVNGISFGTSFASANPVWTNDSDDVYGLVARDAKGD
FT                   HDNVNRLQEYFVQGEWWNTKLKLGAQELRTPMMNPHDIRAIPRTFRGFSAENKSVDNLT
FT                   LSALYITDSMGWSDNSFISVKDAVQNELARAGVIADVADNPVYALGAKYQLPFETIKTE
FT                   VDLWHYRMEDVFNQTYAKVKLSSQLGATNVYLTPSYLTQEATGDKTGGSLDTYQYGFHL
FT                   GAKFAGTDITYIYAKTGDDTVLTPWGDEKVVIQQVNQSARADEEVNALKVAYDFEKVGM
FT                   SGLEAYAFYGQYDVPTGTAKDFNETNFSITYKFSGALSGLGLRARYAMIDVDQGEDYDD
FT                   LRLYITYKFVLGQ"
FT   sig_peptide     complement(611520..611585)
FT                   /locus_tag="Sputw3181_0558"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            611869..612588
FT                   /locus_tag="Sputw3181_0559"
FT   CDS_pept        611869..612588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0559"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: shm:Shewmr7_2789 regulatory protein GntR,
FT                   HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23410"
FT                   /protein_id="ABM23410.1"
FT                   /translation="MHIFKPIKQIKASSEVGQQLKNAILGGDYKAGDKLPSERELIELF
FT                   QVSRTVIREAIKSLEAGGLVEIRQGATGGAFVKHLTFERLSDACHDLFMMGKLSLPELC
FT                   QARMLIEPQVARMAAKNCTPEQALILLEADRHENDTSAYPDTVTLRSQVHYLLAEMSGN
FT                   RFLEAIVKSLLILLRNQTMKYEPPTDEIHPLGLHSVIVEAVVAKDEDKAEAEMLAHLED
FT                   FNVRLREIERKYKNKQA"
FT   gene            complement(612681..613070)
FT                   /locus_tag="Sputw3181_0560"
FT   CDS_pept        complement(612681..613070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23411"
FT                   /protein_id="ABM23411.1"
FT                   /translation="MLGLCFGLAGTLWAQVPTDNFTLAWNHSIEKIRWEEDYNVTPQGL
FT                   VLVEARVKGTGAGMEIPDDAYLKNGSWHYHPTLPILPTLRLGRIPEAGDYDICIESQCN
FT                   AMSHWIGAPTKEEAMVELWSCGALL"
FT   gene            complement(613116..615149)
FT                   /locus_tag="Sputw3181_0561"
FT   CDS_pept        complement(613116..615149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0561"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /note="TIGRFAM: TRAP transporter, 4TM/12TM fusion protein;
FT                   PFAM: TRAP C4-dicarboxylate transport system permease DctM
FT                   subunit; KEGG: she:Shewmr4_0460 TRAP transporter, 4TM/12TM
FT                   fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23412"
FT                   /protein_id="ABM23412.1"
FT                   /translation="MSDPQQGLGANTGDWPKALFYTALIFSIFQIITAAFHPVSTQVLR
FT                   ATHVGFLLLVVFLSYPAVGKSRPWQPLAWLLGIAGMATAAYQWVFEADLIQRSGELTDA
FT                   DMVIGIILIVLVFEAARRVMGWALPIICCIFLAYGLFGQYLPGELMHRGYGVDQIINQL
FT                   AFGTEGLYGTPTYVSATYIFLFILFGAFLEQAGMIRLFTDFAMGLFGHKLGGPAKVAVV
FT                   SSAMMGTITGSGVANVVTTGQFTIPLMKRFGYRPAFAGGVEATSSMGSQIMPPIMGAVA
FT                   FIMAETINVPFIEIAKAALVPALLYFCSVFWMVHLEAKRANLSGLPKDQCPDPWAAIKA
FT                   RWYLLIPLLILIYLLFSGRTPLFSGMVGLALTSIVILGSAIVLRLPSKAMRFAFWIALG
FT                   VLCAGFFQLGIAVVFAVIALLVAVCWFIKGGKETLVICLHALVEGARHAVPVGIACALV
FT                   GVIIGIVSLTGIASTFASYILAVGQDNLFLSLVLTMLTCLVLGMGIPTIPNYIITSSIA
FT                   APALLDLGVPLIVSHMFVFYFGIMADLTPPVALACFAAAPIAKESGLKISLWAIRIAIA
FT                   GFVIPFMAVYDPALMLQSDSWLATGFVVLKATVAIGIWGVIFTGFLLQKLYWWERLIGF
FT                   LAGASLILATPLSDEIGFGLALLFILQHSWRARKLKRLMEQG"
FT   gene            complement(615253..616209)
FT                   /locus_tag="Sputw3181_0562"
FT   CDS_pept        complement(615253..616209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0562"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; KEGG: she:Shewmr4_0461 TRAP transporter solute
FT                   receptor, TAXI family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23413"
FT                   /protein_id="ABM23413.1"
FT                   /translation="MKINKHFVAIGAAITLSLSAATMAAAPAFINILTGGTSGVYYPIG
FT                   VALSQLYGSGIEGAKTSVQATKASVENLNLLQSGRGELAFALGDSVSAAYQGDVDAGFN
FT                   KPLDKIRVIAAAYPNYIQIVANKESGIKTLADLKGKRISVGAPKSGTELNARAIFKAAG
FT                   LSYADMGKVEFLPYAESVELIKNRQLDATLQSSGLGMAAIRDLAATMPINFVEIPEDVV
FT                   LNINNPAYQHGVIPASTYEGQTTDVSTVAIENLLVTHNGVSDDLAYQMTKIMFTNLERL
FT                   GNAHSAAKTINLENATKNLPIPLHPGAERYYKEVGAL"
FT   sig_peptide     complement(616135..616209)
FT                   /locus_tag="Sputw3181_0562"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            complement(616448..616570)
FT                   /locus_tag="Sputw3181_0563"
FT   CDS_pept        complement(616448..616570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23414"
FT                   /protein_id="ABM23414.1"
FT                   /translation="MSKEQKNRKESKKQPLMSAKEKRAAKHAKNASKGFLDNTK"
FT   gene            complement(616885..618375)
FT                   /locus_tag="Sputw3181_0564"
FT   CDS_pept        complement(616885..618375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0564"
FT                   /product="protein of unknown function DUF853, NPT hydrolase
FT                   putative"
FT                   /note="PFAM: protein of unknown function DUF853, NPT
FT                   hydrolase putative; KEGG: shm:Shewmr7_3566 protein of
FT                   unknown function DUF853, NPT hydrolase putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23415"
FT                   /protein_id="ABM23415.1"
FT                   /translation="MNTLLLGKGEQQVHLHLKYANRHGLIAGATGTGKTVSLMSIAEGF
FT                   SRQGVPVFITDVKGDISGLALMGTPSEKLLQRAASIGIEDYQNEANPVVFWDLAGVQGH
FT                   PLRTTVSEMGPTLLSRILELNDTQNGILDIVFQLADDQGLLLLDLDDLRAMLTLVADER
FT                   KEISVKYGLISAQSLAAIQRAVLGLERDGGKDFFGEPALQLEDLMRTNLQGRGIINLLA
FT                   ANKLILTPRLYSSFLLWLLSELFENLPEVGDLDKPKLVFFIDEAHLLFEGCPPSLLKRI
FT                   EQIMRLIRSKGVGVYFCSQFPDDVPNEILGQLGNRIQHALRAYTPRDQKAVKTAAETFV
FT                   PNPKLVVSEVISQLAVGEALVSMLADKGAPTMVERALIAPPRCRMGPATTEELKQIRAQ
FT                   SPIGGKYDTLVNRESAYELLHQRRTENAAATSAPIIEATPHHQADEQGWFSELIFGNKR
FT                   RQGLAQTLSKQAARTVGNQLGKQILRGILGGILGKSSR"
FT   gene            618772..619209
FT                   /locus_tag="Sputw3181_0565"
FT   CDS_pept        618772..619209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0565"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: son:SO0464 MutT/nudix
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23416"
FT                   /protein_id="ABM23416.1"
FT                   /translation="MAFNDTFRLSSHAVITNALGQVLLLKANYGNFAWGLPGGALEPGE
FT                   TIHEALVRECQEELGLSVRVNYLSGVYYHSAYQSQAFIFRCELLLPEVAKDGVEDELLP
FT                   IQLSHEHSAFAFHDIDTLSTVQQQRIKDCLNFNGVVVSAKF"
FT   gene            complement(619235..620434)
FT                   /locus_tag="Sputw3181_0566"
FT   CDS_pept        complement(619235..620434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: psb:Psyr_3988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23417"
FT                   /protein_id="ABM23417.1"
FT                   /translation="MSHSALNSFDDFYQLLADSLAKNSLIKLLLSKYRGADKSLQRITI
FT                   RPISLQNEPMLSFVYQHQTNHITKNLSYDDGLASIKQLLGSDFKSAHLATAQAEVQLEI
FT                   SKKGKVQISTHNVKQTVAAPLEHDREKKRFVDIERPFLTKLGVTDSQHNVIPAMSRKWK
FT                   QINKFIEVFSQALEASPHKNNQPINVVDFGSGKGYLTFAIHDYLRHSLHNDAQVTGVEL
FT                   RQALADLCNETAATLDHQGLSFVCGDVRTHAPKQTDVMIALHACDIATDYAIHYGIRAN
FT                   ADIIMCSPCCHKQIRPQMHSPELFKPMLQYGVHMGQQAEMVTDSLRALFLEANGYATKV
FT                   FEFISLEHTNKNKMILAVKKSQHNPKDSAAILAQIADIKAYYGIKEHCLETLLAQTQAD
FT                   "
FT   gene            complement(621032..622054)
FT                   /locus_tag="Sputw3181_0567"
FT   CDS_pept        complement(621032..622054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0567"
FT                   /product="glycosyl transferase, family 51"
FT                   /note="PFAM: glycosyl transferase, family 51; KEGG:
FT                   bja:bll0910 penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23418"
FT                   /protein_id="ABM23418.1"
FT                   /translation="MLGLSYGNIQLLLPNWRIEGADQPLALKLFPGWLTYAAYPFWMIS
FT                   IISSSVVLFLSAYFIKQNPNVIPEEFNSAFILLMGFFWFLSAMMIYRLSLLDTHETSRL
FT                   IFYKFISKNIGLPLTENIEYIAYRAKLAAHETDRLKVSTLNIKKFLIFIEDRDFYSHSG
FT                   ISYKSLARSILGLMNIKPKSGGSTIVQQLTRTLFISDLSKTKRRKFIELALAPWVTSVF
FT                   SKKIILDIYISSVRFERGCFGVVEAMNHFWGNVEHNPTNAQAFFLIERVSNIRSKLLVN
FT                   KIIDTANSAKEKRLLTHDDISSLFDLYSDAVTNGKITANNTELRKLAKGLNLVCLDTHC
FT                   "
FT   gene            623046..625214
FT                   /locus_tag="Sputw3181_0568"
FT   CDS_pept        623046..625214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0568"
FT                   /product="ATP-dependent DNA helicase UvrD"
FT                   /EC_number="3.6.1.-"
FT                   /note="TIGRFAM: DNA helicase II; PFAM: UvrD/REP helicase;
FT                   KEGG: son:SO0467 DNA helicase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23419"
FT                   /protein_id="ABM23419.1"
FT                   /translation="MDVSSLLDGLNDKQREAVAAPQSSMLVLAGAGSGKTRVLTHRIAW
FT                   LMQVEQQSPYSILAVTFTNKAAAEMRERVEKVAGTNMGRMWIGTFHGLAHRLLRTHFQD
FT                   AGLPQSFQILDSDDQVRLIKRILKSLNLDEKQYPPRQAQGYINGKKDQGLRPKHIDAIG
FT                   FPIEQNLLKIYQVYQESCDRAGLVDFAEILLRAHELWLNKPHLLAHYQERFKHILVDEF
FT                   QDTNAIQYAWIRVLAGQTANVMIVGDDDQSIYGWRGAQVENLHRFLQDFPTATTIRLEQ
FT                   NYRSKGNILKASNALIANNPERMGKELWTDEADGDPISLYCAFNEMDEARFIVGRINDW
FT                   HEKGGNLSDCAILYRSNAQSRVLEEALLHKGLAYRIYGGLRFFERQEIKDAMGYMRLIS
FT                   NKNDDAAFERVVNTPPRGIGDRTLDILRTTARQQELTLWQACLRLLDEKVLAGRAASAV
FT                   RGFMDLIVTLQEDTQDMALYRMADTVIQASGLKAMYEAEKGEKAHARIENLEELVTAAR
FT                   TFEMPEELEDMGELNAFLSHAALEAGEGQADAFTDAVQLMTLHSAKGLEFTMVFMAGVE
FT                   EGIFPSKMALEEGDRLDEERRLCYVGMTRAMEKLYITYAESRRIYGREDYARPSRFIKE
FT                   IPPQYVDEIRLKAQVSTPMANNRFSTQKSAAANDTGFNVGQRVNHPKFGEGKVTNFEGS
FT                   GAQARVQVSFTDFGSKWLVVAYARLEAL"
FT   gene            625360..626220
FT                   /locus_tag="Sputw3181_0569"
FT   CDS_pept        625360..626220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0569"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: shm:Shewmr7_3557
FT                   4-hydroxybenzoate polyprenyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23420"
FT                   /db_xref="GOA:A1RFH5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RFH5"
FT                   /protein_id="ABM23420.1"
FT                   /translation="MNLKQKWDVYSRLTRLDRPIGTLLLMWPCLMALMLAAGGMPDLKV
FT                   LIIFIIGVVIMRACGCIINDYADRDLDSFVERTKSRPLASGEISTKEALILFVVLGLSA
FT                   FGLVLLLNGLVVKLSVVGIILTIIYPFTKRITNMPQMFLGVVWSWSIPMAYAAQTGEVP
FT                   MEAWWLFAANWFWTVAYDTMYAMVDRDDDLKVGIKSTAILFGKYDRQIIGLFQIAALVC
FT                   FIAAGWSAERGLLYGLGLLTFVGFSTYQQMLIFGRERAPCFKAFLNNNWAGLALFVGLG
FT                   ADYLI"
FT   sig_peptide     625360..625473
FT                   /locus_tag="Sputw3181_0569"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.912) with cleavage site probability 0.725 at
FT                   residue 38"
FT   gene            626303..627367
FT                   /locus_tag="Sputw3181_0570"
FT   CDS_pept        626303..627367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0570"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase, NPD; KEGG:
FT                   she:Shewmr4_0476 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23421"
FT                   /protein_id="ABM23421.1"
FT                   /translation="MPCQLTRLFGIELPIIQAPMAGVQGSALTIAVSQAGALGSLPCAM
FT                   LSLETLDAELSLIRSHTTKPINVNFFCHHEPEPQAAKQAAWLKQLTPYFTELGIHPDTQ
FT                   AAGAQRAPYTSAQAEVLAKFKPEVVSFHFGLPNEDLLLEIKSWGSKVISTATTLEEALW
FT                   LEARGVDAIIAQGLEAGGHRGHFLSDDLTEQLGTFALLPQIIAAVDVPVIAAGGIVDAK
FT                   TVRAAMAMGASAVQVGTAYLLCPECTTTKIHRAVLQSETAQHTALTNLFSGRPARGIVN
FT                   RFMAELGPINSAVPDFPLASNAIAGLRSAAEQQGFGDFSPLWCGQNATGCQAIPAAELT
FT                   KQLALGIWLSAEVS"
FT   gene            627438..628520
FT                   /locus_tag="Sputw3181_0571"
FT   CDS_pept        627438..628520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0571"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   she:Shewmr4_0479 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23422"
FT                   /protein_id="ABM23422.1"
FT                   /translation="MTPIFSNAAIGRTLLILLLCAGVFFFIDFLVPALAALIVCFSSWP
FT                   LYQKLLAKCRGRSALAATIALVLIVLGLVIPLAFVFSYALHEIRGWVEWLVHTNQHGAA
FT                   VPVWIKELPLIGEWLTLQWHEFIGEPHELGKIISAISGQNLSGISRWVLQLGWNTLGLL
FT                   LTLLFMLITLFFLYKDGEHVAKQLDIVGERVLPARWHSFSRVVPATVSSTVIGMTLIAI
FT                   GEGIVLGIAYWIAGVPSAVAFGVLTAFMALIPGGAPTMFTLISLYLVGTGDMTAGVGLF
FT                   LWGSIELFIVDKTLRPNLVGGPIKLPFLPTFFGLIGGVKTMGFVGLFVGPVLMALLVAI
FT                   WREWLREEPETIPMDKQAES"
FT   sig_peptide     627438..627545
FT                   /locus_tag="Sputw3181_0571"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.977) with cleavage site probability 0.970 at
FT                   residue 36"
FT   gene            complement(628524..628814)
FT                   /locus_tag="Sputw3181_0572"
FT   CDS_pept        complement(628524..628814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0572"
FT                   /product="putative mitomycin resistance protein"
FT                   /note="KEGG: shm:Shewmr7_3550 putative mitomycin resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23423"
FT                   /protein_id="ABM23423.1"
FT                   /translation="MNPAKVVRAEVKQLTDLPNIGKACATDLRLLGIETPVQLLGRNPY
FT                   EMYRTLNTLTGVKQDPCMLDVFISITRFMAGDDPKPWWNYTDERKNTLAAN"
FT   gene            complement(628880..629458)
FT                   /locus_tag="Sputw3181_0573"
FT   CDS_pept        complement(628880..629458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23424"
FT                   /protein_id="ABM23424.1"
FT                   /translation="MKLTRLTQPIYDHLYRDISDFRRTFDLPVNDVHSLDDKADTLHTS
FT                   LIIEELTELAEADSRTEQADAIVDSVYVLMGRLVHLGAQAMTDRLEISYLIDLLLCVAH
FT                   NREIDFIACWDEVHSSNMSKVCRNEQELAETIAFYAKQGVEIVGSQQGDFIIAKCAKDV
FT                   EMAGKVVRQGKVLKSVYYRPADLTTLVKA"
FT   gene            complement(629634..630218)
FT                   /locus_tag="Sputw3181_0574"
FT   CDS_pept        complement(629634..630218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0574"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: shm:Shewmr7_3545
FT                   redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23425"
FT                   /protein_id="ABM23425.1"
FT                   /translation="MKLRYFPFVLLACFGLFSNSSPAHSLDNKLYSTGEPLPKPQVMTG
FT                   FIEMQHARGVPEVPFIDESGQTQTLKQHQGKLVLVNLWATWCAPCLREIPELQKLKQQY
FT                   QGKNIAIIPISIDEEPKDVRPFLNQYGFSGYATWLDPKQNVEQIIPANVVPASYIFDAK
FT                   GNLVGFVRGYLDWSDKDVGPYLDQLIAKYGQ"
FT   sig_peptide     complement(630141..630218)
FT                   /locus_tag="Sputw3181_0574"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            complement(630235..630654)
FT                   /locus_tag="Sputw3181_0575"
FT   CDS_pept        complement(630235..630654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0575"
FT                   /product="cytochrome C biogenesis protein"
FT                   /note="PFAM: cytochrome C biogenesis protein; KEGG:
FT                   shm:Shewmr7_3544 cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23426"
FT                   /protein_id="ABM23426.1"
FT                   /translation="MNPILRFLVLLLPITLFGIGTTSLSMAQEQSISGLSHQQQAMDIS
FT                   KVLRCPMATNQTLFESQAPIAHELKAQIFSMLEQGQSQDEIIDFMVQRYGEKIRYQPEF
FT                   KASTSALWLGPLLLLVLGVGLCFALITRKKTQSSI"
FT   sig_peptide     complement(630571..630654)
FT                   /locus_tag="Sputw3181_0575"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            complement(630654..632783)
FT                   /locus_tag="Sputw3181_0576"
FT   CDS_pept        complement(630654..632783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0576"
FT                   /product="cytochrome c-type biogenesis protein CcmF"
FT                   /note="TIGRFAM: cytochrome c-type biogenesis protein CcmF;
FT                   PFAM: cytochrome c assembly protein; KEGG: son:SO0478
FT                   cytochrome c-type biogenesis protein CcmF"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23427"
FT                   /protein_id="ABM23427.1"
FT                   /translation="MTTMVPEIGHILLIISSVLALFSAILPLIGIKQHNAYLVGLSPVL
FT                   FRTIFISVFFSLLCLIYCFVTDDFSVAYVANHSNSQLALGYKVAAVWGSHEGSMLFWIF
FT                   TIALWGAIISYHVKIADCTQDKATDSYQDTLYFARLLAILALVILGFNLFLLFTSNPFA
FT                   RLLPNIPIEGRDLNPILQDIGLILHPPMLFLGYVGLTVCFAAALASLLGGGFNTRQINY
FT                   LRPWVLLAWVFLTGGNAFGSWWAYNELGWGGWWFWDPVENASFIPWLVATALVHSLILT
FT                   QRTHGFKLTTLLLCLLAFSLSLLGSFLVRSGIVQSVHAFAADPTRGMSILCLLVIFVGA
FT                   GLLIFALKAHHLKQDVTFALFSKETLLLLGIVILVVAAFSVLLGTFYPLIYELLDLGTL
FT                   SVGAPYFNAIFVPLTFLLVLLMGIAPLVQWQKVQWQKVQWQKVQWQNASKTRITSLLIP
FT                   SLMILAVAGWVSLQAASGSSLFLLLGTAAALWLLVCLLLTILVASGLGRRVYARQLTQN
FT                   RSEHGLNPPVKSSKQGVVAMLFAHLGVAITIIGATSVSFFEQEALLRMGPGQGKPLASY
FT                   VLVYESTENVETNSFTAIQANISIRDAANDERVLGYITPQRQTFKSNGMEMSHAGIDHG
FT                   LWRDIYVSMGLQLSDNEYLIRISYKPLASWIWLGALLMMLGGAIAAWPTRRFSYQADLT
FT                   TLVNLSHHKPQETLA"
FT   gene            633328..635457
FT                   /locus_tag="Sputw3181_0577"
FT   CDS_pept        633328..635457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0577"
FT                   /product="cytochrome c, putative"
FT                   /note="KEGG: she:Shewmr4_0488 cytochrome c, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23428"
FT                   /protein_id="ABM23428.1"
FT                   /translation="MKRWKSKVALSVLFGLGSAISTISIAADAKSDNKVVPGVGNKQQS
FT                   HYTQDILANPNLAENLMEQSRGVKTLQDYIVQEKELFDFLFENHPVFKYDAEGRLKGTY
FT                   KVSDRGEEYLHGGDSVAYSKHSKEVNSTDGTAVRYSSYNDGQRPKALQYRLGAKSILDF
FT                   PNKFVGPEKCGECHGPQYEKWRRSRHSKTIRFPGEHPEVENNLDKTMYGTKDTSILPDG
FT                   ITPDVIYATVGTPRTKYGFIDGYLVRGTYHVKDGLLKDGTGTMVAGGNQFSRGWAEWLT
FT                   PEMAKKIQKVIPDFPTKMEDFGGSGSHQWGMSSYGAKYEKEFLFQPASSYCEMCHSFKF
FT                   DFKTKDEFFAALGNPKELQKHTISKGITCEECHGAGGHLDGGIGGGMPSNCERCHQRFN
FT                   FVEELAETPQGKDKLEYAFNVKMKSSCPSCGTEGSQMFASSHYDKGMRCSTCHDPHEVT
FT                   DGDWKSGITKPKIIKECTDCHTAQAEIASNTKTHSKQTCQSCHMPNMGSCENFTAIQFP
FT                   DVAGFDNVRKSHMWKIDVDPLRKTLNPPEGKSRDSSTKGWTVAKDENGHNYLDLMWTCA
FT                   RTSASDHDVVDNKGCHSQFQSKLGEGLHFKDQQEIYGRVQKWQKPVKEAYAKVEKALIS
FT                   IDKSPNMAKLSVEDKTQVLLLTDKAQDVLKLIKADGSWGVHGARYSQKRLDAALTYVTQ
FT                   AQAIIDGKALSAKKI"
FT   sig_peptide     633328..633408
FT                   /locus_tag="Sputw3181_0577"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.957 at
FT                   residue 27"
FT   gene            635520..635960
FT                   /locus_tag="Sputw3181_0578"
FT   CDS_pept        635520..635960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0578"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG:
FT                   shm:Shewmr7_3541 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23429"
FT                   /protein_id="ABM23429.1"
FT                   /translation="MHNVIRQSVSRTLMVLALGVIALPVIAGGGSEMSEVPYNEIQLNP
FT                   ISMMEAETLVGKQGVYFFDVNTLEIWAEGFIPGAVFFNVQNWRELLPKNKDAVMVFYCA
FT                   NRLCTTSNMAARETMKLGYTGVRHMADGIYGWRMSGRVTEKP"
FT   sig_peptide     635520..635603
FT                   /locus_tag="Sputw3181_0578"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.961 at
FT                   residue 28"
FT   gene            636046..636828
FT                   /locus_tag="Sputw3181_0579"
FT   CDS_pept        636046..636828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0579"
FT                   /product="peptidylprolyl isomerase, FKBP-type"
FT                   /note="PFAM: FKBP-type peptidyl-prolyl isomerase domain
FT                   protein; peptidylprolyl isomerase, FKBP-type; KEGG:
FT                   she:Shewmr4_0490 FKBP-type peptidyl-prolyl isomerase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23430"
FT                   /protein_id="ABM23430.1"
FT                   /translation="MKTRIPASFIPKSITVATCAALFVSVASFAGTGLKTDADKTSYSI
FT                   GASIGNYISGQVYNQVELGSEVNVDLVVQGFVDALKDKQQLTDEEVLTYLNQRAEQLNA
FT                   ARAVVAEKQMAETKKASAAYLAENQKKSGVKVTASGLQYEVLTQGKGHKPNPEDVVTVE
FT                   YVGTLINGTEFENTVGRKEPTRFALMSVIPGWEEGLKLMPVGSKYRFVVPASLAYGAEA
FT                   VGIIPPESALIFEIELKNIEKPSEMKEMKNKKMMPAHG"
FT   sig_peptide     636046..636138
FT                   /locus_tag="Sputw3181_0579"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 31"
FT   gene            636863..637543
FT                   /locus_tag="Sputw3181_0580"
FT   CDS_pept        636863..637543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0580"
FT                   /product="formate-dependent nitrite reductase, NrfG
FT                   protein"
FT                   /note="KEGG: son:SO0482 formate-dependent nitrite
FT                   reductase, NrfG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23431"
FT                   /protein_id="ABM23431.1"
FT                   /translation="METGMVSLGLGIGISLLVFVAYIYWQHMRLNLVMGIAQLPNMSSK
FT                   VPFAMGIVLVLLTLAIYSQTGRFRDWDQGRLDENIDYLVAAEITKASRWAQSEPQNTLA
FT                   LMALAQAYSAGGLYSDAVRTLDKLLEIGGEDAEVLGAKANALYYRELRQMTPETQEVIA
FT                   KALALSPFEPQTHMLLAADAYLHARNQEAIDHWQLLLKHNGDSINREAINNAIAKAQSK
FT                   MNER"
FT   gene            637632..638123
FT                   /locus_tag="Sputw3181_0581"
FT   CDS_pept        637632..638123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0581"
FT                   /product="NosL family protein"
FT                   /note="PFAM: NosL family protein; KEGG: son:SO0485 NosL
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23432"
FT                   /protein_id="ABM23432.1"
FT                   /translation="MKKYYALLLLVPLLFGCNKSEATDHVHKAEMIHEHDRCHLCGMVI
FT                   TKYPGPKGQVHLKAEKTVPKFCSVRDMFNFALQSENKRQIDYMMVHDAGKTDWDQPDDG
FT                   AFIDAKNAFYVYGTTKKAVMGPAVAPFSTRAAAEAFAKEYGGRVLSFDDITLELLAGDK
FT                   "
FT   sig_peptide     637632..637700
FT                   /locus_tag="Sputw3181_0581"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.957) with cleavage site probability 0.772 at
FT                   residue 23"
FT   gene            638128..639423
FT                   /locus_tag="Sputw3181_0582"
FT   CDS_pept        638128..639423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0582"
FT                   /product="periplasmic copper-binding"
FT                   /note="PFAM: periplasmic copper-binding; SMART: Parallel
FT                   beta-helix repeat; Carbohydrate-binding and sugar
FT                   hydrolysis; KEGG: son:SO0486 copper ABC transporter,
FT                   periplasmic copper-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23433"
FT                   /protein_id="ABM23433.1"
FT                   /translation="MMMKLRLLLIGLLCFASFASWAALLRVTDTDSLTLALNKAQAGDT
FT                   LVLATGVYEGSFKVTQSISLKGERGATLDALRQGSALIIEAPQVSIEGLNIRHWGRDLY
FT                   YRDAAILLKQGADNVLIKGNRLVGDGFGIYGEQLNSPTITDNSISGNGAIYVLDRGDGI
FT                   YLKHVNSPQIDRNQLIFVRDGVYLESVTQSRIYENQFAKLQYGIHYMYTQADEAWQNQA
FT                   IAVDGGYALMNSTHIYLHHNRVTQARDFGILLNITEASYVQANIASQIHNPKGTVELGN
FT                   EGKGIFIYAAQHNRIQDNEFSYSDTGISMAMGGEENRLWHNRIIANQTQVKYVGESQLE
FT                   WSYQGQGNYWSEYQGWDLNGDGLGDIAHRPNDSLDKLFWLYPEAKLLMESPVVLLLRWV
FT                   ERQFQPQMTSGISDSFPLMRSSTVSLIDGGSR"
FT   sig_peptide     638128..638196
FT                   /locus_tag="Sputw3181_0582"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            639420..640454
FT                   /locus_tag="Sputw3181_0583"
FT   CDS_pept        639420..640454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0583"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: son:SO0487 copper ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23434"
FT                   /protein_id="ABM23434.1"
FT                   /translation="MNYQTLTCSSNANVVKAINVSKSYGKFKALDEVSFDVLAGQMIAL
FT                   LGHNGAGKSTLLKLILGLVTPSKGQIQVQGQDMRSMNLRQRLSIGYLPENVSFYDNMTA
FT                   NELLRYFAKLKGVALHRVHELLAEFGLEAAKDKRLSTFSKGMRQRLGLAQAILAEPKVL
FT                   LLDEPTVGLDPLASAFLYQKMAQLKSQGCAIIISTHELGLVQENMDRALILGQGHMLAS
FT                   GHLTSLREATALPACITLHAISNAQRQQVLVDPVLTPFISTSTPQGIRLSVPVVQKSVA
FT                   LTHLLQTLKLDTLSVEPPSLQDIFHYYMDKVDAPSSHTLSADISLRTNPTKALMQQTKR
FT                   ECVA"
FT   gene            640451..641329
FT                   /locus_tag="Sputw3181_0584"
FT   CDS_pept        640451..641329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0584"
FT                   /product="copper ABC transporter, permease protein"
FT                   /note="KEGG: son:SO0488 copper ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23435"
FT                   /protein_id="ABM23435.1"
FT                   /translation="MKQACVLQENVHLSAMSLIVTIAAKEFKDNLRNRWLWMMTGILLL
FT                   LSLSVGFMGSSISGSLVIFEPAQILSGLVTLSVFMLPLGAILLSYDSFVGEKESGTLLL
FT                   LLTYPLARWYIVCGKLLGHASVLAVACILGFGITGFILGMLSEVHIRLSILIGFIHLIS
FT                   SGILLSLVFVLLGYWISLMVREKAKALGILLVLWFALVLIYDLVLLTALVGLADTLNRT
FT                   LFNVLILLNPSDLFRALNLLAGQSETLAAKSSLALIAQTGIGLPLMYGLLMCWIGLLLL
FT                   GCFWIFNHQDI"
FT   gene            641551..642834
FT                   /locus_tag="Sputw3181_0585"
FT   CDS_pept        641551..642834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0585"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: shm:Shewmr7_3532 transcriptional regulator, CadC"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23436"
FT                   /protein_id="ABM23436.1"
FT                   /translation="MHKITSYLMLDEQAKELVDHVNGATISLTFSETAVLVLLLSSTKA
FT                   IFTKEELLQVGWPERVVAPTSLTQCISTLRKKLEPYTEVQLKTVARRGYQLHVSEQSHV
FT                   KMLAINDADAIRDAIVGVSIWTKVAGILLLCVILGGIWYVSDHHAVVKRIAKWHADKYI
FT                   SLNIGGTLGTAHMLYISGEEHLHPSWWQKHLAPEGNHINNLNYFSAFASTDGKNYSMAI
FT                   CPELDAKACNGNGIINITAIDAKPAGLNMAEFIPLSKKMEQRIRYNRIVLPIDDKSSGE
FT                   LLEHNYHADIYFPVAGELLVRTDLSMSLVYEGEKKGKFYSTSCITDQDCLTTPIKYTIR
FT                   GEFEQYQTTIDELKVDVFHVKVLQKELTKPDEVSPSAMHFYREIRKHDIRDEDLFYYRV
FT                   YQNEHTAVWIVPQMGQVLAWTQYTQVKL"
FT   gene            642852..643484
FT                   /locus_tag="Sputw3181_0586"
FT   CDS_pept        642852..643484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0586"
FT                   /product="conserved hypothetical flavoprotein oxygenase"
FT                   /note="KEGG: she:Shewmr4_0502 conserved hypothetical
FT                   flavoprotein oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23437"
FT                   /protein_id="ABM23437.1"
FT                   /translation="MTNADLHYFYEPQKGHGLPHDPLNAIIAPRPIGWISSRSAAGQRN
FT                   LAPYSFFNCFNYKPPIIGFASTGWKDSVANIIETGEFVWNLTTRSLAEQMNQTSAMLPR
FT                   GQDEFSFAGLTAKAGTIVKADLVAESPVNFECKLSQCIQLTAANGDKIDTWLVLGEVVA
FT                   VHIAKHLLNAEGIYQTALAEPVLRAGGPSAYYGISEALRFDLHRPEV"
FT   gene            644216..645322
FT                   /locus_tag="Sputw3181_0587"
FT   CDS_pept        644216..645322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23438"
FT                   /protein_id="ABM23438.1"
FT                   /translation="MTSRQSQKGGDSSTNIQAEQLVVNMGIDEKRAREIYQEMNLQLKK
FT                   EYTHEALNIAISRVEEFENSLMLKMNSVEGAMQAFADPSFQLLLVDAQKAAAATERAAD
FT                   YDLLSELLVHRFKKGENRTIRAGITRAVEIVDEISDEALLGLTVAHSVTTFVPATGDIN
FT                   IGLDMLDGLFGKILYNKLPNGNEWLDHLDVLNAVRVNSFGSLKKMKQYYPESLSVYVDV
FT                   GIKKNSDSYSQALEILRINNLPHDLLIEHSLSDEFVRLPFSDKSRIQDTILIQKLVYNG
FT                   LTHTVPVALSPVQLQAITDVYDLYLNDAQIKQQNINSFMEQWEKRENLRLLRSWWDSIN
FT                   TSFQLTSVGKVLAHSNAQRCDNQLPPLN"
FT   gene            complement(646060..646758)
FT                   /locus_tag="Sputw3181_0588"
FT   CDS_pept        complement(646060..646758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0588"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   she:Shewmr4_0505 oxidoreductase FAD/NAD(P)-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23439"
FT                   /protein_id="ABM23439.1"
FT                   /translation="MKTIRCKIEKVSPFNDAVYQVLLKPETAFDFQAGQYLCVVMGDKD
FT                   KRPFSIASAPNAEFIELHIGAAVSESYPMQVVERLKTSSHIDIEAPGGEAHLRHESLRP
FT                   RLLIAGGTGFSYIKSIVEHQIALGQQVETMLYWGCRTQDAMYFETIARQWHDAHPWLHF
FT                   IPVIEEAPANWQGKTANLLAQIKLDFVSLNGYDIYIAGRFDMVGAAREIFREMGVEEAH
FT                   LYGDAFAFIK"
FT   gene            complement(646871..648352)
FT                   /locus_tag="Sputw3181_0589"
FT   CDS_pept        complement(646871..648352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0589"
FT                   /product="3-octaprenyl-4hydroxybenzoate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /note="TIGRFAM: UbiD family decarboxylases; PFAM:
FT                   Carboxylyase-related protein; KEGG: shm:Shewmr7_3525 UbiD
FT                   family decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23440"
FT                   /db_xref="GOA:A1RFJ5"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RFJ5"
FT                   /protein_id="ABM23440.1"
FT                   /translation="MSFKDLRSFIDHLEANGELKRISYPVDPHLEMTEIADRVLRAKGP
FT                   ALLFENPKNHHMPVLANLFGTPKRVAMALGKDDPLALREVGELLAFLKEPEPPRGFKDA
FT                   IAKIPMFKQALNMPPKTVRNPPCQQIIKTGDEVDLTQLPIQHCWPGDVAPLVTWGLTIT
FT                   KGPRKSRQNLGIYRQQLLGKNKLIMRWLSHRGGALDFADFKEQFPGERYPVVVALGADP
FT                   VTILGAVTPVPDSMSEYAFAGLLRGERTEVCKALSCDLEVPATSEIILEGYIDPEELAE
FT                   EGPYGDHTGYYNETDKFPVFTVTHITQRKDAIYHSTYTGRPPDEPAMLGVALNEVFVPI
FT                   LRKQYPEIVDFYLPPEGCSYRMAVISIRKQYPGHAKRVMMGAWSFLRQFMYTKFIVIVD
FT                   EDVNCRDWQDVIWAITTRMDPKRDTVMIENTPIDYLDFASPVAGLGSKMGLDATNKWEG
FT                   ETNREWGTPIVMDPKVKQKIDSIWDELGIDDSPTL"
FT   gene            648512..649288
FT                   /locus_tag="Sputw3181_0590"
FT   CDS_pept        648512..649288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0590"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23441"
FT                   /protein_id="ABM23441.1"
FT                   /translation="MNIPLAFTQKKCCQSQLHGAYQWLRKWGTWSLVGGTALLSGLCVS
FT                   ANAVAGNRDYSDHVESYAQSRDSYSRHINHADQRYDKRYRHKHKYRYYNPWGLGLGLGL
FT                   ATGWHSGWNLGYGWNTQWNNDWGWNTRYPYYREAYLRDNYARDYRNSPYSSIGFSIPMA
FT                   YDDQVVAVSTPVRVTTSMQYAPGEGRMVSSMPASVGSQTSTPDSASIQQRRARTVSTLP
FT                   TNARIVQQDGRTLYEWQGILYAFDWNSKTYQEQFRQ"
FT   sig_peptide     648512..648658
FT                   /locus_tag="Sputw3181_0590"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.819) with cleavage site probability 0.412 at
FT                   residue 49"
FT   gene            649755..650429
FT                   /locus_tag="Sputw3181_0591"
FT   CDS_pept        649755..650429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23442"
FT                   /protein_id="ABM23442.1"
FT                   /translation="MFNDFKVQLSTFDWNGVSGLTNILMVFLTALLLYSLRQGSKNIKE
FT                   SALSRDADILRWAMAEMDILKPAIRVLTNAHKRVAYCQCSEGGHTTKEFACNWTSEELT
FT                   AAQDVSVKLQRIGYMALHNLISRNHFMNVWGPMYLSTWYSLEPWVKHKRLELDEPLTIE
FT                   DGAYSRMYLEQFAQYCEANMPEVLVNNERRRFNLPEMIVKKPRISKNIKKHFRRSNEKL
FT                   DI"
FT   gene            complement(650492..651169)
FT                   /locus_tag="Sputw3181_0592"
FT   CDS_pept        complement(650492..651169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0592"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   shm:Shewmr7_3522 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23443"
FT                   /protein_id="ABM23443.1"
FT                   /translation="MILITGASSGLGAALAALYAKENEPLTLTGRNAERLHTVANALTP
FT                   FSNRPIAAVAANLADVQSVNSLFDSLTAIPKTVIHCAGSGYFGPIETQDVNAIQALLNN
FT                   NITSTILLVRELIKRYKDQAITLVIVMSTAALAAKAGESTYCAAKWAVRGFIESVRLEL
FT                   KHSPMKLIAVYPGGMDTGFWPSSGKTLDTSSFMSADEAATMLKQALVATAHGYIADISI
FT                   QRG"
FT   sig_peptide     complement(651107..651169)
FT                   /locus_tag="Sputw3181_0592"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.837 at
FT                   residue 21"
FT   gene            complement(651224..651658)
FT                   /locus_tag="Sputw3181_0593"
FT   CDS_pept        complement(651224..651658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0593"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: shm:Shewmr7_3520 3-dehydroquinate dehydratase,
FT                   type II; TIGRFAM: 3-dehydroquinate dehydratase, type II;
FT                   PFAM: dehydroquinase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23444"
FT                   /db_xref="GOA:A1RFJ9"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RFJ9"
FT                   /protein_id="ABM23444.1"
FT                   /translation="MSHKILLVNGPNLNLLGRREPSVYGHQTLADIVATLNQQAQQAGV
FT                   ELEHIQSNAEFELINAIHATDAQMIIINPAAFTHTSVALRDAMLGVAIPFFEVHLSNVH
FT                   AREAFRHHSYFSDKAIGVICGFGAQGYEFALSAAIKQLKG"
FT   gene            complement(651777..652208)
FT                   /locus_tag="Sputw3181_0594"
FT   CDS_pept        complement(651777..652208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0594"
FT                   /product="Class I peptide chain release factor"
FT                   /note="PFAM: Class I peptide chain release factor; KEGG:
FT                   son:SO0513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23445"
FT                   /protein_id="ABM23445.1"
FT                   /translation="MPKFAMIKISNRVELQENEIEWQFIRSSGAGGQHLNKVSTAAQLI
FT                   FDIKSSSLPEFYQERLLNKADHRITKSGKIIIKCQASRSQDANRQTALEQFIALVASVG
FT                   EVQKKRIPTRATKGSQTRRLETKKQKGATKAMRQQKSDY"
FT   gene            652345..652710
FT                   /locus_tag="Sputw3181_0595"
FT   CDS_pept        652345..652710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0595"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23446"
FT                   /protein_id="ABM23446.1"
FT                   /translation="MLCQIPDIAKGVISLFASGRLSSTDYRTRLQPAIKSYRKDWGQVC
FT                   LYIEADVLLEGWEFESLTGSGEVQLPNFEALVFVGGPDWVGNALRLLGPFMQGEVAWFP
FT                   LEQKAKAIAWITKRSNN"
FT   gene            652747..652953
FT                   /locus_tag="Sputw3181_0596"
FT   CDS_pept        652747..652953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0596"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23447"
FT                   /protein_id="ABM23447.1"
FT                   /translation="MSLLKSLAVKPLCTKLGAIAYVIAFTAGLSACAPEVGSDAWCKQM
FT                   KNKPSGDWTANEAADYAKHCVFK"
FT   sig_peptide     652747..652842
FT                   /locus_tag="Sputw3181_0596"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.884) with cleavage site probability 0.833 at
FT                   residue 32"
FT   gene            653096..653539
FT                   /locus_tag="Sputw3181_0597"
FT   CDS_pept        653096..653539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23448"
FT                   /protein_id="ABM23448.1"
FT                   /translation="MVTLLIAIIVLQFAGANLGAHQLHAGNGAEEAENHPHLQFSAQVT
FT                   TLTQCIECVCPSEQALGFADSTGLTSHHAGENQSNGFHSHLVKTTEIQDFDLCLDCQCH
FT                   GGHVALLSQAVSQPVQALESVYLPTDVSYFPPDNLPKDRPPIA"
FT   sig_peptide     653096..653173
FT                   /locus_tag="Sputw3181_0597"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.726) with cleavage site probability 0.601 at
FT                   residue 26"
FT   gene            653870..655363
FT                   /locus_tag="Sputw3181_0598"
FT   CDS_pept        653870..655363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0598"
FT                   /product="outer membrane efflux protein"
FT                   /note="KEGG: shm:Shewmr7_3515 outer membrane efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23449"
FT                   /protein_id="ABM23449.1"
FT                   /translation="MKKTILARTLVCLFRSGLFSCGLVLAAGLVAFALAAENDSLEVDV
FT                   LEVKVLETKASEANAPEIKASEVEAFKAQSLGLPAKETDTAHVNFGQWLPELLTQFNQL
FT                   PEVQAQLVRQQQAKLAIQAADRAVYNPELGLNYQNADTDAYSLGLSQTLDWGDKRGVAT
FT                   KRAELEAQILLADIGLERSQMLAERLLALAEQAQSRKALTFAEQQLRFTKAQLNIAEQR
FT                   LAAGDLSNVELQLIQLEVASNTADYALAEQVALVADGKVIELLGDNNFAFSEFIKEIHF
FT                   FVTQAKQAPAAELGTSKSALPALASAYQQVLLARVNVMQVKAEASADPTISLGAEKEGT
FT                   DNKLGVGVSIPLQVRNNYSELQAVADKGIAIAEQGYLARERVLTAKQKQFLYALPRLLE
FT                   RYQDWRELVQVSGAKAAKSLSQQWQAGDVSTSEYLQSRRQLAASYLVGLNLETAIYQSW
FT                   LTWMGESGQLMPFIEKLIIEKLNAAPSITSNAAARTVNP"
FT   sig_peptide     653870..653977
FT                   /locus_tag="Sputw3181_0598"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.963 at
FT                   residue 36"
FT   gene            655374..656639
FT                   /locus_tag="Sputw3181_0599"
FT   CDS_pept        655374..656639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0599"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   son:SO0519 cation efflux protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23450"
FT                   /protein_id="ABM23450.1"
FT                   /translation="MNSNTHHENILQLDAVMTPEKRRFNLSKIALALFVLSTLAFLAQP
FT                   VLAGGDHAPVAKESGDSVTQMASTDEHGEQALKLTEAQQALAGISLLPLSSDSLNIANL
FT                   NLDIRATATLVVDRDRTATLAPQLDVRVLARHVVPGQEVKKGEPLLTLGGAAVAQAQAD
FT                   YINAAAEWSRVKRMSEGAVSVSRRMQAQVDAELKRAILEAIKMTPAQIRALESTPEAIG
FT                   SYQLLAPIDGRVQQDIAMLGQVFSAGTPLMQLTDESYLWVEAQLTPTQTTHIQVGSSAL
FT                   VQVGDKTLAGKIIGRSHELDSVTRTEQVLVSMHNPDHVLHAGQFAELYFAGSTTDPNGS
FT                   GIVLPDAALTRGGDGDWQIFIQDEDGFESIEVEVVQRQRGLSLVRGPELEKAKQAQRNV
FT                   VVAGAFFLASEQAKAGFDIHAH"
FT   sig_peptide     655374..655520
FT                   /locus_tag="Sputw3181_0599"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.987 at
FT                   residue 49"
FT   gene            656669..659896
FT                   /locus_tag="Sputw3181_0600"
FT   CDS_pept        656669..659896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0600"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: shm:Shewmr7_3513 heavy
FT                   metal efflux pump, CzcA family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23451"
FT                   /protein_id="ABM23451.1"
FT                   /translation="MLQKLIEAAIKNRLLVVLALLAVIVGCVAMLPKLNLDAFPDVTNV
FT                   QVTINTAAEGLAAEEVEKLISYPVESAMYALPAVIEVRSLSRTGLSIVTVVFAEGTDIY
FT                   FARQQVFEQLQAAREMIPSGVGVPEIGPNTSGLGQIYQYILRAEPNSGINAAELRSLND
FT                   YLVKLILMPVGGVTEVLSFGGYVRQYQVQVEPNKLRAYGLSMAQVTEALESNNRNAGGW
FT                   FMDQGQEQLVVRGYGMLPAGDVGLAAIAQIPLTEASGTPVRIGDIAQVDFGSEIRVGAV
FT                   TMTRRDEAGQVQNLGEVVAGVVLKRMGANTKATIDDIGARVSLIEQALPDGVSFEVFYD
FT                   QADLVDKAVTTVRDALLMAFVFIVVILALFLVNMRATLLVLLSIPVSIGLALMVMSYYG
FT                   LSANLMSLGGLAVAIGMLVDGSVVMVENIFKHLTQPDRRHLQEARTRADGEIDPYHSDE
FT                   DGGQQANMAVRIMLAAKEVCSPIFFATAIIIVVFAPLFALEGVEGKLFQPMAVSIILAM
FT                   ISALLVALIAVPALAVYLFKRGVLLKQSVILAPLDAAYRKLLTATLARPKVVMLSALVM
FT                   FGLSLLLLPRLGTEFVPELEEGTINLRVTLAPTASLGTSLQVAPKLEAILLEFPEVEYA
FT                   LSRIGAPELGGDPEPVSNIEVYIGLKPIAEWQSASSRLELQRLMEEKLSVFPGLLLTFS
FT                   QPIATRVDELLSGVKAQLAIKIFGPDLAVLSQKGQALTDLVTKIPGAVDVSLEQVSGEA
FT                   QLVVRPKRELLARYGISVDQVMSLVSQGIGGTSAGQVIDGNARYDINVRLAAEFRQSPD
FT                   AIKDLLLSGTNGATVRLGEVASVEVEMAPPNIRRDDVQRRVVVQANVAGRDMGSVVKDI
FT                   YALVPKADLPAGYTVIIGGQYENQQRAQQKLMLVVPISIALIALLLYFSFGSFKQVLLI
FT                   MANVPLALIGGIVALYVSGTYLSVPSSIGFITLFGVAVLNGVVLVDSINQRRQSGEALY
FT                   DCVYEGTVGRLRPVLMTALTSALGLIPILLSSGVGSEIQKPLAVVIIGGLFSSTALTLL
FT                   VLPTLYRWLYRGDKRIDELDSLQISHK"
FT   sig_peptide     656669..656758
FT                   /locus_tag="Sputw3181_0600"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.914) with cleavage site probability 0.870 at
FT                   residue 30"
FT   gene            660057..660380
FT                   /locus_tag="Sputw3181_0601"
FT   CDS_pept        660057..660380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0601"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   son:SO0521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23452"
FT                   /protein_id="ABM23452.1"
FT                   /translation="MIAVIFEVIPTKEGKEEYLHVAAEMRQYLEGRKGLISIERFQSLT
FT                   DDGKVLSLSFWEDQASITQWRNQMAHSIAEQTGIVPCLFNSYRIRVAEVVQDYSETVHI
FT                   EAE"
FT   gene            complement(660458..660868)
FT                   /locus_tag="Sputw3181_0602"
FT   CDS_pept        complement(660458..660868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0602"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="TIGRFAM: large conductance mechanosensitive channel
FT                   protein; PFAM: large-conductance mechanosensitive channel;
FT                   KEGG: shm:Shewmr7_3511 large conductance mechanosensitive
FT                   channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23453"
FT                   /db_xref="GOA:A1RFK8"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RFK8"
FT                   /protein_id="ABM23453.1"
FT                   /translation="MSLIKEFKAFASRGNVIDMAVGIIIGAAFGKIVSSFVADVIMPPI
FT                   GIILGGVNFSDLSIVLQAAQGDAPSVVIAYGKFIQTVIDFTIIAFAIFMGLKAINTLKR
FT                   KEEEAPKAPPTPTKEEELLSEIRDLLKAQQEK"
FT   gene            661067..661522
FT                   /locus_tag="Sputw3181_0603"
FT   CDS_pept        661067..661522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0603"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   she:Shewmr4_0525 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23454"
FT                   /protein_id="ABM23454.1"
FT                   /translation="MHWNNLTFNQLDINMLYDILKLRVDVFVVEQACAYPELDDKDRHP
FT                   ETQHLFGLSPDGELLAYARILPPGLSYPEASIGRVVVSPAGRGKGLAMPLMQQAIESAL
FT                   TTWPDAGIQIGAQDYLKAFYQKLGFVACSEMYLEDGIPHLDMRYQSA"
FT   gene            661596..661922
FT                   /locus_tag="Sputw3181_0604"
FT   CDS_pept        661596..661922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0604"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   son:SO0527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23455"
FT                   /protein_id="ABM23455.1"
FT                   /translation="MSTSTDYRINQQQIACVASFLAKEGKTEALIAALASLIPDTRREA
FT                   GCIRYELNVSRDEPRRVTFVEKFVDITAFDEHCAKDAIQHYFHQVMPELVESYHVETYH
FT                   QIIA"
FT   gene            662242..662499
FT                   /locus_tag="Sputw3181_0605"
FT   CDS_pept        662242..662499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0605"
FT                   /product="redox-active disulfide protein 2"
FT                   /note="KEGG: shm:Shewmr7_3496 redox-active disulfide
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23456"
FT                   /protein_id="ABM23456.1"
FT                   /translation="MLYLQGNNMKRVSVLGDCDKCKKTEEMFKDISEEMAVDLIVKKDT
FT                   DPQSLVKFKVTKTPAVVIDGELVHSGSVPSRADIEEWLRD"
FT   gene            662532..663377
FT                   /locus_tag="Sputw3181_0606"
FT   CDS_pept        662532..663377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0606"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0540 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23457"
FT                   /protein_id="ABM23457.1"
FT                   /translation="MQKRCRIVRYISQCIHYVMLSAWFGIFPLSAADPAQSIGKVLERE
FT                   TRWQNPDYIRQAFSHIALNNEYDTYKHRVRKWQVPIRVFIEHQVADGALHTQLVQMHLS
FT                   HLTEITGHDIRLVDSLEKANLHLVFTRQSLWANEIVRLMGQSAVQNIHGSVCMAKFALN
FT                   SLQQIERAWIIIPVDQAKMHGKLVACIVEEMTQVLGLPNDSEKVFPSIFNDKTQQDLLT
FT                   GLDFILLKLLYSPLIHAGMTAAEVEQPLLNLLIQWQHDGTIMNADKMVRQGKLYPLLGY
FT                   "
FT   sig_peptide     662532..662627
FT                   /locus_tag="Sputw3181_0606"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.777) with cleavage site probability 0.644 at
FT                   residue 32"
FT   gene            663502..664938
FT                   /locus_tag="Sputw3181_0607"
FT   CDS_pept        663502..664938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0607"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   RNA-metabolising metallo-beta-lactamase; KEGG: son:SO0541
FT                   metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23458"
FT                   /protein_id="ABM23458.1"
FT                   /translation="MTLQFLGATREVTGSCHLLSVDHEHLLLDCGLIQGGKEDELRNHD
FT                   PFTFEPESISAVVLSHAHIDHSGRLPLLVKSGFDGPIYTHKATAELCAIMLKDAAMLQS
FT                   RDTERTNKKRTKHDLEPLEPLFTVEDVEQVMRQFIPLEYGQVINVIPHVDICLSDAGHI
FT                   LGSALVEIWLGEGKSQKKIVFSGDLGRAGMPILHNPTLVDTADLVLMESTYGDRFHRSW
FT                   TDTLAELKAIFTKAVTESHGNILLPAFSVGRAQELLYLFHLYAKEWDLSRWRICLDSPM
FT                   AIEATRVYVNNYQLMDEDFKHFTRQSPGKHPLLSNVEFIQTTEESIALNDIHKGLIIIA
FT                   GSGMCNGGRIRSHFEHNLWRPECDVIICGYQARGTPGRALVDGAEELTIHGNSIKVAAK
FT                   LHTVGGLSAHADQAELLHWYHHFDDQPPLVLVHGEPEAQQGLVDVINQDPKTRPKDIAI
FT                   AAYGDKLDLTALPRLMWITS"
FT   gene            665185..666561
FT                   /locus_tag="Sputw3181_0608"
FT   CDS_pept        665185..666561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0608"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: sdn:Sden_0649 amino acid
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23459"
FT                   /protein_id="ABM23459.1"
FT                   /translation="MEAITEFVGLVNGFVWGTPMLVMILGVGLFLSLGLRLMPILKLGT
FT                   GFKLLWSGRIPDKDKNVKGDVSPFNALMTSLSATIGTGNIAGVATAIFIGGPGALFWMW
FT                   CTALVGMATKFAEAVLAVKYREVDDHGNHVGGPMYYIKNGLGKKWAWLGTLFAIFGSLA
FT                   GFGIGNTVQANSVADALSSNFGIPAWASGVVMMLLVGAVLMGGIKRIADVAGKLVPFMT
FT                   IFYITAGLAVLAMHIEEVPAAFALIVHSAFNPVAAQGGFAGAAVWAAIRFGVARGVFSN
FT                   EAGLGSAPIAHAAAQTNNPVAQGLVAMLGTFIDTIIVCSITGLAIVVSGAWTSGENGAA
FT                   LTSYAFSHALPMGNYIVAVALAIFAFTTIIGWSFYSEKCVQYLFGIKAIKPFRLLWTLA
FT                   VPLGAVSSLDFIWLLADTLNAMMAIPNLIALVLLSPVVFGLTREYFIKKRAEETAKVRT
FT                   "
FT   gene            complement(666637..667992)
FT                   /locus_tag="Sputw3181_0609"
FT   CDS_pept        complement(666637..667992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0609"
FT                   /product="protein of unknown function DUF1704"
FT                   /note="PFAM: protein of unknown function DUF1704; KEGG:
FT                   son:SO0542 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23460"
FT                   /protein_id="ABM23460.1"
FT                   /translation="MSESLAQYQQDLRRFSDELIRIQTPIKILDAIKWPREMEERFLSN
FT                   KGSSLPAIKQDFYQNIALPFDPIKTQAELIALKQDIHRRLGKRDKLGKLLVANVDQYRL
FT                   VVDMLGHRGTPTFGKLSQELYGSANHRLHGDRHTLRQLGDKLSYIFSLPAARHMNKHHP
FT                   KIISAPEAVHVLSQRLEKYFHSDDMRVRLSDGIVSDAAVGGDTVKLNSKAMFSESDLNV
FT                   YEVHEGWVHVGTTLNGRAQPHATWLSVGSPRVAATQEGLAVLLEMLTLSSNPGRARRIS
FT                   DRVAAVDMAENGADFIDVFNYFRELNLSAKDSYRVTQRVFRGGMVEGGSFFTKDISYVR
FT                   GYVENINFIRSAITSGLPELIPMLFLGKLAIEDIPVLYQACQEGILTPPKYLPPMFDNF
FT                   SGLYAWFGFASGLAGIDLKGVQRHFTRLFKDVPNVSPAYELFDDTEFDNNSD"
FT   gene            complement(668394..668570)
FT                   /locus_tag="Sputw3181_0610"
FT   CDS_pept        complement(668394..668570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0610"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23461"
FT                   /protein_id="ABM23461.1"
FT                   /translation="MAHIIEVVPNDTEIEAMTTPRNSKAAEAMQHKREIKKRLEDYLER
FT                   AELRRALGDDEFF"
FT   gene            668879..671032
FT                   /locus_tag="Sputw3181_0611"
FT   CDS_pept        668879..671032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0611"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="KEGG: she:Shewmr4_0543 multi-sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region, ATPase domain protein domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   CHASE domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23462"
FT                   /protein_id="ABM23462.1"
FT                   /translation="MHKDDFPKYFDSPKNFYFSVLSSSWMVITAALFFMGVSWYVLEVY
FT                   LRDRGEERFNNNVQELIEAVNSRMIVYEQVLRGGIGLFLASDGVTREEWQTYVVNARLI
FT                   EYYPGIQGFGYTPLLTPETLEAHVNQVRTEGFSEYNVYPQGERDLYCVIQYLEPFDWRN
FT                   QRAFGFDMCSETNRRSAILSSIATGMPTISGKVILVQETQDNTQSGFLMYLPLYQGQAT
FT                   TDEERKQRAVGVIYAAFRMDDLMQGIMGNRFSGLTLAIYDGENANAESLMFTSNKLLPS
FT                   PQDLFYQSQTAIIEGRVWRLDISSESAFISSSEQTQSFWLQLIGCGFILALFYSVVVMA
FT                   RNRYQESRLTSELIANEKRFRLVIEASPSALFMIDRTGVITLVNTHAERLFGYAREELL
FT                   GHSINMLLPKGLWDIHQQHMSNYLVQPIAKNMSMRDDLFGCCKDGSRLAIEVGLTPIHF
FT                   SNGLSILATINNVSERKRVEIQRAQHTKELERINQELDRFAYIASHDLKSPLRGIEQLT
FT                   SWLAEDLVDNTNENVQKYLGLIQNRIHRMVLLLDGLLMFSRIGRVDAEIVEVDARQLIE
FT                   DMFELVAPPQGFELLLEGEFPNFKTVKTLLELVVRNLMSNAIKHHDRDTGVIKVQCEPK
FT                   GDVYWFSVVDDGPGISKAYHGKVFEMFQTLKPRDEVEGSGLGLSLVKKTIESLGGEIKL
FT                   ESEGRGCRFRFSWPVRIVNKEVL"
FT   gene            671029..671463
FT                   /locus_tag="Sputw3181_0612"
FT   CDS_pept        671029..671463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0612"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   she:Shewmr4_0544 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23463"
FT                   /protein_id="ABM23463.1"
FT                   /translation="MSSSNSYTQVTILLVDDDDVDYMAVQRAMKQLRLLNPLIRARDGL
FT                   EALHILTNPEAIKGPYLILLDLNMPRMNGFEFLEHLRSDPTLSSSVVFMLTTSSTDEDR
FT                   MKAYSHHVAGYMVKTDIKDGFNNIFNMLEGYWRIVELPSA"
FT   gene            671473..673194
FT                   /locus_tag="Sputw3181_0613"
FT   CDS_pept        671473..673194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0613"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; response regulator
FT                   receiver; KEGG: son:SO0545 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23464"
FT                   /protein_id="ABM23464.1"
FT                   /translation="MDLLLIDDDEVDRTAVIRALRQSKLAFNVIEANCAFDGLNLALER
FT                   HFDGILLDYMLPDANGLEVLIKLNAMTQDQTVVVMLSRYEDEKLAQRCIELGAQDFLLK
FT                   DEVNSRILTRAIRYAKQRASMALALRNSHQKLKELAEHDSLTKLVNRYGFELCLNRAIA
FT                   RAKRSNNYLAVILLDLDDFKAINDTLGHQTGDILLVKVASRLSEVLRDGDVIARLGGDE
FT                   FVVLVTDDDYKYFPMIVANRLLKAFEEVFCLGDNDVLIGASIGVAFYNEAASDSSELMK
FT                   CADIAMYRAKKMGRNQIQFYSEALDREVRYRNHIESSLRVALRQNEFKVYYQAQVDSLT
FT                   HQMVGMEALIRWQHLKDGVIAPDQFLPIAEEMGLMEEIGDWVLAEACRQAQIWLTQLKP
FT                   IGRDFTIAVNLSASQIAQIDLLSKIIQTLELTGLPPTALELEITENCLIEDPHEHAKVL
FT                   DQIAKLGVRFALDDFGTGFSSLEHIKLFPISVLKIDKSFIASYDKDEKDTRLLAALLNF
FT                   AYGFNVISVAEGVETLEQAEFCTARNCNILQGYLFSRPLEAIDFEAKFITPLLTKL"
FT   gene            673355..674260
FT                   /locus_tag="Sputw3181_0614"
FT   CDS_pept        673355..674260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0614"
FT                   /product="alpha-L-glutamate ligases, RimK family"
FT                   /note="TIGRFAM: alpha-L-glutamate ligases, RimK family;
FT                   PFAM: protein of unknown function DUF201; RimK domain
FT                   protein ATP-grasp; KEGG: son:SO0546 ribosomal protein S6
FT                   modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23465"
FT                   /db_xref="GOA:A1RFM0"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RFM0"
FT                   /protein_id="ABM23465.1"
FT                   /translation="MKIGILSQFPQLYSTQRLVAACESRGHEAVVINTLNCYMNINSIK
FT                   PSIHYEGQELVGFDAIIPRIHASVTFYGCAVVRQFEMMGVFVANDSISIARSRDKLRAL
FT                   QLLSRKGIGMPITGFANKPNDIPDLINMVGGAPLVIKLLEGTQGIGVVLAETKTAAESV
FT                   IEAFLGLKANILVQEYIKESNGSDIRCFVVGDKVVASMKRQGPEGDFRSNLHLGGCGET
FT                   VKITSVERKMAIAAVKAMGLVVAGVDILRSNRGPLILEVNSAPGIEGIEQTTGISVTEP
FT                   IVEYIEKMVAARKTNRPIIA"
FT   gene            complement(674341..675033)
FT                   /locus_tag="Sputw3181_0615"
FT   CDS_pept        complement(674341..675033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0615"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23466"
FT                   /protein_id="ABM23466.1"
FT                   /translation="MRKSLYSVLALSTGMLLTSNAFAAVSANIGGTSNYLWRGVTQTDD
FT                   AVAIQGGIDYSHDSGFYAGTWASNVDFGDETSYELDLYVGYAGNITEDISYDIGYLYYG
FT                   YPDAPGSIDFGELHGAVTWKWIELSYSHVINAGDDVAASPLDNKDLSYLAATVSIPLTE
FT                   KVSLSVHYGYSTGDVVEAWFGEDNYADYNVTLSADTSVGTVSFMVADTDLTDDDTKIVL
FT                   GYSYSFDL"
FT   sig_peptide     complement(674962..675033)
FT                   /locus_tag="Sputw3181_0615"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            complement(675331..675603)
FT                   /locus_tag="Sputw3181_0616"
FT   CDS_pept        complement(675331..675603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0616"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: she:Shewmr4_0548 histone family protein DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23467"
FT                   /protein_id="ABM23467.1"
FT                   /translation="MNKTELIAKIAENADLTKVEAARALKSFEAAITESMKNGDKISIV
FT                   GFGSFETATRAARTGRNPQTGKEIQIAEATVPKFKAGKTLRDSVN"
FT   gene            complement(675750..676547)
FT                   /locus_tag="Sputw3181_0617"
FT   CDS_pept        complement(675750..676547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0617"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   shm:Shewmr7_3481 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23468"
FT                   /protein_id="ABM23468.1"
FT                   /translation="MSHLSPNELSILLVEPSDTQRRIIIQHLQQEGIVSIQTAANIEEA
FT                   KAVVGRHKPDLIASAMHFEDGTAIDLLSYLRVNSDYKDIQFMLVSSECRREQLEIFRQS
FT                   GVVAILPKPFHAEHLGKALNATIDLLSHDELDLSHFDVHDVRVLVVDDSRMARNVIKRT
FT                   IGNLGIKLITEAEDGAQAIELMRNNMFDLVITDYNMPSIDGLALTQFIRNESQQSHIPI
FT                   LMVSSEANDTHLSNVSQAGVNALCDKPFEPQLVKQLLFQLLEE"
FT   gene            complement(676630..677094)
FT                   /locus_tag="Sputw3181_0618"
FT   CDS_pept        complement(676630..677094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0618"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23469"
FT                   /protein_id="ABM23469.1"
FT                   /translation="MIMRLYWTQFSAFPTLPHPKTTKSISHSMPKRLILLTALYCLFSI
FT                   AALWRAITTQSFDLFTLGVLPVLVGILMRAPWSSLVLKIYLGMQTLGFSALGITAVIAY
FT                   RITPEDVKVFFAGKQIPMLPLVIGIIAMLLVQYWAAFSKVTYQYLSGKTE"
FT   sig_peptide     complement(676954..677094)
FT                   /locus_tag="Sputw3181_0618"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.723) with cleavage site probability 0.569 at
FT                   residue 47"
FT   gene            677139..677648
FT                   /locus_tag="Sputw3181_0619"
FT   CDS_pept        677139..677648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0619"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23470"
FT                   /protein_id="ABM23470.1"
FT                   /translation="MTEVEFWALVTRTEAAQPQESLVQALKQKLTELSNEELKAFDKIF
FT                   SQQMRRSYLWSVWGAAYIITGCDSEYAFAEFRCFLISLGQERYDAVITHPDSLARLSAW
FT                   PEKDGYAYPFVDEYDLIAGQLYEDRTGQELPFMPSGKATPVGKKFSTKPKDLKQQYPEL
FT                   SARFPF"
FT   gene            complement(677680..677988)
FT                   /locus_tag="Sputw3181_0620"
FT   CDS_pept        complement(677680..677988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0620"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3477 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23471"
FT                   /protein_id="ABM23471.1"
FT                   /translation="MKFPVVPVFILILFTCFASAIWFISPDSKDDHHQTWSSFIYTHGY
FT                   DSGKYKKTDNFDHYDACRDFARVQSSLYDNVPWECGLNCEFDPRKQGFQCKKMKNDN"
FT   sig_peptide     complement(677926..677988)
FT                   /locus_tag="Sputw3181_0620"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.900) with cleavage site probability 0.741 at
FT                   residue 21"
FT   gene            678261..678785
FT                   /locus_tag="Sputw3181_0621"
FT   CDS_pept        678261..678785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0621"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23472"
FT                   /protein_id="ABM23472.1"
FT                   /translation="MKVQFLLLAGVLSCSAVWAADETSTHPVTEDGVVKIVWQNPKDFR
FT                   DIKSSGEVQSRYETRLFETLTKNINKEAAKILKPNQKLEMMVTDVDLAGDMRPTFGATA
FT                   NDLRVVKDIYPPRITFSYQVLENDKVIVAGDEKLSDMGFLTGIQPLNDKPFMYETQMLN
FT                   DWLKKTIAPKI"
FT   sig_peptide     678261..678320
FT                   /locus_tag="Sputw3181_0621"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(678799..680553)
FT                   /locus_tag="Sputw3181_0622"
FT   CDS_pept        complement(678799..680553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0622"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="PFAM: GGDEF domain containing protein; CBS domain
FT                   containing protein; EAL domain protein; KEGG:
FT                   shm:Shewmr7_3475 diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23473"
FT                   /protein_id="ABM23473.1"
FT                   /translation="MTSLDLAKELDKIISKGAISPLFQPIFNILEHKIHGFEALSRGPE
FT                   HSPLYSPAPLFQTAEHQGKLSELETLCRRISLEQFKCRQFQGRLFINISPKALLDPSYP
FT                   KGLTLQLLQQLGISPSQVVIELSEQYPADDIDLLKSCLNHYRSQGFMTAIDDLGAGYSG
FT                   LRLWSELSPDYVKIDRHFIHQIDSTPVKQEFVRSIVELCQSLTCKVIAEGIETQEELAV
FT                   LKQLGIVYCQGYLLGRPEAMPCRAMKATLVPNNTQAQPRYSESAESLCCGAVTVLPNLK
FT                   LKHLSDTFISQPALQAVVVVEDQVPQGIISRATLLELFSTPYGRALHENHAVSEVMDPQ
FT                   VLQIEANEPLSTVSQLLTSESANTVAQQFIILRRGKLLGIGHTKDLLQRITEHRIKMAR
FT                   HANPLTDLPGNVPIQEELKRLRIQQKPFYLAYFDLCHFKPYNDIYGFCRGDEVICEVAN
FT                   LLMKYKSDNCFIGHVGGDDFVIISTCDQIVTRCQRILTDFEHHKQLFYSAEHWQAQQML
FT                   ADDRQGQACYHKLISLCVGLLSPEHTHNCNEHSLSTLSARAKKQAKSASNGFCLLENNA
FT                   LNPHALIA"
FT   gene            complement(680717..681025)
FT                   /locus_tag="Sputw3181_0623"
FT   CDS_pept        complement(680717..681025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0623"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23474"
FT                   /protein_id="ABM23474.1"
FT                   /translation="MPHTKVIEQLKENLQTAYRQAIDADAKLDELKKAGYGKFTSIFTA
FT                   DQGFIISSNRFLPYVQELVDDLTTLESQPTLDPVALETYVRQLGILLKTLQVFKKQS"
FT   gene            681074..681973
FT                   /locus_tag="Sputw3181_0624"
FT   CDS_pept        681074..681973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0624"
FT                   /product="GumN family protein"
FT                   /note="PFAM: GumN family protein; KEGG: son:SO0557
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23475"
FT                   /protein_id="ABM23475.1"
FT                   /translation="MATSHRRLIAAISCVTLFFHAAIFAAPSDKPPFYQVQWQGKSAYL
FT                   LGSIHIGNRDFYPLPEQIETAFSKAKGLVVEVDMNKVDSRALLQKYGMADGTKGLDWQN
FT                   RDKQTVESMTLYCASRASVCQSIQSFAPWLQATQLNLLRYNGLGYSTDYGVDAQLMARN
FT                   KTLPVFELETAESQFQLLATFDSQEQWSMVRDAISVSDDELLSLITAWRSGDETELDTI
FT                   MQEQMGGEGDTRIIDKILWQRNHTMAEGILKLMDVSDVPAPLFVVIGAGHVVGDKSVVQ
FT                   LLKQAGAKVTACWSDTCL"
FT   sig_peptide     681074..681151
FT                   /locus_tag="Sputw3181_0624"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(681998..682771)
FT                   /locus_tag="Sputw3181_0625"
FT   CDS_pept        complement(681998..682771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0625"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: son:SO0558 smtA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23476"
FT                   /protein_id="ABM23476.1"
FT                   /translation="MQDKNFDKLAHKFAKNIYGTPKGEIRAAVLWRDLSSALAPFGDKK
FT                   LRILDAGGGFGFFSQKLARLGHEVVLCDISQEMLIQAQAHIDASTEPLNIELIHAPIQA
FT                   LSVEQHGVFDLILCHAVVEWLTDAQRTMEGLLTMLKPNGLFSLMFYNKEAMRFHALISG
FT                   NFDYVAADLKVKKKVRLTPTHPLYIQEVKQWFMDWEMTLISQSGVRVIHDYLKKSQAAD
FT                   FDYQKLLQMELEYSQHEPYISLGRYVHFLGISRGT"
FT   gene            683180..684010
FT                   /locus_tag="Sputw3181_0626"
FT   CDS_pept        683180..684010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0626"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   son:SO0559 MaoC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23477"
FT                   /protein_id="ABM23477.1"
FT                   /translation="MPSLLSLYRKIFFGRKPGWDQQPLPHIRVTAPDVTVSEAKVSQYA
FT                   QVCGFQFDGNLLPPTYLYVMAFRLHAVIFTHDGITFPLLGMIHLKNRIQVYRPTTVNEK
FT                   YSFECALTTSRETDSGLEFEFVSKVYVGEELVWESLSTYLYRIETAGRRVRPPKAIEME
FT                   WDAPQAWELGEDLGRRYAKASGDYNLIHLHPLLSKRFGFDRVLAHGMWSKARCLAELMP
FT                   ELGTRPFTVDVTFKLPLLMPAQVGFGYEKNEDNWVFELRDSKGRRPHLSGEIYF"
FT   gene            684185..685897
FT                   /locus_tag="Sputw3181_0627"
FT   CDS_pept        684185..685897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0627"
FT                   /product="Formate-tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="PFAM: formate-tetrahydrofolate ligase, FTHFS; KEGG:
FT                   son:SO0560 formate--tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23478"
FT                   /db_xref="GOA:A1RFN3"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RFN3"
FT                   /protein_id="ABM23478.1"
FT                   /translation="MLTDMEISSRASLTNVAELGAELGLLPEEMLLFGSTKAKVDLSVQ
FT                   QRLAGQSRGKLIIVTAVTPTPHGEGKTVTSIGLTQSLKAIGKKACACIRQPSMGPVFGV
FT                   KGGAAGGGYAQVVPMQELNLHLTGDIHAVSSAHNLGAAAIAARLFHESRLGKVEFEAQS
FT                   GQAFLDIDPAQIRWHRVLDHNDRCLRQVQVGLGENNGPVYESGFDITAASELMAILALS
FT                   ANLADMRARIGRLVLALNRQGQVISAEDLGVAGAMTAIMVDAIKPTLMQTLNGAPCLIH
FT                   AGPFANIAHGNSSIIADDIALKLVDYVITEGGFGSDMGFEKFCNIKVRQSGQVPSAAVL
FT                   VTTLKALKANSGIESDTDINTPDEIRLEAGFANLHWHINNVARYGIPVVVAINRFATDT
FT                   EAELQWLINAVNQTAAFGCEVSDAFSQGEAGAIELAYTVVRAADTQSQFRLLYPDDASL
FT                   EAKLSTLAEVGYGAAGISLSDEAKQQVREFTSLGYAYLPVCMAKTPLSISHDPMQKGVP
FT                   KDFIVPIRALVLNAGAGFVTALVGNVMTMPGLGIKPGYLKIDIDEAGEIIGLG"
FT   gene            complement(686063..686239)
FT                   /locus_tag="Sputw3181_0628"
FT   CDS_pept        complement(686063..686239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0628"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23479"
FT                   /protein_id="ABM23479.1"
FT                   /translation="MNSRHSSLFPSTKRQLEMLAFFRENLGIILGIVIFGALILGGIYY
FT                   VEHSLKSQEQVIQ"
FT   gene            686502..686765
FT                   /locus_tag="Sputw3181_0629"
FT   CDS_pept        686502..686765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0629"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23480"
FT                   /protein_id="ABM23480.1"
FT                   /translation="MISIWLAALLILLSFAASAHSVTHLDDGAKTHCTLCFHQHQFNKI
FT                   LLTQPLVLNLAVQRFDVVEFVLPVFLSKHISVYRSRAPPVLL"
FT   sig_peptide     686502..686561
FT                   /locus_tag="Sputw3181_0629"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.910 at
FT                   residue 20"
FT   gene            686843..688033
FT                   /locus_tag="Sputw3181_0630"
FT   CDS_pept        686843..688033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0630"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23481"
FT                   /protein_id="ABM23481.1"
FT                   /translation="MTVFNTQVSLVALACAFASPSLFAADSSLTNPNISAVLNGYYQTG
FT                   ERPLSETSEGFGLGETELAMSANIDDMFYGKVTAVVEIHDGESELNLEEAFIQTMAMPG
FT                   GFSIRGGRFLSDIGYLNNQHLHTDSFTDRPIAYRAFLGGHYFDDGVRLNFVAPTDLYWT
FT                   MGVEAFKGESLRAADEHGEREFENVGVYTLYTKIGGDIGDNSSWQAGLSYLRNENGQVT
FT                   AHEEGEEDEDEHEHEHEEGHDHSHAASYTGKNTYGADFVYKWAPNGNYKYQNLTLSGEY
FT                   FRVTDFTPVDLHPEDAPSKDYHQGWYLSSVYQFTPSWSAGVRYGEVDTQELHGDHFHAQ
FT                   KLKESEVTLAWHSSHFSTVRFQYTNQKGTNFDGFEDDNIFTIQYIMTLGAHGAHQF"
FT   sig_peptide     686843..686917
FT                   /locus_tag="Sputw3181_0630"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            688017..688925
FT                   /locus_tag="Sputw3181_0631"
FT   CDS_pept        688017..688925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0631"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   shm:Shewmr7_3463 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23482"
FT                   /protein_id="ABM23482.1"
FT                   /translation="MRINSKLVKLAAVALSAAYMGLAHAELNVFACEPEYAALAKELAP
FT                   TANIYSATTALQDPHQVQARPSLIAKMRQADLVVCAGADLEVGWLPMLQMKSANAKVQS
FT                   TEKGLFFAADHIETLDKLASVDRSMGDVHAQGNPHLHFDPMRLLQVATALTSKMAQLDP
FT                   ASEAHYQQSLADFTARWQAAIPRWEEQAKGLQGKKVIAYHSSFRYLFNWIGIEQVADLE
FT                   PKPGLAPTSGHLASLLTRAEQGDILAVVVASYQDERGAKWLGEKAHLPVLMLPMSVGGN
FT                   DSSKDLFSLYDSVISLLNGVK"
FT   sig_peptide     688017..688094
FT                   /locus_tag="Sputw3181_0631"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            688931..689719
FT                   /locus_tag="Sputw3181_0632"
FT   CDS_pept        688931..689719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0632"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: shm:Shewmr7_3462 ABC-3
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23483"
FT                   /protein_id="ABM23483.1"
FT                   /translation="MFDLELMSILLPAFAAGVLVLSTHVVLGRQVLKRGIIFIDLAIAQ
FT                   VAALGAIVAHMDHRVEDIPFSHVWMPAVFALAGAGFIAWLSKRMADELEAMIGCFYVLS
FT                   AVAAMLLLANDPHGAELLKQLMSGQILWVSWPQLILPTVVYAVVLLTFFLRPQILDGAG
FT                   FYLLFALVITLSVELVGVYLVFSTLILPALALNKYRGKGQLFYAYLVGLIGYLLGLVLS
FT                   AAFDLPSGAAIVATLAVSALVFRWWLAKLGTFSAQIASKH"
FT   gene            689829..690614
FT                   /locus_tag="Sputw3181_0633"
FT   CDS_pept        689829..690614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0633"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="KEGG: she:Shewmr4_0569
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferases; TIGRFAM:
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferases; PFAM:
FT                   phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23484"
FT                   /protein_id="ABM23484.1"
FT                   /translation="MLAILSPILSLEYAVLLIVRSMLLAVSLLLAFIFGGLVCLLRPRH
FT                   RDNVHMFAKIFSSVAPILGIKVIVRRHKEVQDGPYIFLANHQNNFDLFTHTKAVPKGTV
FT                   SLGKKSLVWMPLFGQIYWLSGNILIDRKNRHSAFDTMAKTVEKIKQKSLSVWIFPEGTR
FT                   SRGRGLLPFKAGAFHTAIAAGVPIVPVLASCQSHINLNRWDNGVVIIEMMAPIPTADID
FT                   KADVKAFSAQIYDSMSAKFNEINREAATLMGKTPMDDGV"
FT   gene            690658..691062
FT                   /locus_tag="Sputw3181_0634"
FT   CDS_pept        690658..691062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0634"
FT                   /product="protein of unknown function DUF1260"
FT                   /note="PFAM: protein of unknown function DUF1260; KEGG:
FT                   shm:Shewmr7_3460 protein of unknown function DUF1260"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23485"
FT                   /protein_id="ABM23485.1"
FT                   /translation="MSIESQLKAQLAENRDIVQALLDDGSEPDAEYVIEHHFSSTNFDR
FT                   LEKAAVDAFKLGFEVNDAEEMELEDGSVIFCFDAVAHHKLDVALIDKATEQLLQLAAKQ
FT                   KVDYDGWGTYFVGDDMDDEDEDEEDDGFPH"
FT   gene            complement(691132..692106)
FT                   /locus_tag="Sputw3181_0635"
FT   CDS_pept        complement(691132..692106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0635"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: shm:Shewmr7_3459 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23486"
FT                   /protein_id="ABM23486.1"
FT                   /translation="MSNDQSAMNELHWLIDMVQTIEVGLVVLDRHYNIQLWNGFMENHS
FT                   GVSPNSIKGQNVFTRFPDLPATWLKQKMESVFMLKNRAFISWEQRPYVFQFKNYRPITG
FT                   RADFMYQNVTLLPLASLTGKITHISVIVYDVTDIAVNKLQLKAANEQLERLSQTDGLTQ
FT                   LHNRRHWQLCLEHEFDLYARYNDIPSLVMIDIDNFKYINDTYGHVAGDKVIQHIAHILS
FT                   QSLRETDCAGRYGGEEFAVVMPKTSGEDALHFTERLREKIAESTIVYESLKIKVTVSLG
FT                   VCEIGKHISSSSSWISCSDKALYEAKQKGRNCSVLHTEKTIIT"
FT   gene            complement(692125..693120)
FT                   /locus_tag="Sputw3181_0636"
FT   CDS_pept        complement(692125..693120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0636"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: son:SO0570
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23487"
FT                   /protein_id="ABM23487.1"
FT                   /translation="MTISVLICDDSAMARKQMARTLPKEWDVEITYATNGAEGLDAIRA
FT                   GKGEVVFLDLNMPVMDGYEVLQTVQQNDLPALIIVVSGDIQIKAHERVKALGALDFIQK
FT                   PVSADAISNILQEYGILTLTQKALEDETPMIKVDMRDACQEIANVAMGRAADLLAKLLD
FT                   VFVLLPIPNVNVLEVSELTMALKATEESSTVSALCQGFIGAGIAGEALLLFHDSSFQDM
FT                   AKLMRLADPEDKNTEIEVLIDTGNVLIGAFLNGISEQLDMKFSQGHPVVLGRHCTVNDL
FT                   IHDNSEKWQRTLAMEINYRIENHDIQCDLLLLFTEDSIPTLSYKLGYLLD"
FT   gene            693639..694445
FT                   /locus_tag="Sputw3181_0637"
FT   CDS_pept        693639..694445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0637"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   she:Shewmr4_0573 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23488"
FT                   /protein_id="ABM23488.1"
FT                   /translation="MSTQCVKVTISDGIAYVQLNRPEKMNAINYLMFSELDRTIKKIQK
FT                   NRAIRVVILSGAGGNFSSGLDVKSVMSAPMQAVKLLFKWLPGNANLAQRVSLGWQRLPI
FT                   PVIAVLDGCCFGGGMQIALGADIRIASHDSQLSVMEAKWGLVPDMAGLVSLRQIMPKDQ
FT                   AMLLSLTAKVLSGEQAFALGLVTQLSEQPMAAAEQLARELIKTSPDATAAIKLSINRSW
FT                   TASVRSLLSRESLSQIRLLLGKNRTIAAVRQLKDPEKPYQDRQSGW"
FT   gene            complement(694504..695388)
FT                   /locus_tag="Sputw3181_0638"
FT   CDS_pept        complement(694504..695388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0638"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0573 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23489"
FT                   /protein_id="ABM23489.1"
FT                   /translation="MAHIFLAFWVLFLSLMTLPCLSAEPNTSTETPRTNPTRNYLPANE
FT                   VKQITIDNKPYELLVRPWEGKKKLGATIILPATNGTADSPGLMAFLRRNINPAGWASLS
FT                   LTPPKELPAPNFATAAAEVTTAGAAQLATPSNKPSQKIKPEDSNKHLQEQEEFLIKTMS
FT                   QLDGIGTDYPGKRVLITAEQSAGILISLLSQKKIADPDVLIVINPYNEDETRNQAIAEK
FT                   LAKLTMPILDIQSPDGHPASLETAEQRKILAVTLGTPNYRQTTLVLNLDNESAWQNCLN
FT                   TIKGFAARMSGAH"
FT   sig_peptide     complement(695320..695388)
FT                   /locus_tag="Sputw3181_0638"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.950 at
FT                   residue 23"
FT   gene            complement(695558..698464)
FT                   /locus_tag="Sputw3181_0639"
FT   CDS_pept        complement(695558..698464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0639"
FT                   /product="SNF2-related protein"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: she:Shewmr4_0575
FT                   SNF2-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23490"
FT                   /db_xref="GOA:A1RFP5"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RFP5"
FT                   /protein_id="ABM23490.1"
FT                   /translation="MPFALGQRWISDTESELGLGTVVQVEGRMVTVLFPATGENRMFSR
FT                   AEAPLTRVTYNPGDTVESHEGWSLTIEDLTEKDGLVIYHGIHSETGEQVTLRETLLNHN
FT                   IRFNKPQDRLFAGQIDRLDRFGVRYQCQMLRHKLATSDLLGLQGPRVGLIPHQMWIAHE
FT                   VGRRYAPRVLLADEVGLGKTIEAGLIIHQQLLTGRAERVLVIVPDTLRHQWLVEMLRRF
FT                   NLRFSVFDEDRCVEAYADHDNPFYTEQLVICSLELLRKKKRLDQALDADWDLLVVDEAH
FT                   HLEWTEEAPSRAYQVVEALSEVVPGVLLLTATPDQLGHESHFARLRLLDPDRFYDYDAF
FT                   LAEENSYKDVAIAAEALAGNAKLPDAAINSLTELLSEKDIAPSIRLIQADGIDSDVQQA
FT                   ARSELLQELLDRHGTGRVLYRNSRASVKGFPKRFFNPHPQTMPEQYLTAARVSSMMGGH
FT                   KTLEAKAAQALSPEKLYQEFEDNSASWWKFDPRVDWLIAFLKSHRSKKVLIIASQAETA
FT                   LSLEEALRTREGIQATVFHEGMSIIERDKAGAYFAQEEGGAQALICSEIGSEGRNFQFA
FT                   SHLVLFDLPLNPDLLEQRIGRLDRIGQKNDIQIHLPYLEDTAQERLMQWYHQGLNAFEL
FT                   TCPSGHVLYAEFAEDLLNVLVGDDADELTNLLNHTQSRYKELKHAMEQGRDKLLEINSH
FT                   GGDRAKAIVERLAQNDENTQLIGSVIRLWDIIGVDQEDKGENSIILRPSEHMMFPTYPG
FT                   LPEDGVTVTFDRDTALSRDDIALITQEHPLVQTGLDLITGSETGTTSVAVLKNKALPAG
FT                   TLFLELIYMADASAPKSSQLYRYLPPTPIRILLDKNGNDLSAKVDYASFDKQLSAVNRH
FT                   IGGKLVTASQPILHPLFAKGEEYAQAAVDELVIQAREKMTTQLTGELDRLESLKAVNPN
FT                   IREEELEYLRNQMQELNTYLDASQLQLDAIRMVLVSHV"
FT   gene            698867..700261
FT                   /locus_tag="Sputw3181_0640"
FT   CDS_pept        698867..700261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0640"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; SMART: AAA ATPase;
FT                   Nucleotide binding protein, PINc; KEGG: shm:Shewmr7_3454
FT                   PhoH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23491"
FT                   /protein_id="ABM23491.1"
FT                   /translation="MEQDDRKLFVLDTNVLLHEPLAIYSFKEHDVVIPMTVLEELDQIK
FT                   DRKSDVSRDARVAIRALEDTLGGDTTPEQIINGVPLPSREGHADAIGALSIFPDHLVDF
FT                   TLGSLPGDGNDNRIINTALHLQNLHHPRTVVLVTKDINMRLKAKGAGIQLVEDYRTDQL
FT                   IDDIRFLSKGFYQFEGNFWEHLNKVSTERHGRHIIHEVPLKDLENDQFYINQYLIDTES
FT                   DFCGRVTGRTDTHLHILDLGRERMKNLEAWGVKPKNVYQGMALQALLDPDIELVILTGP
FT                   AGCGKTLLAMAAALELVVERNRYDKVIVTRNTPEIAESIGFLPGTEEEKMMPWLAAITD
FT                   TLEVLHKNDVNPTGSLNYIMEKANIQFKSINFMRGRSIQNSIVLLDECQNLTASQIKTM
FT                   ITRMGEGTKLICCGNLAQIDSNYLTAVTSGLTYIVERFKDFEGSANLYLNGVVRSRLAE
FT                   YAEEHL"
FT   gene            700473..704177
FT                   /locus_tag="Sputw3181_0641"
FT   CDS_pept        700473..704177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0641"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="KEGG: she:Shewmr4_0577 multi-sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region, ATPase domain
FT                   protein domain protein; histidine kinase A domain protein
FT                   domain protein; Cache domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23492"
FT                   /protein_id="ABM23492.1"
FT                   /translation="MKSSEPDLQLKSPIQKNYNRAVFYTYIGVIVMSLLTAWVFFDRQK
FT                   TQQMEQREEQVERHVLQIDLLLESSIRAVKSLRDVAVDHLRLGELVRKDRLPEYGKFNE
FT                   SGQYFTLEPSYAKGGKPFTNMGRITGAGSLDGRSDKFYQELEMLFELSLSFPVAKEAAP
FT                   KASAIYYLSRQRIMSYFPWTNDDLRFRDELLNKKQFQYATPAMNPQRSVFWSEAYIDST
FT                   GKGLLTTLGVPIYLDDEFIGSINLDMTLASLARQIRVYFRMPGTVILLDQQNNILSHSD
FT                   FDSSDINRVYHISQRIPSELHSLPESELFDAHEGMIRNGYYIHSVALHNAPWRLLYLQD
FT                   EDDLFQDSWEKLQLTFILVVIALSVLVTIVHWQTRRSFVSPASRLLSHLEGCSQEPRKP
FT                   PEKITQGWEPWFLLVSRIFEENKQYTHHLAEQNKRLDKLVARRTERLKDTTERREREYA
FT                   LLRSLLDSIPEAIVFKDKEGNYLGCNKAAERMLGYTESEMIGLSSEDLTSPEMGIRIRA
FT                   EDQQVLKDRTPLRYQEKVELAGKPVLLDTLKLPFYNRRGELLGLIAVWRDVTREYESAE
FT                   QLRLSEERYHLAMDAVEDGLWDWYLDSEQIICNPAYYSMLGYKTNEFPALVSAIDHLTH
FT                   PDDRIRVEEYRNQYLQDPVDAYEIEFRLLGKNGTYHWVLCRGRVVEFTADGQPKRMLGT
FT                   HKDITRQKSNEVALLEAKQDAELANLYKSEFLANMSHEIRTPMNAIIGMLQLAQRTSLT
FT                   PQQKDYLEKAGFSAQSLLRIINDILDFSKIEAGKLELERVPFPLDKVLDHALDLNALKA
FT                   QEQGVELLLYAPVTAGLILKGDPLRLGQVLINLLSNAVKFTQSGEIELGCEDVGERDHR
FT                   ITLKFWVRDTGIGISKDQQEKLFDAFAQADGSTTRKYGGTGLGLSISKHLVSMMGGKMQ
FT                   VQSELGVGSTFSFTISFEIAEEAKVEPLVVPEKLNNLRTLVVDDNPTALQIYSAVMRDF
FT                   HFEVDTAASGAEALYKLSRDPIDLLLLDWMMPEMDGSDVISAIDTMVAEGRLDKRPVII
FT                   MMTAYSAEPLQYEVESANVFAVLQKPFKASSLFDEIIAAFADEPRLNVVQSMEETDVGE
FT                   HTGLVLLVEDNFINQQVATELLKSAGYEVVLADNGQVALDIIDSRPFDAVLMDIQMPVM
FT                   DGLTAARALRERYSPEELPIIAMTAHAMSGDREKSLAAGMNAHITKPIVLNELFETLNH
FT                   WIQHKNQHS"
FT   gene            704246..706648
FT                   /locus_tag="Sputw3181_0642"
FT   CDS_pept        704246..706648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0642"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0578 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23493"
FT                   /protein_id="ABM23493.1"
FT                   /translation="MKPYNFALALILLGLPVMSVAASEPSTKIIKQSQEAKGFLNLYYE
FT                   TSQGQLYLEVDRLNQPFLLVTSLPEGVGSNDIGLDRGQLGQTRLVQFERQGPYIILKQL
FT                   NTQYRANTLDIAEQRAVKEAFADSVLWQGKVIEGKPDFVAINNLVLNDLHGVSSVLKQT
FT                   SQGDYQLDLSRSAILPAGVKSFERNADVDVQLTFHNAVAGKEVAKVTPDGTLMSVRMRY
FT                   SFVELPDEGYQPRAYHPMSGYLSDEYQDYATDFDQPLVQRFMLRHRLQKLTPGPLPSKV
FT                   VKPIVYYLDPGVPEPIRSALLDGARWWESAFTRAGFIDGFQVKLLPKDADPQDIRYNMI
FT                   QWVHRATRGWSYGAALTDPRTGEIIKGQVTLGSLRVRQDYLIAKGLTAAWRDRVAAEQA
FT                   ATELSLARLRQLAAHEVGHTLGLDHNFAASTNQDASVMDYPHPKIQLKGNDIDISAPYT
FT                   TGIGPWDYFAITYGYSDEGDAIAQKNLQTQLLAEVAKKGLRYIGESDSRQKDASQAYAS
FT                   LWDSGEDPIAQLVMLDKIRTKAIEGFSSAALHPSEPLGELADAFAPIYLLTRYQIDAVA
FT                   KFIGGTDYNYQSIGEGSRWSYIAPQLQLTALDTLLKTLDATSLTVPPLLLDSLVPKAGN
FT                   YRTTRESFDSGLGAISDPLAMAEGFSRHTVSLLLMPKRLNRVSQASMADNEQLSVASLL
FT                   DKLFAATLYQENQLGLIEGVWMRVNAVVIDEVLATLHDPHTSPEVKAVMNDRAQFAIKQ
FT                   LKAKANRANMNRAAHYNWLQQGFNQGLTDAKAKLIAKPLILPPGAPI"
FT   sig_peptide     704246..704311
FT                   /locus_tag="Sputw3181_0642"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.584 at
FT                   residue 22"
FT   gene            complement(706677..708485)
FT                   /locus_tag="Sputw3181_0643"
FT   CDS_pept        complement(706677..708485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0643"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: serine/threonine
FT                   protein kinase; KEGG: shm:Shewmr7_3451 serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23494"
FT                   /protein_id="ABM23494.1"
FT                   /translation="MQTPQLQHFYISEEQSIYLLKANDARKHKAWIRLCKQQLSKLGYS
FT                   DIEFIGKGAYGFVFAGINLEGEAHVFKFSRINLPQHIQDRLEEEAFMLSLLTHPNIPRA
FT                   IKFERVGRQGILVMERAKGEDLEQLCRRLGALPAAMVMSIARQLADILYYLRTGKPLVH
FT                   GDIKPSNLVYDIQSQHLSLIDWGSAVFAQRDEYNKPVEDNVMALMSSDQQHTNARMGDV
FT                   YFIGEEQLNGGLSSPRFDEQGVAATLYALASGQASRFGAQVIPPTSIGLPVELARTLEG
FT                   MLSSDPQQRIIAGDYFLKSMRHSHRLHLPELPKTELQGEIPVWVQSRDKDVETVSYSSR
FT                   KSFLKEHNAQDPIAKMDDIQLEKYYRNFLAGMGDTEKGFIAAVGRLAQYPIVGGLAIHW
FT                   RESGVFIDSNLAIYDAQQKSALVIAVNNMVTLARGIKRIGVFKACFFNARDTLHIERAS
FT                   TNEPFVASADQQLPFEVGDVPTLEDKSRLHSYFEDGKDPDENLELPVEIMEELARINQI
FT                   HHTGCIIFEALPNHLKIHSYLKLLNPRKQAAFRASLDRILHHVGKIQGHGVSGFMKLPY
FT                   KNTRRFTHLERQADHFYPKNPKEIGA"
FT   gene            708734..709075
FT                   /locus_tag="Sputw3181_0644"
FT   CDS_pept        708734..709075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0644"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23495"
FT                   /protein_id="ABM23495.1"
FT                   /translation="MPTQYKALLIELLEYPRKRILQSMEVTHCPHAVFFNDSDEQCLTC
FT                   HQGMECIWMNQNDELVAVEKKSIAELKQQLLIAVDFIDSSLSPHHLSRRQCQCDNCVWL
FT                   RKVQEALDQ"
FT   gene            709179..709835
FT                   /locus_tag="Sputw3181_0645"
FT   CDS_pept        709179..709835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0645"
FT                   /product="Thiopurine S-methyltransferase"
FT                   /EC_number="2.1.1.67"
FT                   /note="PFAM: thiopurine S-methyltransferase; KEGG:
FT                   she:Shewmr4_0581 thiopurine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23496"
FT                   /db_xref="GOA:A1RFQ1"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR022474"
FT                   /db_xref="InterPro:IPR025835"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RFQ1"
FT                   /protein_id="ABM23496.1"
FT                   /translation="MEPGFWHEKWYKQQIGFHQQDINPFLVQYWQRLALPAGAKVFVPL
FT                   CGKSLDMCFLAEQGHQVIGCELNELAVQQFFSDNQLEMTQTVEGEHQHYQTEQVSLYQG
FT                   DIFTLPKRITQDVTAFYDRAALIAWPEEMRAQYAKQLANLLPSGSLGLLVTLDYPQETL
FT                   NGPPFAVSPNWIEAHLTDDFEIQALACQDVLADNPRFVKKEVPWLNEAAYLLKRK"
FT   gene            complement(710090..710281)
FT                   /locus_tag="Sputw3181_0646"
FT   CDS_pept        complement(710090..710281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0646"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: she:Shewmr4_0582 BFD domain protein
FT                   (2Fe-2S)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23497"
FT                   /protein_id="ABM23497.1"
FT                   /translation="MYVCLCHAITDTQIKNAVSQGDSSLADVKKRLGVADQCGKCARMA
FT                   VQIIQNQLELEPKYYEVA"
FT   gene            710532..712106
FT                   /locus_tag="Sputw3181_0647"
FT   CDS_pept        710532..712106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0647"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: chemotaxis
FT                   sensory transducer; PAS fold-3 domain protein; KEGG:
FT                   shm:Shewmr7_3447 methyl-accepting chemotaxis sensory
FT                   transducer with PAS/Pac sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23498"
FT                   /protein_id="ABM23498.1"
FT                   /translation="MRKNLPVTQREYDYPADWILLSTTDTQSHITYANASFCKVSGYEL
FT                   DAMLGQTHNMVRHPDMPPQAFEDLWKKIKKGEPWKGIVKNRCANGDHYWVDAYVSPISI
FT                   NGQVVEFQSVRTKPSREQVKRAEAAYSELNKTGSIKALKLTLSMPTKLLLIALIALLPV
FT                   LYLAIEVGLVGFIAFIFSFIVLLVGGHLVLGRYYALVEKAKRIYDSPLMAHIYSGNCDD
FT                   LGAIDLALQMQSSELKSILGRASDSCYNVAEQAKVSAAKGKEIQRTSQSQLSEIEQVAT
FT                   AMQQMTATLGDMSSNCADTASASQMASAETINGDKRVASTISSIQAMAEQLQETAKVIT
FT                   QLESHSKDIGTVLDVIQSIAGQTNLLALNAAIEAARAGEQGRGFAVVADEVRALAQRTH
FT                   DATKEIHSMISLLQQGTSKAVESMQHGLVAASQCISTADLAGAALQTIREAIATITDMT
FT                   HHIASAVEEQSSVANEMNRSVVNTAQFTHLSHQLGSEMVSLNDDVIQEMDSHSVLVGQF
FT                   LKRSFKV"
FT   gene            712503..712838
FT                   /locus_tag="Sputw3181_0648"
FT   CDS_pept        712503..712838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0648"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3445 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23499"
FT                   /protein_id="ABM23499.1"
FT                   /translation="MFEQLVAIIAQLGNMLRPWAFDIATAMVVCLILVFSADVNRILRR
FT                   HLLGYSFVLRTFVFIILNAFGYGLLIIKTTPWVARHIVAMPPHWMFLLIVSMFIFIGYW
FT                   AQRNNQA"
FT   gene            complement(712854..713576)
FT                   /locus_tag="Sputw3181_0649"
FT   CDS_pept        complement(712854..713576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0649"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: shm:Shewmr7_3444 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23500"
FT                   /protein_id="ABM23500.1"
FT                   /translation="MLIFAHRGASGYQVENTLAAMAKALELGAKAIELDVHNVEGELVV
FT                   FHDRRLDNKSSGTGVIHTVTKDYLAGINVKGEPIPTLWQILELIAGRCTVNIELKGINT
FT                   VQPLVDLYPKVLSELGFTEDQLLISSFNHPYLSDIKRALPQALVAPLLASIPLDGATVV
FT                   SQLHAYSLHLDVSFISQALVDDAHQRGAKVYVYTVDHSDDIHALKQMGVDGIFSNYPDR
FT                   AMEALTQTPSLNYQGYFE"
FT   gene            complement(713591..716797)
FT                   /locus_tag="Sputw3181_0650"
FT   CDS_pept        complement(713591..716797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0650"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   she:Shewmr4_0587 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23501"
FT                   /protein_id="ABM23501.1"
FT                   /translation="MPRILLFIIVFLSFSIQANSPLQLDKRLGLNNKNQQQTAGIDEQI
FT                   TELKNNIDKLAANAASFQQAQLDFEDNKKEINQKLKEASKPLKLKKNTDLSQQASIAYS
FT                   HLSELKESEAALGNQVNELLQRHNLLPSVIATARQNVVQNKKTELAPLDTPSGELQQTQ
FT                   RLFFEQSLATSEAELASSQKRIELTQLKLQLVRQQLIQQEALIETINKAINKQRQQQTD
FT                   ATLAKNLVDTDSKELDPVTRNIADTNQIYGQKLQTLTLQINNVVEQQEQAEIQYQSQAK
FT                   QLANIQEQITWVKMNSAFGERFLQMLQSLPKPPNHEKLQTLIADARLDRYHLEQQQALN
FT                   DQELEQSGLYNDSQIKLLTSQQALIAQLMQSYDQYLSELGKLKVNYQQLSQQNLTLKNT
FT                   LNEHLFWVPNAASINKLWFTDVQRSTIWLAQTAQWGQLTKAWQEQNDYWSWWIILLILC
FT                   LMTQDLVTPKFNQLLTHYTTYVGNVTQDKFIYTLKALLCSVCYALIKPLPVVIAGLIFY
FT                   QSERNFVQAIGMGILVIGLVYLLYRLIFVLALDKGVLVGHFRRPSKLIQAGQFRLKHFV
FT                   LVASPLLGLMGFTEVLDASLVRNSIGRGAFILFCIILFLLYKDIFVLNRQNIDSKMDGK
FT                   NKKLLQKMLWALLIVVPLFSAGLAFRGYYFTAFQMLLQLQLSLVLGLGFLLLYQLIKRW
FT                   MLIERRRIAFDRAKAKRAERLAQREKHETHHLSSDGQDTYEEPVVDLETISSQSLGLVR
FT                   SLLLLAFLASLIGLWTQTHTALFSFLDGITLWTTNTSVNGVEQQLPITMKSLMFGLIVV
FT                   GFSLMVATNLPGLLELMILQRLELSPGTGFAITTVSRYLVVFLGLLIGFSNLGMEWSKL
FT                   QWLIAALSLGLGFGLQEIFANFISGLIILFEKPVRIGDTVTIRELTGTVSKIQIRATTI
FT                   IDWDRKEIIIPNKAFITEQLINWSLSDPITRVIVYVSVARDSDPAKVEATLYQAVQECE
FT                   DALPTPEPEVWFAGFGKHTQDYEVRAYAKEMSSRWPLRHDLHKRITRKLKENNLELAYP
FT                   QMEIHIKNGQNRDQVGIIRS"
FT   sig_peptide     complement(716741..716797)
FT                   /locus_tag="Sputw3181_0650"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.992 at
FT                   residue 19"
FT   gene            complement(716867..717751)
FT                   /locus_tag="Sputw3181_0651"
FT   CDS_pept        complement(716867..717751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0651"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; UAA transporter; KEGG: shm:Shewmr7_3442
FT                   protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23502"
FT                   /protein_id="ABM23502.1"
FT                   /translation="MGSITKPSGLIELHLAVLMFGGTALFSKLIPLSALDITFWRCIVA
FT                   ALILALLIKFSRKPLSLEHKHDYLIAIALGIIVSLHWVTYFAAMQLSSVAIGMIAFFTY
FT                   PVMTVIAEPLLTGNKIKLIDMISGILVFIGVILLIPEANFSNDTTLGIAIGILSAMLFT
FT                   ARNLLQKRYFTQYSGPHAMFYQTLVAAMFLMPWHETPLNSITLDVWELIILLGIVFTAA
FT                   PHALFTSALRQLSAKTVGLVSCLQPFYGAMLALMILGETLNLNTLLGGTIIVATAIFET
FT                   HQSHQSLRRKKRI"
FT   gene            complement(717767..718636)
FT                   /locus_tag="Sputw3181_0652"
FT   CDS_pept        complement(717767..718636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0652"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: shm:Shewmr7_3441 phosphatidylserine
FT                   decarboxylase; TIGRFAM: phosphatidylserine decarboxylase;
FT                   PFAM: phosphatidylserine decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23503"
FT                   /db_xref="GOA:A1RFQ8"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RFQ8"
FT                   /protein_id="ABM23503.1"
FT                   /translation="MDKVKIALQYMLPKHLLSRLVGKLAAAEAGTLTTAAIKWFIKQYK
FT                   IDMSEAAQSEPQAYKSFNDFFTRALKPGIRPINQHTHIMVHPVDGAVSQLGPIKEGRIF
FT                   QAKGHHYSSLTLLGDQAQDAKRFEGGDFATIYLAPKDYHRIHMPIKGTLSKMTYVPGEL
FT                   FSVNPLTARHVPGLFARNERVVAIFETEHGPLAMVLVGATIVASIETVWAGTITPPTGK
FT                   QVFTWEYPTVGPDAITLDKGDEMGRFKLGSTVVMLFAKDAIDTFAEGVEAEAVTRMGQA
FT                   FANLNNPK"
FT   gene            complement(718705..719769)
FT                   /locus_tag="Sputw3181_0653"
FT   CDS_pept        complement(718705..719769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0653"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="TIGRFAM: ribosome small subunit-dependent GTPase A;
FT                   PFAM: GTPase EngC; KEGG: son:SO0591 putative GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23504"
FT                   /protein_id="ABM23504.1"
FT                   /translation="MSKKKPLSQGQLRRMRANHEKRLNRDSGEKNTPELQDSSLGAEQS
FT                   GTVISRFGQHADIETEDGQIVRCNIRRTINSLVTGDKVVVRLAIESQANSGIAGIVEAV
FT                   HPRRSSLTRPDLYDGVKIIASNIDQILIVSSVLPSFTTQIIDRYLVAAEDTNIPPIIIL
FT                   NKIDLLNPQEAPVIEAALKRYQDIGYPVYKVSSKLGEGIDTIKGLLKDKVSVFAGQSGV
FT                   GKSSIINALLPDADLLVGDVSDNSGLGQHTTTTAKLLHLASGGDLIDSPGVREFALWHL
FT                   PAQRVGWCFIEFREFLGGCKFRDCKHGDDPGCALKTAVDEGKISEDRFNNYHRIIASLD
FT                   EQRHARHFRAATDE"
FT   gene            719882..720427
FT                   /locus_tag="Sputw3181_0654"
FT   CDS_pept        719882..720427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0654"
FT                   /product="Exonuclease, RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease, RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: shm:Shewmr7_3439 exonuclease,
FT                   RNase T and DNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23505"
FT                   /db_xref="GOA:A1RFR0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RFR0"
FT                   /protein_id="ABM23505.1"
FT                   /translation="MTANVNNLIWIDLEMTGLEPDVDRIIEIATLVTDQELNIIGQGPV
FT                   IAIHQPDEVLAAMDDWNQKHHGESGLIDRVRASQDNEAQAVAKTIAFLEQYVPKGASPM
FT                   CGNSVGQDRRFLNRYMRELEDYFHYRNLDVSTVKELVKRWSPEIMEGFKKQNTHQALQD
FT                   IQESIAELQYYRSKVFKI"
FT   gene            720617..720692
FT                   /locus_tag="Sputw3181_R0017"
FT   tRNA            720617..720692
FT                   /locus_tag="Sputw3181_R0017"
FT                   /product="tRNA-Gly"
FT   gene            720814..720889
FT                   /locus_tag="Sputw3181_R0018"
FT   tRNA            720814..720889
FT                   /locus_tag="Sputw3181_R0018"
FT                   /product="tRNA-Gly"
FT   gene            720932..721007
FT                   /locus_tag="Sputw3181_R0019"
FT   tRNA            720932..721007
FT                   /locus_tag="Sputw3181_R0019"
FT                   /product="tRNA-Gly"
FT   gene            721014..721089
FT                   /locus_tag="Sputw3181_R0020"
FT   tRNA            721014..721089
FT                   /locus_tag="Sputw3181_R0020"
FT                   /product="tRNA-Gly"
FT   gene            721977..722432
FT                   /locus_tag="Sputw3181_0655"
FT   CDS_pept        721977..722432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0655"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23506"
FT                   /protein_id="ABM23506.1"
FT                   /translation="MRIQQLRDLLEYVANCRLDMAQLYGRLINQADSARVKMMLEYFES
FT                   HQKTMAEKLRDYMDEAPHRILDTWYKDFTFEDFTKRCQDTMLPANMNEDDVLNLHLDLE
FT                   NRLIGLLEKTVNSTTAEDARNALANLIRVEKTQQQRLVHSTIRMDDI"
FT   gene            722726..724225
FT                   /locus_tag="Sputw3181_0656"
FT   CDS_pept        722726..724225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0656"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="TIGRFAM: carbohydrate kinase, YjeF related protein;
FT                   PFAM: protein of unknown function UPF0031; YjeF-family
FT                   N-terminal domain protein; KEGG: she:Shewmr4_0593
FT                   carbohydrate kinase, YjeF related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23507"
FT                   /protein_id="ABM23507.1"
FT                   /translation="MAQDLSRLPTALYTQQQVREAELLAVSQGAATLYELVERAGYAAF
FT                   QYLAKHIATEHGTASTPLLMLVGSGNNGADALVCARLALEAGNTVSVMLTKTTGSVEYE
FT                   RALTAYVNQGGLTQEIDINLISQAEIIVDGLLGTGVKGEVRDDTAKLINAINQSTAWVL
FT                   SLDLPSGINPDTGAVANVAVMADVTLCFGGVKQGLLTSKARHHSGLIEFAELGLTPFFT
FT                   QSSAQRVGREILKDYFAARARDSHKGQSGKVTVIGGDFGMAGAIRLASEACLRAGAGLV
FT                   TVISRPEHQLTVNVSRPELMFWGCDLVDMEVYLRLGWAQVIVLGPGLGKHDWGYNLFKA
FT                   AGLSDKPCVLDADALNLLSHEPRRQSNWVLTPHPGEAARLLGCSVAEIEQDRFAAVLAM
FT                   QQKYGGVVLLKGAGTVIYDGKTMVVAPVGNPGLASGGCGDVLSGIIGALMAQGMDNMQA
FT                   TIVAVVVHGCAADLAATQGERGMLASDLMPFIRQLVNSDLL"
FT   gene            724314..724772
FT                   /locus_tag="Sputw3181_0657"
FT   CDS_pept        724314..724772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0657"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   son:SO0599 conserved hypothetical protein TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23508"
FT                   /protein_id="ABM23508.1"
FT                   /translation="MTELTFFLNNEDDTIAVGQQLARYIKAPLTLYLTGDLGAGKTTLS
FT                   RGLIQGLGHQGAVKSPTYTLVEPYELNGVEIYHFDLYRLNDPEELEFMGIRDYFSDKSL
FT                   CIVEWPDKGEGLLPDADIHLHLSYVNSGREIHIQALSKSGEKLLAAIK"
FT   gene            724781..726211
FT                   /locus_tag="Sputw3181_0658"
FT   CDS_pept        724781..726211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0658"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="PFAM: Peptidoglycan-binding LysM; cell wall
FT                   hydrolase/autolysin; KEGG: she:Shewmr4_0595
FT                   N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23509"
FT                   /protein_id="ABM23509.1"
FT                   /translation="MTKINHYFHLITLFLCTFFTVSAHGANRLEGVRIWAAPESTRVVF
FT                   DLSEAPNYTYFSIEGPNRLVVDLKKTSTKLTLKNIDNNSKLVKGVRISQSPTKGDLRLV
FT                   IDLVKPLNANLFSLPVTAPYGNRLVVDLEDKTVTLAPPAASSTPVKKSVTQSMQSSRDI
FT                   VIAIDAGHGGDDPGSIGPSGLYEKKVVFEISRRLASKINDTPGMRAVMIRSGDYFVNLN
FT                   KRSELARNSKADLLISIHADAFTSPNPRGASVWVLSMRRANSEIGRWLEQKEKHSELLG
FT                   GAGEIIQNTDNEQYLAMTLLDMSMNSSMAIGHAVAGDILKDLGAVTTLHKSRPESASFA
FT                   VLKSPDIPSILVETGFISNPKEERLLSSHQHQESIATAIYKGVSRYFHSNPPADTLIAK
FT                   QNGARPSPISSSKSASTGISSRPSVRSSGTVKHKVSRGESLSAIAQRYQVPMSSIKRAN
FT                   GMKTDVVQLGQTLVIPES"
FT   sig_peptide     724781..724858
FT                   /locus_tag="Sputw3181_0658"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.964 at
FT                   residue 26"
FT   gene            726213..728138
FT                   /locus_tag="Sputw3181_0659"
FT   CDS_pept        726213..728138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0659"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   DNA mismatch repair protein, C-terminal domain protein;
FT                   KEGG: she:Shewmr4_0596 DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23510"
FT                   /protein_id="ABM23510.1"
FT                   /translation="MEKSMGIQILPPQLANQIAAGEVVERPASVVKELVENSLDAGATR
FT                   IDIEIDKGGSKLIKIRDNGSGIPKEELTLALSRHATSKLHSLDDLEAILSFGFRGEALA
FT                   SISSVSRLTLTSRTAEQTEAWQAYAEGVDMAVKIMPAAHPVGSTIEAVDLFFNTPARRR
FT                   FLKSDKTEFTHIDEWLKRIALVRGDIHFTLTHNGKLVRNYRPAVNEAQYLQRLTQVSGR
FT                   QFAEHALKIECQHDDLRLSGYLQSPWSTVLTDTHYFYVNGRLIRDRLVNHAVRQAFAHK
FT                   AEIEQPGYVLMLEIDPHQVDVNVHPAKHEVRFHQSRYVHDYILQALQSALEEAGELCLT
FT                   DNGNLTEPEAACMDTQCTKAIEPSGLFELASISDQTDKIERIRDASPVTASQERFTESS
FT                   QAQAVTSVRSGFGIQKNAFGSMAQPRDSHYRSFSGGEARQRAELPSKSAIVSYGALLQT
FT                   PSYNVKDKDYQPVAPMPPILDGQYWVVVEANHLRLLPIKSVALATRAQEIEAKLATGLI
FT                   GQPLLMPVSVVADPDWQSLLDENEQLIRQIGLELTIRYQQLIIKKVPPYLRESQLAKLI
FT                   PEWLQSLRFETPSPNALAKWLAKQSLSGFVSAPEIWAAFSLLTDETRQHIANQAISLPW
FT                   QSWLEE"
FT   gene            728154..729068
FT                   /locus_tag="Sputw3181_0660"
FT   CDS_pept        728154..729068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0660"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="KEGG: son:SO0602 tRNA
FT                   delta(2)-isopentenylpyrophosphate transferase; TIGRFAM:
FT                   tRNA delta(2)-isopentenylpyrophosphate transferase; PFAM:
FT                   tRNA isopentenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23511"
FT                   /db_xref="GOA:A1RFR6"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RFR6"
FT                   /protein_id="ABM23511.1"
FT                   /translation="MLPKVLFLMGPTASGKTALALELAENHNCEIISVDSALIYRGMDI
FT                   GSAKPSIEELARGPHRLIDIRDPSESYSAADFRADALAEIEQIIRMGKTPLLVGGTMMY
FT                   FKALLEGLSPLPSADDAIRADIQAEADAKGWETLHDQLRDIDPVSAERIHPNDPQRLSR
FT                   ALEVYRISGKSLTELTQTKSAPLPYDVVQFAIAPRERKVLHDLIAQRFRIMLQQGFIGE
FT                   VTQLKARGDLHLDLPSMRCVGYRQCWQHLDGEFDYDTMVEKAVAATRQLAKRQLTWLRS
FT                   WPELNWLESGAEGNLVTLMRHCR"
FT   sig_peptide     728154..728216
FT                   /locus_tag="Sputw3181_0660"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.853) with cleavage site probability 0.832 at
FT                   residue 21"
FT   gene            729159..729431
FT                   /locus_tag="Sputw3181_0661"
FT   CDS_pept        729159..729431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0661"
FT                   /product="RNA-binding protein Hfq"
FT                   /note="TIGRFAM: RNA chaperone Hfq; PFAM: Like-Sm
FT                   ribonucleoprotein, core; KEGG: shm:Shewmr7_3432 RNA
FT                   chaperone Hfq"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23512"
FT                   /db_xref="GOA:A1RFR7"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RFR7"
FT                   /protein_id="ABM23512.1"
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPARPFNVTGHQNAQGGYGPQDDVPSGE"
FT   gene            729455..730762
FT                   /locus_tag="Sputw3181_0662"
FT   CDS_pept        729455..730762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0662"
FT                   /product="GTP-binding protein, HSR1-related"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; KEGG:
FT                   son:SO0604 GTP-binding protein HflX"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23513"
FT                   /protein_id="ABM23513.1"
FT                   /translation="MFDRYEAGETAVLVHIDFSDEERREDLVELQLLVESAGARSVGVI
FT                   TGSRRSPDRKFFVGSGKAEELAALVAATEANVVIFNHALSPAQERNLEQVCQCRVLDRT
FT                   TLILDIFAQRARTHEGKLQVELAQLRHMSTRLVRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRGRIKNINKRLERVDKQREQSRRARKRSEMPTVSLVGYTNAGKSTLFNALTSSDV
FT                   YAADQLFATLDPTLRKLDLPDGAVILADTVGFIRHLPHDLVAAFKATLQETRQAELLLH
FT                   IVDCADENMADNFEQVQSVLKDIEADEVMQLIVCNKIDLLEDVTPRIEYDDQGKPIRVW
FT                   VSAQKRLGFDLLLKAITELIGEVIRELTLRIPATAGHYLGQFYRLDAIQQKEYDDLGNC
FT                   ILSVRLSDADWRRLAKQSQGELETFIFDASIEKAVC"
FT   gene            730799..731941
FT                   /locus_tag="Sputw3181_0663"
FT   CDS_pept        730799..731941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0663"
FT                   /product="HflK protein"
FT                   /note="TIGRFAM: HflK protein; PFAM: band 7 protein; KEGG:
FT                   she:Shewmr4_0600 HflK protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23514"
FT                   /protein_id="ABM23514.1"
FT                   /translation="MAWNEPGNKGNDPWGNKGGNDKGPPDLDEVFRNLSKRFGGKGTGS
FT                   GQSFSSLSLIIILAIALAVWGLSGFYTIKEAERGVALRFGKHIGEIGPGLHWKATFIDE
FT                   IYPVDIQSVRSIPASGSMLTSDENVVKVELDVQYRILDAYSYLFSAVDANASLREATDS
FT                   ALRYVIGHNKMDDILTTGRDAIRRDTWKELERILEPYKLGLSVVDVNFLPARPPEEVKD
FT                   AFDDAISAQEDEQRFIREAEAYAREIEPKARGEVERMAQQANAYKEREILEARGKVARF
FT                   ELLLPEYQASPEVTRKRLYLDTMQQVMTETNKVLIDAKNNGNLMYLPLDKLMKEKPATP
FT                   ELEPKPQQNVNSSSVSTTRISSEPLSGRPSRDDRTRQGRD"
FT   gene            731945..732838
FT                   /locus_tag="Sputw3181_0664"
FT   CDS_pept        731945..732838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0664"
FT                   /product="HflC protein"
FT                   /note="TIGRFAM: HflC protein; PFAM: band 7 protein; KEGG:
FT                   shm:Shewmr7_3429 HflC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23515"
FT                   /protein_id="ABM23515.1"
FT                   /translation="MGRLGIILIAIVLGVVLSSVMVVSEGERAIVARFGEIVKDNVDGK
FT                   PMTRVFGPGLHFKVPVIDKVKLLDARIQTLDGAADRFVTSEKKDLMVDSYVKWRIYDFE
FT                   KYYLSTNGGIKANAESLLQRKINNDLRTEFGRRTIREIVSGKRDELQNDALANASESAK
FT                   DLGIQVVDVRVKQINLPANVSNSIYQRMRAERQAVAKEHRAQGKEQSEIIRATIDANVT
FT                   VKIAEAERKALTIRGEGDALAAKIYADAYNKDPEFFGFMRSLEAYRASFSGNSDIMVLE
FT                   PDSEFFKYMKSTSPKK"
FT   sig_peptide     731945..732019
FT                   /locus_tag="Sputw3181_0664"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.892) with cleavage site probability 0.640 at
FT                   residue 25"
FT   gene            733202..733792
FT                   /locus_tag="Sputw3181_0665"
FT   CDS_pept        733202..733792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0665"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /EC_number="1.10.2.2"
FT                   /note="KEGG: shm:Shewmr7_3428 ubiquinol-cytochrome c
FT                   reductase, iron-sulfur subunit; TIGRFAM:
FT                   ubiquinol-cytochrome c reductase, iron-sulfur subunit;
FT                   PFAM: Rieske [2Fe-2S] domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23516"
FT                   /protein_id="ABM23516.1"
FT                   /translation="MSNAPVDTGRRRFLTAATAVVGGAGAVAVAVPFIKSWNPSAKAKA
FT                   AGAPVEVNISKVEPGQLIRVEWRGKPVWVVRRTDDVINALPKHDNKLRDPASVEMQQPD
FT                   YATNPLRSIKPEFFIAVGICTHLGCSPTYLPDSFGEQVEGVTSGFFCPCHGSKFDMAGR
FT                   VFQGVPAPLNLVVPPHQYVDDGTVIIGVDKGVA"
FT   sig_peptide     733202..733294
FT                   /locus_tag="Sputw3181_0665"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.977) with cleavage site probability 0.539 at
FT                   residue 31"
FT   gene            733792..735006
FT                   /locus_tag="Sputw3181_0666"
FT   CDS_pept        733792..735006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0666"
FT                   /product="Cytochrome b/b6, N-terminal domain"
FT                   /note="PFAM: Cytochrome b/b6, N-terminal domain; Cytochrome
FT                   b/b6, C-terminal domain; KEGG: son:SO0609
FT                   ubiquinol-cytochrome c reductase, cytochrome b"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23517"
FT                   /protein_id="ABM23517.1"
FT                   /translation="MVKNLINWIDARIPMTATYNRHVGQYATPTNFNFWYFFGSLAMLV
FT                   LVNQLLTGIWLTMNYVPTAEGAFASVEYIMRDVEYGWLLRYMHSTGASAFFVVIYLHMF
FT                   RGLIYGSYQKPRELLWLFGMLIFLVLMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPVI
FT                   GDDLTLWIRGDYVISGATLNRFFALHVIALPLVLVVLVFLHLIALHEVGSNNPDGIEIK
FT                   KNKDENGWPVDGIPFHPYYTVKDIMGVAGFLIVFCYVLFFMPEGGGYFLEKPNFEAANS
FT                   MKTPEHIAPVWYFTPFYAILRAVPDKLGGVVMMGLSIAVLFVLPWLDRCKVKSVRYRST
FT                   LHKLNIAQFAISFIVLGYLGVVPATPILTIVAQIFTVTYFGFFLALWLYSKNEKTKPVP
FT                   ARLTH"
FT   gene            735006..735704
FT                   /locus_tag="Sputw3181_0667"
FT   CDS_pept        735006..735704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0667"
FT                   /product="cytochrome c1"
FT                   /note="PFAM: cytochrome c1; KEGG: shm:Shewmr7_3426
FT                   cytochrome c1"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23518"
FT                   /protein_id="ABM23518.1"
FT                   /translation="MKKLLIALVTLLPTLAMAASGHNVHLEDAKVDLHDKASLERGVDL
FT                   FQHYCSGCHSTQYQRYERVANDIGISADDMRNKYMFTDAKIGELMQSAIPAKDAAKWFG
FT                   ATPPDLTLVARVRGEDWVYSYLKGFYKDPSRPFGVNNTVFPSVGMPHVLEELQGTPVKQ
FT                   EDGSIVVTGGKLNAEEYDQAVRDITGFLVYSAEPVRLEREAMGWWVLGFLFIFFIVAYL
FT                   LKKEYWKDVH"
FT   sig_peptide     735006..735062
FT                   /locus_tag="Sputw3181_0667"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.964 at
FT                   residue 19"
FT   gene            735801..736430
FT                   /locus_tag="Sputw3181_0668"
FT   CDS_pept        735801..736430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0668"
FT                   /product="Glutathione S-transferase, N-terminal domain"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   Glutathione S-transferase, C-terminal domain; KEGG:
FT                   shm:Shewmr7_3425 glutathione S-transferase, N-terminal
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23519"
FT                   /protein_id="ABM23519.1"
FT                   /translation="MAVAANKRSIMTLFSGADDLYSHQVRIVLAEKGVTVDVLQVDPNE
FT                   MPEDLLEVNPYNSVPTLVDRELVLYESRIIMEYLDERFPHPPLMPVYPVSRGQSRLMMH
FT                   RIDTDWYALVDRIRKGDRAEAARKELTESLVAIAPVFGEVPYFMSEEFGLADCYLGPLL
FT                   WRLPVLGIELDSRVAKDIKAYMTRIFERESFKASLTEAEREMRMGM"
FT   gene            736430..736867
FT                   /locus_tag="Sputw3181_0669"
FT   CDS_pept        736430..736867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0669"
FT                   /product="Stringent starvation protein B"
FT                   /note="PFAM: Stringent starvation protein B; KEGG:
FT                   shm:Shewmr7_3424 stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23520"
FT                   /protein_id="ABM23520.1"
FT                   /translation="MKSLTPNRPYLLRAYYDWLMDNQLTPHVVVDAFVKGTQVPQQYVK
FT                   DGQIVLNIAAGAVGNLQISNEFVEFNARFGGVPQQVLLPMASIIAIYARENGAGTVFDV
FT                   EDAYLMEDEAESVLSVVDVTDKPKDPTDQPPKRRSHLTVVK"
FT   gene            737091..737627
FT                   /locus_tag="Sputw3181_0670"
FT   CDS_pept        737091..737627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0670"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23521"
FT                   /protein_id="ABM23521.1"
FT                   /translation="MFFKMQEFYYKDIYFCYSDKNAISYVDALKSTSSKIDNMYYDVDC
FT                   LDDIVNQYDILPTLGLPLVSQRFFDLFKDKLGKEINLIPAVIMDSEGRVNSHFYALQVL
FT                   TCYECVDFVRSHISYKNYGNRLWMTIKNLIIDMNKVGSASIFSLKEKHGYIIVNNTVKE
FT                   QCEKLKGFEFKYISE"
FT   gene            737791..739425
FT                   /locus_tag="Sputw3181_0671"
FT   CDS_pept        737791..739425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0671"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; response regulator receiver; KEGG: cps:CPS_0756
FT                   sensory box sensor histidine kinase/DNA-binding response
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23522"
FT                   /protein_id="ABM23522.1"
FT                   /translation="MGMATIPSLHVSIGEALLSSFSWVLSLTIILVLSFYLAKLTRTYK
FT                   AKVKSFQVELTQANKTIQSLTQQRECEQRTFGQLFTEITKNVTWLAPYIANTQTHTDEM
FT                   NALLLRINQLLESTRQWNESSRQMLSSPFLLQPWLKNQLSFEKAKSQQPLPIHISEIPD
FT                   LLVQTHLELLEKVFSKFCQDIRQSTGIAGYVLEIESKQGLRLTLTGKVEATREEYADDS
FT                   YLLLKKQVEENGGELCCLHSSQSIAQYTLCLPATVYELPQFTPDFRYLQHHVADESKAK
FT                   VLIVESDPEFMDWLYYHLAADFRLTLCQTWQGAQYELDEQGAELILCDTQLSDGDAASW
FT                   LSTLKHQPEYTAIPFVMLTAVDDPQQRLQAWQCYADDYVSKNSDPGLLVVRLNALIENR
FT                   RLVQQQMLSLSLAINSVQASTSTPVLSTVETLDEQFAKRLRLVIDQHITTQELTVEFVA
FT                   QQFHTSSRSLQRRVQSVFGLSYSQYLKQTQLQIAKDALVAGHTVKEAAYYAGFTSQNYF
FT                   GRVFRAEYGVTPSQFKKDASTKPPSLA"
FT   gene            complement(739403..740881)
FT                   /locus_tag="Sputw3181_0672"
FT   CDS_pept        complement(739403..740881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0672"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: cvi:CV0964 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23523"
FT                   /protein_id="ABM23523.1"
FT                   /translation="MFADFTVFSWVLFVISALCLILAGATLKIRYQAVTIWFIGLLLAY
FT                   AIQAFGYAFELTSHELDSIKFWLNIEFVGACFIPTCVVLFAVSYQTRTSPPLWLVSSLL
FT                   SISAIVLLGQLTNDLHGLGFNIIGLEKVDNITVTTNHLGWLYLAYSLYIHLAVIVSVII
FT                   FIRCMQNTHPVLRPQILLILVGITLTWLNYIWTLFGNTPYGLDIGTFGFIFCTIAFAIS
FT                   VFRYDLIKLTPIARDQIFHQVEQGYIVIDEQSRLIDYNPKAKAFLPALSTGKIGQPLSG
FT                   FIDPSLVADNQTKVIRLDDGKRVQVQRSLMGKNAAMAIGSVIMLSDVTEKEQLLEEMER
FT                   IANTDSLTGCYNRHALHCRLKQQIIESRHQLTPLSIVALDIVGFRKVNEVHGYTVGDMR
FT                   LKQLSHILSHHLPSDAILIRYIGDIFIIILPSYRLEDANQLALQLADKAKQLASLAIST
FT                   FCVQHHSEESDRQVIDRLLGEAMQLKKIRPSLAV"
FT   gene            741264..742541
FT                   /locus_tag="Sputw3181_0673"
FT   CDS_pept        741264..742541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0673"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1163 PKD"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23524"
FT                   /protein_id="ABM23524.1"
FT                   /translation="MIRAKKSITQVFSIALFAMLSGILSGCGGDDAGANPSPEQPDNGG
FT                   GVTRVTISSVASEGGSILPAQLELNKGGSASFVISANPGYSIDQITGCDGERQGDSYQV
FT                   KNVQQSCQITPTFTRNRYQIDTKITGNGQIIPTQLQLEYGQQGQFTLTPQTGFVIANVT
FT                   GCEGNLSGNTYTSSPVTSACTVNASFTPVAYTVTASASEGGIISPESQLVNHGQSASFT
FT                   LTPNAGYRVDTVSGCDGTLKENTYVIQSGSADCSIKAHFALAANFTNVQIGTQALSPEQ
FT                   QQQPLFLVNDAYAKSLDKNLAEASIATLPEQNQLLTLIDQTGEPLMLGLKLANEPTTEV
FT                   TVESSAVVFVLSSNHFYGADFTDRAELNRRIRAHQTFPQLVSELSEQLQNGNPCPMDRS
FT                   CSAVAAIISERIASSLNVDGLLVAGE"
FT   sig_peptide     741264..741344
FT                   /locus_tag="Sputw3181_0673"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.417 at
FT                   residue 27"
FT   gene            742544..745915
FT                   /locus_tag="Sputw3181_0674"
FT   CDS_pept        742544..745915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0674"
FT                   /product="protein of unknown function DUF1566"
FT                   /note="PFAM: PKD domain containing protein; protein of
FT                   unknown function DUF1566; KEGG: pat:Patl_3292 protein of
FT                   unknown function DUF1566"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23525"
FT                   /protein_id="ABM23525.1"
FT                   /translation="MKGFKLKVAASMCMFAITMAMGSAQAQTQYRLNDNINFTLDDSGK
FT                   LTVNSGYLTYYLLRGYDPKTEYQTGRHLVSASSQRIDFDVADLELDGFFPKVELKLPQR
FT                   KYESTELELPKVLPTANGWQNAELTLKGVSLVGLVNEYYDNESMEGEDFADMVSLLALN
FT                   TLVVVDIAANTVTGGPISTAKKRNQFQQSLDRFARFADYVRNAREQKFWNKYAHFIDYV
FT                   KLSRDILSNFVDDANINAADYPWLEYTLHDSEIIFTGLEKLQVITGEVDEDSPIKGTLK
FT                   QQYQRLLKADIDAGKVSGDSYDELIKFGAKKFTESLKGADPKTAEIIIAKYIMEPLGQA
FT                   LAAYQKGLRQQLMIAQAKGQKEIITSLEAQIKDLNQARVVILLSSLVLNSSDIYQDLKA
FT                   DPQKMISTIFELGVEASAEMAEQVFDGADGATILAKYALQRMTGSDGRAHIYHVTGKLS
FT                   QGVSIGNSIANKLLPFLWDLAWAPGKMSVALVDGKLNPLGAMQSHVDIYRVANNGAREL
FT                   VKQLSNTNVIKDTVIALEHLDQLDIEVALSRPNMFDTTRSPWLMSGNVPPQSLYEAKII
FT                   DTNQRGYASRFLCTRTLLNDLKYVDYQIANTSMADAYDTRCGAGDWYANTWFNGTKSGA
FT                   TIYEDNDKLANSLKLKPELSDAQALISYQHIYREGDKPVLVLIDGHSTNAITHKISFVP
FT                   AVSNVGFGTVQMPVDNGGYVIGFDISQIVQSNLDPIVTYRWDFGDGSAVLETSSTLVEH
FT                   IYAEGSFTVTLTVVTQAGIETTVSQTVAVGERLRTPMLEQPRYQIETDGSASITLNWRN
FT                   IEQGSTVNLYLAEESFTDLNDIANYASLKGARRTSVKGAVEYRFTGLTADTAYFMVATT
FT                   QGAHKESPLSNQVQLVTRRVAQPTGKLNDTGIDWCADGSNNYLDCPVQGYEGQDAEYGR
FT                   DALARNGQLQKVGGGAAGFDFTKLDNSGNPLPESASEWSCVRDNHTGLIWEVKQPAGSG
FT                   GLRDANYTYSWYNPDNSTNGGNAGTQNGGTCQGSDCDTAAFVNAVNSQGLCGASDWRLP
FT                   TVKELMGIVHNGRANPAIDLDYFPNFPITTPFDSYWTSVRNAPNAGNSWMVMFSYGGVE
FT                   MYRSGNNFVRLVRNEQ"
FT   sig_peptide     742544..742624
FT                   /locus_tag="Sputw3181_0674"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            746049..746579
FT                   /locus_tag="Sputw3181_0675"
FT   CDS_pept        746049..746579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0675"
FT                   /product="protein of unknown function DUF1566"
FT                   /note="PFAM: protein of unknown function DUF1566; KEGG:
FT                   pat:Patl_3291 protein of unknown function DUF1566"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23526"
FT                   /protein_id="ABM23526.1"
FT                   /translation="MLNFNKLLLWIFLLIVEMQVYASELCSGIENSAIQATTPSSEFTD
FT                   NGDGTVTHLTTGLIWQRCSLGQTWDGSYCIDNATTYNWPASALQAKDNLFAGYSDWRLP
FT                   NKNELASIIEYRCHHPAINSQIFPNTSPSGYWSSSHSSNYGNHTSWIVEFNSGSVYLDV
FT                   RFHYYHVRLVRGG"
FT   sig_peptide     746049..746117
FT                   /locus_tag="Sputw3181_0675"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.837) with cleavage site probability 0.835 at
FT                   residue 23"
FT   gene            746899..747636
FT                   /locus_tag="Sputw3181_0676"
FT   CDS_pept        746899..747636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputw3181_0676"
FT                   /product="protein of unknown function DUF1566"
FT                   /note="PFAM: protein of unknown function DUF1566; KEGG:
FT                   pat:Patl_3291 protein of unknown function DUF1566"
FT                   /db_xref="EnsemblGenomes-Gn:Sputw3181_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABM23527"
FT                   /protein_id="ABM23527.1"
FT                   /translation="MSSQRTLTVLFFLSLCGFLCLSKLAQASDYVSCLAEKLQGITHDA
FT                   AVKAITEACQAQYASNTASKAASAPAKALIDGRYRDNGNGTITDTKTNLIWMRCSLGQQ
FT                   WTGSTCAGVAMEMNWNDALKTAISFSYAGHSDWRVPTVDELDTLVQCSAGRAPSARPNG
FT                   KFVADTDGSCHGNEFSNPKININAFPNTPIVGFFWSSSPNTDHSGYAWGVYFDSGYVGF
FT                   NNGGAYGSNRGEGRHVRLVRAGQ"
FT   sig_peptide     746899..746982
FT                   /locus_tag="Sputw318